BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17273_g1_i1 len=1451 path=[89:0-1189 1537:1190-1190 40:1191-1450]

Length=1451
                                                                      Score     E

ref|XP_009792812.1|  PREDICTED: uncharacterized protein LOC104239795    266   4e-80   
ref|XP_009625035.1|  PREDICTED: uncharacterized protein LOC104115988    264   4e-79   
ref|XP_009795461.1|  PREDICTED: uncharacterized protein LOC104242159    258   5e-77   
ref|XP_006358324.1|  PREDICTED: uncharacterized protein LOC102592049    256   6e-77   
ref|XP_004242771.1|  PREDICTED: formin-J                                255   4e-76   
ref|XP_006345991.1|  PREDICTED: uncharacterized protein LOC102591105    254   5e-76   
ref|XP_009591729.1|  PREDICTED: uncharacterized protein LOC104088710    253   7e-75   
emb|CDP04279.1|  unnamed protein product                                245   9e-73   
ref|XP_004239688.1|  PREDICTED: putative uncharacterized protein ...    247   1e-72   
ref|XP_011069440.1|  PREDICTED: uncharacterized protein LOC105155266    223   2e-63   
gb|EYU39518.1|  hypothetical protein MIMGU_mgv1a007478mg                222   4e-63   
gb|EYU39778.1|  hypothetical protein MIMGU_mgv1a009123mg                212   5e-60   
ref|XP_004494967.1|  PREDICTED: uncharacterized protein LOC101508328    205   3e-57   
gb|KCW57324.1|  hypothetical protein EUGRSUZ_H00123                     195   1e-52   
ref|XP_010025827.1|  PREDICTED: uncharacterized protein LOC104416087    195   2e-52   
ref|XP_002521996.1|  conserved hypothetical protein                     189   3e-51   Ricinus communis
ref|XP_004495587.1|  PREDICTED: uncharacterized protein LOC101488962    188   6e-51   
ref|XP_007205372.1|  hypothetical protein PRUPE_ppa007276mg             188   8e-51   
emb|CDP04278.1|  unnamed protein product                                188   9e-51   
ref|XP_003535375.1|  PREDICTED: uncharacterized protein LOC100795448    184   2e-49   
gb|KDP23730.1|  hypothetical protein JCGZ_23563                         184   2e-49   
ref|XP_008441789.1|  PREDICTED: uncharacterized protein LOC103485843    181   2e-48   
ref|XP_009379739.1|  PREDICTED: uncharacterized protein LOC103968123    182   3e-48   
ref|XP_008366882.1|  PREDICTED: uncharacterized protein LOC103430513    182   3e-48   
ref|XP_009343786.1|  PREDICTED: uncharacterized protein LOC103935702    182   3e-48   
ref|XP_008370760.1|  PREDICTED: uncharacterized protein LOC103434221    182   4e-48   
gb|KHN31488.1|  hypothetical protein glysoja_035595                     177   4e-48   
ref|XP_006356117.1|  PREDICTED: uncharacterized protein LOC102592369    183   4e-48   
ref|XP_011077059.1|  PREDICTED: uncharacterized protein LOC105161156    181   4e-48   
gb|EYU43768.1|  hypothetical protein MIMGU_mgv1a006114mg                182   5e-48   
ref|XP_004152866.1|  PREDICTED: uncharacterized protein LOC101218582    179   9e-48   
ref|XP_004155136.1|  PREDICTED: uncharacterized protein LOC101227028    179   1e-47   
ref|XP_008218351.1|  PREDICTED: uncharacterized protein LOC103318712    181   1e-47   
gb|KDO41882.1|  hypothetical protein CISIN_1g041258mg                   182   3e-47   
ref|XP_006489752.1|  PREDICTED: uncharacterized protein DDB_G0271...    182   3e-47   
ref|XP_008388740.1|  PREDICTED: uncharacterized protein LOC103451084    179   3e-47   
ref|XP_004173200.1|  PREDICTED: uncharacterized LOC101215059            182   3e-47   
ref|XP_004147189.1|  PREDICTED: uncharacterized protein LOC101215059    182   5e-47   
ref|XP_008460692.1|  PREDICTED: uncharacterized protein LOC103499460    182   5e-47   
gb|KEH24577.1|  calcium-dependent lipid-binding (CaLB domain) fam...    178   5e-47   
ref|XP_007226487.1|  hypothetical protein PRUPE_ppa026634mg             180   7e-47   
ref|XP_008224037.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    180   8e-47   
ref|XP_002314508.1|  C2 domain-containing family protein                179   8e-47   Populus trichocarpa [western balsam poplar]
ref|XP_006577748.1|  PREDICTED: uncharacterized protein LOC102667983    177   1e-46   
ref|XP_004304780.1|  PREDICTED: uncharacterized protein LOC101296310    179   1e-46   
ref|XP_011077131.1|  PREDICTED: uncharacterized protein LOC105161211    176   2e-46   
ref|XP_003590980.1|  hypothetical protein MTR_1g080360                  176   2e-46   
ref|XP_006420366.1|  hypothetical protein CICLE_v10006849mg             179   3e-46   
ref|XP_004234051.1|  PREDICTED: uncharacterized protein LOC101265801    178   3e-46   
ref|XP_011041447.1|  PREDICTED: uncharacterized protein LOC105137420    177   4e-46   
ref|XP_010105208.1|  hypothetical protein L484_011265                   179   4e-46   
emb|CAN83108.1|  hypothetical protein VITISV_026570                     177   6e-46   Vitis vinifera
ref|XP_002282144.1|  PREDICTED: uncharacterized protein LOC100256206    177   6e-46   Vitis vinifera
ref|XP_011073723.1|  PREDICTED: uncharacterized protein LOC105158612    177   6e-46   
ref|XP_002319115.2|  hypothetical protein POPTR_0013s04590g             174   1e-45   Populus trichocarpa [western balsam poplar]
ref|XP_004297932.1|  PREDICTED: uncharacterized protein LOC101311957    177   1e-45   
ref|XP_009804994.1|  PREDICTED: uncharacterized protein DDB_G0292...    176   2e-45   
ref|XP_002311697.2|  C2 domain-containing family protein                176   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_009604695.1|  PREDICTED: uncharacterized protein LOC104099416    176   4e-45   
ref|XP_009795412.1|  PREDICTED: uncharacterized protein LOC104242110    176   6e-45   
ref|XP_009357966.1|  PREDICTED: uncharacterized protein LOC103948651    175   6e-45   
ref|XP_002528347.1|  hypothetical protein RCOM_1217340                  174   9e-45   Ricinus communis
ref|XP_011029742.1|  PREDICTED: uncharacterized protein LOC105129399    174   1e-44   
ref|XP_010667096.1|  PREDICTED: uncharacterized protein LOC104884184    173   2e-44   
ref|XP_008340669.1|  PREDICTED: uncharacterized protein LOC103403599    174   2e-44   
emb|CDO99320.1|  unnamed protein product                                173   3e-44   
emb|CBI23723.3|  unnamed protein product                                172   4e-44   
ref|XP_003590735.1|  RNA-binding protein 12B                            174   4e-44   
ref|XP_004247791.2|  PREDICTED: uncharacterized protein LOC101245204    173   4e-44   
ref|XP_004495257.1|  PREDICTED: proteoglycan 4-like                     174   5e-44   
ref|XP_006342681.1|  PREDICTED: uncharacterized protein LOC102596842    172   5e-44   
ref|XP_007132355.1|  hypothetical protein PHAVU_011G087700g             169   7e-44   
ref|XP_007132356.1|  hypothetical protein PHAVU_011G087800g             169   7e-44   
ref|XP_011036375.1|  PREDICTED: uncharacterized protein LOC105133911    169   1e-43   
ref|XP_004253020.1|  PREDICTED: uncharacterized protein LOC101244358    172   1e-43   
ref|XP_002325345.1|  hypothetical protein POPTR_0019s03780g             168   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_011038591.1|  PREDICTED: uncharacterized protein LOC105135426    168   2e-43   
gb|KCW57325.1|  hypothetical protein EUGRSUZ_H00124                     161   2e-43   
ref|XP_009621969.1|  PREDICTED: uncharacterized protein LOC104113496    171   3e-43   
ref|XP_007035276.1|  Calcium-dependent lipid-binding family prote...    170   3e-43   
gb|EPS62035.1|  hypothetical protein M569_12761                         160   5e-43   
ref|XP_011091348.1|  PREDICTED: uncharacterized protein LOC105171810    169   1e-42   
gb|KDO53064.1|  hypothetical protein CISIN_1g035970mg                   166   2e-42   
ref|XP_006437469.1|  hypothetical protein CICLE_v10033675mg             166   2e-42   
ref|XP_009767920.1|  PREDICTED: uncharacterized protein LOC104218993    167   3e-42   
ref|XP_007147205.1|  hypothetical protein PHAVU_006G104400g             164   3e-42   
ref|XP_006303752.1|  hypothetical protein CARUB_v10011922mg             168   3e-42   
gb|KFK31057.1|  hypothetical protein AALP_AA6G062700                    164   4e-42   
ref|XP_003555498.1|  PREDICTED: uncharacterized protein LOC100812185    168   7e-42   
ref|XP_010043310.1|  PREDICTED: uncharacterized protein LOC104432551    163   9e-42   
gb|KCW85316.1|  hypothetical protein EUGRSUZ_B02156                     163   9e-42   
ref|XP_010522448.1|  PREDICTED: uncharacterized protein LOC104801063    167   1e-41   
ref|XP_009590587.1|  PREDICTED: ankyrin repeat-containing protein...    166   1e-41   
ref|XP_003535258.1|  PREDICTED: uncharacterized protein LOC100787698    167   1e-41   
ref|XP_010556931.1|  PREDICTED: uncharacterized protein LOC104826097    167   1e-41   
ref|XP_010025828.1|  PREDICTED: uncharacterized protein LOC104416088    156   1e-41   
emb|CDY23753.1|  BnaC04g43690D                                          166   3e-41   
gb|KCW60206.1|  hypothetical protein EUGRSUZ_H02915                     164   3e-41   
ref|XP_010026783.1|  PREDICTED: protein bunched, class 2/F/G isof...    164   4e-41   
ref|XP_006293875.1|  hypothetical protein CARUB_v10022860mg             165   4e-41   
ref|XP_009141305.1|  PREDICTED: uncharacterized protein LOC103865261    165   4e-41   
emb|CDY37732.1|  BnaA04g19360D                                          165   5e-41   
ref|NP_180890.1|  calcium-dependent lipid-binding domain-containi...    165   5e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881275.1|  C2 domain-containing protein                       164   7e-41   
ref|XP_006410470.1|  hypothetical protein EUTSA_v10016412mg             164   9e-41   
ref|XP_010264865.1|  PREDICTED: uncharacterized protein LOC104602763    161   1e-40   
ref|XP_010483923.1|  PREDICTED: uncharacterized protein LOC104762347    164   2e-40   
ref|XP_010469493.1|  PREDICTED: uncharacterized protein LOC104749540    163   2e-40   
ref|XP_010413889.1|  PREDICTED: uncharacterized protein LOC104700118    163   2e-40   
ref|XP_010475114.1|  PREDICTED: uncharacterized protein LOC104754591    163   2e-40   
ref|XP_010509905.1|  PREDICTED: serine/arginine repetitive matrix...    163   2e-40   
ref|NP_171948.1|  calcium-dependent lipid-binding domain-containi...    163   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457504.1|  PREDICTED: uncharacterized protein LOC104738975    163   2e-40   
gb|AAB80639.1|  Contains similarity to Glycine SRC2 (gb|AB000130)       162   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010102203.1|  hypothetical protein L484_024484                   159   3e-40   
ref|XP_002889512.1|  hypothetical protein ARALYDRAFT_470434             162   3e-40   
ref|XP_007144140.1|  hypothetical protein PHAVU_007G132000g             164   3e-40   
ref|XP_009143873.1|  PREDICTED: uncharacterized protein LOC103867544    162   4e-40   
ref|XP_003556915.1|  PREDICTED: uncharacterized protein LOC100779058    160   5e-40   
ref|XP_006418119.1|  hypothetical protein EUTSA_v10007144mg             162   5e-40   
gb|KFK42792.1|  hypothetical protein AALP_AA1G039700                    161   7e-40   
ref|XP_009119477.1|  PREDICTED: uncharacterized protein LOC103844449    160   1e-39   
emb|CDY53195.1|  BnaAnng12200D                                          160   2e-39   
ref|XP_009118638.1|  PREDICTED: uncharacterized protein LOC103843645    160   2e-39   
emb|CDY59181.1|  BnaC08g50140D                                          160   3e-39   
emb|CDY18242.1|  BnaC05g02650D                                          156   6e-39   
gb|KDP33324.1|  hypothetical protein JCGZ_12873                         157   8e-39   
ref|XP_007145354.1|  hypothetical protein PHAVU_007G232100g             155   2e-38   
ref|XP_007030351.1|  Calcium-dependent lipid-binding (CaLB domain...    153   6e-38   
ref|XP_004497792.1|  PREDICTED: uncharacterized protein LOC101505544    154   9e-38   
ref|XP_003590193.1|  hypothetical protein MTR_1g045780                  153   2e-37   
ref|XP_010674263.1|  PREDICTED: uncharacterized protein LOC104890461    149   2e-36   
emb|CDX74193.1|  BnaA03g28540D                                          147   5e-36   
gb|EYU32591.1|  hypothetical protein MIMGU_mgv1a006056mg                145   9e-35   
ref|XP_009134757.1|  PREDICTED: uncharacterized protein LOC103859027    142   4e-34   
emb|CDX92066.1|  BnaC03g33680D                                          142   5e-34   
ref|XP_010485810.1|  PREDICTED: putative lysozyme-like protein          140   2e-33   
gb|AFK13837.1|  C2 domain-containing protein SRC2                       138   5e-33   
ref|XP_006297897.1|  hypothetical protein CARUB_v10013938mg             139   5e-33   
emb|CDX89815.1|  BnaA10g02670D                                          140   6e-33   
gb|KFK37859.1|  hypothetical protein AALP_AA3G038400                    137   1e-32   
ref|XP_010463915.1|  PREDICTED: uncharacterized protein LOC104744544    137   2e-32   
emb|CDY42921.1|  BnaC05g47300D                                          137   2e-32   
emb|CDY49343.1|  BnaA05g33050D                                          136   3e-32   
ref|XP_009123999.1|  PREDICTED: uncharacterized protein LOC103848923    136   3e-32   
ref|XP_002884443.1|  hypothetical protein ARALYDRAFT_477695             136   4e-32   
gb|AAF26778.1|AC016829_2  hypothetical protein                          135   4e-32   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28543.1|  unknown                                                 135   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566225.4|  calcium-dependent lipid-binding family protein        136   6e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67146.1|  unknown                                                 135   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842598.1|  hypothetical protein AMTR_s00077p00167680          135   7e-32   
ref|XP_006408192.1|  hypothetical protein EUTSA_v10020890mg             135   7e-32   
ref|XP_011093241.1|  PREDICTED: uncharacterized protein LOC105173247    130   7e-31   
ref|XP_010558947.1|  PREDICTED: uncharacterized protein LOC104827473    132   9e-31   
gb|KFK39933.1|  hypothetical protein AALP_AA3G308600                    130   4e-30   
ref|XP_010549648.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    130   5e-30   
ref|XP_002885870.1|  hypothetical protein ARALYDRAFT_480303             129   1e-29   
ref|XP_010518533.1|  PREDICTED: uncharacterized protein LOC104793798    129   1e-29   
ref|XP_010467176.1|  PREDICTED: uncharacterized protein LOC104747266    129   1e-29   
ref|XP_010488836.1|  PREDICTED: uncharacterized protein LOC104766620    128   2e-29   
ref|XP_009625033.1|  PREDICTED: uncharacterized protein LOC104115986    128   2e-29   
ref|NP_178968.1|  C2 domain-containing protein                          128   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010533203.1|  PREDICTED: uncharacterized protein LOC104809...    128   3e-29   
ref|XP_006300066.1|  hypothetical protein CARUB_v10016294mg             127   7e-29   
ref|XP_003553776.1|  PREDICTED: uncharacterized protein LOC100793541    124   1e-28   
ref|XP_010557577.1|  PREDICTED: uncharacterized protein LOC104826528    127   1e-28   
ref|XP_006409691.1|  hypothetical protein EUTSA_v10022712mg             126   1e-28   
emb|CDX81442.1|  BnaC09g08530D                                          126   1e-28   
emb|CDY37207.1|  BnaA09g08280D                                          126   2e-28   
emb|CDY37206.1|  BnaA09g08270D                                          126   2e-28   
ref|XP_009112245.1|  PREDICTED: uncharacterized protein LOC103837642    126   2e-28   
ref|XP_008801291.1|  PREDICTED: uncharacterized protein LOC103715451    125   2e-28   
ref|XP_010262513.1|  PREDICTED: uncharacterized protein LOC104601031    124   2e-28   
ref|XP_009764572.1|  PREDICTED: uncharacterized protein LOC104216252    122   5e-28   
gb|EYU38921.1|  hypothetical protein MIMGU_mgv1a022778mg                121   6e-28   
emb|CDX89605.1|  BnaC03g45190D                                          124   6e-28   
ref|XP_009136211.1|  PREDICTED: uncharacterized protein LOC103860372    124   6e-28   
ref|XP_010544424.1|  PREDICTED: uncharacterized protein LOC104817045    120   1e-27   
gb|EPS68074.1|  hypothetical protein M569_06693                         119   2e-27   
ref|XP_010055064.1|  PREDICTED: uncharacterized protein LOC104443389    120   3e-27   
ref|XP_009591358.1|  PREDICTED: uncharacterized protein LOC104088405    119   3e-27   
ref|XP_009406969.1|  PREDICTED: uncharacterized protein LOC103989745    119   5e-27   
ref|XP_004133823.1|  PREDICTED: uncharacterized protein LOC101212280    119   6e-27   
ref|XP_009385178.1|  PREDICTED: uncharacterized protein LOC103972545    119   7e-27   
ref|XP_007051663.1|  Calcium-dependent lipid-binding family prote...    118   9e-27   
ref|XP_006577334.1|  PREDICTED: BON1-associated protein 2-like          115   2e-26   
ref|XP_006339653.1|  PREDICTED: uncharacterized protein LOC102592387    117   2e-26   
ref|XP_006842901.1|  hypothetical protein AMTR_s00075p00073210          119   2e-26   
gb|EPS60622.1|  hypothetical protein M569_14180                         117   3e-26   
ref|XP_004229965.1|  PREDICTED: BON1-associated protein 2               117   3e-26   
ref|XP_010920373.1|  PREDICTED: CASP-like protein 4A1                   119   4e-26   
gb|KDO86360.1|  hypothetical protein CISIN_1g047341mg                   116   4e-26   
ref|XP_006444911.1|  hypothetical protein CICLE_v10021815mg             116   4e-26   
ref|XP_010092894.1|  hypothetical protein L484_022489                   116   5e-26   
ref|XP_007147256.1|  hypothetical protein PHAVU_006G109100g             115   8e-26   
ref|XP_008437926.1|  PREDICTED: uncharacterized protein LOC103483209    115   1e-25   
ref|XP_009401202.1|  PREDICTED: uncharacterized protein LOC103985274    115   1e-25   
ref|XP_010456220.1|  PREDICTED: BON1-associated protein 2-like          114   1e-25   
emb|CDP08734.1|  unnamed protein product                                115   2e-25   
ref|XP_010422779.1|  PREDICTED: BON1-associated protein 2-like          113   4e-25   
ref|XP_009111426.1|  PREDICTED: uncharacterized protein LOC103836878    113   5e-25   
emb|CDP17419.1|  unnamed protein product                                114   6e-25   
ref|XP_006396291.1|  hypothetical protein EUTSA_v10028892mg             112   7e-25   
ref|XP_010936043.1|  PREDICTED: uncharacterized protein LOC105055767    113   8e-25   
ref|XP_002276427.1|  PREDICTED: uncharacterized protein LOC100258448    112   9e-25   Vitis vinifera
ref|XP_009377282.1|  PREDICTED: BON1-associated protein 2               111   1e-24   
ref|XP_004494776.1|  PREDICTED: uncharacterized protein LOC101496947    112   1e-24   
ref|XP_002301388.2|  hypothetical protein POPTR_0002s16800g             111   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_008362824.1|  PREDICTED: uncharacterized protein LOC103426513    112   2e-24   
ref|XP_002511946.1|  conserved hypothetical protein                     111   2e-24   Ricinus communis
gb|AES82742.2|  calcium-dependent lipid-binding (CaLB domain) fam...    111   2e-24   
ref|XP_010427687.1|  PREDICTED: BON1-associated protein 2-like          111   3e-24   
ref|XP_003626524.1|  hypothetical protein MTR_7g116840                  111   4e-24   
gb|KDP28538.1|  hypothetical protein JCGZ_14309                         110   5e-24   
ref|XP_010251574.1|  PREDICTED: uncharacterized protein LOC104593437    110   5e-24   
ref|XP_009420756.1|  PREDICTED: uncharacterized protein LOC104000435    110   5e-24   
ref|XP_007218843.1|  hypothetical protein PRUPE_ppa010336mg             110   6e-24   
ref|XP_010669605.1|  PREDICTED: uncharacterized protein LOC104886787    110   7e-24   
ref|XP_011023248.1|  PREDICTED: uncharacterized protein LOC105124808    110   9e-24   
ref|XP_008233233.1|  PREDICTED: uncharacterized protein LOC103332288    110   9e-24   
ref|XP_011093070.1|  PREDICTED: uncharacterized protein LOC105173112    108   2e-23   
ref|XP_002872904.1|  C2 domain-containing protein                       108   2e-23   
ref|XP_006289671.1|  hypothetical protein CARUB_v10003230mg             108   2e-23   
ref|NP_192029.1|  calcium-dependent lipid-binding domain-containi...    108   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008796382.1|  PREDICTED: uncharacterized protein LOC103711856    108   4e-23   
emb|CDY07180.1|  BnaCnng01950D                                          111   2e-22   
emb|CDY48509.1|  BnaA09g00140D                                          111   2e-22   
ref|XP_009350266.1|  PREDICTED: uncharacterized protein LOC103941795    105   3e-22   
ref|XP_009347863.1|  PREDICTED: uncharacterized protein LOC103939495    105   6e-22   
gb|KDP30266.1|  hypothetical protein JCGZ_17048                         100   5e-21   
emb|CAN79006.1|  hypothetical protein VITISV_040896                     103   8e-21   Vitis vinifera
ref|XP_004308328.1|  PREDICTED: uncharacterized protein LOC101301728    100   3e-20   
ref|XP_008798687.1|  PREDICTED: uncharacterized protein LOC103713510  97.4    2e-19   
ref|XP_007031704.1|  Calcium-dependent lipid-binding (CaLB domain...  96.3    1e-18   
ref|XP_006605265.1|  PREDICTED: uncharacterized protein LOC102668124  91.7    5e-18   
ref|XP_008791481.1|  PREDICTED: uncharacterized protein LOC103708363  92.4    1e-17   
gb|ABK22654.1|  unknown                                               91.3    2e-17   Picea sitchensis
ref|XP_010914657.1|  PREDICTED: uncharacterized protein LOC105039993  90.9    4e-17   
ref|XP_009400560.1|  PREDICTED: uncharacterized protein LOC103984726  90.1    7e-17   
ref|XP_008679175.1|  PREDICTED: uncharacterized protein LOC103654122  90.1    9e-17   
ref|XP_010914471.1|  PREDICTED: uncharacterized protein LOC105039856  89.0    2e-16   
gb|ABK23345.1|  unknown                                               87.4    3e-16   Picea sitchensis
ref|XP_010245272.1|  PREDICTED: uncharacterized protein LOC104588843  87.4    3e-16   
gb|EAY87999.1|  hypothetical protein OsI_09421                        88.2    5e-16   Oryza sativa Indica Group [Indian rice]
gb|AEW08214.1|  hypothetical protein 2_3193_01                        85.1    7e-16   
gb|AFG52320.1|  hypothetical protein 2_3193_01                        84.0    2e-15   
gb|AFG52315.1|  hypothetical protein 2_3193_01                        83.2    3e-15   
ref|XP_003572941.1|  PREDICTED: uncharacterized protein LOC100843074  85.5    3e-15   
ref|XP_002989504.1|  hypothetical protein SELMODRAFT_428112           82.0    1e-14   
ref|XP_002964639.1|  hypothetical protein SELMODRAFT_406042           81.6    2e-14   
ref|XP_001782642.1|  predicted protein                                80.5    1e-13   
ref|XP_002968005.1|  hypothetical protein SELMODRAFT_440190           79.7    2e-13   
ref|XP_002976843.1|  hypothetical protein SELMODRAFT_443351           79.7    4e-13   
ref|XP_001761054.1|  predicted protein                                78.2    5e-13   
ref|XP_002453028.1|  hypothetical protein SORBIDRAFT_04g037000        78.6    6e-13   Sorghum bicolor [broomcorn]
ref|XP_008365038.1|  PREDICTED: uncharacterized protein LOC103428692  78.6    7e-13   
gb|ABK24127.1|  unknown                                               76.3    2e-12   Picea sitchensis
ref|XP_002992362.1|  hypothetical protein SELMODRAFT_430579           77.0    2e-12   
ref|XP_002967740.1|  hypothetical protein SELMODRAFT_408999           76.3    4e-12   
ref|XP_010417623.1|  PREDICTED: uncharacterized protein LOC104703311  77.0    4e-12   
ref|NP_001048499.1|  Os02g0815100                                     76.3    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010936622.1|  PREDICTED: uncharacterized protein LOC105056210  75.1    5e-12   
dbj|BAK03653.1|  predicted protein                                    75.5    7e-12   
gb|ABU98655.1|  SRC2 protein                                          76.3    8e-12   Taiwania cryptomerioides
gb|KCW90833.1|  hypothetical protein EUGRSUZ_A02890                   73.9    1e-11   
ref|XP_010275059.1|  PREDICTED: uncharacterized protein LOC104610232  73.2    2e-11   
gb|ABK23901.1|  unknown                                               75.1    2e-11   Picea sitchensis
ref|XP_008225460.1|  PREDICTED: uncharacterized protein LOC103325105  73.2    2e-11   
ref|XP_002279465.1|  PREDICTED: formin-1                              72.8    5e-11   Vitis vinifera
ref|XP_001772125.1|  predicted protein                                74.3    8e-11   
gb|ABR18223.1|  unknown                                               72.4    1e-10   Picea sitchensis
ref|NP_001152648.1|  C2 domain containing protein                     71.6    1e-10   Zea mays [maize]
ref|XP_004985379.1|  PREDICTED: uncharacterized protein LOC101774...  71.6    2e-10   
ref|XP_004985378.1|  PREDICTED: uncharacterized protein LOC101774...  71.6    2e-10   
gb|ABR17336.1|  unknown                                               71.6    2e-10   Picea sitchensis
ref|NP_001170657.1|  hypothetical protein                             70.9    3e-10   Zea mays [maize]
ref|XP_003569491.1|  PREDICTED: uncharacterized protein LOC100842238  71.2    3e-10   
ref|XP_010256631.1|  PREDICTED: leucine-rich repeat extensin-like...  71.2    3e-10   
ref|XP_004247617.1|  PREDICTED: formin-like protein 14                71.2    3e-10   
gb|ACN40336.1|  unknown                                               70.9    4e-10   
ref|NP_001043768.1|  Os01g0659800                                     70.5    5e-10   
ref|XP_009774894.1|  PREDICTED: uncharacterized protein LOC104224872  69.7    6e-10   
ref|XP_009588589.1|  PREDICTED: pollen-specific leucine-rich repe...  70.5    7e-10   
emb|CDM83573.1|  unnamed protein product                              69.7    8e-10   
ref|XP_002970540.1|  hypothetical protein SELMODRAFT_441151           69.3    8e-10   
ref|XP_009779320.1|  PREDICTED: pollen-specific leucine-rich repe...  69.7    8e-10   
ref|XP_004240724.1|  PREDICTED: uncharacterized protein LOC101263030  68.9    8e-10   
ref|XP_004955273.1|  PREDICTED: uncharacterized protein LOC101765467  69.3    9e-10   
ref|XP_002275480.1|  PREDICTED: uncharacterized protein LOC100242355  68.9    9e-10   
ref|XP_010319948.1|  PREDICTED: uncharacterized protein LOC104647076  69.7    1e-09   
ref|XP_009627866.1|  PREDICTED: uncharacterized protein LOC104118341  68.9    1e-09   
gb|AFW83462.1|  C2 domain containing protein                          69.3    1e-09   
emb|CAN69351.1|  hypothetical protein VITISV_017753                   68.9    1e-09   
ref|XP_006422081.1|  hypothetical protein CICLE_v10005598mg           68.9    1e-09   
ref|XP_006827562.1|  hypothetical protein AMTR_s00009p00222310        68.6    1e-09   
gb|KDO56853.1|  hypothetical protein CISIN_1g023810mg                 68.9    1e-09   
ref|XP_003634095.1|  PREDICTED: uncharacterized protein LOC100852496  68.2    2e-09   
emb|CAN78886.1|  hypothetical protein VITISV_002549                   68.2    2e-09   
ref|XP_002272904.1|  PREDICTED: cytokinesis protein sepA-like         68.6    2e-09   
ref|XP_009792811.1|  PREDICTED: uncharacterized protein LOC104239794  68.9    2e-09   
ref|XP_006363329.1|  PREDICTED: uncharacterized protein LOC102600321  68.2    2e-09   
ref|XP_010025284.1|  PREDICTED: uncharacterized protein LOC104415652  67.0    2e-09   
ref|XP_002456081.1|  hypothetical protein SORBIDRAFT_03g030080        67.8    3e-09   
emb|CDP14057.1|  unnamed protein product                              68.2    3e-09   
ref|XP_002978619.1|  hypothetical protein SELMODRAFT_443918           68.9    3e-09   
ref|XP_008779256.1|  PREDICTED: uncharacterized protein LOC103698987  67.8    3e-09   
ref|XP_007009086.1|  Calcium-dependent lipid-binding family protein   68.2    3e-09   
ref|XP_011084443.1|  PREDICTED: uncharacterized protein LOC105166693  67.4    3e-09   
gb|KDP37957.1|  hypothetical protein JCGZ_04600                       66.2    3e-09   
ref|XP_007208693.1|  hypothetical protein PRUPE_ppa1027138mg          66.2    4e-09   
ref|XP_010670031.1|  PREDICTED: probable inactive serine/threonin...  68.2    4e-09   
gb|KDO67597.1|  hypothetical protein CISIN_1g020960mg                 67.8    4e-09   
ref|XP_007011415.1|  Calcium-dependent lipid-binding family protein   67.8    5e-09   
ref|XP_006435975.1|  hypothetical protein CICLE_v10033529mg           67.4    6e-09   
ref|XP_002266989.1|  PREDICTED: formin-A                              67.4    6e-09   
ref|XP_010096867.1|  hypothetical protein L484_003038                 67.0    6e-09   
ref|XP_006486118.1|  PREDICTED: probable inactive serine/threonin...  67.0    8e-09   
gb|KDP44823.1|  hypothetical protein JCGZ_01323                       66.6    8e-09   
ref|XP_006394656.1|  hypothetical protein EUTSA_v10004867mg           65.5    9e-09   
ref|XP_010940561.1|  PREDICTED: transcription elongation factor SPT5  66.2    9e-09   
ref|XP_004307752.1|  PREDICTED: uncharacterized protein LOC101311043  66.6    1e-08   
ref|XP_010934387.1|  PREDICTED: large proline-rich protein bag6-like  66.2    1e-08   
ref|XP_008343828.1|  PREDICTED: formin-like protein 20                65.9    2e-08   
ref|XP_011041338.1|  PREDICTED: leucine-rich repeat extensin-like...  65.9    2e-08   
ref|XP_004289725.1|  PREDICTED: uncharacterized protein LOC101315189  65.5    2e-08   
gb|KDP21615.1|  hypothetical protein JCGZ_03286                       65.5    2e-08   
ref|XP_008234153.1|  PREDICTED: verprolin                             65.9    2e-08   
gb|KDP27783.1|  hypothetical protein JCGZ_18863                       65.5    3e-08   
ref|XP_010035163.1|  PREDICTED: uncharacterized protein DDB_G0290...  66.6    3e-08   
ref|XP_007218318.1|  hypothetical protein PRUPE_ppa008392mg           65.5    3e-08   
ref|XP_010097658.1|  hypothetical protein L484_023798                 63.5    3e-08   
ref|XP_011090948.1|  PREDICTED: protein diaphanous homolog 1-like     65.5    3e-08   
ref|XP_010999508.1|  PREDICTED: formin-G                              65.1    4e-08   
gb|EYU43935.1|  hypothetical protein MIMGU_mgv1a013059mg              63.5    5e-08   
gb|KDP46959.1|  hypothetical protein JCGZ_07976                       63.9    5e-08   
ref|XP_011076131.1|  PREDICTED: WW domain-containing protein C11B...  63.9    5e-08   
gb|KCW65820.1|  hypothetical protein EUGRSUZ_G031711                  63.5    5e-08   
ref|XP_010922806.1|  PREDICTED: WW domain-binding protein 11          64.3    6e-08   
ref|XP_010035164.1|  PREDICTED: uncharacterized protein DDB_G0290...  65.1    6e-08   
ref|XP_002872084.1|  hypothetical protein ARALYDRAFT_910412           63.2    6e-08   
ref|XP_008800861.1|  PREDICTED: formin-like protein 18                64.3    7e-08   
gb|ACV71018.1|  UPA18                                                 64.3    7e-08   
ref|XP_001779834.1|  predicted protein                                63.5    7e-08   
ref|XP_006371351.1|  hypothetical protein POPTR_0019s09350g           63.9    7e-08   
ref|XP_010098296.1|  hypothetical protein L484_023544                 63.5    8e-08   
ref|XP_009410493.1|  PREDICTED: uncharacterized protein LOC103992499  63.9    8e-08   
ref|XP_008234191.1|  PREDICTED: WW domain-containing protein C11B...  63.5    8e-08   
ref|XP_009368751.1|  PREDICTED: WW domain-containing protein C11B...  63.5    9e-08   
ref|XP_002519702.1|  conserved hypothetical protein                   62.4    9e-08   
ref|XP_002520901.1|  conserved hypothetical protein                   63.9    1e-07   
ref|XP_002965668.1|  hypothetical protein SELMODRAFT_407234           63.9    1e-07   
ref|XP_004235211.1|  PREDICTED: uncharacterized protein LOC101249714  63.5    1e-07   
ref|XP_004140766.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  62.0    1e-07   
ref|XP_010068940.1|  PREDICTED: uncharacterized protein LOC104455934  63.2    1e-07   
ref|XP_006358166.1|  PREDICTED: uncharacterized protein LOC102591162  63.2    1e-07   
ref|XP_001778275.1|  predicted protein                                62.0    1e-07   
ref|XP_008379961.1|  PREDICTED: WW domain-containing protein C11B...  62.8    1e-07   
ref|XP_010101600.1|  hypothetical protein L484_001120                 61.2    2e-07   
ref|XP_002299003.1|  hypothetical protein POPTR_0001s46230g           60.8    2e-07   
ref|XP_002971671.1|  hypothetical protein SELMODRAFT_412188           63.2    2e-07   
ref|XP_010031258.1|  PREDICTED: formin-like protein 20                63.2    2e-07   
ref|XP_010060582.1|  PREDICTED: uncharacterized protein LOC104448451  62.4    2e-07   
ref|XP_002315561.1|  shock protein SRC2                               62.4    2e-07   
ref|XP_002526856.1|  protein with unknown function                    62.8    2e-07   
gb|KCW90655.1|  hypothetical protein EUGRSUZ_A02756                   62.4    2e-07   
ref|XP_007218770.1|  hypothetical protein PRUPE_ppa009523mg           62.4    2e-07   
ref|XP_010662793.1|  PREDICTED: uncharacterized protein LOC104882217  60.8    2e-07   
ref|XP_011030162.1|  PREDICTED: uncharacterized protein LOC105129684  62.0    2e-07   
ref|XP_007218347.1|  hypothetical protein PRUPE_ppa008681mg           62.4    2e-07   
ref|XP_004157192.1|  PREDICTED: uncharacterized protein LOC101224685  62.0    3e-07   
ref|XP_006855523.1|  hypothetical protein AMTR_s00057p00209740        62.0    3e-07   
ref|XP_010269468.1|  PREDICTED: abl interactor homolog                61.6    4e-07   
ref|XP_008375255.1|  PREDICTED: uncharacterized protein LOC103438493  62.0    4e-07   
emb|CAN64035.1|  hypothetical protein VITISV_020002                   60.8    4e-07   
ref|XP_002318206.1|  hypothetical protein POPTR_0012s12880g           60.5    4e-07   
ref|XP_010109170.1|  hypothetical protein L484_017111                 62.0    4e-07   
ref|XP_002311204.1|  hypothetical protein POPTR_0008s06510g           61.6    4e-07   
gb|ABK92946.1|  unknown                                               61.6    4e-07   
ref|XP_008347213.1|  PREDICTED: uncharacterized protein LOC103410258  62.0    4e-07   
emb|CAN61785.1|  hypothetical protein VITISV_015873                   60.1    4e-07   
ref|XP_010096455.1|  hypothetical protein L484_001160                 60.5    5e-07   
ref|NP_001149536.1|  src2-like protein                                62.0    5e-07   
ref|XP_001759306.1|  predicted protein                                62.4    5e-07   
ref|XP_009362765.1|  PREDICTED: wiskott-Aldrich syndrome protein ...  61.6    5e-07   
ref|XP_008439269.1|  PREDICTED: zinc finger matrin-type protein C...  61.2    5e-07   
ref|XP_003529574.1|  PREDICTED: toll-interacting protein-like         61.2    5e-07   
emb|CDY17163.1|  BnaA05g10250D                                        57.8    5e-07   
ref|XP_008803020.1|  PREDICTED: WAS/WASL-interacting protein fami...  61.6    5e-07   
ref|XP_009791711.1|  PREDICTED: uncharacterized protein LOC104238906  61.6    5e-07   
gb|KEH35505.1|  calcium-dependent lipid-binding (CaLB domain) fam...  61.2    6e-07   
gb|AFW84033.1|  src2-like protein                                     61.6    6e-07   
gb|EYU25119.1|  hypothetical protein MIMGU_mgv1a021760mg              61.2    6e-07   
ref|XP_003615471.1|  hypothetical protein MTR_5g068530                59.7    6e-07   
ref|XP_007213255.1|  hypothetical protein PRUPE_ppb020632mg           59.3    7e-07   
ref|XP_006425035.1|  hypothetical protein CICLE_v10028899mg           61.2    7e-07   
ref|XP_010662792.1|  PREDICTED: uncharacterized protein LOC104882216  59.3    7e-07   
ref|XP_010550541.1|  PREDICTED: uncharacterized protein LOC104821382  60.5    7e-07   
ref|XP_010259736.1|  PREDICTED: uncharacterized protein LOC104599071  59.7    7e-07   
dbj|BAJ97521.1|  predicted protein                                    61.6    8e-07   
gb|EYU19982.1|  hypothetical protein MIMGU_mgv1a024988mg              60.8    9e-07   
ref|XP_011044520.1|  PREDICTED: actin cytoskeleton-regulatory com...  60.5    9e-07   
ref|XP_009135963.1|  PREDICTED: uncharacterized protein LOC103860112  58.9    9e-07   
ref|XP_003565019.1|  PREDICTED: basic salivary proline-rich prote...  60.8    1e-06   
ref|XP_006646653.1|  PREDICTED: C2 domain-containing protein At1g...  59.3    1e-06   
ref|XP_009600682.1|  PREDICTED: uncharacterized protein LOC104096081  60.5    1e-06   
ref|XP_006827556.1|  hypothetical protein AMTR_s00009p00221230        60.1    1e-06   
emb|CDY22480.1|  BnaC03g22900D                                        59.3    1e-06   
ref|XP_010111003.1|  BON1-associated protein 2                        58.5    1e-06   
ref|XP_007163517.1|  hypothetical protein PHAVU_001G240600g           60.1    1e-06   
ref|XP_009800792.1|  PREDICTED: WW domain-containing protein C11B...  60.1    1e-06   
ref|XP_009384169.1|  PREDICTED: basic proline-rich protein-like       60.5    1e-06   
gb|KDP41888.1|  hypothetical protein JCGZ_26906                       60.1    1e-06   
ref|XP_006288435.1|  hypothetical protein CARUB_v10001693mg           59.7    1e-06   
ref|XP_011076733.1|  PREDICTED: pollen-specific leucine-rich repe...  60.1    1e-06   
gb|KEH28140.1|  C2 domain protein                                     60.1    1e-06   
ref|XP_004309433.1|  PREDICTED: uncharacterized protein LOC101294323  59.7    2e-06   
ref|XP_010938433.1|  PREDICTED: neural Wiskott-Aldrich syndrome p...  59.7    2e-06   
ref|XP_004490527.1|  PREDICTED: uncharacterized protein LOC101506482  60.1    2e-06   
gb|AES98429.2|  C2 domain protein                                     60.1    2e-06   
gb|KFK27692.1|  hypothetical protein AALP_AA8G416000                  59.3    2e-06   
ref|XP_009350922.1|  PREDICTED: formin-like protein 20                60.1    2e-06   
ref|XP_004234422.1|  PREDICTED: probable calcium-binding protein ...  60.1    2e-06   
ref|XP_008392919.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    2e-06   
ref|XP_007152204.1|  hypothetical protein PHAVU_004G110200g           58.9    2e-06   
emb|CAN68012.1|  hypothetical protein VITISV_005112                   57.8    2e-06   
ref|XP_010662671.1|  PREDICTED: uncharacterized protein LOC104882187  57.8    2e-06   
ref|XP_002516905.1|  conserved hypothetical protein                   59.3    2e-06   
gb|AAB61031.1|  A_IG002N01.24 gene product                            60.8    2e-06   
gb|KDP21440.1|  hypothetical protein JCGZ_21911                       57.0    2e-06   
ref|XP_003615539.1|  hypothetical protein MTR_5g069320                59.7    2e-06   
ref|XP_006299431.1|  hypothetical protein CARUB_v10015591mg           59.7    2e-06   
ref|XP_003602455.1|  hypothetical protein MTR_3g093550                56.6    3e-06   
ref|XP_002459044.1|  hypothetical protein SORBIDRAFT_03g045000        59.7    3e-06   
ref|XP_007038773.1|  Calcium-dependent lipid-binding family protein   58.9    3e-06   
ref|XP_010504403.1|  PREDICTED: leucine-rich repeat extensin-like...  59.7    3e-06   
ref|XP_011076565.1|  PREDICTED: cleavage and polyadenylation spec...  59.3    3e-06   
ref|NP_188272.1|  Calcium-dependent lipid-binding domain-containi...  59.3    3e-06   
ref|XP_002271409.1|  PREDICTED: BAHD acyltransferase DCR              60.1    3e-06   
ref|NP_001062521.1|  Os08g0562600                                     58.9    3e-06   
ref|XP_008801062.1|  PREDICTED: wiskott-Aldrich syndrome protein ...  59.3    3e-06   
ref|XP_011071658.1|  PREDICTED: neural Wiskott-Aldrich syndrome p...  58.9    3e-06   
ref|XP_009401591.1|  PREDICTED: uncharacterized protein LOC103985575  58.5    3e-06   
ref|XP_010440511.1|  PREDICTED: uncharacterized protein LOC104723800  58.5    3e-06   
ref|XP_002280187.1|  PREDICTED: formin-like protein 14                58.9    3e-06   
gb|EPS57822.1|  hypothetical protein M569_16995                       56.6    4e-06   
ref|XP_009779515.1|  PREDICTED: formin-like protein 18                58.9    4e-06   
emb|CBI22681.3|  unnamed protein product                              59.7    4e-06   
ref|XP_009363765.1|  PREDICTED: wiskott-Aldrich syndrome protein-...  58.9    4e-06   
ref|XP_010921798.1|  PREDICTED: ingression protein fic1-like          58.9    4e-06   
ref|XP_006342789.1|  PREDICTED: formin-A-like isoform X1              58.5    4e-06   
ref|XP_002512414.1|  conserved hypothetical protein                   58.2    4e-06   
ref|XP_010554734.1|  PREDICTED: uncharacterized protein LOC104824373  58.5    4e-06   
ref|XP_006353889.1|  PREDICTED: RNA-binding protein EWS-like isof...  58.9    4e-06   
ref|XP_006353888.1|  PREDICTED: RNA-binding protein EWS-like isof...  58.9    5e-06   
ref|XP_006296032.1|  hypothetical protein CARUB_v10025177mg           58.5    5e-06   
ref|XP_010454681.1|  PREDICTED: uncharacterized protein LOC104736407  57.8    5e-06   
gb|EEE55117.1|  hypothetical protein OsJ_02891                        58.2    5e-06   
gb|ACU18582.1|  unknown                                               57.8    5e-06   
emb|CDX87149.1|  BnaC09g04640D                                        57.0    6e-06   
ref|NP_197783.2|  calcium-dependent lipid-binding domain-containi...  57.0    6e-06   
dbj|BAB10068.1|  unnamed protein product                              57.0    7e-06   
gb|KHN40007.1|  hypothetical protein glysoja_009384                   58.2    7e-06   
ref|XP_004971180.1|  PREDICTED: calcium-binding protein P-like        58.2    7e-06   
ref|XP_008376957.1|  PREDICTED: protein transport protein Sec24-l...  58.2    8e-06   
ref|XP_004967742.1|  PREDICTED: forkhead box protein D1-like          57.8    8e-06   
ref|XP_006601957.1|  PREDICTED: uncharacterized protein LOC102666...  57.8    8e-06   
ref|XP_003544269.1|  PREDICTED: uncharacterized protein LOC100802456  57.8    8e-06   
ref|XP_010095064.1|  hypothetical protein L484_026371                 58.2    8e-06   
ref|XP_009612128.1|  PREDICTED: cyclin-dependent kinase inhibitor...  57.8    8e-06   
ref|XP_010248679.1|  PREDICTED: uncharacterized protein LOC104591520  56.6    8e-06   
ref|XP_003519347.1|  PREDICTED: elicitor-responsive protein 1-like    55.5    9e-06   
gb|KHG21324.1|  BON1-associated 2 -like protein                       57.0    1e-05   
emb|CDX74290.1|  BnaA03g27570D                                        55.8    1e-05   
emb|CDY16874.1|  BnaA09g05080D                                        56.2    1e-05   
ref|XP_007035560.1|  Soybean gene regulated by cold-2, putative       57.0    1e-05   
ref|XP_006411349.1|  hypothetical protein EUTSA_v10016922mg           57.4    1e-05   
ref|XP_002513669.1|  conserved hypothetical protein                   57.0    1e-05   
ref|XP_010665443.1|  PREDICTED: uncharacterized protein LOC104882777  55.8    1e-05   
ref|XP_001758706.1|  predicted protein                                56.6    1e-05   
ref|XP_010421203.1|  PREDICTED: actin cytoskeleton-regulatory com...  57.0    1e-05   
ref|XP_006406829.1|  hypothetical protein EUTSA_v10021044mg           57.4    1e-05   
tpg|DAA55958.1|  TPA: hypothetical protein ZEAMMB73_567157            57.0    1e-05   
ref|XP_010255304.1|  PREDICTED: uncharacterized protein LOC104596023  56.6    2e-05   
gb|KHN02132.1|  hypothetical protein glysoja_046458                   57.0    2e-05   
ref|XP_001775930.1|  predicted protein                                57.0    2e-05   
gb|KEH34781.1|  C2 domain protein                                     57.0    2e-05   
gb|KHN46184.1|  hypothetical protein glysoja_039908                   57.0    2e-05   
ref|XP_006365577.1|  PREDICTED: uncharacterized protein LOC102595643  55.1    2e-05   
gb|ABK26354.1|  unknown                                               56.6    2e-05   
ref|XP_004229314.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  56.6    2e-05   
gb|KCW46456.1|  hypothetical protein EUGRSUZ_K00286                   56.6    2e-05   
ref|XP_001782058.1|  predicted protein                                56.2    2e-05   
ref|XP_008785412.1|  PREDICTED: extensin-like                         56.2    3e-05   
emb|CDP13872.1|  unnamed protein product                              56.2    3e-05   
ref|XP_009399250.1|  PREDICTED: MAPK-interacting and spindle-stab...  56.2    3e-05   
ref|XP_003600860.1|  BAHD acyltransferase DCR                         57.0    3e-05   
ref|XP_009147165.1|  PREDICTED: uncharacterized protein LOC103870749  56.6    3e-05   
ref|XP_010666732.1|  PREDICTED: uncharacterized protein LOC104883866  55.5    3e-05   
ref|XP_010931620.1|  PREDICTED: basic proline-rich protein-like       56.2    3e-05   
ref|XP_010493524.1|  PREDICTED: uncharacterized protein LOC104770764  55.8    3e-05   



>ref|XP_009792812.1| PREDICTED: uncharacterized protein LOC104239795 [Nicotiana sylvestris]
Length=404

 Score =   266 bits (681),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 161/349 (46%), Positives = 209/349 (60%), Gaps = 64/349 (18%)
 Frame = +1

Query  328   HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
             +HILEITLISAQDL+ V KS RTYAL WVNPN+KR+T +D++G +NPTWN KFSFRV D+
Sbjct  39    NHILEITLISAQDLSPVCKSLRTYALTWVNPNRKRTTRVDNQGHSNPTWNDKFSFRVDDE  98

Query  508   FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRP  687
             FL S+ SAV+VEIY+V+WFRD+LVGTVK+ + +L+ P  RS        ++F+ALQIRRP
Sbjct  99    FLNSESSAVHVEIYTVSWFRDILVGTVKVLLNNLINPFDRS--------KKFVALQIRRP  150

Query  688   SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKF----------FPDS  837
             SG+PQG+LN+GVAL D + RS P +++++  S D RD+L++K+N            FP+ 
Sbjct  151   SGNPQGILNLGVALIDKSKRSMPLFNQITPLSLDHRDILDRKINDINAQDQMINENFPED  210

Query  838   ESAV----------------------EFPAKGGSVCNSSAVNG----GSEVCSDIGPSAS  939
             E  +                      EFP + GS+CN S VNG    GSE+CSDIGPSAS
Sbjct  211   EEKLQINNKIQLWQSQNLGYSDVNTGEFPNQAGSICNGSMVNGSIVNGSELCSDIGPSAS  270

Query  940   VVAAE----LMNLNppapapaqaakttvpvaEKTKSACGESLIleeltae--eaaaKGFT  1101
             +VAAE    L  L PP     +  K      E  +S+  E L  EE  A+    + +G  
Sbjct  271   IVAAEIAKKLQPLPPPRVPSKELNKEYSGEGEDGESSILEELTAEEAYAKGLALSTEGRK  330

Query  1102  KEPGVKKK--------------GRLVSCFGNAYGFEVTIVCGQSKKQKK  1206
             KE    +K              G L SCFGNAY FE TIVCG S    +
Sbjct  331   KEAAAPEKCQRGSGGHPRRNTDGGLYSCFGNAYCFEFTIVCGASNNNNQ  379



>ref|XP_009625035.1| PREDICTED: uncharacterized protein LOC104115988 [Nicotiana tomentosiformis]
Length=406

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 163/343 (48%), Positives = 206/343 (60%), Gaps = 66/343 (19%)
 Frame = +1

Query  328   HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
             +HILEITLISAQDL+ V KS RTYAL WVNPN+KR+T +D++G +NPTWN KFSFRV D+
Sbjct  41    NHILEITLISAQDLSPVCKSLRTYALTWVNPNRKRTTRVDNQGHSNPTWNDKFSFRVDDE  100

Query  508   FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRP  687
             FL S+ SAV+VEIY+V+WFRD+LVGTVK+ + +L+ P  RS        ++F+ALQIRRP
Sbjct  101   FLNSESSAVHVEIYTVSWFRDILVGTVKVLLNNLINPYDRS--------KKFVALQIRRP  152

Query  688   SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKF----------FPDS  837
             SG+PQG+LN+GVAL D + RS P + E++  S D RD+L++K+N            FP+ 
Sbjct  153   SGNPQGILNLGVALIDKSKRSMPLFDEITPLSLDHRDILDRKINDINAQDQMINENFPED  212

Query  838   ESAV----------------------EFPAKGGSVCNSSAVNG----GSEVCSDIGPSAS  939
             E  +                      EFP + GS+CN S  NG    GSE+CSDIGPSAS
Sbjct  213   EEKLQINNKIQLWQSQSLGYSDVNNGEFPNQAGSICNGSMANGSVVNGSELCSDIGPSAS  272

Query  940   VVAAELMNLNppapapaqaakttvpvaEKTKSACGESLIleeltaeeaaaKGFTKEPGVK  1119
             +VAAE+         P +     +      +   GES ILEELTAEEA AKG       +
Sbjct  273   IVAAEIAK-KLQPLPPPRVPSKELSKEYSGEGDDGESSILEELTAEEAYAKGLALSTEAR  331

Query  1120  KK---------------------GRLVSCFGNAYGFEVTIVCG  1185
             KK                     G L SCFGNAY FE TIVCG
Sbjct  332   KKEAAAPEKCQRGSGGHPRRNTNGGLYSCFGNAYCFEFTIVCG  374



>ref|XP_009795461.1| PREDICTED: uncharacterized protein LOC104242159 [Nicotiana sylvestris]
Length=395

 Score =   258 bits (659),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 169/340 (50%), Positives = 208/340 (61%), Gaps = 63/340 (19%)
 Frame = +1

Query  328   HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
             +HILEI+LISAQDLA VSKS RTYAL W+NPNKKRST ID++G  NPTWN KFSF+V D+
Sbjct  35    NHILEISLISAQDLAPVSKSLRTYALAWINPNKKRSTRIDNEGHNNPTWNDKFSFKVNDE  94

Query  508   FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRP  687
             FL S+ SAV+VEIY+V+WFRDVLVGTV + + +L+ P       + N K RF+ALQIRRP
Sbjct  95    FLYSETSAVHVEIYTVSWFRDVLVGTVHVLLNNLINP----FINNSNGK-RFVALQIRRP  149

Query  688   SGDPQGMLNMGVALFDSASRSKPKYSE--VSGSSSDCRDLLEKKMNKFFPDSESAV----  849
             SG+PQG+LNMGV+L  S+ RS P      ++ SS D RD+L+KKMN+ + + +       
Sbjct  150   SGNPQGILNMGVSLIHSSMRSMPLICNEIMNPSSLDYRDILDKKMNENYQEDDEKQRQIN  209

Query  850   -------------------EFPAKGGSVCNSSAVNG---------GSEVCSDIGPSASVV  945
                                +FP K GSVCN S VNG         GSE+CSDIGPSAS+V
Sbjct  210   DKIQLWRSLSLGYSEVNNEDFPNKAGSVCNGSMVNGSMCNGSIVNGSELCSDIGPSASIV  269

Query  946   AAELMNLNppapapaqaakttvpvaEKTKSACGESLIleeltaeeaaaKGF--TKEPGVK  1119
             AAE+      A    Q     V + +  +   GES ILE+LTAEEA AKG   + E G K
Sbjct  270   AAEI------AAKRYQPPPQKVQIKQPKEMEDGESSILEDLTAEEAYAKGLASSMEKGRK  323

Query  1120  KK----------------GRLVSCFGNAYGFEVTIVCGQS  1191
             +                 G L SCFGNAYG E  IVCG S
Sbjct  324   ETAALAVVNGGHSRRNSDGGLFSCFGNAYGIEFRIVCGAS  363



>ref|XP_006358324.1| PREDICTED: uncharacterized protein LOC102592049 [Solanum tuberosum]
Length=353

 Score =   256 bits (655),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 148/317 (47%), Positives = 195/317 (62%), Gaps = 43/317 (14%)
 Frame = +1

Query  328   HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
             +HILEITLISAQDL+ V KS RTYAL WVNPN+KR+T +D+ G  NP WN KFSFRV D+
Sbjct  35    NHILEITLISAQDLSPVCKSLRTYALTWVNPNRKRTTRVDNHGHNNPNWNDKFSFRVDDE  94

Query  508   FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRP  687
             FL SD SA++VEIY+V+WFRD+LVGTVK+ + +L+ P   +     N+ ++F+ALQIRRP
Sbjct  95    FLSSDSSAIHVEIYTVSWFRDILVGTVKVILNNLVNPFENT---SSNQSKKFVALQIRRP  151

Query  688   SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSE---------  840
             SG+PQG+LNMGVA+ D + RS P +SE++  S D RD+L++K+N      E         
Sbjct  152   SGNPQGILNMGVAVIDKSKRSMPLFSEITPLSLDHRDILDRKINDINAQDEMINNNHNHT  211

Query  841   ---------------SAVEFPAKGGSVCNSSAVNGGSEVCSDIGPSASVVAAELM-NLNp  972
                            +  EFP + GS+ N      GSE+CSDIGPSAS+VAAE    L  
Sbjct  212   DEKLQIQMWQQSDNVAYSEFPNQAGSIIN------GSELCSDIGPSASIVAAETAKKLQV  265

Query  973   papapaqaakttvpvaEKT-KSACGESLIleeltaeeaaaKGFTKEPGVKKKGRLVSCFG  1149
             P+    +  +++  + E T + A G+ L        + A  G T+       G L SCFG
Sbjct  266   PSNRENEDGESSSILEELTAEEAYGKGL-----EETKRAKGGHTRR---NTDGGLYSCFG  317

Query  1150  NAYGFEVTIVCGQSKKQ  1200
             NAY FE TIVCG    Q
Sbjct  318   NAYCFEFTIVCGAGNNQ  334



>ref|XP_004242771.1| PREDICTED: formin-J [Solanum lycopersicum]
Length=370

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 157/321 (49%), Positives = 193/321 (60%), Gaps = 54/321 (17%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             HILEITLISAQDL+ V KS RTYAL WVNPN+KR+T ID+ G  NP WN KFSFRV D+F
Sbjct  34    HILEITLISAQDLSPVCKSLRTYALTWVNPNRKRTTRIDNHGHNNPNWNDKFSFRVDDEF  93

Query  511   LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
             L SD SA++VEIY+V+WFRD+LVGTVK+ + +L+ P         N  ++F+ALQIRRPS
Sbjct  94    LISDSSAIHVEIYTVSWFRDILVGTVKVILNNLVNP----FENTSNSSKKFVALQIRRPS  149

Query  691   GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSE----------  840
             G+PQG+LNMGV+L D + RS P +SE++  S D RD+L++K+N      E          
Sbjct  150   GNPQGILNMGVSLIDKSKRSMPLFSEITPLSMDHRDILDRKINDINAQDEMINNNHNDTD  209

Query  841   ----------------------SAVEFPAKGGSVCNSSAVNGGSEVCSDIGPSASVVAAE  954
                                   +  EFP + GS+ N      GSE+CSDIGPSAS+VAAE
Sbjct  210   EKLKITNKVQIWQSHNLAYSEINNGEFPNQAGSIVN------GSELCSDIGPSASIVAAE  263

Query  955   LMNLNppapapaqaakttvpvaEKTKSACGESLIleeltaeeaaaKGFTKEP----GVKK  1122
                      A          VA    +  GES IL ELTAEEA AKG  +      G  +
Sbjct  264   --------TAKKLQPMLPQRVASNRGNEDGESSILGELTAEEAYAKGLEETKRGRGGHTR  315

Query  1123  KGRLVSCFGNAYGFEVTIVCG  1185
              G L SCFGNAY FE TIVCG
Sbjct  316   DGGLYSCFGNAYCFEFTIVCG  336



>ref|XP_006345991.1| PREDICTED: uncharacterized protein LOC102591105, partial [Solanum 
tuberosum]
Length=373

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 162/346 (47%), Positives = 208/346 (60%), Gaps = 57/346 (16%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             HILEITLISAQDLA VSKS RTYAL W+NPN+KRST +D+ G  NPTWN KFSF+V ++F
Sbjct  31    HILEITLISAQDLAPVSKSLRTYALTWINPNRKRSTKVDNDGHNNPTWNDKFSFKVNEEF  90

Query  511   LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
             L S++SAV+VEIY+V+WFRDVLVGT+ + + +L+ P      Q+    +RF+ALQIRRPS
Sbjct  91    LYSENSAVHVEIYTVSWFRDVLVGTINVQLNNLINPCVN--FQNSLNGKRFVALQIRRPS  148

Query  691   GDPQGMLNMGVALFDSASRSKPKYSE--VSGSSSDCRDLLEKKMNKFFP-----DSESAV  849
             G+PQG+LNMGVA+ +S+ RS P   +  +  SS D RD+L+KKM++ +      D +  +
Sbjct  149   GNPQGILNMGVAIIESSMRSMPLICKEIIDPSSLDYRDILDKKMSENYQEVIDDDKQREL  208

Query  850   --------------------EFPAKGGSVCNSSAVNGGSEVCSDIGPSASVVAAELMNLN  969
                                 EFP KGGS+CN S VN GSE+CSD+GPSAS+VAAE+    
Sbjct  209   NEKVQLWRSMSLGYSEVNNDEFPIKGGSICNGSMVN-GSELCSDVGPSASIVAAEIA-AK  266

Query  970   ppapapaqaakttvpvaEKTKSACGE----SLIleeltaeeaaaKGF--TKEPGVKKK--  1125
                   +          E  KS   E    SLILE+LTAEEA AKG   +    ++K+  
Sbjct  267   RYQQLLSTVQPEPRQEVETKKSKEMEDGESSLILEDLTAEEAYAKGLLSSNREKLRKETI  326

Query  1126  ------------------GRLVSCFGNAYGFEVTIVCGQSKKQKKD  1209
                               G L SCFGNAYG E  IVCG +     D
Sbjct  327   ATQMQAINGGHARRNSDGGGLFSCFGNAYGIEFRIVCGANSNNDDD  372



>ref|XP_009591729.1| PREDICTED: uncharacterized protein LOC104088710 [Nicotiana tomentosiformis]
Length=399

 Score =   253 bits (645),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 166/335 (50%), Positives = 208/335 (62%), Gaps = 55/335 (16%)
 Frame = +1

Query  328   HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
             +HI+EI+LISAQDLA VSKS RTYAL W+NPNKKRST ID++G  NP+WN KFSF+V D+
Sbjct  37    NHIIEISLISAQDLAPVSKSLRTYALTWINPNKKRSTRIDNEGHNNPSWNDKFSFKVNDE  96

Query  508   FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRP  687
             FL S+ SAV+VEIY+V+WFRDVLVGTV + + +L+ P   S        +RF+ALQIRRP
Sbjct  97    FLYSETSAVHVEIYTVSWFRDVLVGTVHVLLNNLINPFVNS------NGKRFVALQIRRP  150

Query  688   SGDPQGMLNMGVALFDSASRSKPKY-SEVSGSSS-DCRDLLEKKMNKFFP-DSESAVE--  852
             SG+PQG+LNMGV+L +S+ +S P   SE+   SS + RD+L+KK+N+ +  D E   +  
Sbjct  151   SGNPQGILNMGVSLINSSMKSMPLICSEIMNPSSLNYRDILDKKINENYQVDDEKQRQIN  210

Query  853   --------------------FPAKGGSVCNSSAVNG----GSEVCSDIGPSASVVAAELM  960
                                 FP K GSVCN S VNG    GSE+CSDIGPSAS+VAAE+ 
Sbjct  211   DKVQLWRSLSLGYSEVNNEDFPNKAGSVCNGSMVNGSIVNGSELCSDIGPSASIVAAEIA  270

Query  961   --NLNppapapaqaakttvpvaEKTKSACGESLIleeltaeeaaaKGFT-------KEPG  1113
                  PP           + + +  +   GES ILE+LTAEEA AKG T       KE  
Sbjct  271   AKRYQPPRQPARPEPPKEMHIKQPKEMEDGESSILEDLTAEEAYAKGLTSSIEKGRKEMA  330

Query  1114  VK-----------KKGRLVSCFGNAYGFEVTIVCG  1185
             V+             G L SCFGNAYG E  IVCG
Sbjct  331   VQAVVNGGHSRRNSDGGLFSCFGNAYGIEFRIVCG  365



>emb|CDP04279.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   245 bits (626),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 146/326 (45%), Positives = 195/326 (60%), Gaps = 63/326 (19%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ++L I+LISAQDLA +SKS RTYA+ W++P++K +TS+D +  TNP WN +F+FRV  +F
Sbjct  27    YVLNISLISAQDLAPISKSMRTYAVTWIHPSRKLTTSVDQQRHTNPLWNERFAFRVDSEF  86

Query  511   LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
             L SD +A+ VEIY+V+WFRD+LVGTV++ +  L+ P AR+ T       R++ALQIRRPS
Sbjct  87    LSSDQAAITVEIYTVSWFRDLLVGTVRVLISDLITPCARNHT-------RYLALQIRRPS  139

Query  691   GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN-----------------  819
             G+PQGMLNMGVAL D+A+RS P   E++ S  D +D L KK+N                 
Sbjct  140   GNPQGMLNMGVALMDAANRSMPLRREMNPSVRDYQDALVKKLNSMSAQQKDGEIVTEENN  199

Query  820   -----------KFFPDSESAVEFPAKGGSVCNSSAVNGGSEVCSDIGPSASVVAAELMNL  966
                         +   SE   EFP K GS+CN +    GSE+CSD+GPSAS+VAAE+   
Sbjct  200   DQMNEKIHLWRSYSLGSEFNEEFPLKAGSICNGN----GSELCSDVGPSASIVAAEI---  252

Query  967   NppapapaqaakttvpvaEKTKSACGESLIleeltaeeaaaKGFTKEPGVKKKGR-----  1131
                             +    +   G S++ EE+T EEA AKG   +   ++ GR     
Sbjct  253   ------------ARKSLPPMAERKIGNSIV-EEMTVEEATAKGLNSDG--RRHGRRHSDG  297

Query  1132  -LVSCFGNAYGFEVTIVCGQSKKQKK  1206
              L SCFGNAYGFE TIVCG S    K
Sbjct  298   GLFSCFGNAYGFEFTIVCGASNHGNK  323



>ref|XP_004239688.1| PREDICTED: putative uncharacterized protein DDB_G0267840 [Solanum 
lycopersicum]
Length=415

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 207/340 (61%), Gaps = 57/340 (17%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             HILEITLISAQDLA +SKS RTYAL W+NPN+KRST ID++G  NPTWN KFSF+V ++F
Sbjct  32    HILEITLISAQDLAPISKSLRTYALTWINPNRKRSTKIDNEGHNNPTWNDKFSFKVNEEF  91

Query  511   LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
             L S++SAV+VEIY+V+WFRDVLVGT+ + + +L+ P      Q+ +  +RF+ALQIRRPS
Sbjct  92    LYSENSAVHVEIYTVSWFRDVLVGTINVQLNNLINPYVN--FQNSSNGKRFVALQIRRPS  149

Query  691   GDPQGMLNMGVALFDSASRSKPKYSE--VSGSSSDCRDLLEKKMNKFFP-----DSESAV  849
             G+PQG+LNMGVA+ +S+ RS P      +  +S D RD+L+KKM++ +      D +  +
Sbjct  150   GNPQGILNMGVAIIESSMRSMPLLCNEIMDPTSLDYRDILDKKMSENYQEVVEDDKQREI  209

Query  850   --------------------EFPAKGGSVCNSSAVNG----GSEVCSDIGPSASVVAAEL  957
                                 E   KG S+CN S  NG    GSE+CSD+GPSAS+VAAE+
Sbjct  210   NEKIQLWRSMSLGYSEINNDELLIKGSSICNGSMANGSMVNGSELCSDVGPSASIVAAEI  269

Query  958   MNLNppapapaqaakttvpvaEKTKSAC-GE-SLIleeltaeeaaaKGF--TKEPGVKKK  1125
                      P    ++     +++K    GE SLILE+LTAEEA AKG   +    ++K+
Sbjct  270   AAKRYQQLLPTIQFESREAAIKQSKEMEDGERSLILEDLTAEEAYAKGLISSNREKLRKE  329

Query  1126  --------------------GRLVSCFGNAYGFEVTIVCG  1185
                                 G L SCFGN YG E  IVCG
Sbjct  330   TTATQTQTINGGHARRNSDGGGLFSCFGNTYGIEFRIVCG  369



>ref|XP_011069440.1| PREDICTED: uncharacterized protein LOC105155266 [Sesamum indicum]
Length=404

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 143/351 (41%), Positives = 184/351 (52%), Gaps = 70/351 (20%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ++LEI+LISAQDLA +SKS +TYA+ W+NPNKK +T  D +G  NP WN KF FR+ ++ 
Sbjct  33    YLLEISLISAQDLAPISKSMQTYAMAWINPNKKHTTRTDQQGNKNPMWNDKFVFRLTNEL  92

Query  511   LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
             L S+ + V VEIY+V+WFRDVLVG V++ +  L+ P  R++ Q   K  RF+ALQ+RRPS
Sbjct  93    LHSETATVTVEIYTVSWFRDVLVGMVRVLISDLITPLIRTL-QTNTKNTRFVALQVRRPS  151

Query  691   GDPQGMLNMGVALFDSASRSKP--KYSEVSGSSSDCRDLLEKKMNKFFPD----------  834
             G PQG+LNMG++L DS  RS P   Y+    + ++ +D  EK  N   PD          
Sbjct  152   GTPQGILNMGISLLDSTMRSMPLKNYAARKHAKNNVQDSDEKNTN---PDDDTLQKDEQL  208

Query  835   --------------------SESAVEFPAKGGSVCNSSAVNG---------GSEVCSDIG  927
                                 SE   +FP K GS+ N S VNG         GSE+CSDIG
Sbjct  209   SDEKRELNAKIQLWRSLSAGSEVNEDFPVKAGSIYNGSMVNGSLCNGSIEYGSELCSDIG  268

Query  928   PSASVVAAELM-------NLNppapapaqaakttvpvaEKTKSACGESLIleelta----  1074
             PSAS+VAAE+        +L  PA +  + AK      E   S   E  I E        
Sbjct  269   PSASIVAAEVAKKLQPPPDLTYPAASNPKEAKLQGDHQETGSSILEELTIEEAKAKGYRV  328

Query  1075  -----eeaaaKGFTKEPGVKKKGR---------LVSCFGNAYGFEVTIVCG  1185
                        G   E  +   GR         L SCFGNAYG E TIVCG
Sbjct  329   ASKERSRRDRDGNESEMSIVTSGRSRRNPADAGLFSCFGNAYGIEFTIVCG  379



>gb|EYU39518.1| hypothetical protein MIMGU_mgv1a007478mg [Erythranthe guttata]
Length=406

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 156/245 (64%), Gaps = 36/245 (15%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            H+LEI+LISAQDL  ++KS RTYA+ WVNPN+K +T  D  G T+PTWN K +FRV   F
Sbjct  30   HLLEISLISAQDLTPITKSMRTYAIAWVNPNRKLTTRTDQHGNTHPTWNDKLTFRVDSQF  89

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L SDD+A+ VEIY+V+WFRDVLVGTV++ +  L++PP+    Q   K  RF+ALQ+RRPS
Sbjct  90   LASDDAAITVEIYTVSWFRDVLVGTVRVLISDLMSPPSGVPLQSLPKNMRFVALQVRRPS  149

Query  691  GDPQGMLNMGVALFDSASRSKP---------------------KYSEVSGSSSDCRDLLE  807
            G PQG+LNMGV+L D++ +S P                        E + +  D +  LE
Sbjct  150  GAPQGILNMGVSLLDTSMQSMPLQRGQPHEEFREEILKKVNALSLEEQNNNEDDEKKELE  209

Query  808  KKMNKFFPDS-ESAV-----EFPAKGGSVCNSSAVNG---------GSEVCSDIGPSASV  942
            K+++ +   S  S V     EFP KGGSV N S VNG         GSE+CSDIGPSAS+
Sbjct  210  KRIHLWRSLSVGSGVNNDDDEFPQKGGSVYNGSMVNGSMCNGSMVNGSELCSDIGPSASI  269

Query  943  VAAEL  957
            VAAE+
Sbjct  270  VAAEM  274



>gb|EYU39778.1| hypothetical protein MIMGU_mgv1a009123mg [Erythranthe guttata]
Length=352

 Score =   212 bits (540),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 140/332 (42%), Positives = 187/332 (56%), Gaps = 44/332 (13%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
              +LEI+LISAQDLA VSKS  TY ++W+ PNKK +T  D+ G  NP WN K  F + D+ 
Sbjct  27    QLLEISLISAQDLAPVSKSMHTYGVVWIRPNKKHTTRTDNHGQRNPKWNDKCVFSL-DNP  85

Query  511   LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
               ++D+ V VEIY+V+WFRDV+VG V++ V  L+ P    +T+  NK  RF+ALQIRRPS
Sbjct  86    PENNDATVTVEIYTVSWFRDVIVGMVRVRVADLITP----LTRTRNKNTRFVALQIRRPS  141

Query  691   GDPQGMLNMGVALFDSAS-RSKPKYS----EVSGSSSDCRDLLEKKMNKFFPDSESA---  846
             G PQG+LNMGVAL D+A+ RS P  S    +    + D  DL     N     S SA   
Sbjct  142   GSPQGILNMGVALSDTAAMRSMPLSSKNRFDEHKQNDDVTDL-----NIVLWRSLSAGDG  196

Query  847   ----VEFPAKGGSVCNSSAVNGGSEVCSDIGPSASVVAAELMNLNppapapaqaakttvp  1014
                 + FP K GS+CN S V+ GS++CSD+GPSASVVAAE+      A     ++     
Sbjct  197   KADDLSFPDKPGSICNGSTVDNGSDLCSDVGPSASVVAAEIN--TTAADQETGSSILEEL  254

Query  1015  vaEKTKSACGESLIleeltaeeaaaKGFTKEPGVKK-------------KGRLVSCFGNA  1155
              AE+ K+   +S+   +     A  +G   E  + +             +GR  SCFGNA
Sbjct  255   TAEEAKAKGYKSVATSKEMWRRAMVEGGGDESELLRNGGGRRRSRRSSDEGRF-SCFGNA  313

Query  1156  YGFEVTIVCGQSKKQKKD*APPANSPRGPLRQ  1251
             YG E TIVCG  K       P +N+ R   R+
Sbjct  314   YGIEFTIVCGAGKN------PSSNNKRSGCRR  339



>ref|XP_004494967.1| PREDICTED: uncharacterized protein LOC101508328 [Cicer arietinum]
Length=373

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/355 (36%), Positives = 179/355 (50%), Gaps = 75/355 (21%)
 Frame = +1

Query  328   HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
             + +LEI++ISAQDL  V+KS + YA+ W++P +K +T ID  G TNPTWN KF FRV D+
Sbjct  10    YQLLEISIISAQDLPPVAKSIKAYAVAWLHPERKLATQIDQVGHTNPTWNEKFVFRVDDE  69

Query  508   FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--RFMALQIR  681
             FL S++S + ++IY+  W RDVL+GTV + V +LL P  R+    GN+K   RF+ALQIR
Sbjct  70    FLNSENSVIMIDIYNSTWIRDVLIGTVGVLVGNLLPPGTRT----GNRKPKLRFVALQIR  125

Query  682   RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKF------------  825
             +PSG PQG+LN+GV + DS  RS P YSE+S S+    DL++    K             
Sbjct  126   KPSGRPQGILNIGVTVLDSTMRSMPLYSELSTSAVGYSDLMDSNKKKISNDNNNDNYSTT  185

Query  826   ---------------------------------FPDSESAVEFPAKGGSVCNSSAVNGGS  906
                                              + +SE +V  P KGG        N   
Sbjct  186   DSKLLTLQRCQSEKNDSTINDYVYHGAGKNGYVYEESEVSVPLPRKGG--------NNEE  237

Query  907   EVCSDIGPSASVVAAELMNLNppapapaqaakttvpvaEKTKSACGESLIleeltaeeaa  1086
              +CSDIGPS SVVAA +                +  V + ++S C E +  +        
Sbjct  238   SLCSDIGPSPSVVAAAIAK-GLYPIPAPPRTMESSTVDDWSESNCSEGMNTKIQRWRHEL  296

Query  1087  aKGFTKE-------------PG--VKKKGRLVSCFGNAYGFEVTIVCGQSKKQKK  1206
                + KE             PG  V +KG+L SCFG A+G E +I CG   ++KK
Sbjct  297   TPAYNKEEYDEIEKRVGGKTPGRPVSRKGKLFSCFGTAFGCEFSISCGGGNQKKK  351



>gb|KCW57324.1| hypothetical protein EUGRSUZ_H00123 [Eucalyptus grandis]
Length=462

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDL +VS+S R+YA++WV+P++K ST +D++G  NPTWN KF FRV ++F
Sbjct  10   QLLEVNIISAQDLRSVSRSMRSYAVVWVHPDRKLSTRVDTRGRRNPTWNDKFVFRVDEEF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV +EIY+V WFRDVLVGT+++ V +LL PP+R      +   RF+ALQ+RRPS
Sbjct  70   LRCDTSAVMIEIYAVHWFRDVLVGTIRLLVSNLLPPPSRPFRHQRHIGMRFVALQVRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            G PQG+LN+GVAL DS+ RS P Y+++S S+   +DLL+++
Sbjct  130  GRPQGILNVGVALLDSSMRSMPLYTQLSASAVGFQDLLQRQ  170



>ref|XP_010025827.1| PREDICTED: uncharacterized protein LOC104416087 [Eucalyptus grandis]
Length=481

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDL +VS+S R+YA++WV+P++K ST +D++G  NPTWN KF FRV ++F
Sbjct  10   QLLEVNIISAQDLRSVSRSMRSYAVVWVHPDRKLSTRVDTRGRRNPTWNDKFVFRVDEEF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV +EIY+V WFRDVLVGT+++ V +LL PP+R      +   RF+ALQ+RRPS
Sbjct  70   LRCDTSAVMIEIYAVHWFRDVLVGTIRLLVSNLLPPPSRPFRHQRHIGMRFVALQVRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            G PQG+LN+GVAL DS+ RS P Y+++S S+   +DLL+++
Sbjct  130  GRPQGILNVGVALLDSSMRSMPLYTQLSASAVGFQDLLQRQ  170



>ref|XP_002521996.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40400.1| conserved hypothetical protein [Ricinus communis]
Length=380

 Score =   189 bits (481),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 132/213 (62%), Gaps = 20/213 (9%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +ISAQDLA VSKS RTYA++WV+P +K +T +D  G TNP WN KF FRV D F
Sbjct  9    QLLEINVISAQDLAPVSKSMRTYAVVWVHPERKLTTRVDQNGHTNPQWNEKFVFRVDDTF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L S+ S++ +EIY+ AW RDV +G+V++ + +L   P      + N K RF+ALQIRRPS
Sbjct  69   LNSETSSIMIEIYAAAWLRDVQIGSVRVLISNLFPSPT-----NNNSKMRFVALQIRRPS  123

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSESAV-------  849
            G PQG+LNMGV L D+  RS P Y+E+S S+    DL++ K +K   D +          
Sbjct  124  GRPQGILNMGVQLLDNTMRSMPLYTELSASAVGFNDLIDAKTSKQTMDEKKGRLRRTQSD  183

Query  850  --------EFPAKGGSVCNSSAVNGGSEVCSDI  924
                    EF  KG +   SS VNGGS V S +
Sbjct  184  HTDLTLTDEFGVKGSAPPRSSVVNGGSLVNSSL  216



>ref|XP_004495587.1| PREDICTED: uncharacterized protein LOC101488962 [Cicer arietinum]
Length=363

 Score =   188 bits (478),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 127/336 (38%), Positives = 174/336 (52%), Gaps = 49/336 (15%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             H+LEI +ISAQDL+ VSKS + YA+ W++P +K +T ID     NPTWN KF FRV DDF
Sbjct  9     HLLEINIISAQDLSPVSKSIKAYAVAWLDPQRKLTTQIDPHAHNNPTWNEKFVFRVDDDF  68

Query  511   LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
             L S+DSA+ +EIYS AW RD+L+GTV +N+ +LL         +   K RF+ALQ+RRPS
Sbjct  69    LQSEDSAIVIEIYSSAWLRDILIGTVAVNLNNLLPR-----LYNRKSKIRFVALQVRRPS  123

Query  691   GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSESAVE------  852
             G PQG+LN+GV L D+  RS P YSE+S S+ +  DL+  K  +   +  +A +      
Sbjct  124   GRPQGILNIGVNLVDATMRSMPMYSELSSSAVEYHDLMNPKKIQNHENENNACDSKLMTL  183

Query  853   ----------------FPAKG----GSVCNSSA------------VNGGSEVCSDIGPSA  936
                             +   G    G V NS +            +N    +CSD+GPS 
Sbjct  184   QRSQSEKNDSTINDYTYNPNGKNGYGGVENSESEIGVPTGKKGVIMNANGSLCSDVGPSP  243

Query  937   SVVAAELMN--LNppapapaqaakttvpvaEKTKSACGESLIleeltaeeaaaKGFTKEP  1110
             SVVAA +       P P P +AA       ++ ++     +            K   K+ 
Sbjct  244   SVVAAAIAKGLYPLPLPVPRKAANPMFDKMDRWRTMELPVVYDHLGKNNCNGEKMGMKQT  303

Query  1111  GV-KKKGR---LVSCFGNAYGFEVTIVCGQSKKQKK  1206
             G   KKG    L SCFG A G E++I CG   +  K
Sbjct  304   GEGNKKGSRQGLFSCFGTALGCEISITCGGGNRNNK  339



>ref|XP_007205372.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
 gb|EMJ06571.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
Length=375

 Score =   188 bits (478),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 136/229 (59%), Gaps = 30/229 (13%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI LISAQDL   SKS RT+A+ WVNP +K +T +D  G TNPTWN KF FRV D+F
Sbjct  11   QLLEINLISAQDLYPASKSMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDDEF  70

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D S + +EIY+ AW RDVL+GT  + V +L              K RFMA+Q+RRPS
Sbjct  71   LKDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL----------QNKSKMRFMAIQLRRPS  120

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE------KKMNKFFPDSESAVE  852
            G PQG+LN+G+ L D+  RS P YSE+S S+    DL+E      K  +  + D +  + 
Sbjct  121  GRPQGILNIGLGLLDNTMRSMPLYSELSSSAVGYWDLMEGKGANQKNHDPNYKDQDKFII  180

Query  853  FP--------AKGGSVCN----SSAVNG--GSEVCSDIGPSASVVAAEL  957
            F         +  GS+ N    SSA  G  G  +CSD+GPS SVVAA +
Sbjct  181  FQRSQSDRTGSDYGSIVNGSELSSAQKGGKGGSICSDVGPSPSVVAAAI  229



>emb|CDP04278.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   188 bits (477),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 147/243 (60%), Gaps = 38/243 (16%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS++ RTYA+ W+NP +K  T +D +G TNPTWN KF FRV + F
Sbjct  7    QLLELNVISAQDLAPVSQNLRTYAVAWMNPERKLRTRVDQQGKTNPTWNDKFVFRVDEKF  66

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L S+ S+V +E+Y++ W RD  VG+V++ + +L+    +++ +  N + RF+ALQIRRPS
Sbjct  67   LDSETSSVMIEVYAIGWLRDTPVGSVRVLISNLI---PQNVRKTNNSQRRFVALQIRRPS  123

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSS--------------------SDCRDLLEK  810
            G PQG+LNMGV L D+  +S P YSE+S S+                    SDC ++ EK
Sbjct  124  GRPQGILNMGVTLLDNNMKSMPLYSELSASAKNGNGNSDQKEEKIKLRRTQSDCTEVKEK  183

Query  811  KMNKFFPDSE------SAVEFPAKGGSVCNSSAVNG--------GSEVCSDIGPSASVVA  948
              NK+  + E      S V  P +GGS  N   +NG        GS   SD+GPS SVVA
Sbjct  184  G-NKWKGNGEGSVYNSSVVNGPTRGGSSLNGPNLNGSEIGVAKNGSMCNSDVGPSPSVVA  242

Query  949  AEL  957
            A +
Sbjct  243  AAV  245



>ref|XP_003535375.1| PREDICTED: uncharacterized protein LOC100795448 [Glycine max]
Length=373

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 127/345 (37%), Positives = 164/345 (48%), Gaps = 57/345 (17%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
              +LE+ +ISAQDLA VSKS + YA+ W+NP +K +T ID  G  NPTWN KF FRV DDF
Sbjct  9     QLLELNIISAQDLAPVSKSIKAYAVAWLNPERKLTTQIDPNGQNNPTWNEKFVFRVDDDF  68

Query  511   LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
             L SD+S + +EIY+ AW RD+L+GTV +   +LL    RSI      K RF+ALQ+RRPS
Sbjct  69    LTSDESLIIIEIYASAWLRDILIGTVTVLASNLL---PRSINTR-KSKIRFVALQVRRPS  124

Query  691   GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSESAVEFPAK--  864
             G PQG+LN+GV L DS  RS P YSE+S S+    D+++ K  K   +  +  +   K  
Sbjct  125   GRPQGILNIGVNLVDSTMRSMPMYSELSASAVGYWDVMDPKKPKLQQNETNNNDSSCKLL  184

Query  865   -----------------------------GGSVCNSSAV-----------NGGSEVCSDI  924
                                          GG  C  S V           N    +CSD+
Sbjct  185   TLQRSQSEKNDSTINDYAYNCSKENGYDEGGDDCQGSEVGMPMAKKGVIMNMNGSLCSDV  244

Query  925   GPSASVVAAE----LMNLNppapapaqaakttvpvaEKTK--SACGESLIleeltaeeaa  1086
             GPS SVVAA     L  L                  E+    +A  + L       +   
Sbjct  245   GPSPSVVAAAIAKGLYPLPMMTAPRKPGNLVFQDWPEERGGLTAVYDHLGKNNENKKVRH  304

Query  1087  aKGFTKEPGVKKK-----GRLVSCFGNAYGFEVTIVCGQSKKQKK  1206
                  K  G K +     G L SCFG A G E +I CG     +K
Sbjct  305   VHSIPKGKGQKHRKGSSDGGLFSCFGTAMGCEFSITCGGGHGNRK  349



>gb|KDP23730.1| hypothetical protein JCGZ_23563 [Jatropha curcas]
Length=375

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/246 (44%), Positives = 138/246 (56%), Gaps = 52/246 (21%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +ISAQDLA VSKS RTYA++WV+P +K +T ID  G TNP WN KF FRV D F
Sbjct  9    QLLEINVISAQDLATVSKSMRTYAVVWVHPERKLTTRIDQNGHTNPQWNEKFVFRVDDAF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L S+ SA+ +EIY+ AW RDV +G+V++ V +L        + + N K RF+ALQIRRPS
Sbjct  69   LDSETSAIMIEIYAAAWLRDVQIGSVRVLVSNLFP------SNNNNSKMRFVALQIRRPS  122

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSE----------  840
            G PQG+LNMGV L D+  RS P Y+E+S S+    DL++ K N      E          
Sbjct  123  GRPQGILNMGVQLLDNTMRSMPLYTELSASAVGFNDLIDAKTNTKQTIEEKTSKLRRTQS  182

Query  841  -------SAVEFPAKG----------GSVCNSSAV----------------NG---GSEV  912
                   +A EF  KG          GS+ NSSAV                NG      +
Sbjct  183  DHTDFTTNADEFGVKGSHTAKSSVINGSLVNSSAVIHTNNKDKDASTGSHGNGSMVNGSL  242

Query  913  CSDIGP  930
            CSD+GP
Sbjct  243  CSDVGP  248



>ref|XP_008441789.1| PREDICTED: uncharacterized protein LOC103485843 [Cucumis melo]
Length=361

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/343 (38%), Positives = 177/343 (52%), Gaps = 59/343 (17%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
              +LE++L+SA DLA+VSK+ RT+A+ W+NP++K +T +D  GLTNPTWN KF F+V DD 
Sbjct  7     QVLELSLLSANDLASVSKTMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFVFKVDDDL  66

Query  511   LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-RFMALQIRRP  687
             L    S V +EIYS A  RD+LVGTV   V +L       I Q   K   RF+ LQ+RRP
Sbjct  67    LEDPTSTVTIEIYSSALLRDILVGTVTEVVSNL-------IPQSSPKSNMRFLTLQVRRP  119

Query  688   SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCR-DLLEKKMNK----------FFPD  834
             SG P+G + +GV L DSA RS P  S++  S+ D   DL E K  K              
Sbjct  120   SGRPKGTVKVGVTLLDSAKRSMPLESDLGSSAVDYDWDLREIKAQKQNFQKNGYTIVMKR  179

Query  835   SESAVEFP-----AKGGSVCNSSAVNGGSE--------------------VCSDIGPSAS  939
             S SA   P       GGSVCN+S+V GG +                    +CSD+GPS S
Sbjct  180   SHSARYDPDALNGKPGGSVCNASSVMGGRDSVRSRSELGTTKKIVNANGSLCSDVGPSPS  239

Query  940   VVAAELM--------NLNppapapaqaakttvpvaEKTKSACGE-SLIleeltaeeaaaK  1092
             VVAA +         ++            +   +  K +    E   I+ +   ++  ++
Sbjct  240   VVAAAIAKGLYPAPDDVGSSILEDWTEKDSIEGLKTKIERWRTELHPIMYDNEIKKLPSR  299

Query  1093  GFTKEPGVKKKGR-----LVSCFGNAYGFEVTIVCGQSKKQKK  1206
              + K+  VKK+ R     L SCFG AYG E +I CG   ++KK
Sbjct  300   SYRKK-SVKKQRRKKGSGLFSCFGTAYGCEFSITCGGPNQKKK  341



>ref|XP_009379739.1| PREDICTED: uncharacterized protein LOC103968123 [Pyrus x bretschneideri]
Length=395

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/272 (42%), Positives = 139/272 (51%), Gaps = 74/272 (27%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI LISAQ+L   SK+ RT+A+ WVNP +K +T +D  G TNPTWN KF FRV DDF
Sbjct  10   QLLEINLISAQELTPASKAMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDDDF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D S + +EIY+ AW RDVL+GT  + V +L              K RFMA+Q+RRPS
Sbjct  70   LRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL----------QNKSKMRFMAIQLRRPS  119

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE--------------KKMNKF-  825
            G PQG+LN+G+ L DS  RS P YSE+S S+    DL+E              K  +KF 
Sbjct  120  GRPQGILNIGLGLLDSTMRSMPLYSELSSSAVGYWDLMEGKTGNHQKSNGPNSKDQDKFI  179

Query  826  -FPDSES----------------------------------AVEFPAKGGSVCNSSAVNG  900
             F  S+S                                  A   P    S CNSS VN 
Sbjct  180  IFQRSQSDRTGSDYGFSKSKPASSICDGVTKSRPPSSICNAAAYKPKHQASFCNSSIVN-  238

Query  901  GSEV-------------CSDIGPSASVVAAEL  957
            GSEV             CSD+GPS SVVAA +
Sbjct  239  GSEVSTVQKKGNVNGSLCSDVGPSPSVVAAAI  270



>ref|XP_008366882.1| PREDICTED: uncharacterized protein LOC103430513 [Malus domestica]
Length=395

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/272 (42%), Positives = 139/272 (51%), Gaps = 74/272 (27%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI LISAQDL   SK+ RT+A+ WVNP +K +T +D  G TNPTWN KF FRV +DF
Sbjct  10   QLLEINLISAQDLTPASKAMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDEDF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D S + +EIY+ AW RDVL+GT  + V +L              K RFMA+Q+RRPS
Sbjct  70   LRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL----------QNKSKMRFMAIQLRRPS  119

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE--------------KKMNKF-  825
            G PQG+LN+G+ L DS  RS P YSE+S S+    DL+E              K  +KF 
Sbjct  120  GRPQGILNIGLGLLDSTMRSMPLYSELSSSAVGYWDLMEGKTGNHQKSNGSNSKDQDKFI  179

Query  826  -FPDSES----------------------------------AVEFPAKGGSVCNSSAVNG  900
             F  S+S                                  A   P    S CNSS VN 
Sbjct  180  IFQRSQSDRTGSDYGFSKSRPASSICDGVTKSRPPSSICNAAAYKPKHQASFCNSSIVN-  238

Query  901  GSEV-------------CSDIGPSASVVAAEL  957
            GSEV             CSD+GPS SVVAA +
Sbjct  239  GSEVSTVQKKGNVNGSLCSDVGPSPSVVAAAI  270



>ref|XP_009343786.1| PREDICTED: uncharacterized protein LOC103935702 [Pyrus x bretschneideri]
Length=402

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 136/270 (50%), Gaps = 71/270 (26%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI LISAQDL   SK+ RT+A+ WVNP +K +T  D  G TNPTWN KF FRV DDF
Sbjct  10   QLLEINLISAQDLTPASKAMRTFAVAWVNPKRKLTTRFDQTGHTNPTWNEKFVFRVDDDF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D S + +EIY+ AW RDVL+GT  + V +L              K RFMA+Q+RRPS
Sbjct  70   LRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL----------QNKSKMRFMAIQLRRPS  119

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE-------------KKMNKF--  825
            G PQG+LN+G+ L DS  RS P YSE+S S+    DL+E             K  +KF  
Sbjct  120  GRPQGILNIGLGLLDSTMRSMPLYSELSSSAVGYWDLMEGKAGNQKSSGLNSKDQDKFVI  179

Query  826  FPDSES----------------------------------AVEFPAKGGSVCNSSAVNGG  903
            F  S+S                                  A   P    S CNSS VNG 
Sbjct  180  FQRSQSDRTGSDSGFSKSRPASSICDGVTKIRPSNSTCNAAAYKPKTQASFCNSSIVNGS  239

Query  904  S------------EVCSDIGPSASVVAAEL  957
                          +CSD+GPS SVVAA +
Sbjct  240  ELSTEQKKGNVNGSLCSDVGPSPSVVAAAI  269



>ref|XP_008370760.1| PREDICTED: uncharacterized protein LOC103434221 [Malus domestica]
 ref|XP_008370902.1| PREDICTED: uncharacterized protein LOC103434347 [Malus domestica]
Length=402

 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 136/270 (50%), Gaps = 71/270 (26%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI LISAQDL   SK+ RT+A+ WVNP +K +T  D  G TNPTWN KF FRV DDF
Sbjct  10   QLLEINLISAQDLTPASKAMRTFAVAWVNPKRKLTTRFDQTGHTNPTWNEKFVFRVDDDF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D S + +EIY+ AW RDVL+GT  + V +L              K RFMA+Q+RRPS
Sbjct  70   LRHDTSKIMIEIYASAWLRDVLIGTAAVVVNNL----------QNKSKMRFMAIQLRRPS  119

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE-------------KKMNKF--  825
            G PQG+LN+G+ L DS  RS P YSE+S S+    DL+E             K  +KF  
Sbjct  120  GRPQGILNIGLGLLDSTMRSMPLYSELSSSAVGYWDLMEGKTGNQKSSGLNSKDQDKFVI  179

Query  826  FPDSES----------------------------------AVEFPAKGGSVCNSSAVNGG  903
            F  S+S                                  A   P    S CNSS VNG 
Sbjct  180  FQRSQSDRTGSDSGFSKSRPASSICDGVTKIRPSNSTCNAAAYKPKTQASFCNSSIVNGS  239

Query  904  S------------EVCSDIGPSASVVAAEL  957
                          +CSD+GPS SVVAA +
Sbjct  240  ELSTGQKKGNVNGSLCSDVGPSPSVVAAAI  269



>gb|KHN31488.1| hypothetical protein glysoja_035595, partial [Glycine soja]
Length=241

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 137/248 (55%), Gaps = 47/248 (19%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LEI +ISAQDLA VSKS R YA+ W++P +K +T +D +G TNPTWN KF FRV D FL
Sbjct  1    LLEINVISAQDLAQVSKSVRGYAVAWLHPERKLATQVDQEGHTNPTWNEKFVFRVDDSFL  60

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPSG  693
             SD+S + +EIYS AW R VL+GTV + + +LL PP R        K RF+ALQIRRPSG
Sbjct  61   NSDNSVIMIEIYSHAWLRHVLIGTVAVQLTNLL-PPNRK------PKLRFVALQIRRPSG  113

Query  694  DPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL-------------EKKMNKFFPD  834
             PQG+LN+GV L DS  RS P YSE+S S+    D++             +   +   P 
Sbjct  114  RPQGILNIGVNLLDSTMRSMPLYSELSSSTVGYWDIMESSKKKKKSEEDDDNTHHHHSPL  173

Query  835  SESAVEFP----AKGGSVCNSSAVNGGSE-----------------------VCSDIGPS  933
              S +        K  S  N  A +G ++                       + SD+GPS
Sbjct  174  DSSLLTLQRCQSEKNDSTVNDYAYHGNAKHYGYDGQDSDVGMRKGAVFNEGSLISDVGPS  233

Query  934  ASVVAAEL  957
             SVVAA +
Sbjct  234  PSVVAAAI  241



>ref|XP_006356117.1| PREDICTED: uncharacterized protein LOC102592369 [Solanum tuberosum]
Length=482

 Score =   183 bits (465),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 118/161 (73%), Gaps = 1/161 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +ISAQDL  +SK  +TYA  WV+P +K +T +D +G  NPTWN KF FRV D+F
Sbjct  16   QLLEINIISAQDLEPMSKKMKTYAAAWVHPTRKLATGVDVEGGHNPTWNDKFVFRVDDEF  75

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D+SAV++EIYSV WFRD LVGTV++ V +L+ PP R+  +  +   RF+ALQ+RRPS
Sbjct  76   LRHDNSAVHIEIYSVHWFRDTLVGTVRVLVGNLI-PPIRTHLRTHHHGMRFIALQVRRPS  134

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            G PQG+LN+GV+L DS+ RS P Y ++S S+   RDL+E +
Sbjct  135  GRPQGILNIGVSLLDSSMRSMPLYRQMSTSAVAYRDLMEDR  175



>ref|XP_011077059.1| PREDICTED: uncharacterized protein LOC105161156 [Sesamum indicum]
Length=397

 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 122/165 (74%), Gaps = 4/165 (2%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            + +LE+ +ISAQDLA+VS++ RTYA  W+NPN+K  T +D++GL NPTWN KF FRV D 
Sbjct  6    YQLLELAIISAQDLASVSRNLRTYATTWINPNRKLKTRVDNQGLNNPTWNDKFIFRVDDK  65

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRP  687
            FL S  S+V +EIY+  W RD  VG+V + + +L+ P   S+ Q+G+ + RF+ALQIRRP
Sbjct  66   FLNSATSSVMIEIYAQGWLRDTPVGSVSVLISNLIPP---SVRQEGSSR-RFVALQIRRP  121

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNK  822
            SG PQG+LNMGV+L D+  +S P Y++++ S+   RDL+++K+ K
Sbjct  122  SGRPQGILNMGVSLLDNTMKSMPLYADLNASAVGVRDLMDEKLCK  166



>gb|EYU43768.1| hypothetical protein MIMGU_mgv1a006114mg [Erythranthe guttata]
Length=456

 Score =   182 bits (463),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 118/165 (72%), Gaps = 2/165 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +ISAQDL  VS+  RTYA  W++ ++K S+ +D++G TNPTWN KF FRV D+F
Sbjct  8    QLLEINIISAQDLEPVSRKMRTYATAWMHQSRKLSSCVDNEGKTNPTWNDKFVFRVDDEF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKK--ERFMALQIRR  684
            L  D SA+ +EIY+  WFRDVLVGTV++ V +L+ PP R+  Q  +     RF+ALQ+RR
Sbjct  68   LRQDTSAIMIEIYATHWFRDVLVGTVRVLVGNLIPPPTRTHQQTNHYTGGMRFVALQVRR  127

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN  819
            PSG PQG+LN+GVAL DS+ RS P Y ++S S+   RDL++   N
Sbjct  128  PSGRPQGILNIGVALLDSSMRSMPLYRQLSMSAVGFRDLMDGPQN  172



>ref|XP_004152866.1| PREDICTED: uncharacterized protein LOC101218582 [Cucumis sativus]
 gb|KGN61292.1| hypothetical protein Csa_2G076000 [Cucumis sativus]
Length=360

 Score =   179 bits (455),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 128/347 (37%), Positives = 178/347 (51%), Gaps = 68/347 (20%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
              +LE++L+SA DLA+VSK+ RT+A+ W+NP++K +T +D  GLTNPTWN KF F+V DD 
Sbjct  7     QVLELSLLSANDLASVSKTMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFVFKVDDDL  66

Query  511   LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-RFMALQIRRP  687
             L    S V +EIYS A  RD+LVGTV   V +L       I Q  +K   RF+ LQ+RRP
Sbjct  67    LEDPTSTVTIEIYSSALLRDILVGTVTEVVSNL-------IPQSSSKSNMRFLTLQVRRP  119

Query  688   SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCR-DLLEKKMNK--------------  822
             SG P+G + +GV L DSA RS P  S++  S+ D   DL E K  K              
Sbjct  120   SGRPKGTVKVGVTLLDSAKRSMPLESDLGSSAVDYDWDLSEIKAQKQNFQKNGYRIVMKR  179

Query  823   -----FFPDSESAVEFPAK-GGSVCNSSAVNGGSE--------------------VCSDI  924
                  + PD+     F  K  GSVCN+++V GG E                    +CSD+
Sbjct  180   SHSERYDPDA-----FNGKPSGSVCNTNSVIGGRESVRSKSELGTTKKIVNANGSLCSDV  234

Query  925   GPSASVVAAELM--------NLNppapapaqaakttvpvaEKTKSACGESLIleeltaee  1080
             GPS SVVAA +         ++            +   +  K +    E   + E   ++
Sbjct  235   GPSPSVVAAAIAKGLYPAPDDVGSSILEDWTEKDSIEGLKTKIERWRTELHPMYESEIKK  294

Query  1081  aaaKGFTKEPGVKKKGR-----LVSCFGNAYGFEVTIVCGQSKKQKK  1206
               ++ + K+  VKK+ R     L SCFG AYG E +I CG   ++KK
Sbjct  295   LPSRSYRKK-SVKKQRRKKGSGLFSCFGTAYGCEFSITCGGPNQKKK  340



>ref|XP_004155136.1| PREDICTED: uncharacterized protein LOC101227028 [Cucumis sativus]
Length=360

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 127/347 (37%), Positives = 178/347 (51%), Gaps = 68/347 (20%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
              +LE++L+SA DLA+VSK+ RT+A+ W+NP++K +T +D  GLTNPTWN KF F+V DD 
Sbjct  7     QVLELSLLSANDLASVSKTMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFVFKVDDDL  66

Query  511   LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-RFMALQIRRP  687
             L    S V +EIYS A  RD+L+GTV   V +L       I Q  +K   RF+ LQ+RRP
Sbjct  67    LEDPTSTVTIEIYSSALLRDILIGTVTEVVSNL-------IPQSSSKSNMRFLTLQVRRP  119

Query  688   SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCR-DLLEKKMNK--------------  822
             SG P+G + +GV L DSA RS P  S++  S+ D   DL E K  K              
Sbjct  120   SGRPKGTVKVGVTLLDSAKRSMPLESDLGSSAVDYDWDLSEIKAQKQNFQKNGYRIVMKR  179

Query  823   -----FFPDSESAVEFPAK-GGSVCNSSAVNGGSE--------------------VCSDI  924
                  + PD+     F  K  GSVCN+++V GG E                    +CSD+
Sbjct  180   SHSERYDPDA-----FNGKPSGSVCNTNSVIGGRESVRSKSELGTTKKIVNANGSLCSDV  234

Query  925   GPSASVVAAELM--------NLNppapapaqaakttvpvaEKTKSACGESLIleeltaee  1080
             GPS SVVAA +         ++            +   +  K +    E   + E   ++
Sbjct  235   GPSPSVVAAAIAKGLYPAPDDVGSSILEDWTEKDSIEGLKTKIERWRTELHPMYESEIKK  294

Query  1081  aaaKGFTKEPGVKKKGR-----LVSCFGNAYGFEVTIVCGQSKKQKK  1206
               ++ + K+  VKK+ R     L SCFG AYG E +I CG   ++KK
Sbjct  295   LPSRSYRKK-SVKKQRRKKGSGLFSCFGTAYGCEFSITCGGPNQKKK  340



>ref|XP_008218351.1| PREDICTED: uncharacterized protein LOC103318712 [Prunus mume]
Length=417

 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 141/273 (52%), Gaps = 74/273 (27%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI LISAQDL   SKS RT+A+ WVNP +K +T +D  G TNPTWN KF FRV D+F
Sbjct  11   QLLEINLISAQDLYPASKSMRTFAVAWVNPKRKLTTRVDQNGHTNPTWNEKFVFRVDDEF  70

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D S + +EIY+ AW RDVL+GT  + V +L              K RFMA+Q+RRPS
Sbjct  71   LKDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL----------QNKSKMRFMAIQLRRPS  120

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE-------------KKMNKF--  825
            G PQG+LN+G+ L D+  RS P YSE+S S+    DL+E             K  +KF  
Sbjct  121  GRPQGILNIGLGLLDNTMRSMPLYSELSSSAVGYWDLMEGKGANQKNHDPNYKDQDKFII  180

Query  826  FPDSE-----------------------------SAVEFPAKGG---------SVCNSSA  891
            F  S+                             S++   A GG         S CNSS 
Sbjct  181  FQRSQSDRTGSDYGFSKSRPASSVCDGLSKSKASSSICNAATGGFSKTTKPQGSFCNSSI  240

Query  892  VNG-----------GSEVCSDIGPSASVVAAEL  957
            VNG           G  +CSD+GPS SVVAA +
Sbjct  241  VNGSELSSAQKGGKGGSICSDVGPSPSVVAAAI  273



>gb|KDO41882.1| hypothetical protein CISIN_1g041258mg [Citrus sinensis]
Length=510

 Score =   182 bits (461),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 113/149 (76%), Gaps = 1/149 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+S RTYA+ WV+PN+K ST +D+ G  NPTWN KF FRV +DF
Sbjct  10   QLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNK-KERFMALQIRRP  687
            L +D SAV +EI+++ WFRD+ VGTV++ V +L+ PP RS+         RF+ALQ+RRP
Sbjct  70   LHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRRP  129

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVS  774
            SG PQG+LN+GVAL DS+ RS P Y+++S
Sbjct  130  SGRPQGILNIGVALLDSSMRSMPLYTQLS  158



>ref|XP_006489752.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
Length=510

 Score =   182 bits (461),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 113/149 (76%), Gaps = 1/149 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+S RTYA+ WV+PN+K ST +D+ G  NPTWN KF FRV +DF
Sbjct  10   QLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNK-KERFMALQIRRP  687
            L +D SAV +EI+++ WFRD+ VGTV++ V +L+ PP RS+         RF+ALQ+RRP
Sbjct  70   LHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRRP  129

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVS  774
            SG PQG+LN+GVAL DS+ RS P Y+++S
Sbjct  130  SGRPQGILNIGVALLDSSMRSMPLYTQLS  158



>ref|XP_008388740.1| PREDICTED: uncharacterized protein LOC103451084 [Malus domestica]
Length=395

 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 138/272 (51%), Gaps = 74/272 (27%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI LISAQDL   SK+ RT+A+ WVNP +K +T +D  G TNPTWN KF FRV +DF
Sbjct  10   QLLEINLISAQDLTPASKAMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDEDF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D S + +EIY+ AW RDVL+GT  + V +L              K RFMA+Q+RRPS
Sbjct  70   LRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL----------QNKSKMRFMAIQLRRPS  119

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE--------------KKMNKF-  825
            G P G+LN+G+ L DS  RS P YSE+S S+    DL+E              K  +KF 
Sbjct  120  GRPXGILNIGLGLLDSTMRSMPLYSELSSSAVGYWDLMEGKTGNHQKSNGSNSKDQDKFI  179

Query  826  -FPDSES----------------------------------AVEFPAKGGSVCNSSAVNG  900
             F  S+S                                  A   P    S CNSS VN 
Sbjct  180  IFQRSQSDRTGSDYGFSKSRPASSICDGVTKSRPPSSICNAAAYKPKHQASFCNSSIVN-  238

Query  901  GSEV-------------CSDIGPSASVVAAEL  957
            GSEV             CSD+GPS SVVAA +
Sbjct  239  GSEVSTVQKKGNVNGSLCSDVGPSPSVVAAAI  270



>ref|XP_004173200.1| PREDICTED: uncharacterized LOC101215059 [Cucumis sativus]
Length=533

 Score =   182 bits (461),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+S RTYA+ WV+P++K ST +D+ G  NPTWN KF FRV D+F
Sbjct  8    QLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVDDEF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPAR--SITQDGNKKERFMALQIRR  684
            L SD SAV +EIY++ WF+D+ VGTV+I V +L+  P R    +Q      RF+ALQ+RR
Sbjct  68   LHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVGMRFVALQVRR  127

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            PSG PQG+LN+GVAL  S+ RS P YS++S S+   R+L+
Sbjct  128  PSGRPQGILNIGVALLHSSMRSMPLYSQLSTSAIGYRNLM  167



>ref|XP_004147189.1| PREDICTED: uncharacterized protein LOC101215059 [Cucumis sativus]
 gb|KGN61560.1| hypothetical protein Csa_2G171820 [Cucumis sativus]
Length=561

 Score =   182 bits (461),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+S RTYA+ WV+P++K ST +D+ G  NPTWN KF FRV D+F
Sbjct  8    QLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVDDEF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPAR--SITQDGNKKERFMALQIRR  684
            L SD SAV +EIY++ WF+D+ VGTV+I V +L+  P R    +Q      RF+ALQ+RR
Sbjct  68   LHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVGMRFVALQVRR  127

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            PSG PQG+LN+GVAL  S+ RS P YS++S S+   R+L+
Sbjct  128  PSGRPQGILNIGVALLHSSMRSMPLYSQLSTSAIGYRNLM  167



>ref|XP_008460692.1| PREDICTED: uncharacterized protein LOC103499460 [Cucumis melo]
Length=561

 Score =   182 bits (461),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+S RTYA+ WV+P++K ST +D+ G  NPTWN KF FRV D+F
Sbjct  8    QLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVDDEF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPAR--SITQDGNKKERFMALQIRR  684
            L SD SAV +EIY++ WF+D+ VGTV+I V +L+  P R    +Q      RF+ALQ+RR
Sbjct  68   LHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVGMRFVALQVRR  127

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            PSG PQG+LN+GVAL  S+ RS P YS++S S+   R+L+
Sbjct  128  PSGRPQGILNIGVALLHSSMRSMPLYSQLSTSAIGYRNLM  167



>gb|KEH24577.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=389

 Score =   178 bits (452),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 104/253 (41%), Positives = 143/253 (57%), Gaps = 47/253 (19%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            + +LEI +ISAQDL+ V+KS + YA+ W++P +K +T ID  G TNPTWN KF FRV ++
Sbjct  10   YQLLEINIISAQDLSGVAKSVKAYAVAWLHPERKLATQIDQVGHTNPTWNEKFVFRVDNE  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--RFMALQIR  681
            FL S+ S + +EIY+ AW RD+L+GTV + V +LL     ++T  GN+K   RF+ LQIR
Sbjct  70   FLNSESSVIMIEIYNSAWLRDILIGTVVVLVNNLLP----TVTLSGNRKPKLRFVGLQIR  125

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNK-------------  822
            RPSG PQG+LN+GV L DS  RS P YSE+S S+    D+++   NK             
Sbjct  126  RPSGRPQGILNIGVTLLDSTMRSMPLYSELSTSAVGYWDMMDSNSNKRKVNNNYNDNNSI  185

Query  823  FFPDSESAVEFP----AKGGSVCNSSAVNG----------------------GSE--VCS  918
               DS+  +        K  S  N    +G                      G+E  +CS
Sbjct  186  VTDDSKMMLTLQRCQSEKNDSTINDYTYHGAGKNNYNGYEESEASMPLPRKRGNEESLCS  245

Query  919  DIGPSASVVAAEL  957
            D+GPS SVVAA +
Sbjct  246  DVGPSPSVVAAAI  258



>ref|XP_007226487.1| hypothetical protein PRUPE_ppa026634mg [Prunus persica]
 gb|EMJ27686.1| hypothetical protein PRUPE_ppa026634mg [Prunus persica]
Length=492

 Score =   180 bits (457),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA +S+S RTYA+ WV+P++K ST +D++G  NPTWN KF FRV +DF
Sbjct  10   QLLELNVISAQDLAPISRSMRTYAIAWVHPDRKLSTRVDTQGHNNPTWNDKFVFRVDEDF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV +EIY++ WF+DV VGTV++ V +L+  PA+    + +   RF+ALQ+RRPS
Sbjct  70   LHEDTSAVMIEIYALHWFKDVHVGTVRVLVGNLIPTPAKPHHHNPHLGMRFVALQVRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            G PQG+LN+GVAL  S+ RS P YS++S S+   + L+
Sbjct  130  GRPQGILNIGVALLHSSMRSMPLYSQLSTSAVGYKTLM  167



>ref|XP_008224037.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103323799 
[Prunus mume]
Length=516

 Score =   180 bits (457),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA +S+S RTYA+ WV+P++K ST +D++G +NPTWN KF FRV +DF
Sbjct  10   QLLELNVISAQDLAPISRSMRTYAIAWVHPDRKLSTRVDTQGHSNPTWNDKFVFRVDEDF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV +EIY++ WF+DV VGTV++ V +L+  PA+    +     RF+ALQ+RRPS
Sbjct  70   LHEDTSAVMIEIYALHWFKDVHVGTVRVLVGNLIPTPAKPHHHNPQLGMRFVALQVRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            G PQG+LN+GVAL  S+ RS P YS++S S+   + L+
Sbjct  130  GRPQGILNIGVALLHSSMRSMPLYSQLSTSAVGYKTLM  167



>ref|XP_002314508.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF00679.1| C2 domain-containing family protein [Populus trichocarpa]
Length=460

 Score =   179 bits (455),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDL  VS+  +TYA+ WV+P+++ ST +DS+G  NPTWN KF FRV D F
Sbjct  10   QLLELNVISAQDLVKVSRKMKTYAVAWVHPDRRLSTRVDSEGCNNPTWNDKFVFRVDDRF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV +EIY++ WFRD+ +GTV++ V +L+ PP            RF+ALQ+RRPS
Sbjct  70   LHGDTSAVMIEIYALHWFRDIHIGTVRVIVGNLIPPPRPHHHNQFQLGMRFVALQVRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL-EKKMNKFFPDSE  840
            G PQG+LN+GVAL DS+ RS P YS++S S+   R L+ E ++N    DS+
Sbjct  130  GRPQGILNIGVALLDSSMRSMPLYSQISVSAVGYRQLMGEGELNHHKDDSD  180



>ref|XP_006577748.1| PREDICTED: uncharacterized protein LOC102667983 [Glycine max]
Length=373

 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 112/159 (70%), Gaps = 7/159 (4%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            + +LEI +ISAQDLA VSKS R YA+ W++P +K +T +D +G TNPTWN KF FRV D 
Sbjct  8    YQLLEINVISAQDLAQVSKSVRGYAVAWLHPERKLATQVDQEGHTNPTWNEKFVFRVDDS  67

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRP  687
            FL SD+S + +EIYS AW R VL+GTV + + +LL PP R        K RF+ALQIRRP
Sbjct  68   FLNSDNSVIMIEIYSHAWLRHVLIGTVAVQLTNLL-PPNR------KPKLRFVALQIRRP  120

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            SG PQG+LN+GV L DS  RS P YSE+S S+    D++
Sbjct  121  SGRPQGILNIGVNLLDSTMRSMPLYSELSSSTVGYWDIM  159



>ref|XP_004304780.1| PREDICTED: uncharacterized protein LOC101296310 [Fragaria vesca 
subsp. vesca]
Length=457

 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 109/159 (69%), Gaps = 10/159 (6%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI LISAQDL A SKS RT+A+ WVNP +K +T +D  G TNPTWN KF FRVG+DF
Sbjct  40   QLLEINLISAQDLTAASKSMRTFAVAWVNPKRKLTTRVDQNGHTNPTWNEKFVFRVGEDF  99

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D S + +EIY+ AW RDVLVGT  I V +L            N K RF+A+Q+RRPS
Sbjct  100  LKDDTSKIMIEIYASAWLRDVLVGTAAIVVSNL----------QNNSKMRFVAIQLRRPS  149

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE  807
            G PQG+LN+G+ L D+  RS P YSE+S S+   RD+++
Sbjct  150  GRPQGILNVGLGLLDNTMRSMPLYSELSTSAVGYRDIMD  188



>ref|XP_011077131.1| PREDICTED: uncharacterized protein LOC105161211 [Sesamum indicum]
Length=377

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 161/327 (49%), Gaps = 53/327 (16%)
 Frame = +1

Query  340   EITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFLGS  519
             +++LISAQDL+ V KS RTYA+ W+NPN+K +T  D +G T+PTWN KFSFRV    L S
Sbjct  35    DVSLISAQDLSPVCKSMRTYAVAWINPNRKLTTRTDQQGHTHPTWNEKFSFRVDTKSLIS  94

Query  520   DDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPSGDP  699
             ++SA+ VEIY+V+WFRDVLVGTV++ +  LLAPP+    Q+  +  RF+ALQ+RRPSG P
Sbjct  95    ENSAMTVEIYTVSWFRDVLVGTVRVLISDLLAPPSGIPLQNLPRSTRFIALQVRRPSGAP  154

Query  700   QGMLNMGVALFDSASRSKP-----------------------KYSEVSGSSSDCRDLLEK  810
             QG+LNMGV+L D+  RS P                       +  +      D +  LE+
Sbjct  155   QGILNMGVSLLDTTMRSMPLNPIADNFHDEIQKKAGAVSLQQELPQYDEDGEDEKKELER  214

Query  811   KMNKFFPDS----ESAVEFPAKGGSVCNSSAVNGGSEVCSDIGPSASVVAAELMNLNppa  978
             K+  +   S     +  +F  K GSV + S +NG       + P   V  A  + L    
Sbjct  215   KIQLWRSLSVGSEMNTDDFALKPGSVIDGSIINGS------LPPPLPVKPATQIRLEIND  268

Query  979   papaqaakttvpvaEKTKSACGESLIleeltaeeaaaKGFT--------KEPGVKKK---  1125
                +   +       K K   G              + G T         E    K+   
Sbjct  269   DTSSSILEELTIEEAKAK---GYRTRTSRERWRREVSDGHTDLESCDDDSELSTNKRHSR  325

Query  1126  ----GRLVSCFGNAYGFEVTIVCGQSK  1194
                 G L SC    YG E TIVCG SK
Sbjct  326   RNSDGGLFSCL--VYGIEFTIVCGASK  350



>ref|XP_003590980.1| hypothetical protein MTR_1g080360 [Medicago truncatula]
 gb|AES61231.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=375

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/250 (41%), Positives = 137/250 (55%), Gaps = 52/250 (21%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +ISAQDLA VSKS + YA+ W+NP +K +T  D  G  NPTWN KF FRV DDF
Sbjct  9    QLLEINVISAQDLAPVSKSIKAYAVAWLNPERKLTTQADPHGHNNPTWNEKFVFRVDDDF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L S++S + +EIY+ AW RDVL+GTV +++ +LL    +S       K RF+ALQ+RRPS
Sbjct  69   LLSEESVIMIEIYASAWLRDVLIGTVAVHLNNLLPRNRKS-------KIRFVALQVRRPS  121

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE----------------KKM--  816
            G PQG+LN+GV + D+  RS P YSE+S S+ +  D+ +                K M  
Sbjct  122  GRPQGILNIGVNVVDATMRSMPMYSELSSSAVEYYDITKPNKQNQNYDNNSNCDAKHMMT  181

Query  817  -----------------------NKFFPDSESAVEFPAKGGSVCNSSAVNGGSEVCSDIG  927
                                   N +  + ES +  P     V     VN    +CSD+G
Sbjct  182  LQRSQSEKNDSTINDYVYNPNGKNGYGGECESEISVPTGKKGVI----VNANGSLCSDVG  237

Query  928  PSASVVAAEL  957
            PS SVVAA +
Sbjct  238  PSPSVVAAAI  247



>ref|XP_006420366.1| hypothetical protein CICLE_v10006849mg [Citrus clementina]
 gb|ESR33606.1| hypothetical protein CICLE_v10006849mg [Citrus clementina]
Length=497

 Score =   179 bits (453),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+S R YA+ WV+PN+K ST +D+ G  NPTWN KF FRV +DF
Sbjct  10   QLLELNIISAQDLAPVSRSMRAYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNK-KERFMALQIRRP  687
            L +D SAV +EI+++ WFRD+ VGTV++ V +L+ PP RS+         RF+ALQ+RRP
Sbjct  70   LHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRRP  129

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVS  774
            SG PQG+LN+GVAL DS+ RS P Y+ +S
Sbjct  130  SGRPQGILNIGVALLDSSMRSMPLYTALS  158



>ref|XP_004234051.1| PREDICTED: uncharacterized protein LOC101265801 [Solanum lycopersicum]
Length=485

 Score =   178 bits (452),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +ISAQDL  +SK  +TYA  WV+P +K +T +D  G  NPTWN KF FRV ++F
Sbjct  16   QLLEINIISAQDLEPMSKKLKTYAAAWVHPTRKLATGVDVNGGHNPTWNDKFVFRVDEEF  75

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  ++SAV++EIYSV WFRD LVGTV++ V +L+ PP R+  +  +   RF+ALQIRRPS
Sbjct  76   LRHENSAVHIEIYSVHWFRDSLVGTVRVLVGNLI-PPIRTHLRTHHHGMRFVALQIRRPS  134

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            G PQG+LN+GV+L DS+ RS P Y ++S S+   RDL+E +
Sbjct  135  GRPQGILNIGVSLLDSSMRSMPLYRQMSTSAVAYRDLMEDR  175



>ref|XP_011041447.1| PREDICTED: uncharacterized protein LOC105137420 [Populus euphratica]
Length=459

 Score =   177 bits (450),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 119/170 (70%), Gaps = 1/170 (1%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LE+ +ISAQDL  VS+  +TYA+ WV+P+++ ST + S+G  NPTWN KF FRV D FL
Sbjct  11   LLELNVISAQDLVKVSRKMKTYAVAWVHPDRRLSTRVTSEGCNNPTWNDKFVFRVDDRFL  70

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPSG  693
              D SAV +EIY++ WFRD+ +GTV++ V +L+ PP            RF+ALQ+RRPSG
Sbjct  71   HGDTSAVMIEIYALHWFRDIHIGTVRVIVGNLIPPPRPHHHNQFQLGMRFVALQVRRPSG  130

Query  694  DPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL-EKKMNKFFPDSE  840
             PQG+LN+GVAL DS+ RS P YS++S S+   R L+ E+++N    DS+
Sbjct  131  RPQGILNIGVALLDSSMRSMPLYSQISVSAVGYRQLMGEEELNHHKDDSD  180



>ref|XP_010105208.1| hypothetical protein L484_011265 [Morus notabilis]
 gb|EXC04073.1| hypothetical protein L484_011265 [Morus notabilis]
Length=589

 Score =   179 bits (455),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 119/166 (72%), Gaps = 8/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+S RTYA+ WV+P++K ST +D+ G TNPTWN KF FRV +DF
Sbjct  8    QLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTYGHTNPTWNDKFVFRVDEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPP-ARSITQDGNKKE-------RFM  666
            L +D SA+ +EIY++ WF+DV VGTV+I V +L+ PP A S    G+          RF+
Sbjct  68   LHTDTSAIMIEIYALHWFKDVHVGTVRILVGNLIPPPRAGSSFGHGHSHNNYNQLGMRFV  127

Query  667  ALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            ALQ+RRPSG PQG+LN+GVA+  SA RS P YS +S S+   R+L+
Sbjct  128  ALQVRRPSGRPQGILNIGVAILHSAMRSMPLYSHLSNSAVGYRELM  173



>emb|CAN83108.1| hypothetical protein VITISV_026570 [Vitis vinifera]
Length=494

 Score =   177 bits (450),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 114/160 (71%), Gaps = 5/160 (3%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI LISAQDLA V +S RTYA+ WV+P++K ST IDS G  +PTWN KF FRV D+F
Sbjct  8    QLLEINLISAQDLAPVGRSMRTYAIAWVHPDRKLSTRIDSTGHNSPTWNDKFVFRVDDEF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPAR--SITQDGNKKERFMALQIRR  684
            L +D SAV ++IYS  WFRD  VGTV+I V +L+ P  R    TQ G    RFMALQ+RR
Sbjct  68   LRADTSAVMIDIYSQHWFRDYHVGTVRILVGNLIPPSVRPGHRTQMG---MRFMALQVRR  124

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
             SG PQG+LN+GVAL DS+ RS P YS++S S+    DL+
Sbjct  125  SSGRPQGLLNIGVALLDSSMRSMPLYSQLSASAVGFHDLV  164



>ref|XP_002282144.1| PREDICTED: uncharacterized protein LOC100256206 [Vitis vinifera]
Length=494

 Score =   177 bits (450),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 114/160 (71%), Gaps = 5/160 (3%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI LISAQDLA V +S RTYA+ WV+P++K ST IDS G  +PTWN KF FRV D+F
Sbjct  8    QLLEINLISAQDLAPVGRSMRTYAIAWVHPDRKLSTRIDSTGHNSPTWNDKFVFRVDDEF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPAR--SITQDGNKKERFMALQIRR  684
            L +D SAV ++IYS  WFRD  VGTV+I V +L+ P  R    TQ G    RFMALQ+RR
Sbjct  68   LRADTSAVMIDIYSQHWFRDYHVGTVRILVGNLIPPSVRPGHRTQMG---MRFMALQVRR  124

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
             SG PQG+LN+GVAL DS+ RS P YS++S S+    DL+
Sbjct  125  SSGRPQGLLNIGVALLDSSMRSMPLYSQLSASAVGFHDLV  164



>ref|XP_011073723.1| PREDICTED: uncharacterized protein LOC105158612 [Sesamum indicum]
Length=505

 Score =   177 bits (450),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 113/160 (71%), Gaps = 1/160 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +IS QDL  V++  RTYA  WV+PN+K S+ +D +G  NPTWN KF FRV ++F
Sbjct  9    QLLEINIISGQDLEPVARKMRTYAKAWVHPNRKLSSCVDKEGNNNPTWNDKFVFRVEEEF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKK-ERFMALQIRRP  687
            L  D SAV +EIYS  W RDVLVGTV++ V +L+ PP R+   + +    RF+ALQ+RRP
Sbjct  69   LREDSSAVMIEIYSAHWLRDVLVGTVRVLVGNLIPPPVRTHQNNSHYMGMRFVALQVRRP  128

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE  807
            SG PQG+LN+GVAL D + RS P Y ++S S+   RDL++
Sbjct  129  SGRPQGILNIGVALLDGSLRSMPLYRQLSSSAVGYRDLMQ  168



>ref|XP_002319115.2| hypothetical protein POPTR_0013s04590g, partial [Populus trichocarpa]
 gb|EEE95038.2| hypothetical protein POPTR_0013s04590g, partial [Populus trichocarpa]
Length=383

 Score =   174 bits (442),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 127/212 (60%), Gaps = 20/212 (9%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +IS QDLA VSKS RTYA++WV+P +K ST +D  G TNP WN KF FRV D F
Sbjct  9    QLLEINVISGQDLAPVSKSMRTYAIVWVHPGRKLSTKVDQNGHTNPQWNEKFVFRVDDTF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            + +++S++ +E+Y+ AW RDV +G+V + + +L        + + N K RF+ALQ+RRPS
Sbjct  69   INAENSSIMIEVYAAAWLRDVQIGSVNVLISNLFP------SHNNNNKMRFVALQVRRPS  122

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE------------KKMNKFFPD  834
            G PQG+LN+GV L D+  RS P Y+E+S S+    DL++             K+ +   D
Sbjct  123  GRPQGILNLGVQLLDTTMRSMPLYTELSVSAVGFDDLIDAKTIGQSLEEKSAKLRRTQSD  182

Query  835  SESAVEFPAKGGSVCNSSAVNGGSEVCSDIGP  930
                      G      S +NG   +CSD+GP
Sbjct  183  QTDQTISDKSGIKESGVSMINGS--LCSDVGP  212



>ref|XP_004297932.1| PREDICTED: uncharacterized protein LOC101311957 [Fragaria vesca 
subsp. vesca]
Length=519

 Score =   177 bits (449),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 114/158 (72%), Gaps = 0/158 (0%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+S RTYA+ WV+P++K ST +D+ G  NPTWN KF FRV +DF
Sbjct  8    QLLELNVISAQDLAPVSRSMRTYAIAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVDEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV +EIY++ WF+DV VGT+++ V +L+  PA+          RF+ALQ+RRPS
Sbjct  68   LHEDTSAVMIEIYALHWFKDVHVGTIRVLVGNLIQTPAKPHHHHPQLGMRFVALQVRRPS  127

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            G PQG+LN+GVAL  S+ RS P YS+++ S+   + L+
Sbjct  128  GRPQGILNIGVALLHSSMRSMPLYSQLNSSAVGYKQLM  165



>ref|XP_009804994.1| PREDICTED: uncharacterized protein DDB_G0292186-like [Nicotiana 
sylvestris]
Length=526

 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 113/160 (71%), Gaps = 0/160 (0%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +ISAQDL   SK  +TYA  WV+P +K +T +D +G  NPTWN KF FRV ++F
Sbjct  14   QLLEINIISAQDLEPTSKKMKTYATAWVHPTRKLTTGVDVEGGNNPTWNDKFVFRVDEEF  73

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV++EI+SV WFRD LVGTV++ V++L+ P       + +   RF+ALQIRRPS
Sbjct  74   LRQDTSAVHIEIFSVHWFRDSLVGTVRVLVRNLIPPIRAHGHHNHHLGMRFVALQIRRPS  133

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEK  810
            G PQG+LN+GVAL D + RS P Y ++S S+   RDL+E+
Sbjct  134  GRPQGILNIGVALLDGSMRSMPLYRQMSTSAVGYRDLMEE  173



>ref|XP_002311697.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE89064.2| C2 domain-containing family protein [Populus trichocarpa]
Length=492

 Score =   176 bits (445),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+  +TYA+ W++P++K ST IDS+G  NPTWN KF FRV D F
Sbjct  10   QLLELNVISAQDLAKVSRKMKTYAVAWIHPDRKLSTRIDSEGRNNPTWNDKFVFRVDDRF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV +EIY++ WFRD+ VGTV++ V +L+ PP            RF+ALQ+RRPS
Sbjct  70   LHGDTSAVMIEIYALHWFRDIHVGTVRVIVGNLIPPPDPHHHNQFQIGMRFVALQVRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGS  780
            G PQG+LN+GVAL DS+ RS P YS++S +
Sbjct  130  GRPQGILNIGVALLDSSMRSMPLYSQLSSA  159



>ref|XP_009604695.1| PREDICTED: uncharacterized protein LOC104099416 [Nicotiana tomentosiformis]
Length=545

 Score =   176 bits (447),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 117/174 (67%), Gaps = 3/174 (2%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDL  VSK  +TYA  WV+P +K +T +D++G  NPTWN KF FRV ++F
Sbjct  12   QLLEVNIISAQDLEPVSKKMKTYATAWVHPTRKLTTGVDTEGGNNPTWNDKFVFRVDEEF  71

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV ++IYSV WFRD LVG+V++ V +L+ PP R +    +   RF+ALQIRRPS
Sbjct  72   LRQDTSAVQIDIYSVHWFRDSLVGSVRVLVGNLIPPPTR-LQHQHHIGMRFVALQIRRPS  130

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSESAVE  852
            G PQG+LN+GV L     RS P Y ++S S+   RDL+E+  +   P+    +E
Sbjct  131  GRPQGILNIGVTLLGGTMRSMPLYRQLSMSAVGYRDLMEE--DAHLPNYNEKIE  182



>ref|XP_009795412.1| PREDICTED: uncharacterized protein LOC104242110 [Nicotiana sylvestris]
Length=545

 Score =   176 bits (445),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 117/174 (67%), Gaps = 3/174 (2%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDL  VSK  +TYA  WV+P +K +T +D++G  NPTWN KF FRV ++F
Sbjct  12   QLLEVNIISAQDLEPVSKRMKTYATAWVHPTRKLTTGVDTEGGNNPTWNDKFVFRVDEEF  71

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV ++IYSV WFRD LVG+V++ V +L+ PP R +    +   RF+ALQIRRPS
Sbjct  72   LRQDTSAVQIDIYSVHWFRDSLVGSVRVLVGNLIPPPTR-LQHQHHIGMRFVALQIRRPS  130

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSESAVE  852
            G PQG+LN+GV L     RS P Y ++S S+   RDL+E+  +   P+    +E
Sbjct  131  GRPQGILNIGVTLLGGTMRSMPLYRQLSMSAVGYRDLMEE--DAHLPNYNEKIE  182



>ref|XP_009357966.1| PREDICTED: uncharacterized protein LOC103948651 [Pyrus x bretschneideri]
Length=533

 Score =   175 bits (444),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 112/158 (71%), Gaps = 0/158 (0%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA +S+S RTYA+ WV+P++K ST +D+ G  NPTWN KF FRV +DF
Sbjct  10   QLLELNVISAQDLAPISRSMRTYAVAWVHPDRKLSTRVDTLGHNNPTWNDKFVFRVDEDF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV +EIY + WF+DV VGTV++ V +L+  P R          RF+ALQ+RRPS
Sbjct  70   LHDDTSAVMIEIYVLHWFKDVHVGTVRVLVGNLIQTPMRPHHHHPQVGMRFVALQVRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            G PQG+LN+GVAL  S+ RS P YS++S S+   + L+
Sbjct  130  GRPQGILNIGVALLHSSMRSMPLYSQLSTSAVGYKTLM  167



>ref|XP_002528347.1| hypothetical protein RCOM_1217340 [Ricinus communis]
 gb|EEF34019.1| hypothetical protein RCOM_1217340 [Ricinus communis]
Length=472

 Score =   174 bits (441),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 117/164 (71%), Gaps = 5/164 (3%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LE+ +IS QDLA VS+  RTYA+ WV+P++K ST +D++G  NPTWN KF FRV D+FL
Sbjct  12   LLELNVISGQDLAQVSRKMRTYAVAWVHPDRKLSTRVDAQGHNNPTWNDKFVFRVDDEFL  71

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKK----ERFMALQIR  681
              + SA+ +EIY++ WFRDV VGTV++ V +L+ PPA+   Q          RF+ALQ+R
Sbjct  72   YGETSAIMIEIYALHWFRDVHVGTVRVIVGNLI-PPAQLYRQHQQHHVQLGMRFVALQVR  130

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            R SG PQG+LN+GVAL D++ RS P YS++S S+   R L+ +K
Sbjct  131  RHSGRPQGILNIGVALLDTSMRSMPLYSQISASAVGYRHLMGEK  174



>ref|XP_011029742.1| PREDICTED: uncharacterized protein LOC105129399 [Populus euphratica]
Length=492

 Score =   174 bits (441),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+  +TYA+ W++P++K ST IDS+G  NPTWN KF FRV D F
Sbjct  10   QLLELNVISAQDLAKVSRKMKTYAVAWIHPDRKLSTRIDSEGRNNPTWNDKFVFRVDDRF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV +EIY++ WFRD+ VGTV++ V +L+ PP            RF+ALQ+RRPS
Sbjct  70   LHGDTSAVMIEIYALHWFRDIHVGTVRVIVGNLIPPPDPHHHNQFQIGMRFVALQVRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGS  780
            G P+G+LN+GVAL DS+ RS P YS++S +
Sbjct  130  GRPKGILNIGVALLDSSMRSMPLYSQLSSA  159



>ref|XP_010667096.1| PREDICTED: uncharacterized protein LOC104884184 [Beta vulgaris 
subsp. vulgaris]
Length=464

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 114/158 (72%), Gaps = 1/158 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +IS QD+  VS+S +TYA+ WV+P++K +T +DS G TNPTWN KF FRV + F
Sbjct  5    QLLEINIISGQDIHKVSRSMKTYAVAWVHPDRKLTTRVDSNGGTNPTWNDKFVFRVDNRF  64

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L SD SA+ +EIY++ WFRDV VGTV++ V +L+ P  RS  Q+ +   RF+ALQ+RRPS
Sbjct  65   LQSDTSAIMIEIYALHWFRDVHVGTVRVLVGNLIPPQTRSFNQN-HIGMRFVALQVRRPS  123

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            G PQG+LN+GV + DS  RS P Y ++S S+   + L+
Sbjct  124  GRPQGILNVGVTVLDSTMRSMPLYRQLSTSAVGYQTLM  161



>ref|XP_008340669.1| PREDICTED: uncharacterized protein LOC103403599 [Malus domestica]
Length=533

 Score =   174 bits (441),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 111/158 (70%), Gaps = 0/158 (0%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA +S+S RTYA+ WV+P++K ST +D+ G  NPTWN KF FRV +DF
Sbjct  10   QLLELNVISAQDLAPISRSMRTYAIAWVHPDRKLSTRVDTSGHNNPTWNDKFVFRVDEDF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV +EIY + WF+DV VGTV++ V +L+    R          RF+ALQ+RRPS
Sbjct  70   LHDDTSAVMIEIYVLHWFKDVHVGTVRVLVGNLIQTSTRPYHHHPQVGMRFVALQVRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            G PQG+LN+GVAL  S+ RS P YS++S S+   + L+
Sbjct  130  GRPQGILNIGVALLHSSMRSMPLYSQLSTSAVGYKTLM  167



>emb|CDO99320.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   173 bits (439),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 112/158 (71%), Gaps = 1/158 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +ISAQDL  VS+  +TYA  WVN ++K S+ +DS G  NPTWN KF FRV +DF
Sbjct  9    QLLEINVISAQDLEPVSRKMKTYATAWVNSSRKLSSRVDSGGHVNPTWNDKFVFRVDEDF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV +EI++V WF+D LVGTV++ V +L+ P  RS     +   RF+ALQ+RRPS
Sbjct  69   LRQDTSAVQIEIHAVHWFKDTLVGTVRVLVGNLIPPLLRS-RHHNHIGMRFVALQVRRPS  127

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            G PQG+LN+GV L DS+ RS P Y+++S S+   RDL+
Sbjct  128  GRPQGILNIGVTLLDSSMRSMPLYTQLSASAVGYRDLM  165



>emb|CBI23723.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   172 bits (435),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 112/163 (69%), Gaps = 13/163 (8%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI LISAQDLA V +S RTYA+ WV+P++K ST IDS G  +PTWN KF FRV D+F
Sbjct  8    QLLEINLISAQDLAPVGRSMRTYAIAWVHPDRKLSTRIDSTGHNSPTWNDKFVFRVDDEF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPAR--SITQDGNKKERFMALQIRR  684
            L +D SAV ++IYS  WFRD  VGTV+I V +L+ P  R    TQ G    RFMALQ+RR
Sbjct  68   LRADTSAVMIDIYSQHWFRDYHVGTVRILVGNLIPPSVRPGHRTQMG---MRFMALQVRR  124

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
             SG PQG+LN+GVAL DS+ RS P Y  V        DLL+KK
Sbjct  125  SSGRPQGLLNIGVALLDSSMRSMPLYKFV--------DLLKKK  159



>ref|XP_003590735.1| RNA-binding protein 12B [Medicago truncatula]
 gb|AES60986.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=682

 Score =   174 bits (442),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LE+ +ISAQDLA++ ++ RTYA+ WV+P++K ST +D++G TNPTWN KF FRV ++FL
Sbjct  10   LLELNVISAQDLASLGRNMRTYAVAWVHPDRKLSTRVDTQGHTNPTWNDKFVFRVDEEFL  69

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQD-GNKKERFMALQIRRPS  690
             SD SA+ VE+Y++ WF+D+ VGTV++ V +L+ PP R    D      RF+ALQ+RRPS
Sbjct  70   YSDTSAIMVEVYALHWFKDIHVGTVRVLVGNLIPPPTRPFHNDRAPMGMRFVALQVRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            G PQG+LN+GV + DS+ RS P Y+ ++ S+   R L+ +K
Sbjct  130  GRPQGILNIGVTVLDSSMRSMPLYT-LNASAVGYRHLMGEK  169



>ref|XP_004247791.2| PREDICTED: uncharacterized protein LOC101245204 [Solanum lycopersicum]
Length=521

 Score =   173 bits (438),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 116/162 (72%), Gaps = 2/162 (1%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LEI +ISAQDL  VSK  +TYA +WV+P +K +T++D +G  NPTWN KF FRV ++FL
Sbjct  9    LLEINIISAQDLEPVSKKMKTYATVWVHPTRKLTTAVDIEGGNNPTWNDKFVFRVDEEFL  68

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSI--TQDGNKKERFMALQIRRP  687
              D SAV +EI+   WF+D LVG+V++ V +L+  P+R+       N   RF+ALQ+RRP
Sbjct  69   RQDTSAVQIEIHCGHWFKDSLVGSVRVLVGNLIPSPSRTHHNHHPHNLGMRFVALQVRRP  128

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            SG PQG+LN+GVAL DS  RS P Y+E++ S+   RDL+E++
Sbjct  129  SGRPQGILNIGVALLDSTMRSMPLYTELNKSAVGYRDLMEEE  170



>ref|XP_004495257.1| PREDICTED: proteoglycan 4-like [Cicer arietinum]
Length=713

 Score =   174 bits (442),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 119/162 (73%), Gaps = 2/162 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA+V ++ RTYA+ WV+P++K ST +D++G TNPTWN KF FRV D+F
Sbjct  9    QLLELNVISAQDLASVGRNMRTYAVAWVHPDRKLSTRVDTQGHTNPTWNDKFVFRVDDEF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNK-KERFMALQIRRP  687
            L +D SA  +EIY++ WF+D+ VGTV++ V +L+ PP+R   +D      RF+ALQ+RRP
Sbjct  69   LYNDTSAFMIEIYALHWFKDIHVGTVRVLVGNLITPPSRPFHKDNAPIGMRFVALQVRRP  128

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            SG PQG+LN+GV + DS+ RS P Y+  + S+   R L+ +K
Sbjct  129  SGRPQGILNIGVTVLDSSMRSMPLYTH-NASAVGYRHLMGEK  169



>ref|XP_006342681.1| PREDICTED: uncharacterized protein LOC102596842 [Solanum tuberosum]
Length=528

 Score =   172 bits (437),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 111/160 (69%), Gaps = 0/160 (0%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDL  +SK  +TYA  WV+P +K +T +D++G  NPTWN KF FRV D+F
Sbjct  12   QLLEVNIISAQDLEPISKKMKTYASAWVHPTRKLTTGVDTEGGNNPTWNDKFVFRVDDEF  71

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SA+ ++I+SV WFRD LVG+V++ V +L+ PP R   Q  +   RF+ALQIRRPS
Sbjct  72   LQQDTSAIQIDIFSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQQHHIGMRFVALQIRRPS  131

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEK  810
            G PQG+LN+GV L     RS   Y ++S S+   RDL+++
Sbjct  132  GRPQGILNIGVTLLGGTMRSMQLYRQLSMSAVGYRDLMDE  171



>ref|XP_007132355.1| hypothetical protein PHAVU_011G087700g [Phaseolus vulgaris]
 gb|ESW04349.1| hypothetical protein PHAVU_011G087700g [Phaseolus vulgaris]
Length=385

 Score =   169 bits (429),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 104/252 (41%), Positives = 137/252 (54%), Gaps = 49/252 (19%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VSKS + YA+ W++P +K +T I   G  NPTWN KF FR+ +DF
Sbjct  9    QLLEVNIISAQDLAPVSKSIKAYAVAWLDPERKLTTQIHPDGHNNPTWNEKFVFRIDEDF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L +DDS V +EIY+  W RD+LVGTV + + +LL    RSI +    K RF+ALQ+RRPS
Sbjct  69   LYADDSVVMIEIYASTWLRDILVGTVGVLLSNLL---PRSINR--TSKIRFIALQVRRPS  123

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSESAVEFPA---  861
            G PQG+LN+GV L D   RS P YSE+  S+    D   KK  K  P+   + EF +   
Sbjct  124  GHPQGILNIGVNLVDPTRRSMPMYSELGSSTVGDWDADPKK-QKPMPNQTPSNEFNSAKC  182

Query  862  ------KGGSVCNSSAVNG-----------------GSE-----------------VCSD  921
                  +  S  N S +N                  GSE                 +CSD
Sbjct  183  KLLTLQRSASEKNDSTINDYTYKNYPKGYEDNEDCQGSELGMPTTKKGMIMNLNGSLCSD  242

Query  922  IGPSASVVAAEL  957
            +GPS SVVA  +
Sbjct  243  VGPSPSVVATAI  254



>ref|XP_007132356.1| hypothetical protein PHAVU_011G087800g [Phaseolus vulgaris]
 gb|ESW04350.1| hypothetical protein PHAVU_011G087800g [Phaseolus vulgaris]
Length=385

 Score =   169 bits (429),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 105/256 (41%), Positives = 139/256 (54%), Gaps = 57/256 (22%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VSKS + YA+ W++P +K +T ID  G  NPTWN KF FR+ +DF
Sbjct  9    QLLEVNIISAQDLAPVSKSIKAYAVAWLDPERKLTTQIDPDGHNNPTWNEKFVFRIDEDF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L +DDS V +EIY+  W RD+LVGTV + + +LL    RSI +    K RF+ALQ+RRPS
Sbjct  69   LYADDSVVMIEIYASTWLRDILVGTVGVLLSNLL---PRSINR--TSKIRFIALQVRRPS  123

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGS-------------------------SSDCR  795
            G PQG+LN+GV L D   RS P YSE+  S                         S++C+
Sbjct  124  GHPQGILNIGVNLVDPTRRSMPMYSELGSSTVGDWDADPKKQKPMSNQTPSNEFNSANCK  183

Query  796  -----------------DLLEKKMNKFFPDSE----SAVEFP-AKGGSVCNSSAVNGGSE  909
                             D       K + D+E    S +  P  K G V N   +NG   
Sbjct  184  LLTLQRSASEKNDSTINDYTYNNYPKGYEDNEDCQGSELGMPTTKKGMVMN---LNG--S  238

Query  910  VCSDIGPSASVVAAEL  957
            +CSD+GPS SVVA  +
Sbjct  239  LCSDVGPSPSVVATAI  254



>ref|XP_011036375.1| PREDICTED: uncharacterized protein LOC105133911 [Populus euphratica]
Length=382

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 133/236 (56%), Gaps = 45/236 (19%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LEI +IS QDLA VSKS RTYA+ WV+P +K ST +D  G  NP WN KF FRV D F+
Sbjct  28   LLEINVISGQDLAPVSKSMRTYAVAWVHPGRKLSTKVDQNGHINPQWNEKFVFRVDDTFI  87

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPSG  693
             +++S++ +EIY+ AW RDV +G+V++ + +L        + + N K RF+ALQ+RRPSG
Sbjct  88   NAENSSIMIEIYAAAWLRDVQIGSVRVLISNLFP------SNNNNNKMRFVALQVRRPSG  141

Query  694  DPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN------------------  819
             PQG+LNMGV + DS  RS P Y+E+S S+    DL+  K N                  
Sbjct  142  RPQGILNMGVQVLDSTMRSMPLYTELSASAVGFNDLINAKTNGKDLEEKGAKLRRTQSDR  201

Query  820  -KFFPDSESAVE---FPAKGGSVCNSSA---------------VNGGSEVCSDIGP  930
                   ES ++     + GGS+ NSS                VNG   +CSD+GP
Sbjct  202  TDLTTTDESGLKEGGVRSLGGSLINSSVAKPSVKDNGNGNGSMVNG--SLCSDVGP  255



>ref|XP_004253020.1| PREDICTED: uncharacterized protein LOC101244358 [Solanum lycopersicum]
Length=534

 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 110/160 (69%), Gaps = 0/160 (0%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDL  +SK  +TYA  WV+P +K +T +D+ G  NPTWN KF FRV D+F
Sbjct  12   QLLEVNIISAQDLEPISKKMKTYASAWVHPTRKLTTGVDNDGGNNPTWNDKFVFRVDDEF  71

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV ++I+SV WFRD LVG+V++ V +L+ PP R   Q  +   RF+ALQIRRPS
Sbjct  72   LQQDTSAVQIDIFSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQQHHIGMRFVALQIRRPS  131

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEK  810
            G PQG+LN+GV L     RS   Y ++S S+   RDL+++
Sbjct  132  GRPQGILNIGVTLLGGTMRSMQLYRQLSMSAVGYRDLMDE  171



>ref|XP_002325345.1| hypothetical protein POPTR_0019s03780g [Populus trichocarpa]
 gb|EEE99726.1| hypothetical protein POPTR_0019s03780g [Populus trichocarpa]
Length=364

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 133/237 (56%), Gaps = 45/237 (19%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +IS QDLA VSKS RTYA+ WV+P +K ST +D  G  NP WN KF FRV D F
Sbjct  9    QLLEINVISGQDLAPVSKSMRTYAVAWVHPGRKLSTKVDQNGHINPQWNEKFVFRVDDTF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            + +++S++ +EIY+ AW RDV +G+V++ + +L        + + N K RF+ALQ+RRPS
Sbjct  69   INAENSSIMIEIYAAAWLRDVQIGSVRVLISNLFP------SNNNNNKMRFVALQVRRPS  122

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN-----------------  819
            G PQG+LNMGV + DS  RS P Y+E+S S+    DL+  K N                 
Sbjct  123  GRPQGILNMGVQVLDSTMRSMPLYTELSASAVGFNDLINAKTNGKDLEEKGAKLRRTQSD  182

Query  820  --KFFPDSESAVE---FPAKGGSVCNSSA---------------VNGGSEVCSDIGP  930
                    ES ++     + GGS+ NSS                VNG   +CSD+GP
Sbjct  183  RTDHTTTDESGLKEGGVRSLGGSLINSSVAKPSVKDNGNGNGSMVNG--SLCSDVGP  237



>ref|XP_011038591.1| PREDICTED: uncharacterized protein LOC105135426 [Populus euphratica]
Length=367

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/242 (38%), Positives = 134/242 (55%), Gaps = 50/242 (21%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +IS QDLA VSKS RTYA++WV+P +K ST +D  G TNP WN KF FRV + F
Sbjct  9    QLLEINVISGQDLAPVSKSMRTYAIVWVHPGRKLSTKVDQNGHTNPQWNEKFVFRVDEIF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            + +++S++ +E+Y+ AW RDV +G+V + + +L        + + N K  F+ALQ+RRPS
Sbjct  69   INAENSSIMIEVYAAAWLRDVQIGSVNVLISNLFP------SHNNNNKMHFVALQVRRPS  122

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKM------------------  816
            G PQG+LN+GV L D+  RS P Y+E+S S++   DL++ K                   
Sbjct  123  GRPQGILNLGVQLLDTTMRSMPLYTELSVSAAGFDDLIDAKTIGQSLEEKSAKLRRTQSD  182

Query  817  --NKFFPDSESAVEFPAK--GGSVCNSSAV--------------------NGGSEVCSDI  924
              ++   D     E   +  GGS+ NSS V                    NG   +CSD+
Sbjct  183  QTDQTISDKSGVKESGVRSLGGSLINSSVVKRDNGNGNGNGNGNGNGSLINGS--LCSDV  240

Query  925  GP  930
            GP
Sbjct  241  GP  242



>gb|KCW57325.1| hypothetical protein EUGRSUZ_H00124 [Eucalyptus grandis]
Length=153

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 105/143 (73%), Gaps = 1/143 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            H+LE+ +ISAQDLA VS+  RTYA++WV+P+ K  T +D+ G  +PTWN +F FRV ++F
Sbjct  10   HLLEVDIISAQDLAPVSRYMRTYAVVWVHPDGKLPTRVDACGRCDPTWNDRFVFRVNEEF  69

Query  511  LGSDDSAVNVEIYSV-AWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRP  687
            L  D SAV +EIY+V   F+DV VGTV++ V +    P+RS  ++ +     MALQ+RRP
Sbjct  70   LRRDTSAVMIEIYAVRRLFKDVRVGTVRVLVSNFFPRPSRSFRREQHSGRHVMALQVRRP  129

Query  688  SGDPQGMLNMGVALFDSASRSKP  756
            SG PQG+LN+GVAL DS++RSKP
Sbjct  130  SGRPQGILNVGVALLDSSTRSKP  152



>ref|XP_009621969.1| PREDICTED: uncharacterized protein LOC104113496 [Nicotiana tomentosiformis]
Length=523

 Score =   171 bits (432),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +IS QDL   SK  +TY   W++P +K +T +D +G  NPTWN KF FRV ++F
Sbjct  14   QLLEINIISVQDLEPTSKKMKTYVTAWIHPTQKLTTGVDVEGGNNPTWNDKFVFRVDEEF  73

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNK-KERFMALQIRRP  687
            L  D SAV++EI+SV WFRD L+GTV++ V +L+ PP R+     +    RF+ALQIRRP
Sbjct  74   LRQDTSAVHIEIFSVHWFRDSLIGTVRVLVGNLI-PPIRAYGHHNHHLGMRFVALQIRRP  132

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEK  810
            SG PQG+LN+GVAL D + RS P Y ++S S+   RDL+E+
Sbjct  133  SGRPQGILNIGVALLDGSMRSMPLYRQMSTSAVGYRDLMEE  173



>ref|XP_007035276.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOY06202.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=480

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 117/168 (70%), Gaps = 9/168 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQ-RTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
             +LE+ +ISAQDL  VS+ + RTYA+ WV+P +K ST ID+ G TNPTWN KF FRV D+
Sbjct  11   QLLELNVISAQDLEPVSRRKMRTYAVAWVHPQRKLSTRIDNLGHTNPTWNDKFVFRVDDE  70

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPA-----RSITQDGNKKERFMAL  672
            FL  D SAV +E+Y+V WFRD+ VGTV++ V +L++PP      R   Q G    RF+AL
Sbjct  71   FLHGDTSAVMIELYAVHWFRDIHVGTVRVIVGNLISPPTSRPRHRHEVQIG---MRFVAL  127

Query  673  QIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKM  816
            Q+ RPSG PQG+LN+GVAL DS+ RS P Y ++  S+   R L+ +++
Sbjct  128  QVWRPSGRPQGILNIGVALLDSSMRSMPLYMQMGSSAVGYRHLMGEEI  175



>gb|EPS62035.1| hypothetical protein M569_12761, partial [Genlisea aurea]
Length=167

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 112/162 (69%), Gaps = 7/162 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            H+LEI +ISAQ+L  V K  +TYA  WV+P +K STS+D+ G T+PTWN KF F+V +DF
Sbjct  9    HLLEINVISAQELEPVRKKMQTYATAWVHPQRKLSTSVDNDGNTSPTWNDKFVFKVDEDF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKER----FMALQI  678
            L +D SAV++EI +  WF D++VG+V+I + +L+ P    +  D     R    F+ALQ+
Sbjct  69   LRNDTSAVSIEILAEHWFTDIVVGSVRIIIGNLIPP---HVWTDRRHHHRIGMQFIALQV  125

Query  679  RRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            RRPSG PQG+LN+GVA+ +   RS P Y+++S S+   RDL+
Sbjct  126  RRPSGRPQGILNIGVAVLNGTMRSMPLYTQLSASAFGYRDLM  167



>ref|XP_011091348.1| PREDICTED: uncharacterized protein LOC105171810 [Sesamum indicum]
Length=545

 Score =   169 bits (428),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 113/159 (71%), Gaps = 1/159 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +ISAQDL  VSK  RTYA  W++PN+K S+ +D++G  +PTWN KF F+V ++F
Sbjct  42   QLLEINIISAQDLEPVSKKMRTYATAWLHPNRKLSSCVDAEGNNSPTWNDKFVFKVEEEF  101

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  D SAV +EIY+  W RD LVGTV++ V +L+    R++    +   RF+ALQ+RRPS
Sbjct  102  LRRDTSAVMIEIYAKQWLRDTLVGTVRVLVGNLIPSSTRTLGHH-HFGMRFVALQVRRPS  160

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE  807
            G PQG+LN+GVAL DS+ RS P Y ++S S+   RDL++
Sbjct  161  GRPQGILNIGVALLDSSMRSMPLYRQLSASAVGYRDLMD  199



>gb|KDO53064.1| hypothetical protein CISIN_1g035970mg, partial [Citrus sinensis]
Length=377

 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 116/172 (67%), Gaps = 4/172 (2%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI+++S  DLA VSKS +TY++ WV+P +K +T +D  GL NP+WN KF FRV D F
Sbjct  6    RVLEISIVSGHDLALVSKSMKTYSVAWVDPERKLTTRVDQNGLNNPSWNEKFVFRVDDRF  65

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  + SA+ +EIY+ AW +D L+G+V++ + HL      ++T + +   R++ALQ+RRPS
Sbjct  66   LTDETSAIMIEIYAAAWLKDALIGSVRVLISHLFG----TLTHNSSSSTRYVALQVRRPS  121

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSESA  846
            G PQG+LN+G+ L D+  RS P ++E+ G+ ++  ++     +   P++ +A
Sbjct  122  GRPQGILNLGITLLDNTMRSMPLFAELCGAGANFSEVSSGANDVMKPETTTA  173



>ref|XP_006437469.1| hypothetical protein CICLE_v10033675mg [Citrus clementina]
 ref|XP_006484674.1| PREDICTED: haze protective factor 1-like [Citrus sinensis]
 gb|ESR50709.1| hypothetical protein CICLE_v10033675mg [Citrus clementina]
Length=393

 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 116/172 (67%), Gaps = 4/172 (2%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI+++S  DLA VSKS +TY++ WV+P +K +T +D  GL NP+WN KF FRV D F
Sbjct  6    RVLEISIVSGHDLALVSKSMKTYSVAWVDPERKLTTRVDQNGLNNPSWNEKFVFRVDDRF  65

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  + SA+ +EIY+ AW +D L+G+V++ + HL      ++T + +   R++ALQ+RRPS
Sbjct  66   LTDETSAIMIEIYAAAWLKDALIGSVRVLISHLFG----TLTHNSSSSTRYVALQVRRPS  121

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSESA  846
            G PQG+LN+G+ L D+  RS P ++E+ G+ ++  ++     +   P++ +A
Sbjct  122  GRPQGILNLGITLLDNTMRSMPLFAELCGAGANFSEVSSGANDVMKPETTTA  173



>ref|XP_009767920.1| PREDICTED: uncharacterized protein LOC104218993 [Nicotiana sylvestris]
Length=520

 Score =   167 bits (424),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 116/162 (72%), Gaps = 1/162 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +ISAQDL  +SK  +TYA +WV+P +K +T++D +G  NPTWN KF FRV ++F
Sbjct  8    QLLEINIISAQDLQPISKKMKTYATVWVHPTRKLTTAVDVEGGNNPTWNDKFVFRVDEEF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNK-KERFMALQIRRP  687
            L  D SAV +EI+ V WF+D LVG+V++ V +L+ PP R      +    RF+ALQ+RRP
Sbjct  68   LRQDTSAVQIEIHCVHWFKDSLVGSVRVLVGNLIPPPPRPHHNHHHHFGMRFVALQVRRP  127

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            SG PQG+LN+GVAL DS  RS P Y+E++ S+   RDL+E++
Sbjct  128  SGRPQGILNIGVALLDSTMRSMPLYTELNKSAVGYRDLMEEE  169



>ref|XP_007147205.1| hypothetical protein PHAVU_006G104400g [Phaseolus vulgaris]
 gb|ESW19199.1| hypothetical protein PHAVU_006G104400g [Phaseolus vulgaris]
Length=371

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/248 (40%), Positives = 130/248 (52%), Gaps = 45/248 (18%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            + +LEI ++SAQDL  VSK  R YA+ W++P++K +T +D +G TNPTWN KF FRV D 
Sbjct  7    YQLLEINVMSAQDLPRVSKPVRAYAVGWLHPDRKLTTQVDQEGHTNPTWNEKFVFRVDDQ  66

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRP  687
            FL SDD+ + +EIY+ AW   VL+GTV I V  LL P  R        K RF+A+QIRRP
Sbjct  67   FLDSDDAVITIEIYTQAWLSPVLIGTVGILVSDLL-PTNR------KPKLRFVAVQIRRP  119

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSESAVEF----  855
            SG  QG+LN+GV L DS  RS P YS++S S     D  E + NK     E   E     
Sbjct  120  SGRTQGILNIGVTLLDSTMRSMPLYSDLSSSDGGYYDPTESRKNKHAVTEEDREEHSPSD  179

Query  856  -----------PAKGGSVCNSSAVNG-----------------------GSEVCSDIGPS  933
                         K  S  +  A +G                       G  + SD+GPS
Sbjct  180  TTSLLTLQRYQSEKNDSTIDDYAYHGNAKRYFYDEQDSEVGVRKGGVFNGDSLISDVGPS  239

Query  934  ASVVAAEL  957
             S+VA+ +
Sbjct  240  PSMVASAI  247



>ref|XP_006303752.1| hypothetical protein CARUB_v10011922mg [Capsella rubella]
 gb|EOA36650.1| hypothetical protein CARUB_v10011922mg [Capsella rubella]
Length=600

 Score =   168 bits (426),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 112/165 (68%), Gaps = 8/165 (5%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LE+ +ISAQDLA V++  +TYA+ WV+P +K +T +D  G TNPTWN KF FRV +DFL
Sbjct  10   LLELNIISAQDLAPVARKTKTYAVAWVHPERKLTTRVDYNGGTNPTWNDKFVFRVNEDFL  69

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFMA  669
             +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+A
Sbjct  70   YADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRFVA  129

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RR SG PQG+LN+GV L D + RS P Y+ +  S+   RDLL
Sbjct  130  LQVRRSSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGYRDLL  174



>gb|KFK31057.1| hypothetical protein AALP_AA6G062700 [Arabis alpina]
Length=367

 Score =   164 bits (416),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 111/165 (67%), Gaps = 7/165 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV +DF
Sbjct  8    QLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYSGGANPTWNDKFVFRVSEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-------RFMA  669
            L +D SAV +EIY++ WFRDV VGT+++ + +L+ P  R   +  ++         RF+A
Sbjct  68   LYADTSAVVIEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRFVA  127

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RRPSG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  128  LQVRRPSGRPQGILNIGVGMLDGSMRSMPLYTNMDSSAVGYRDLL  172



>ref|XP_003555498.1| PREDICTED: uncharacterized protein LOC100812185 [Glycine max]
Length=642

 Score =   168 bits (425),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LE+ +ISAQDLA + ++ RTYA+ WV+P++K ST +DS+G TNPTWN KF FRV ++FL
Sbjct  10   LLELNVISAQDLAPLGRNMRTYAVSWVHPDRKLSTRVDSEGHTNPTWNDKFVFRVDEEFL  69

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNK-KERFMALQIRRPS  690
             SD SA+ +EIY++ WF+D+ VGTV++ V +L  PP++    +      RF+ALQ+RRPS
Sbjct  70   YSDTSAIMIEIYALHWFKDIHVGTVRVLVGNLAPPPSKPFHNNRTPLGMRFIALQVRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            G PQG+LN+G  + DS+ RS P Y+  + S+   R L+ +K
Sbjct  130  GRPQGILNIGFTVLDSSMRSMPLYTH-NASAVGYRHLMGEK  169



>ref|XP_010043310.1| PREDICTED: uncharacterized protein LOC104432551 [Eucalyptus grandis]
Length=355

 Score =   163 bits (412),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 124/207 (60%), Gaps = 12/207 (6%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ LISAQDLA VSKS RTYA+ WV+P++K +T +D KG  NP WN KF FRV D  
Sbjct  9    RLLELNLISAQDLAPVSKSMRTYAVAWVHPDRKLTTRVDEKGHANPNWNEKFVFRVNDVS  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L +D   + +EIY++ W R VLVGTV+  +  L+ P  R+ T+  N   RFM LQ+ RPS
Sbjct  69   LETDTCVITIEIYALTWLRVVLVGTVRALLSSLIPPSTRTRTK--NTPMRFMTLQVLRPS  126

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSS-DCRDLLEKKMNKFFPDSE---------  840
            G PQG +N GV+L +S+ RS P  SE+S S + D  +  ++K NK  P ++         
Sbjct  127  GRPQGAINFGVSLINSSMRSMPLNSELSASLAFDSGEEADQKDNKKEPGNDGNKNSQKDA  186

Query  841  SAVEFPAKGGSVCNSSAVNGGSEVCSD  921
            + +          N  + N GS VC+D
Sbjct  187  TKIRLWRSQSERTNDYSYNPGSTVCND  213



>gb|KCW85316.1| hypothetical protein EUGRSUZ_B02156 [Eucalyptus grandis]
Length=352

 Score =   163 bits (412),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 124/207 (60%), Gaps = 12/207 (6%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ LISAQDLA VSKS RTYA+ WV+P++K +T +D KG  NP WN KF FRV D  
Sbjct  9    RLLELNLISAQDLAPVSKSMRTYAVAWVHPDRKLTTRVDEKGHANPNWNEKFVFRVNDVS  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L +D   + +EIY++ W R VLVGTV+  +  L+ P  R+ T+  N   RFM LQ+ RPS
Sbjct  69   LETDTCVITIEIYALTWLRVVLVGTVRALLSSLIPPSTRTRTK--NTPMRFMTLQVLRPS  126

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSS-DCRDLLEKKMNKFFPDSE---------  840
            G PQG +N GV+L +S+ RS P  SE+S S + D  +  ++K NK  P ++         
Sbjct  127  GRPQGAINFGVSLINSSMRSMPLNSELSASLAFDSGEEADQKDNKKEPGNDGNKNSQKDA  186

Query  841  SAVEFPAKGGSVCNSSAVNGGSEVCSD  921
            + +          N  + N GS VC+D
Sbjct  187  TKIRLWRSQSERTNDYSYNPGSTVCND  213



>ref|XP_010522448.1| PREDICTED: uncharacterized protein LOC104801063 [Tarenaya hassleriana]
Length=580

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 112/167 (67%), Gaps = 9/167 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+  +TYA+ WV+  +K +T +D  G +NPTWN KF FRV D+F
Sbjct  8    QLLELNIISAQDLAHVSRKMKTYAIAWVHSERKLTTRVDYSGGSNPTWNDKFVFRVNDEF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE---------RF  663
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   + GN +          RF
Sbjct  68   LYADTSAVMIEIYALHWFRDVHVGTVRVLISNLIPPSHRPGFRTGNNEYRRSTLPPGMRF  127

Query  664  MALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            +ALQ+RR SG PQG+LN+GV L D + RS P Y+ +  S+   RDLL
Sbjct  128  VALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGYRDLL  174



>ref|XP_009590587.1| PREDICTED: ankyrin repeat-containing protein kinase A-like [Nicotiana 
tomentosiformis]
Length=535

 Score =   166 bits (421),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 116/162 (72%), Gaps = 1/162 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +ISAQDL  +SK  +TYA +WV+P +K +T++D +G  NPTWN KF FRV ++F
Sbjct  8    QLLEINIISAQDLQPISKKMKTYATVWVHPTRKLTTAVDVEGGNNPTWNDKFVFRVDEEF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNK-KERFMALQIRRP  687
            L  D SAV +EI+ V WF+D +VG+V++ V +L+ PP R      +    RF+ALQ+RRP
Sbjct  68   LRQDTSAVQIEIHCVHWFKDSVVGSVRVLVGNLIPPPPRPHHNHHHHFGMRFVALQVRRP  127

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            SG PQG+LN+GVAL DS  RS P Y+E++ S+   RDL+E++
Sbjct  128  SGRPQGILNIGVALLDSTMRSMPLYTELNKSAVGYRDLMEEE  169



>ref|XP_003535258.1| PREDICTED: uncharacterized protein LOC100787698 [Glycine max]
Length=657

 Score =   167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LE+ +ISAQDLA VS++ RTYA+ WV+P +K ST +D++G T+PTWN KF FRV ++FL
Sbjct  10   LLELNVISAQDLAPVSRNMRTYAVSWVHPERKLSTRVDTEGHTHPTWNDKFVFRVDEEFL  69

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNK-KERFMALQIRRPS  690
             SD SA+ +EIY++ WF+D+ VGTV++ V +L  PP++    +      RF+ALQ+RRPS
Sbjct  70   YSDTSAIMIEIYALHWFKDIHVGTVRVLVGNLAPPPSKPFHNNRTPLGMRFVALQMRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            G PQG+LN+G  + DS+ RS P Y+  + S+   R L+ +K
Sbjct  130  GRPQGILNIGFTVLDSSMRSMPLYTH-NASAVGYRHLMGEK  169



>ref|XP_010556931.1| PREDICTED: uncharacterized protein LOC104826097 [Tarenaya hassleriana]
Length=585

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 112/167 (67%), Gaps = 9/167 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+  +TYA+ WVN  ++ +T +D  G +NPTWN KF FRV ++F
Sbjct  8    QLLELNIISAQDLAPVSRKMKTYAIAWVNSERRLATRVDYSGGSNPTWNDKFVFRVNEEF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE---------RF  663
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   + GN +          RF
Sbjct  68   LYADTSAVMIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTGNNEYRRSTPPPGMRF  127

Query  664  MALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            +ALQ+RR SG PQG+LN+GV L D + RS P Y+ +  S+   RDLL
Sbjct  128  VALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGYRDLL  174



>ref|XP_010025828.1| PREDICTED: uncharacterized protein LOC104416088 [Eucalyptus grandis]
 gb|KCW57326.1| hypothetical protein EUGRSUZ_H00125 [Eucalyptus grandis]
Length=155

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 103/145 (71%), Gaps = 0/145 (0%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +L+I +ISAQDLA+VS S RTYA+ WV+P++K ST +D++G  NPTWN KF F V  +FL
Sbjct  11   LLKIDIISAQDLASVSHSMRTYAVAWVHPDRKFSTRVDTRGQCNPTWNDKFVFCVDQEFL  70

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPSG  693
              + SAV VEIY+V WFRDVL+GTV++ V +   P +    +      R +ALQ+RRPSG
Sbjct  71   RRETSAVMVEIYAVHWFRDVLIGTVRVLVSNFAPPSSWPFRRKQLIGMRVVALQVRRPSG  130

Query  694  DPQGMLNMGVALFDSASRSKPKYSE  768
             PQG+LN+G  L DS+  SKP Y++
Sbjct  131  RPQGILNVGGTLLDSSMGSKPLYTQ  155



>emb|CDY23753.1| BnaC04g43690D [Brassica napus]
Length=610

 Score =   166 bits (420),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 7/165 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ LISAQDLA VS+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV +DF
Sbjct  8    QLLELNLISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGEANPTWNDKFVFRVSEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-------RFMA  669
            L +D SAV VEIY++ WFRDV VGTV++ + +L+ P  R   +  ++         RF+A
Sbjct  68   LYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRFIA  127

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RRPSG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  128  LQVRRPSGRPQGILNIGVGILDGSMRSLPLYTNMDSSAVGYRDLL  172



>gb|KCW60206.1| hypothetical protein EUGRSUZ_H02915 [Eucalyptus grandis]
Length=452

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA V+++ RTYA+ WV+P++K ST +DS G  +PTWN KF FRV ++F
Sbjct  10   QLLELNIISAQDLAMVARTMRTYAVAWVHPDRKLSTRVDSNGRNSPTWNDKFVFRVDEEF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP-PARSITQDGNKKERFMALQIRRP  687
            L SD S V +EIY+V WF+DVLVG V++ V HL+ P P     Q  +   RF+ALQ+RRP
Sbjct  70   LRSDTSGVMIEIYAVHWFKDVLVGRVRVLVGHLVTPQPHPFRHQQHHVGMRFVALQVRRP  129

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            SG PQG+LN+GVA+ DS+ RS P Y +++ S+   RDL+
Sbjct  130  SGRPQGILNIGVAVLDSSMRSMPLYMQLNASAVGYRDLM  168



>ref|XP_010026783.1| PREDICTED: protein bunched, class 2/F/G isoform-like [Eucalyptus 
grandis]
Length=456

 Score =   164 bits (414),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA V+++ RTYA+ WV+P++K ST +DS G  +PTWN KF FRV ++F
Sbjct  10   QLLELNIISAQDLAMVARTMRTYAVAWVHPDRKLSTRVDSNGRNSPTWNDKFVFRVDEEF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP-PARSITQDGNKKERFMALQIRRP  687
            L SD S V +EIY+V WF+DVLVG V++ V HL+ P P     Q  +   RF+ALQ+RRP
Sbjct  70   LRSDTSGVMIEIYAVHWFKDVLVGRVRVLVGHLVTPQPHPFRHQQHHVGMRFVALQVRRP  129

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            SG PQG+LN+GVA+ DS+ RS P Y +++ S+   RDL+
Sbjct  130  SGRPQGILNIGVAVLDSSMRSMPLYMQLNASAVGYRDLM  168



>ref|XP_006293875.1| hypothetical protein CARUB_v10022860mg [Capsella rubella]
 gb|EOA26773.1| hypothetical protein CARUB_v10022860mg [Capsella rubella]
Length=597

 Score =   165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 111/165 (67%), Gaps = 7/165 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV +DF
Sbjct  8    QLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-------RFMA  669
            L +D SAV VEIY++ WFRDV VGTV++ + +L+ P  R   +  ++         RF+A
Sbjct  68   LYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFVA  127

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RRPSG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  128  LQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGYRDLL  172



>ref|XP_009141305.1| PREDICTED: uncharacterized protein LOC103865261 [Brassica rapa]
Length=611

 Score =   165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 7/165 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ LISAQDLA VS+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV +DF
Sbjct  8    QLLELNLISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-------RFMA  669
            L +D SAV VEIY++ WFRDV VGTV++ + +L+ P  R   +  ++         RF+A
Sbjct  68   LYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRFVA  127

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RRPSG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  128  LQVRRPSGRPQGILNIGVGILDGSMRSLPLYTNMDSSAVGYRDLL  172



>emb|CDY37732.1| BnaA04g19360D [Brassica napus]
Length=611

 Score =   165 bits (418),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 7/165 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ LISAQDLA VS+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV +DF
Sbjct  8    QLLELNLISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-------RFMA  669
            L +D SAV VEIY++ WFRDV VGTV++ + +L+ P  R   +  ++         RF+A
Sbjct  68   LYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRFVA  127

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RRPSG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  128  LQVRRPSGRPQGILNIGVGILDGSMRSLPLYTNMDSSAVGYRDLL  172



>ref|NP_180890.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAB80650.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08815.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=602

 Score =   165 bits (417),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 112/166 (67%), Gaps = 9/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV +DF
Sbjct  8    QLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGGNPTWNDKFVFRVSEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFM  666
            L +D SAV VEIY++ WFRDV VGTV++ + +L+ PP R      N++         RF+
Sbjct  68   LYADTSAVVVEIYALHWFRDVHVGTVRVLISNLI-PPNRRPGYRSNEEYRRTPPPGMRFV  126

Query  667  ALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            ALQ+RRPSG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  127  ALQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGYRDLL  172



>ref|XP_002881275.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57534.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=595

 Score =   164 bits (416),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 111/165 (67%), Gaps = 7/165 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV +DF
Sbjct  8    QLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-------RFMA  669
            L +D SAV VEIY++ WFRDV VGT+++ + +L+ P  R   +  ++         RF+A
Sbjct  68   LYADTSAVVVEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFVA  127

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RRPSG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  128  LQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGYRDLL  172



>ref|XP_006410470.1| hypothetical protein EUTSA_v10016412mg [Eutrema salsugineum]
 gb|ESQ51923.1| hypothetical protein EUTSA_v10016412mg [Eutrema salsugineum]
Length=597

 Score =   164 bits (415),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 111/165 (67%), Gaps = 7/165 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV +DF
Sbjct  8    QLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-------RFMA  669
            L +D SAV VEIY++ WFRDV VGT+++ + +L+ P  R   +  ++         RF+A
Sbjct  68   LYADTSAVVVEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFVA  127

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RRPSG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  128  LQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGYRDLL  172



>ref|XP_010264865.1| PREDICTED: uncharacterized protein LOC104602763 [Nelumbo nucifera]
Length=418

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 109/157 (69%), Gaps = 2/157 (1%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LEI +ISAQDLA V++S  TYA+ WV+P +K ST +D+ G  +PTWN KF FRV D+FL
Sbjct  11   LLEINVISAQDLAPVTRSMHTYAVAWVDPERKLSTCVDTHGHVDPTWNDKFVFRVDDEFL  70

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPSG  693
             SD SAV ++I+++  FRDV VGTV++ V +L   P  S+        RF+ALQ+RRPSG
Sbjct  71   HSDTSAVMIKIFALRPFRDVHVGTVRVLVGNLF--PLSSLRSHQRSGMRFVALQVRRPSG  128

Query  694  DPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
             PQG+LN+G AL D + RS P YS+ + S+   R L+
Sbjct  129  RPQGILNIGAALLDKSMRSMPLYSQPNSSALGYRHLM  165



>ref|XP_010483923.1| PREDICTED: uncharacterized protein LOC104762347 [Camelina sativa]
Length=601

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 8/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA V++  +TYA+ WV+  +K +T +D  G TNPTWN KF FRV ++F
Sbjct  9    QLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEEF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFM  666
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+
Sbjct  69   LYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMRFV  128

Query  667  ALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            ALQ+RR SG PQG+LN+GV L D + RS P Y+ +  S+   RDLL
Sbjct  129  ALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGYRDLL  174



>ref|XP_010469493.1| PREDICTED: uncharacterized protein LOC104749540 [Camelina sativa]
Length=596

 Score =   163 bits (413),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 110/165 (67%), Gaps = 7/165 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA +S+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV +DF
Sbjct  8    QLLELNIISAQDLAPLSRKMKTYAVAWVHSERKLTTRVDYTGGVNPTWNDKFVFRVNEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-------RFMA  669
            L +D SAV VEIY + WFRDV VGTV++ + +L+ P  R   +  ++         RF+A
Sbjct  68   LYADTSAVVVEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFVA  127

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RRPSG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  128  LQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGYRDLL  172



>ref|XP_010413889.1| PREDICTED: uncharacterized protein LOC104700118 [Camelina sativa]
Length=596

 Score =   163 bits (413),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 110/165 (67%), Gaps = 7/165 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA +S+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV +DF
Sbjct  8    QLLELNIISAQDLAPLSRKMKTYAVAWVHSERKLTTRVDYSGGVNPTWNDKFVFRVNEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-------RFMA  669
            L +D SAV VEIY + WFRDV VGTV++ + +L+ P  R   +  ++         RF+A
Sbjct  68   LYADTSAVVVEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFVA  127

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RRPSG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  128  LQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGYRDLL  172



>ref|XP_010475114.1| PREDICTED: uncharacterized protein LOC104754591 [Camelina sativa]
Length=600

 Score =   163 bits (413),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 111/167 (66%), Gaps = 10/167 (6%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA V++  +TYA+ WV+  +K +T +D  G TNPTWN KF FRV ++F
Sbjct  9    QLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEEF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE---------RF  663
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ PP R      N  E         RF
Sbjct  69   LYADTSAVVIEIYALHWFRDVHVGTVRVLISNLI-PPNRRPGYRTNNNEYRRTPPPGMRF  127

Query  664  MALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            +ALQ+RR SG PQG+LN+GV L D + RS P Y+ +  S+   RDLL
Sbjct  128  VALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGYRDLL  174



>ref|XP_010509905.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Camelina 
sativa]
Length=596

 Score =   163 bits (413),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 110/165 (67%), Gaps = 7/165 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA +S+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV +DF
Sbjct  8    QLLELNIISAQDLAPLSRKMKTYAVAWVHSERKLTTRVDYTGGVNPTWNDKFVFRVNEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE-------RFMA  669
            L +D SAV VEIY + WFRDV VGTV++ + +L+ P  R   +  ++         RF+A
Sbjct  68   LYADTSAVVVEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFVA  127

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RRPSG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  128  LQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGYRDLL  172



>ref|NP_171948.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE27711.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=601

 Score =   163 bits (412),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 8/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA V++  +TYA+ WV+  +K +T +D  G TNPTWN KF FRV ++F
Sbjct  9    QLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEEF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFM  666
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+
Sbjct  69   LYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRFV  128

Query  667  ALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            ALQ+RR SG PQG+LN+GV L D + RS P Y+ +  S+   RDLL
Sbjct  129  ALQVRRTSGRPQGILNIGVGLIDGSMRSMPLYTHMDSSAVGYRDLL  174



>ref|XP_010457504.1| PREDICTED: uncharacterized protein LOC104738975 [Camelina sativa]
Length=600

 Score =   163 bits (412),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 8/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA V++  +TYA+ WV+  +K +T +D  G TNPTWN KF FRV ++F
Sbjct  9    QLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEEF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFM  666
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+
Sbjct  69   LYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRFV  128

Query  667  ALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            ALQ+RR SG PQG+LN+GV L D + RS P Y+ +  S+   RDLL
Sbjct  129  ALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGYRDLL  174



>gb|AAB80639.1| Contains similarity to Glycine SRC2 (gb|AB000130) [Arabidopsis 
thaliana]
Length=578

 Score =   162 bits (411),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 111/165 (67%), Gaps = 8/165 (5%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LE+ +ISAQDLA V++  +TYA+ WV+  +K +T +D  G TNPTWN KF FRV ++FL
Sbjct  7    LLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEEFL  66

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFMA  669
             +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+A
Sbjct  67   YADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRFVA  126

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RR SG PQG+LN+GV L D + RS P Y+ +  S+   RDLL
Sbjct  127  LQVRRTSGRPQGILNIGVGLIDGSMRSMPLYTHMDSSAVGYRDLL  171



>ref|XP_010102203.1| hypothetical protein L484_024484 [Morus notabilis]
 gb|EXB93146.1| hypothetical protein L484_024484 [Morus notabilis]
Length=377

 Score =   159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 129/228 (57%), Gaps = 19/228 (8%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ L+SA+DLA VSKS +T+A+ W++ ++K  T  D  G  NP WN KF+FRV DDF
Sbjct  10   RLLELNLLSARDLATVSKSMKTFAVAWIDQDRKLETRNDQTGQNNPAWNEKFAFRVDDDF  69

Query  511  LGSDDSAVNVEIYSVAWFRD-VLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRP  687
            L S+ S + +EI ++    + VLVGTV + V  L    + S  +    K RF+ LQIRRP
Sbjct  70   LVSESSTITIEIRALTRRGNVVLVGTVSVLVASLFPRSSTSFQKRSFSKMRFLTLQIRRP  129

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE-----KKMNKFFPD------  834
             G PQG+L++GVAL D   RS P  S+VS S     D+++     ++  K  P+      
Sbjct  130  CGRPQGVLDVGVALLDGTRRSMPLSSDVSASGYGTTDMMDTRSDKERKRKSLPNMIKLRR  189

Query  835  -------SESAVEFPAKGGSVCNSSAVNGGSEVCSDIGPSASVVAAEL  957
                   SES +  P  G  +  S    G   +CSD+GPS SVVAA +
Sbjct  190  SKSDRSISESCLLKPTNGSLISCSDLGKGKESLCSDVGPSPSVVAAAI  237



>ref|XP_002889512.1| hypothetical protein ARALYDRAFT_470434 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65771.1| hypothetical protein ARALYDRAFT_470434 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   162 bits (411),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 8/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA V++  +TYA+ WV+  +K +T +D  G TNPTWN KF FRV ++F
Sbjct  9    QLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEEF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFM  666
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+
Sbjct  69   LYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRFV  128

Query  667  ALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            ALQ+RR SG PQG+LN+GV L D + RS P Y+ +  S+   RDLL
Sbjct  129  ALQVRRTSGRPQGILNIGVGLIDGSMRSMPLYTHMDSSAVGYRDLL  174



>ref|XP_007144140.1| hypothetical protein PHAVU_007G132000g [Phaseolus vulgaris]
 gb|ESW16134.1| hypothetical protein PHAVU_007G132000g [Phaseolus vulgaris]
Length=736

 Score =   164 bits (414),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LE+ +ISAQDLA VS++ RTYA+ WV+P++K ST +D++G T+PTWN KF FRV D+FL
Sbjct  10   LLELNVISAQDLAPVSRNMRTYAVSWVHPDRKLSTRVDTQGHTHPTWNDKFVFRVDDEFL  69

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNK-KERFMALQIRRPS  690
             SD S++ +EIY++ WF+D+ VGTV++ + +L  PP+R    +      RF A+Q+RRPS
Sbjct  70   CSDTSSIMIEIYALHWFKDIHVGTVRVLIGNLAPPPSRPFHSNRTPLGTRFAAVQVRRPS  129

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            G PQG+LN+G  + D +  S P Y+  + S+   R L+ +K
Sbjct  130  GRPQGILNIGFTVLDGSMHSMPLYTH-NASAVGYRHLMGEK  169



>ref|XP_009143873.1| PREDICTED: uncharacterized protein LOC103867544 [Brassica rapa]
Length=561

 Score =   162 bits (409),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 112/166 (67%), Gaps = 9/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQ+LA VS+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV +DF
Sbjct  8    QLLELNIISAQELAPVSRKMKTYAVAWVHSQRKLTTRVDYTGAANPTWNDKFVFRVSEDF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFM  666
            L +D SAV VEIY++ WFRDV VGT+++ + +L+ PP R      N++         RF+
Sbjct  68   LYADTSAVVVEIYTLHWFRDVHVGTIRVLISNLI-PPNRRPGYRSNEEYRHTPPLGMRFV  126

Query  667  ALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            ALQ+RRPSG PQG+LN+GV + D + RS P Y+ +  S+   +DLL
Sbjct  127  ALQVRRPSGRPQGILNIGVGILDGSMRSLPLYTHMDSSAVGPKDLL  172



>ref|XP_003556915.1| PREDICTED: uncharacterized protein LOC100779058 [Glycine max]
Length=449

 Score =   160 bits (405),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 111/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            + +LE+ +ISAQDLA V +S RTYA+ W++P++K ST +DS+G TNPTWN KF FRV +D
Sbjct  8    YQLLELNVISAQDLAPVGRSMRTYAIAWIDPDRKLSTRVDSQGGTNPTWNDKFVFRVDED  67

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE---RFMALQI  678
            FL  ++S + ++IY++ WFRD+ VG+ ++    L  PP +   Q    K    +FM LQ+
Sbjct  68   FLYDEESVITIDIYALHWFRDIHVGSAQVLSGDLFPPPTQP--QKNTYKSTGMQFMGLQV  125

Query  679  RRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEK  810
            +RPSG P+G+LN+G A+ DS+ RS P Y++ S +     D L K
Sbjct  126  QRPSGRPKGILNIGAAIIDSSMRSMPLYTQNSPAVGYSHDDLNK  169



>ref|XP_006418119.1| hypothetical protein EUTSA_v10007144mg [Eutrema salsugineum]
 gb|ESQ36472.1| hypothetical protein EUTSA_v10007144mg [Eutrema salsugineum]
Length=595

 Score =   162 bits (409),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 110/166 (66%), Gaps = 8/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV ++F
Sbjct  9    QLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNEEF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFM  666
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+
Sbjct  69   LYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRFV  128

Query  667  ALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            ALQ+RR SG PQG+LN+GV L D + RS P Y+ +  S+   RDLL
Sbjct  129  ALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGYRDLL  174



>gb|KFK42792.1| hypothetical protein AALP_AA1G039700 [Arabis alpina]
Length=572

 Score =   161 bits (408),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 110/166 (66%), Gaps = 8/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV ++F
Sbjct  8    QLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNGGPNPTWNDKFVFRVNEEF  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFM  666
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+
Sbjct  68   LYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPDRRPGYRTSNNEYRRTPPQGMRFV  127

Query  667  ALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            ALQ+RR SG PQG+LN+GV L D + RS P Y+ +  S+   RDLL
Sbjct  128  ALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGYRDLL  173



>ref|XP_009119477.1| PREDICTED: uncharacterized protein LOC103844449 [Brassica rapa]
Length=561

 Score =   160 bits (406),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 110/165 (67%), Gaps = 8/165 (5%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LE+ +ISAQDLA VS+  +TYA+ WV+  +K +T +D    TNPTWN KF FRV ++FL
Sbjct  10   LLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNAGTNPTWNDKFVFRVDEEFL  69

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFMA  669
             +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+A
Sbjct  70   YADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYHRTPPQGMRFVA  129

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            LQ+RR SG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  130  LQVRRASGRPQGILNIGVGVLDGSMRSMPLYTHMDSSAVGYRDLL  174



>emb|CDY53195.1| BnaAnng12200D [Brassica napus]
Length=593

 Score =   160 bits (405),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 110/166 (66%), Gaps = 8/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA V++  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV ++F
Sbjct  9    QLLELNIISAQDLAPVARKMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNEEF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFM  666
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+
Sbjct  69   LYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMRFV  128

Query  667  ALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            ALQ+RR SG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  129  ALQVRRTSGRPQGILNIGVGVLDGSMRSMPLYTHMDSSAVGYRDLL  174



>ref|XP_009118638.1| PREDICTED: uncharacterized protein LOC103843645 [Brassica rapa]
Length=593

 Score =   160 bits (404),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 110/166 (66%), Gaps = 8/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA V++  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV ++F
Sbjct  9    QLLELNIISAQDLAPVARKMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNEEF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFM  666
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+
Sbjct  69   LYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMRFV  128

Query  667  ALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            ALQ+RR SG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  129  ALQVRRTSGRPQGILNIGVGVLDGSMRSMPLYTHMDSSAVGYRDLL  174



>emb|CDY59181.1| BnaC08g50140D [Brassica napus]
Length=593

 Score =   160 bits (404),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 110/166 (66%), Gaps = 8/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA V++  +TYA+ WV+  +K +T +D  G  NPTWN KF FRV ++F
Sbjct  9    QLLELNIISAQDLAPVARKMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNEEF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFM  666
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+
Sbjct  69   LYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRFV  128

Query  667  ALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            ALQ+RR SG PQG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  129  ALQVRRTSGRPQGILNIGVGVLDGSMRSMPLYTHMDSSAVGYRDLL  174



>emb|CDY18242.1| BnaC05g02650D [Brassica napus]
Length=410

 Score =   156 bits (395),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 106/151 (70%), Gaps = 9/151 (6%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA VS+  +TYA+ WV+  +K +T +D    TNPTWN KF FRV ++F
Sbjct  9    QLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNAGTNPTWNDKFVFRVDEEF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L +D SAV +EIY++ WFRDV VGTV++ + +L+ PP+R +        RF+ALQ+RR S
Sbjct  69   LYADTSAVVIEIYALHWFRDVHVGTVRVLISNLI-PPSRRM--------RFVALQVRRAS  119

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSS  783
            G PQG+LN+GV + D + RS P Y+ +  S+
Sbjct  120  GRPQGILNIGVGVLDGSMRSMPLYTHMDSSA  150



>gb|KDP33324.1| hypothetical protein JCGZ_12873 [Jatropha curcas]
Length=446

 Score =   157 bits (396),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 105/151 (70%), Gaps = 4/151 (3%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +IS QDLA VS+  RTYA+ WV+P +K ST +D     NPTWN KF FRV D+F
Sbjct  10   QLLELNVISGQDLAQVSRKMRTYAVAWVHPERKLSTRLDIYSHNNPTWNDKFVFRVDDEF  69

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE---RFMALQIR  681
            L  + SA+ VEIY+V+WFRD+ VGTV++ V +L+ PPA       +  +   RF+ALQ+R
Sbjct  70   LYRETSAIMVEIYAVSWFRDIHVGTVRVIVGNLI-PPAEHKKHQKHGVQLGMRFVALQVR  128

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVS  774
            R SG PQG+LN+GVA  D++ +S P Y++ +
Sbjct  129  RRSGRPQGILNIGVAFLDASRKSMPLYTQTA  159



>ref|XP_007145354.1| hypothetical protein PHAVU_007G232100g [Phaseolus vulgaris]
 gb|ESW17348.1| hypothetical protein PHAVU_007G232100g [Phaseolus vulgaris]
Length=438

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 106/161 (66%), Gaps = 5/161 (3%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LE+ +ISAQDLA   +S RTYA+ W++P++K ST +DS G TNPTWN KF FR+  DF
Sbjct  9    QLLELHVISAQDLAPAGRSMRTYAVAWIDPDRKLSTRVDSHGGTNPTWNDKFVFRMDQDF  68

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--RFMALQIRR  684
            L  D S + ++IY++ WFRD+ VGT ++    L  P ++    +  K    RF+ LQ++R
Sbjct  69   LYDDSSVITIDIYALHWFRDIHVGTAEVLSTDLFPPSSQPQQPNAYKSTGMRFLGLQVQR  128

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVS---GSSSDCRD  798
            PSG P+G+LN+G A+ DS+ RS P YS+ S   G S D  D
Sbjct  129  PSGRPKGILNVGAAIIDSSMRSMPLYSQNSPIIGYSQDDHD  169



>ref|XP_007030351.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY10853.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=370

 Score =   153 bits (386),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 125/229 (55%), Gaps = 31/229 (14%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            ILEI LISA+DLA VSK+ +TYA+ WV P+ K +T ID  G T+P+WN KF FR+ D FL
Sbjct  10   ILEINLISAEDLAPVSKNMKTYAVAWVQPDHKLATGIDQTGRTDPSWNEKFMFRLDDKFL  69

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPSG  693
             S+D+A+ VEIY+ AW +DVL+G V + +K +    + +  +      R + LQIRRPSG
Sbjct  70   NSEDAAIVVEIYAAAWVKDVLIGYVNVLIKDIFHLRSIADAKINYSATRTVTLQIRRPSG  129

Query  694  DPQGMLNMGVALFDSASRSKPKY-----------------------------SEVSGSSS  786
             PQG+LNM V L DS + S P+                              +++S S S
Sbjct  130  RPQGILNMEVILLDSTTPSVPELGDPKPKTTSKNEESFENNNELESHKSSPNAKISRSQS  189

Query  787  DCRD-LLEKKMNKFFPDSESAVEFPAKGGSVCNSSAVNGGSEVCSDIGP  930
            D  D  +E  + K  P   S V   +   +    S VNGGS   SD+GP
Sbjct  190  DVTDSTMEDNLEK-RPQMGSIVNDGSGSEAKGYGSMVNGGSICSSDVGP  237



>ref|XP_004497792.1| PREDICTED: uncharacterized protein LOC101505544 [Cicer arietinum]
Length=451

 Score =   154 bits (388),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 105/150 (70%), Gaps = 5/150 (3%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            + +LE+ +ISAQDLA V +S RTYA+ WV+P++K ST +DS G  NP WN KF FRV DD
Sbjct  8    YQLLELNVISAQDLAPVGRSMRTYAVAWVDPDRKLSTRVDSHGGINPAWNDKFVFRVDDD  67

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE---RFMALQI  678
            FL  ++S + ++IY++ WF+D+ VGT  +    ++ PP+R  + + N K    RF+ LQ+
Sbjct  68   FLNDENSIITIDIYALHWFKDIHVGTALVLADDII-PPSRP-SHNKNYKPPGMRFVGLQV  125

Query  679  RRPSGDPQGMLNMGVALFDSASRSKPKYSE  768
            RRPSG P+G+LN+GV + DS+ RS P Y+ 
Sbjct  126  RRPSGRPKGILNVGVVVIDSSMRSMPLYTH  155



>ref|XP_003590193.1| hypothetical protein MTR_1g045780 [Medicago truncatula]
 gb|AES60444.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=459

 Score =   153 bits (386),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            + +LE+ +ISAQDLA V +S RTYA+ WV+P++K ST +DS+  TNP WN KF FRV +D
Sbjct  8    YQLLELNVISAQDLAEVGRSMRTYAVAWVDPDRKLSTRVDSQSGTNPAWNDKFVFRVDED  67

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--RFMALQIR  681
            FL  ++S + ++IY++ WF+D+ VGT  +    ++ PP+R    +  K +  +F+ LQ+ 
Sbjct  68   FLYDENSTITIDIYAIHWFKDIHVGTAHVLADDII-PPSRPSHSNNYKPQGMQFVGLQVH  126

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSE  768
            RPSG P+G+LN+GVA+ DS+ RS P Y+ 
Sbjct  127  RPSGRPKGILNVGVAVIDSSMRSMPLYTH  155



>ref|XP_010674263.1| PREDICTED: uncharacterized protein LOC104890461 [Beta vulgaris 
subsp. vulgaris]
Length=372

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 120/213 (56%), Gaps = 18/213 (8%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +L I +ISA+DLA VSKS  TY + WVNPN+K +T +D KG   P WN KF FRV   F
Sbjct  6    QLLHINIISARDLAPVSKSMNTYVVGWVNPNRKLTTRVDHKGNNCPEWNDKFVFRVTPKF  65

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L SD S V++EIYS AW RD L+G+V++++ +L+     +  Q+G+ + R +ALQIRRPS
Sbjct  66   LNSDSSIVDIEIYSQAWLRDALIGSVRVSIANLIP----TGYQNGSTR-RSVALQIRRPS  120

Query  691  GDPQGMLNMGVALFDSASRSKP-------------KYSEVSGSSSDCRDLLEKKMNKFFP  831
            G PQG+LN+ V++ D + +S P                E  GS    R    ++      
Sbjct  121  GRPQGILNVVVSVLDGSRQSMPLSVVGLPSEKGARPKPEPEGSIISLRRAKSERSWTATI  180

Query  832  DSESAVEFPAKGGSVCNSSAVNGGSEVCSDIGP  930
            D E     PA  G     S+  GGS   SD+GP
Sbjct  181  DQEPRAPRPAGRGPEPGPSSSMGGSMCNSDVGP  213



>emb|CDX74193.1| BnaA03g28540D [Brassica napus]
Length=387

 Score =   147 bits (372),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 116/201 (58%), Gaps = 10/201 (5%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDL+ VSK+ +TY++ W+N  P +K +T +D    +NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLSLVSKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE----RFMALQ  675
             L +D SA+ +EIY+ AW +D LVGTV + +  L AP +     D         R + LQ
Sbjct  70   TLQADVSAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDEGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRD---LLEKKMNKFFPD-SES  843
            IRRPSG  QG L +GVAL D   RS P  SEV+    D +D   ++ ++ N    D + S
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSSEVNDVKRDGQDGVKVMHRRTNSDLTDLTTS  189

Query  844  AVEFPAKGGSVCNSSAVNGGS  906
              ++  K G V     V+GG+
Sbjct  190  TNDYGVKTGVVTGGGRVSGGN  210



>gb|EYU32591.1| hypothetical protein MIMGU_mgv1a006056mg [Erythranthe guttata]
Length=459

 Score =   145 bits (366),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 98/160 (61%), Gaps = 20/160 (13%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +LEI +IS QDL  V K  RTYA  WVNP +K S+                   V DDF
Sbjct  10   QLLEINIISGQDLQPVLKKMRTYARAWVNPGRKLSS-------------------VDDDF  50

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNK-KERFMALQIRRP  687
            LG D SAV +EIY+  WFRDV+VGTV++ V +L+ PP  +    G     RF+ALQ+RRP
Sbjct  51   LGEDTSAVMIEIYAAHWFRDVIVGTVRVLVGNLIPPPLMTRRNGGGPIGMRFVALQVRRP  110

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLE  807
            SG PQG+LN+GVAL D + RS P Y ++S S+   RDL++
Sbjct  111  SGRPQGILNIGVALLDGSMRSMPLYRQLSASAVGYRDLMQ  150



>ref|XP_009134757.1| PREDICTED: uncharacterized protein LOC103859027 [Brassica rapa]
Length=397

 Score =   142 bits (358),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 111/191 (58%), Gaps = 10/191 (5%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDL+ VSK+ +TY++ W+N  P +K +T +D    +NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLSLVSKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L +D SA+ +EIY+ AW +D LVGTV + +  L AP            GN   R + LQ
Sbjct  70   TLQADVSAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRD---LLEKKMNKFFPD-SES  843
            IRRPSG  QG L +GVAL D   RS P  SEV+    D +D   ++ ++ N    D + S
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGLRSMPLSSEVNDVKRDGQDGVKMMHRRTNSDLTDLTTS  189

Query  844  AVEFPAKGGSV  876
              ++  K G V
Sbjct  190  TNDYGVKTGVV  200



>emb|CDX92066.1| BnaC03g33680D [Brassica napus]
Length=383

 Score =   142 bits (357),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 104/176 (59%), Gaps = 9/176 (5%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDL+ VSK+ +TY++ W+N  P +K +T +D    +NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLSLVSKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L +D SA+ +EIY+ AW +D LVGTV + +  L AP            GN   R + LQ
Sbjct  70   TLQADVSAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRD---LLEKKMNKFFPD  834
            IRRPSG  QG L +GVAL D   RS P  SEV+    D +D   ++ ++ N    D
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSSEVNDVKRDGQDGVKMMHRRTNSDLTD  185



>ref|XP_010485810.1| PREDICTED: putative lysozyme-like protein [Camelina sativa]
Length=391

 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 121/230 (53%), Gaps = 32/230 (14%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA VS++ +TY++ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L +D SA+ +EIY+ AW +D LVGTV + +  L AP            GN   R + LQ
Sbjct  70   ILDADASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSS----SDCRD-----LLEKKMNKFF  828
            IRRPSG  QG L +GVAL D   RS P   EV   S    ++ RD     ++ ++ N   
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSIEVFDGSRRGDTNKRDQEASRMMHRRTNSDQ  189

Query  829  PD-SESAVEFPAKGGSVCNS---------------SAVNGGSEVCSDIGP  930
             D + S  ++  K G V N                S VN GS   SDIGP
Sbjct  190  SDLTTSTNDYGVKTGVVTNGGGGGGGGGGLVIGADSMVN-GSLCSSDIGP  238



>gb|AFK13837.1| C2 domain-containing protein SRC2 [Beta vulgaris subsp. vulgaris]
Length=331

 Score =   138 bits (347),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 110/200 (55%), Gaps = 33/200 (17%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             +L I +ISA+DLA VSKS  TY + WVNP +K +T +D KG   P WN KF FRV   F
Sbjct  6    QLLHINIISARDLAPVSKSMNTYVVGWVNPYRKLTTRVDHKGNNCPEWNDKFVFRVTPKF  65

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L SD S V++EIYS AW RD L+G+V++++ +L+     +  Q+G+ + R +ALQIRRPS
Sbjct  66   LNSDSSIVDIEIYSQAWLRDALIGSVRVSIANLIP----TGYQNGSTR-RSVALQIRRPS  120

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSESAVEFPAKGG  870
            G PQG+LN+ V++ D  +                             D E     PA  G
Sbjct  121  GRPQGILNVVVSVLDGTT----------------------------IDQEPRAPRPAGRG  152

Query  871  SVCNSSAVNGGSEVCSDIGP  930
                 S+  GGS   SD+GP
Sbjct  153  PEPGPSSSMGGSMCNSDVGP  172



>ref|XP_006297897.1| hypothetical protein CARUB_v10013938mg [Capsella rubella]
 gb|EOA30795.1| hypothetical protein CARUB_v10013938mg [Capsella rubella]
Length=382

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 92/152 (61%), Gaps = 6/152 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA VS++ +TY++ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDG----NKKERFMALQ  675
             L  D SA+ +EIY+ AW +D LVGTV + +  L AP +     D     N   R + LQ
Sbjct  70   ILDFDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDCGGRNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEV  771
            IRRPSG  QG L +GVAL D   RS P   EV
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSIEV  161



>emb|CDX89815.1| BnaA10g02670D [Brassica napus]
Length=498

 Score =   140 bits (353),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 103/165 (62%), Gaps = 17/165 (10%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            +LE+ +ISAQDLA VS+  +TYA+ WV+  +K +T +D    TNPTWN KF FRV ++FL
Sbjct  10   LLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNAGTNPTWNDKFVFRVDEEFL  69

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--------RFMA  669
             +D SAV +EIY++ WFRDV VGTV++ + +L+ P  R   +  N +         RF+A
Sbjct  70   YADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPQGMRFVA  129

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            L         QG+LN+GV + D + RS P Y+ +  S+   RDLL
Sbjct  130  L---------QGILNIGVGVLDGSMRSMPLYTHMDSSAVGYRDLL  165



>gb|KFK37859.1| hypothetical protein AALP_AA3G038400 [Arabis alpina]
Length=387

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 95/161 (59%), Gaps = 7/161 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA +S++ +TY++ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPISRNMKTYSVAWINTDPMRKLTTRVDQNNRANPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE----RFMALQ  675
             L  D SA+ +EIY+ AW +D LVGTV + +  L AP +     D         R + LQ
Sbjct  70   ILDVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDVGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEV-SGSSSDCR  795
            IRRPSG  QG L +GVAL D   RS P   EV  GS  D R
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSVEVFDGSRRDGR  170



>ref|XP_010463915.1| PREDICTED: uncharacterized protein LOC104744544 [Camelina sativa]
Length=392

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 92/152 (61%), Gaps = 6/152 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA VS++ +TY++ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L +D SA+ +EIY+ AW +D LVGTV + +  L AP            GN   R + LQ
Sbjct  70   ILDADASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEV  771
            IRRPSG  QG L +GVAL D   RS P   EV
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSIEV  161



>emb|CDY42921.1| BnaC05g47300D [Brassica napus]
Length=377

 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 100/170 (59%), Gaps = 7/170 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA +SK+ +TY++ W+N  P +K +T +D    +NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPISKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVDDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L  D S++ +EIY+ AW +D LVGTV + +  L AP            GN   R + LQ
Sbjct  70   ILDVDASSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEV-SGSSSDCRDLLEKKMNK  822
            IRRPSG  QG L +GVAL D   RS P   EV  GS  D +    K M++
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSVEVFDGSRRDSKRGDAKMMHR  179



>emb|CDY49343.1| BnaA05g33050D [Brassica napus]
Length=384

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 99/170 (58%), Gaps = 7/170 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA +SK+ +TY++ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPISKNMKTYSVAWINTDPMRKLTTRVDQANRANPIWNEKFVFRVDDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L  D S++ +EIY+ AW +D LVGTV + +  L AP            GN   R + LQ
Sbjct  70   ILDVDASSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEV-SGSSSDCRDLLEKKMNK  822
            IRRPSG  QG L +GVAL D   RS P   EV  GS  D +    K M++
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSVEVFDGSRRDSKRDDAKMMHR  179



>ref|XP_009123999.1| PREDICTED: uncharacterized protein LOC103848923 [Brassica rapa]
Length=384

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 99/170 (58%), Gaps = 7/170 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA +SK+ +TY++ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPISKNMKTYSVAWINTDPMRKLTTRVDQANRANPIWNEKFVFRVDDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L  D S++ +EIY+ AW +D LVGTV + +  L AP            GN   R + LQ
Sbjct  70   ILDVDASSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEV-SGSSSDCRDLLEKKMNK  822
            IRRPSG  QG L +GVAL D   RS P   EV  GS  D +    K M++
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSVEVFDGSRRDSKRDDAKMMHR  179



>ref|XP_002884443.1| hypothetical protein ARALYDRAFT_477695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60702.1| hypothetical protein ARALYDRAFT_477695 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 91/152 (60%), Gaps = 6/152 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA VS++ +TY++ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L  D SA+ +EIY+ AW +D LVGTV + +  L AP            GN   R + LQ
Sbjct  70   ILDVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEV  771
            IRRPSG  QG L +GVAL D   RS P   EV
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSIEV  161



>gb|AAF26778.1|AC016829_2 hypothetical protein [Arabidopsis thaliana]
Length=353

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 92/152 (61%), Gaps = 6/152 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA VS++ +TY++ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L  D SA+ +EIY+ AW +D LVGTV + +  L AP       +    GN   R + LQ
Sbjct  70   ILYVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEV  771
            IRRPSG  QG L +GVAL D   RS P   EV
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSIEV  161



>gb|ABK28543.1| unknown [Arabidopsis thaliana]
Length=354

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 92/152 (61%), Gaps = 6/152 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA VS++ +TY++ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L  D SA+ +EIY+ AW +D LVGTV + +  L AP       +    GN   R + LQ
Sbjct  70   ILYVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEV  771
            IRRPSG  QG L +GVAL D   RS P   EV
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSIEV  161



>ref|NP_566225.4| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
 gb|AEE74070.1| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
Length=391

 Score =   136 bits (342),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 92/152 (61%), Gaps = 6/152 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA VS++ +TY++ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L  D SA+ +EIY+ AW +D LVGTV + +  L AP       +    GN   R + LQ
Sbjct  70   ILYVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEV  771
            IRRPSG  QG L +GVAL D   RS P   EV
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSIEV  161



>gb|AAM67146.1| unknown [Arabidopsis thaliana]
Length=391

 Score =   135 bits (341),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 92/152 (61%), Gaps = 6/152 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA VS++ +TY++ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L  D SA+ +EIY+ AW +D LVGTV + +  L AP       +    GN   R + LQ
Sbjct  70   ILDVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEV  771
            IRRPSG  QG L +G+AL D   RS P   EV
Sbjct  130  IRRPSGRLQGFLRLGIALLDGGQRSMPLSIEV  161



>ref|XP_006842598.1| hypothetical protein AMTR_s00077p00167680 [Amborella trichopoda]
 gb|ERN04273.1| hypothetical protein AMTR_s00077p00167680 [Amborella trichopoda]
Length=355

 Score =   135 bits (339),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 104/161 (65%), Gaps = 7/161 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            H+LE+ +ISAQD+   +++   YA+ WV+ + K ST  D +G T PTWN KF FRV + F
Sbjct  21   HLLELNIISAQDIHPATQAMHPYAVAWVHRDHKLSTRTDPQGHTEPTWNDKFIFRVTETF  80

Query  511  LGSDDSAVNVEIYS---VAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
            L SD +AV ++I++      F D L+GTV++ V +LL+  A+S    G    RF ALQ+R
Sbjct  81   LRSDTAAVTIQIFTHRPCCVFPDPLIGTVRVLVGNLLS--AQS-HAPGYSGMRFTALQVR  137

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLL  804
            RPSG PQG+LN+G+ L D A RS P Y + + S+   +DL+
Sbjct  138  RPSGRPQGILNLGITLLDPALRSMPLYVQAT-SALGYQDLM  177



>ref|XP_006408192.1| hypothetical protein EUTSA_v10020890mg [Eutrema salsugineum]
 gb|ESQ49645.1| hypothetical protein EUTSA_v10020890mg [Eutrema salsugineum]
Length=392

 Score =   135 bits (341),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 91/152 (60%), Gaps = 6/152 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI LISAQDLA +S++ +TY++ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINLISAQDLAPISRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAP----PARSITQDGNKKERFMALQ  675
             L  D SA+ +E+Y+ AW +D LVGTV + +  L AP            GN   R + LQ
Sbjct  70   ILDVDASAIVIEVYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEV  771
            IRRPSG  QG L +GVAL D   RS P   EV
Sbjct  130  IRRPSGRLQGFLRLGVALLDGGQRSMPLSIEV  161



>ref|XP_011093241.1| PREDICTED: uncharacterized protein LOC105173247 [Sesamum indicum]
Length=262

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 101/167 (60%), Gaps = 9/167 (5%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRV  498
            H ILEI LI+AQ L   S + R   TYA+IWVNP KK  T +DS G  NPTWN KF FRV
Sbjct  4    HQILEINLITAQGLKTPSANLRRMQTYAVIWVNPGKKLRTRLDSLGGENPTWNDKFLFRV  63

Query  499  GDDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLL--APPARSITQDGNKKERFMAL  672
             ++F+  D SAV+VEI+++ + +D L+GTV+  +   L    P  S          F A+
Sbjct  64   SNEFISGDTSAVSVEIFALGYIKDFLIGTVRFLLSTCLKRTIPIASAGGGSVGSSAFTAV  123

Query  673  QIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            QIRRPSG  QG+LN+  A++DS+    P   ++S  S    DL++KK
Sbjct  124  QIRRPSGRFQGVLNIATAVYDSS--EFPILGKISAVS--FHDLMDKK  166



>ref|XP_010558947.1| PREDICTED: uncharacterized protein LOC104827473 [Tarenaya hassleriana]
Length=396

 Score =   132 bits (333),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 86/233 (37%), Positives = 113/233 (48%), Gaps = 37/233 (16%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI +ISAQDLA+VS++ +TYA+ W+N  P +K +T +D     NP WN K  FRV D 
Sbjct  10   VLEINMISAQDLASVSRNMKTYAVAWINTDPMRKLTTRVDQTNRANPIWNEKLVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKE--RFMALQIR  681
             L  D SA+ +EIY+ AW +D LVG++ + +  L AP +      GN     R + LQIR
Sbjct  70   ILNVDASAIVIEIYAAAWAKDALVGSINVLLSDLFAPWSGFNHGGGNGNNNMRLVTLQIR  129

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSS--------------------------  783
            RPSG  QG+L +G+AL D   RS P   EV   S                          
Sbjct  130  RPSGRLQGLLRLGIALLDGTQRSMPLSVEVFDGSNHGGHRYKKGIHDMNGGGGGSGGMVL  189

Query  784  ----SDCRDLLEKKMNKFFPDSESAVEFPAKGGSVCNSSAVNGGSEVCSDIGP  930
                SD  DL     + +             GG+    S VNG    CSDIGP
Sbjct  190  RRTHSDQTDLTTSTDDIYGVKPGVVSGGGGYGGT---DSMVNGSDLCCSDIGP  239



>gb|KFK39933.1| hypothetical protein AALP_AA3G308600 [Arabis alpina]
Length=401

 Score =   130 bits (328),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 112/202 (55%), Gaps = 26/202 (13%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P +K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLEEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  + S V +EIY++ WF+D+ VGTV+  +  L+ P         +   RF+ L++ R S
Sbjct  68   LYDERSIVVIEIYALHWFKDIHVGTVQALISDLVTP---------SSAMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN---------KFFPDSES  843
            G P G+LN+ V L D++ +S P   E         DL+  K N         +   D+ S
Sbjct  119  GRPHGLLNIAVGLIDNSGQSMPLLFE--------EDLMFHKKNISSKPVGLRRSKSDTSS  170

Query  844  AVEFPAKGGSVCNSSAVNGGSE  909
             V+ P K      SS  N G E
Sbjct  171  MVDSPRKVTQTRMSSTTNSGFE  192



>ref|XP_010549648.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104820763 
[Tarenaya hassleriana]
Length=397

 Score =   130 bits (327),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 88/148 (59%), Gaps = 3/148 (2%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVN--PNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            +LEI +ISAQDLA+VS++ +TYA+ W+N  P +K +T +D     NP WN KF FRV D 
Sbjct  10   VLEINVISAQDLASVSRNMKTYAVAWINTDPMRKLTTPVDQTNRANPIWNEKFVFRVNDK  69

Query  508  FLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRP  687
             L  D SA+ +EIY+ AW +D LVG+V + +  L AP +               L IRRP
Sbjct  70   ILKVDASAIVIEIYAAAWAKDALVGSVNVLLSDLFAPWS-GFADGDGGGNNNXPLHIRRP  128

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEV  771
            SG  QG L +GVAL D   RS P   EV
Sbjct  129  SGRLQGFLRLGVALLDGMQRSMPLSVEV  156



>ref|XP_002885870.1| hypothetical protein ARALYDRAFT_480303 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62129.1| hypothetical protein ARALYDRAFT_480303 [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 112/202 (55%), Gaps = 26/202 (13%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P +K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L    S V +EIY++ WF+D+ VGTV+  +  L++P         +   RF+ L++ R S
Sbjct  68   LYDATSIVVIEIYALHWFKDIHVGTVQTLISDLVSP---------SSAMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN---------KFFPDSES  843
            G P G+LN+ V L D++ +S P   E         DLL  K N         +   D+ S
Sbjct  119  GRPHGLLNIAVGLIDNSGQSMPLLFE--------EDLLFHKKNISSKPVGFRRSKSDTSS  170

Query  844  AVEFPAKGGSVCNSSAVNGGSE  909
             V+ P K      SS  N G E
Sbjct  171  MVDSPRKVTQSRVSSTTNSGFE  192



>ref|XP_010518533.1| PREDICTED: uncharacterized protein LOC104793798 [Camelina sativa]
Length=404

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 112/202 (55%), Gaps = 26/202 (13%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P +K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L    S V +EIY++ WF+D+ VGTV+  +  L++P         +   RF+ L++ R S
Sbjct  68   LYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSP---------SSAMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN---------KFFPDSES  843
            G P G+LN+ V L D++ +S P   E         DLL  K N         +   D+ S
Sbjct  119  GRPHGLLNIAVGLIDNSGQSMPLLFE--------EDLLFHKKNISSKPVGLRRSKSDTSS  170

Query  844  AVEFPAKGGSVCNSSAVNGGSE  909
             V+ P K      SS  N G E
Sbjct  171  MVDSPRKVTQSRVSSTTNSGFE  192



>ref|XP_010467176.1| PREDICTED: uncharacterized protein LOC104747266 [Camelina sativa]
Length=404

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 112/202 (55%), Gaps = 26/202 (13%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P +K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L    S V +EIY++ WF+D+ VGTV+  +  L++P         +   RF+ L++ R S
Sbjct  68   LYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSP---------SSAMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN---------KFFPDSES  843
            G P G+LN+ V L D++ +S P   E         DLL  K N         +   D+ S
Sbjct  119  GRPHGLLNIAVGLIDNSGQSMPLLFE--------EDLLFHKKNISSKPVGLRRSKSDTSS  170

Query  844  AVEFPAKGGSVCNSSAVNGGSE  909
             V+ P K      SS  N G E
Sbjct  171  MVDSPRKVTQSRVSSTTNSGFE  192



>ref|XP_010488836.1| PREDICTED: uncharacterized protein LOC104766620 [Camelina sativa]
Length=403

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 112/202 (55%), Gaps = 26/202 (13%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P +K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L    S V +EIY++ WF+D+ VGTV+  +  L++P         +   RF+ L++ R S
Sbjct  68   LYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSP---------SSAMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN---------KFFPDSES  843
            G P G+LN+ V L D++ +S P   E         DLL  K N         +   D+ S
Sbjct  119  GRPHGLLNIAVGLIDNSGQSMPLLFE--------DDLLFHKKNISPKPVGLRRSKSDTSS  170

Query  844  AVEFPAKGGSVCNSSAVNGGSE  909
             V+ P K      SS  N G E
Sbjct  171  MVDSPRKVTQSRVSSTTNSGFE  192



>ref|XP_009625033.1| PREDICTED: uncharacterized protein LOC104115986 [Nicotiana tomentosiformis]
Length=397

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 87/136 (64%), Gaps = 5/136 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFL  513
            ILEI +ISAQDL  VSK  RT+A+ +++P+ + +T +D  G TNPTWN+K  FRV D FL
Sbjct  9    ILEINVISAQDLPPVSKMLRTFAVAYIHPDHRLTTRVDHNGKTNPTWNYKMVFRVDDKFL  68

Query  514  GSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPSG  693
             S+ ++V  EIY+VAW RD+ +GT  + +     PP  S     N   R   L IRRPSG
Sbjct  69   NSESASVTFEIYNVAWLRDLPIGTTHLMINSFF-PPLSS----KNPTMRSTTLHIRRPSG  123

Query  694  DPQGMLNMGVALFDSA  741
              QG+L++ V L D++
Sbjct  124  HLQGLLHVSVQLIDTS  139



>ref|NP_178968.1| C2 domain-containing protein [Arabidopsis thaliana]
 gb|AAD28670.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM15260.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAC43170.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63412.1| At2g13350 [Arabidopsis thaliana]
 gb|AEC06226.1| C2 domain-containing protein [Arabidopsis thaliana]
Length=401

 Score =   128 bits (321),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 111/200 (56%), Gaps = 26/200 (13%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P +K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L    S V +EIY++ WF+D+ VGTV+  +  L++P         +   RF+ L++ R S
Sbjct  68   LYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSP---------SSAMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN---------KFFPDSES  843
            G P G+LN+ V L D++ +S P   E         DLL  K N         +   D+ S
Sbjct  119  GRPHGLLNIAVGLIDNSGQSMPLLFE--------EDLLFHKKNISSKPVGLRRSKSDTSS  170

Query  844  AVEFPAKGGSVCNSSAVNGG  903
             V+ P K      SS  N G
Sbjct  171  MVDSPRKVTQSRVSSTTNSG  190



>ref|XP_010533203.1| PREDICTED: uncharacterized protein LOC104809022 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010533204.1| PREDICTED: uncharacterized protein LOC104809022 isoform X2 [Tarenaya 
hassleriana]
Length=431

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 94/145 (65%), Gaps = 9/145 (6%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQDLA V++  +TYA+ W++P +K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILELNIISAQDLAPVARYMKTYAIAWLDPERKLTTRVDNTGGTSPTWNDKFVFRLDEES  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L  + S V +EIY++ WF+D+ VGTV+  V  L+         +     RF+ L++ R S
Sbjct  68   LYDETSLVVIEIYALHWFKDIHVGTVQALVSDLV---------NHVSAMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYS  765
            G P G+LN+ V L DS+ +S P Y+
Sbjct  119  GRPHGLLNIAVGLIDSSRQSVPLYT  143



>ref|XP_006300066.1| hypothetical protein CARUB_v10016294mg [Capsella rubella]
 gb|EOA32964.1| hypothetical protein CARUB_v10016294mg [Capsella rubella]
Length=404

 Score =   127 bits (319),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 108/202 (53%), Gaps = 26/202 (13%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P +K  T +D+ G T PTWN KF FR+ ++ 
Sbjct  8    QILELNIISAQELAPVARCMKTYAIAWIDPERKLMTRVDNTGGTTPTWNDKFVFRLDEET  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
               D + V +EIY++ WF+D+ VGTV+  +  L++P         +   RF+ L++ R S
Sbjct  68   TYDDTTIVVIEIYALHWFKDIHVGTVQALISDLVSP---------SSAMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN---------KFFPDSES  843
            G P G+LN+ V L D++  S P   E         DLL  K N         +   D+ S
Sbjct  119  GRPHGLLNIAVGLIDNSGHSMPLLYE--------EDLLFHKKNISTKPVGLRRSKSDTSS  170

Query  844  AVEFPAKGGSVCNSSAVNGGSE  909
             V+ P K      S   N G E
Sbjct  171  MVDSPRKVTQSHMSYTTNSGFE  192



>ref|XP_003553776.1| PREDICTED: uncharacterized protein LOC100793541 [Glycine max]
Length=260

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 97/168 (58%), Gaps = 13/168 (8%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRV  498
            H +LEI LISAQ L   S  +R   TYA+ W++P  K  T +D  G  NPTWN KF FRV
Sbjct  8    HQVLEINLISAQGLKPPSSPRRRLQTYAVTWIDPATKLRTRVDKLGGHNPTWNDKFLFRV  67

Query  499  GDDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQI  678
              DFL  D S+V V IY+V  FRD LVGTV+  + ++ +P A   T        F A QI
Sbjct  68   TPDFLAGDTSSVCVAIYAVGTFRDHLVGTVRFLISNMFSPDADYATPC------FSAFQI  121

Query  679  RRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNK  822
            RRPSG   G++N+G  + DS+    P   ++S      RDL+ +K+++
Sbjct  122  RRPSGRFHGVMNIGAMVMDSS--GFPALEKISAIGY--RDLMGEKIHQ  165



>ref|XP_010557577.1| PREDICTED: uncharacterized protein LOC104826528 [Tarenaya hassleriana]
Length=446

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 94/149 (63%), Gaps = 14/149 (9%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQDLA V++  +TYA+ W++P  K +T +D+ G TNPTWN KF FR+  + 
Sbjct  10   QILELNIISAQDLAPVARYMKTYAVAWLDPQHKLTTRVDNTGGTNPTWNDKFVFRLDKEA  69

Query  511  LGSDDSAVNV-EIYSVAWFRDVLVGTVKINVKHLLAP---PARSITQDGNKKERFMALQI  678
            L    S++ V EIY++ WF+D+ +GTV+  +  LL+P   PA           RF+ L++
Sbjct  70   LYYGTSSIMVIEIYALHWFKDIHIGTVQALITDLLSPTSLPAM----------RFVTLEV  119

Query  679  RRPSGDPQGMLNMGVALFDSASRSKPKYS  765
             R SG P G+LN+ V L DS+  S P Y+
Sbjct  120  LRASGRPHGLLNIAVGLIDSSRPSMPLYT  148



>ref|XP_006409691.1| hypothetical protein EUTSA_v10022712mg [Eutrema salsugineum]
 gb|ESQ51144.1| hypothetical protein EUTSA_v10022712mg [Eutrema salsugineum]
Length=400

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 109/199 (55%), Gaps = 26/199 (13%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P +K  T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILELNIISAQELAPVARCMKTYAIAWIDPERKLMTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L    S V +EIY++ WF+D+ VGTV+  +  L+ P         +   RF+ L++ R S
Sbjct  68   LYHGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNP---------SSAMRFITLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN---------KFFPDSES  843
            G P G+LN+ V + D++ +S P   E         DL+  K N         +   DS S
Sbjct  119  GRPHGLLNIAVGVIDNSGQSMPLLFE--------EDLMFHKKNISSKPIALRRSKSDSSS  170

Query  844  AVEFPAKGGSVCNSSAVNG  900
             VE P +      SS  +G
Sbjct  171  MVESPRRVAQTRMSSTTSG  189



>emb|CDX81442.1| BnaC09g08530D [Brassica napus]
Length=408

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 106/187 (57%), Gaps = 26/187 (14%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P +K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILEMNIISAQELAPVARCMKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L    S V +EIY++ WF+D+ VGTV+  +  L+ P         +   RF+ L++ R S
Sbjct  68   LYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNP---------SSGMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN---------KFFPDSES  843
            G P G+LN+ V L D++ +S P   E         DL+  K N         +   D+ S
Sbjct  119  GRPHGLLNIAVGLIDNSGQSMPLLFE--------EDLMFHKTNITSKPVGLRRSKSDTSS  170

Query  844  AVEFPAK  864
             VE P K
Sbjct  171  MVESPRK  177



>emb|CDY37207.1| BnaA09g08280D [Brassica napus]
Length=407

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 106/187 (57%), Gaps = 26/187 (14%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P +K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILEMNIISAQELAPVARCMKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L    S V +EIY++ WF+D+ VGTV+  +  L+ P         +   RF+ L++ R S
Sbjct  68   LYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNP---------SSGMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN---------KFFPDSES  843
            G P G+LN+ V L D++ +S P   E         DL+  K N         +   D+ S
Sbjct  119  GRPHGLLNIAVGLIDNSGQSMPLLFE--------EDLMFHKTNITSKPVGLRRSKSDTSS  170

Query  844  AVEFPAK  864
             VE P K
Sbjct  171  MVESPRK  177



>emb|CDY37206.1| BnaA09g08270D [Brassica napus]
Length=407

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 106/187 (57%), Gaps = 26/187 (14%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P +K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILEMNIISAQELAPVARCMKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L    S V +EIY++ WF+D+ VGTV+  +  L+ P         +   RF+ L++ R S
Sbjct  68   LYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNP---------SSGMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN---------KFFPDSES  843
            G P G+LN+ V L D++ +S P   E         DL+  K N         +   D+ S
Sbjct  119  GRPHGLLNIAVGLIDNSGQSMPLLFE--------EDLMFHKTNITSKPVGLRRSKSDTSS  170

Query  844  AVEFPAK  864
             VE P K
Sbjct  171  MVESPRK  177



>ref|XP_009112245.1| PREDICTED: uncharacterized protein LOC103837642 [Brassica rapa]
Length=407

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 106/187 (57%), Gaps = 26/187 (14%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P +K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILEMNIISAQELAPVARCMKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L    S V +EIY++ WF+D+ VGTV+  +  L+ P         +   RF+ L++ R S
Sbjct  68   LYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNP---------SSGMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN---------KFFPDSES  843
            G P G+LN+ V L D++ +S P   E         DL+  K N         +   D+ S
Sbjct  119  GRPHGLLNIAVGLIDNSGQSMPLLFE--------EDLMFHKTNITSKPVGLRRSKSDTSS  170

Query  844  AVEFPAK  864
             VE P K
Sbjct  171  MVESPRK  177



>ref|XP_008801291.1| PREDICTED: uncharacterized protein LOC103715451 [Phoenix dactylifera]
Length=337

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 98/158 (62%), Gaps = 17/158 (11%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            H+LE+T++SAQDL A S+S RTYA+ W+ P  K  T +D+ G T PTWN KF FRV D  
Sbjct  22   HLLEVTVVSAQDLFANSRSMRTYAVAWIEPAHKLRTRLDAAGHTEPTWNDKFVFRVDDAV  81

Query  511  LGSDDSAVNVEIYSVAWFR-----DVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQ  675
            L SD +AV V IY+ A  R     D+L+GT +  +  L            +   RF+A+ 
Sbjct  82   LRSDTAAVTVNIYA-ARPRFLPASDILIGTARALLSAL----------RPSTATRFVAVL  130

Query  676  IRRP-SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSS  786
            +RRP S  PQG+LN+GV+L D+  RS P ++E++G+ +
Sbjct  131  VRRPQSLRPQGILNIGVSLLDAYVRSLPIFAELAGAGA  168



>ref|XP_010262513.1| PREDICTED: uncharacterized protein LOC104601031 [Nelumbo nucifera]
Length=318

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = +1

Query  337  LEITLISAQDLAAVSKSQRTYALIWVNPNKK--RSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            LEI +ISA DLA V+ + RTYA+  ++  +K  +ST I   G TNPTWN KF F V +DF
Sbjct  16   LEINVISALDLAPVTSAMRTYAVACLDRERKCKQSTRIALIGHTNPTWNAKFIFPVDEDF  75

Query  511  LGSDDSAVNVEIYSVAW-FRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRP  687
            L S  S+V +EIY++ + FR+VLVGTV + V + + P   S+        + + LQ+RRP
Sbjct  76   LKSYTSSVIIEIYALRYLFRNVLVGTVHVLVSNFIHP--SSLQPHDRDYGQLVCLQVRRP  133

Query  688  SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMN  819
            S  PQG+LN+ VAL D++ R  P  ++ S ++    DL+ KKM+
Sbjct  134  SDRPQGLLNISVALLDNSVRIMPLCNQPSTTTVGYSDLMGKKMH  177



>ref|XP_009764572.1| PREDICTED: uncharacterized protein LOC104216252 [Nicotiana sylvestris]
Length=263

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 98/165 (59%), Gaps = 15/165 (9%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             ILEI LISAQ L     + R   TYAL+WVN + K  T ID  G  NPTWN KF FRV 
Sbjct  7    QILEINLISAQSLKTPITNLRRMQTYALLWVNSSNKLRTKIDHFGGENPTWNDKFLFRVS  66

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
              F+  D S V+VEIY+V   +D LVGTV++    LL+   + +         F A+QIR
Sbjct  67   PKFISGDTSGVSVEIYAVGVLKDFLVGTVRL----LLSSCFKGMVNTATPA--FTAVQIR  120

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDC-RDLLEKK  813
            RPSG  QG+LN+G A++ S       +S ++G S+ C RDL+E+K
Sbjct  121  RPSGRFQGVLNIGAAVYISTD-----FSLLNGLSAVCFRDLMEEK  160



>gb|EYU38921.1| hypothetical protein MIMGU_mgv1a022778mg [Erythranthe guttata]
Length=242

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 98/171 (57%), Gaps = 12/171 (7%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             ILEI LISAQ L   S + R   TYA+ W++P  K  T +DS G  NPTWN KF FRV 
Sbjct  4    QILEINLISAQGLKPPSANLRRIQTYAITWIDPATKLRTHVDSVGGENPTWNDKFLFRVS  63

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLL---APPARSITQDGNKKERFMAL  672
            D+F+  D SAV VEI++V + +D+L+GTV+  +   L   A P  S  +          L
Sbjct  64   DEFIAGDTSAVAVEIFAVGYIKDILIGTVRFLLSTCLKRAASPIDSAGEGSIGTPSCTGL  123

Query  673  QIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSG-SSSDCRDLLEKKMNK  822
            QIRRPSG  QG+LN+  A + S+      Y+ +   S+   R L+EKK N+
Sbjct  124  QIRRPSGRFQGVLNIAAAAYRSSD-----YAVLENVSAVSFRGLMEKKENE  169



>emb|CDX89605.1| BnaC03g45190D [Brassica napus]
Length=406

 Score =   124 bits (311),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 91/142 (64%), Gaps = 9/142 (6%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P  K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILELNVISAQELAPVARCMKTYAIAWIDPECKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L    S V +EIY++ WF+D+ VGTV+  +  L+ P         +   RF+ L++ R S
Sbjct  68   LYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVDP---------SSAMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKP  756
            G P G+LN+ V L D++ +S P
Sbjct  119  GRPHGLLNIAVGLIDNSGQSMP  140



>ref|XP_009136211.1| PREDICTED: uncharacterized protein LOC103860372 [Brassica rapa]
 emb|CDX93113.1| BnaA03g38350D [Brassica napus]
Length=404

 Score =   124 bits (311),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 91/142 (64%), Gaps = 9/142 (6%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
             ILE+ +ISAQ+LA V++  +TYA+ W++P  K +T +D+ G T+PTWN KF FR+ ++ 
Sbjct  8    QILELNVISAQELAPVARCMKTYAIAWIDPECKLTTRVDNTGGTSPTWNDKFVFRLDEEA  67

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPS  690
            L    S V +EIY++ WF+D+ VGTV+  +  L+ P         +   RF+ L++ R S
Sbjct  68   LYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVDP---------SSAMRFVTLEVLRAS  118

Query  691  GDPQGMLNMGVALFDSASRSKP  756
            G P G+LN+ V L D++ +S P
Sbjct  119  GRPHGLLNIAVGLIDNSGQSMP  140



>ref|XP_010544424.1| PREDICTED: uncharacterized protein LOC104817045 [Tarenaya hassleriana]
Length=260

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 96/158 (61%), Gaps = 10/158 (6%)
 Frame = +1

Query  331  HILEITLISAQDLAAVS---KSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+L+I LISAQ L   S   +  +TYA++WV+P+ K  T ID  G  NP WN KF F+V 
Sbjct  10   HVLQINLISAQGLKEPSGKLRRMQTYAVVWVDPSCKLRTRIDRIGAENPIWNDKFLFQVS  69

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             DFL  + S V++EIY++ + RD L+GTV+  V + L  P  S+     K    +ALQIR
Sbjct  70   ADFLSRETSGVSIEIYTIGYLRDHLIGTVRFLVSNFL--PTVSL-----KAPSLLALQIR  122

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCR  795
            RPSG   G+LN+G  + DS+  +   ++ V  ++++ R
Sbjct  123  RPSGKFHGVLNIGAMVIDSSEITADIFNVVRENTTESR  160



>gb|EPS68074.1| hypothetical protein M569_06693, partial [Genlisea aurea]
Length=233

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 96/167 (57%), Gaps = 10/167 (6%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             ILEITLISAQ +   S + R   TYA+ WVNP  K  T +DS G  NPTWN KF FRV 
Sbjct  4    RILEITLISAQGIKPPSGNLRRLQTYAVTWVNPATKLRTRVDSMGGENPTWNDKFLFRVC  63

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPAR---SITQDGNKKERFMAL  672
            +DF+  D SAV+VEI++V + +D L+GTV+  +      P     S  +       F A+
Sbjct  64   NDFISGDTSAVSVEIFAVGYIKDFLIGTVRFLLSSCFKRPGSVELSREEGTIGTPAFTAV  123

Query  673  QIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKK  813
            QIRRPSG  QG+LN+  A++       P   + +  S   RDL+EK+
Sbjct  124  QIRRPSGRFQGVLNIAAAVYQLL--DYPIMEKETAVS--FRDLMEKR  166



>ref|XP_010055064.1| PREDICTED: uncharacterized protein LOC104443389 [Eucalyptus grandis]
 gb|KCW71540.1| hypothetical protein EUGRSUZ_E00081 [Eucalyptus grandis]
Length=267

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 100/162 (62%), Gaps = 14/162 (9%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            ILE+ LISAQ+L     + R   TY+L+WV+P+ K  T +D  G  NPTWN KF FRVG 
Sbjct  11   ILELHLISAQNLKPPPANMRRTETYSLVWVDPSTKLRTRLDRVGSDNPTWNDKFFFRVGP  70

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKK-ERFMALQIR  681
            DFL S  SAV VEIY+V + RD LVG+V++ +  +L+ P       GN K   F A+ IR
Sbjct  71   DFLSSHTSAVTVEIYAVGYIRDYLVGSVRLLLSTVLSWPDFV----GNSKLPYFTAVGIR  126

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSS-DCRDLL  804
            RPSG   G+LN+G+ L + +      ++ + G+S+   RDL+
Sbjct  127  RPSGKIHGVLNIGIMLTNGSD-----FTALKGASAIGYRDLM  163



>ref|XP_009591358.1| PREDICTED: uncharacterized protein LOC104088405 [Nicotiana tomentosiformis]
Length=267

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 100/167 (60%), Gaps = 15/167 (9%)
 Frame = +1

Query  331  HILEITLISAQDL---AAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             ILEI LISAQ L    A  +  +TYALI+V+ + K  T ID  G  NPTWN KF FRV 
Sbjct  7    QILEINLISAQSLKTPIANFRRLQTYALIFVDSSNKLRTKIDHFGGENPTWNDKFLFRVS  66

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDG--NKKERFMALQ  675
              F+  D S V+VEIY+V   +D LVGTV++    LL+   + +   G       F A+Q
Sbjct  67   PKFISGDTSGVSVEIYAVGVLKDFLVGTVRL----LLSSCFKGMVNSGISTATPVFTAVQ  122

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDC-RDLLEKK  813
            IRRPSG  QG+LN+G A++ S       +S ++G S+ C RDL+E+K
Sbjct  123  IRRPSGRFQGVLNIGAAVYSSTD-----FSLLNGLSAVCFRDLMEEK  164



>ref|XP_009406969.1| PREDICTED: uncharacterized protein LOC103989745 [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 101/171 (59%), Gaps = 16/171 (9%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            H+LEIT+IS Q L   S+S + YA  WV+P  K  T +D  G+T+PTWN KF FRV D F
Sbjct  29   HLLEITIISGQGLFPASRSLQAYASAWVDPKHKLYTRVDRAGVTDPTWNDKFVFRVDDAF  88

Query  511  LGSDDSAVNVEIYS----VAWFRDVLVGTVKINVKHL-LAPPARSITQDGNKKERFMALQ  675
            L S+ SAVNV +++    ++  RD L+GTV++ +  L LAP A           R +ALQ
Sbjct  89   LRSETSAVNVHLHAARGRLSPLRDHLLGTVRVVLSALRLAPGA----------GRCVALQ  138

Query  676  IRRPSGD-PQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKF  825
            +RRPS   P G+LN+GVAL DS       +   S ++   +DL+  K  K+
Sbjct  139  VRRPSTLCPHGILNLGVALHDSDKIMPLSFDLQSLAAFAYKDLIGAKQEKY  189



>ref|XP_004133823.1| PREDICTED: uncharacterized protein LOC101212280 [Cucumis sativus]
 ref|XP_004155854.1| PREDICTED: uncharacterized protein LOC101225970 [Cucumis sativus]
 gb|KGN56448.1| hypothetical protein Csa_3G119780 [Cucumis sativus]
Length=279

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 102/168 (61%), Gaps = 15/168 (9%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKS---QRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LEI LISAQDL   S     + TYA+ WV+P+ +  T +D+ G  NPTWN KF FRV 
Sbjct  18   HVLEINLISAQDLKIPSNHFNPKHTYAVAWVHPSHRLRTRLDTIGGENPTWNDKFLFRVS  77

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             +FL  + S V++EIYS+  F D LVGTV+  + +++AP       D +    F A+Q+R
Sbjct  78   PEFLARETSGVSIEIYSLGRFCDTLVGTVRFLIGNVIAP------NDCSTTPSFTAVQVR  131

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSS-DCRDLLEKKMNK  822
            RPSG   G+LN+ V +  ++      ++ ++G S+   RDL+ + +N+
Sbjct  132  RPSGRFHGVLNVAVMVNGNSD-----FASLNGVSAIGYRDLMGESLNR  174



>ref|XP_009385178.1| PREDICTED: uncharacterized protein LOC103972545 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 100/165 (61%), Gaps = 15/165 (9%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            H LE+T+ISAQDL   ++S RTYA+ +  P+ +  T ID+ G T+PTWN KF FRV D  
Sbjct  39   HHLEVTVISAQDLYPAARSMRTYAVAYFRPDHRARTRIDASGHTDPTWNDKFVFRVDDAV  98

Query  511  LGSDDSAVNVEIYS----VAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQI  678
            L SD SA+ +++Y+    +    D+L+GT +  +  L   P+ +I         + ALQI
Sbjct  99   LHSDTSAITIDVYADRPGLLPGPDILLGTARALLSTLR--PSSAI--------HYAALQI  148

Query  679  RRPSG-DPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEK  810
            RRP+   PQG+LN+GVAL D ++R+ P ++    +SS  R  + K
Sbjct  149  RRPASLRPQGILNLGVALVDPSARTVPVHANRGHASSTPRPEVPK  193



>ref|XP_007051663.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOX95820.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=266

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 105/186 (56%), Gaps = 22/186 (12%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVS---KSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRV  498
            +++LEITLISAQ L   S   +  +TYAL W++ + K  T +D  G  NPTWN KF F+V
Sbjct  4    NYVLEITLISAQGLKEPSGKLRRMQTYALAWIDSSVKLRTCVDRVGGENPTWNDKFLFKV  63

Query  499  GDDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQI  678
              +FL S+ S ++VEI++V   RD LVGTV+  V + L P   +   +  K   F A+QI
Sbjct  64   SSEFLSSETSGISVEIFAVGVLRDSLVGTVRFLVSNFL-PSGSAF--NAAKTHSFNAVQI  120

Query  679  RRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNK------------  822
            RRPSG  QG+LN+G  + D A    P ++ V  S+   RDL+  +  K            
Sbjct  121  RRPSGRFQGVLNIGATVLDGA--YVPSWTGV--SAMGFRDLIGHRSLKKSKSALPISREN  176

Query  823  FFPDSE  840
             FPDS+
Sbjct  177  LFPDSD  182



>ref|XP_006577334.1| PREDICTED: BON1-associated protein 2-like [Glycine max]
Length=208

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 95/168 (57%), Gaps = 13/168 (8%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRV  498
            H +LEI LISAQ +   S  +R   TYA+ W++P  K  T +D  G  NPTWN KF F V
Sbjct  8    HQVLEINLISAQGMKPPSSPRRRLQTYAVTWIDPATKLRTRVDKLGGHNPTWNDKFLFGV  67

Query  499  GDDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQI  678
              DFL  D S+V V IY+V  FR  LVGTV+  + ++ +P A   T        F A QI
Sbjct  68   TKDFLAGDTSSVCVAIYAVGTFRHHLVGTVRFLISNMFSPDADDAT------PCFSAFQI  121

Query  679  RRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNK  822
            RRPSG   G++N+G  + D +    P   ++  S+   RDL+ +K+++
Sbjct  122  RRPSGRFHGVMNIGAMVMDGS--GFPALEKI--SALGYRDLMGEKIHQ  165



>ref|XP_006339653.1| PREDICTED: uncharacterized protein LOC102592387 [Solanum tuberosum]
Length=269

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 100/169 (59%), Gaps = 15/169 (9%)
 Frame = +1

Query  331  HILEITLISAQDL---AAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             ILEI LISAQ L    A  +  +TYA++WV+ + K  T ID  G  NPTWN KF FRV 
Sbjct  6    QILEINLISAQSLKTPVANLRRMQTYAILWVDSSTKLRTKIDHLGGENPTWNDKFLFRVS  65

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDG--NKKERFMALQ  675
             +F+  + S V+VEIY+V + +D L+GTV++ +   L    + I   G       F A+Q
Sbjct  66   PEFISGETSGVSVEIYAVGYIKDFLIGTVRLLISSCL----KGIANHGITTATPAFTAVQ  121

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCR-DLLEKKMN  819
            +RRPSG   G+LN+  A++ S+      +S ++G S+ C  DL+E+K N
Sbjct  122  VRRPSGRFHGVLNIAAAVYCSSD-----FSLLNGLSAICFGDLMEEKEN  165



>ref|XP_006842901.1| hypothetical protein AMTR_s00075p00073210 [Amborella trichopoda]
 gb|ERN04576.1| hypothetical protein AMTR_s00075p00073210 [Amborella trichopoda]
Length=404

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 85/140 (61%), Gaps = 13/140 (9%)
 Frame = +1

Query  328  HHILEITLISAQDLAAV---SKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRV  498
            + +LE+ LISAQDL  +   +K+  TYA+ WV+P KK  T +D+ G  NPTWN KF F V
Sbjct  16   YQLLEVNLISAQDLKPIIHSNKTIHTYAVAWVDPRKKLRTRVDTLGRENPTWNDKFIFTV  75

Query  499  GDDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQI  678
               FL  + SA+++EI+ V + RDVL GTV+  V  L+     S          F ALQ+
Sbjct  76   DQSFLSGESSAISIEIFYVRYLRDVLAGTVRALVADLMKGGGLS----------FAALQV  125

Query  679  RRPSGDPQGMLNMGVALFDS  738
            RRPSG   G+LN+G+ + D+
Sbjct  126  RRPSGRFHGVLNLGLIVLDA  145



>gb|EPS60622.1| hypothetical protein M569_14180, partial [Genlisea aurea]
Length=283

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 102/311 (33%), Positives = 144/311 (46%), Gaps = 68/311 (22%)
 Frame = +1

Query  337   LEITLISAQDLAAVSKSQRTYALIWVNPN--KKRSTSIDSKGLTNPTW--NHKFSFRVGD  504
             + I+LISA  L  +S S +TYA  +V PN  KK  T+IDS+G  NP W  +++F FR   
Sbjct  26    IYISLISANGLPELSDSMQTYAAAYVPPNHTKKHLTAIDSRGQVNPRWEDSNQFCFRT--  83

Query  505   DFLGSDDSAVNVEIYSVA--WFR------DVLVGTVKINVKHLLAPPARSITQDGNKKER  660
                   DS++  EIY+V+   FR      DVL+GT  +++ HL+            K   
Sbjct  84    ----DRDSSLVAEIYAVSDPQFRGPDPDRDVLIGTAAVSIGHLI------------KATP  127

Query  661   FMALQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSE  840
             F++LQ+ RPSG P G+LN+GV +                        L+   N       
Sbjct  128   FLSLQVNRPSGSPGGILNLGVDV-----------------------ALDWNAN-------  157

Query  841   SAVEFPAKGGSVCNSSAVNGGSEVCSDIGPSASVVAAELMNLNppapapaqaakttvpva  1020
             +  EFP K GSVCN    N GSE+ SDIGPSAS+VAAEL      A    Q  +      
Sbjct  158   TEAEFPRKPGSVCNGDRDN-GSELWSDIGPSASIVAAELSRKRTAAETRRQEDRNGSGGG  216

Query  1021  EKTKSACGESLIleeltaeeaaaKGFTKEPGVKKKGRLVSCFGNAYGFEVTIVCGQSKKQ  1200
              +  S   ES   +      +   G  +       G L++CF    G E T+VCG    +
Sbjct  217   WQKSSDVDES---DGSALSRSETSGLMRR--GSSNGSLLACF--VCGVEFTVVCGGKTAR  269

Query  1201  KKD*APPANSP  1233
             ++   P + +P
Sbjct  270   RRKRLPMSGNP  280



>ref|XP_004229965.1| PREDICTED: BON1-associated protein 2 [Solanum lycopersicum]
Length=270

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 100/169 (59%), Gaps = 15/169 (9%)
 Frame = +1

Query  331  HILEITLISAQDL---AAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             ILEI LISAQ L    A  +  +TYA++WV+ + K  T ID  G  NPTWN KF FRV 
Sbjct  6    QILEINLISAQSLKTPVANLRRMQTYAILWVDSSTKLRTKIDHLGGENPTWNDKFLFRVS  65

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDG--NKKERFMALQ  675
             +F+  + S V+VEIY+V + +D L+GTV++ +   L    + I + G       F A+Q
Sbjct  66   PEFISGETSGVSVEIYAVGYIKDFLIGTVRLLISSCL----KGIAKHGITTATPAFNAVQ  121

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCR-DLLEKKMN  819
            +RRPSG   G+LN+  A++ S+      +S + G S+ C  DL+E+K N
Sbjct  122  VRRPSGRFHGVLNIAAAVYSSSD-----FSLLDGLSAICFGDLMEEKEN  165



>ref|XP_010920373.1| PREDICTED: CASP-like protein 4A1 [Elaeis guineensis]
Length=458

 Score =   119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 96/154 (62%), Gaps = 17/154 (11%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            H+LE+T++SAQDL A S+S RTYA+ W++P  K  T +D+ G T PTWN KF FR+ D  
Sbjct  22   HLLEVTVVSAQDLFANSRSMRTYAVAWIDPAHKLRTRLDAAGHTEPTWNDKFVFRLDDAI  81

Query  511  LGSDDSAVNVEIYSVAWFR-----DVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQ  675
            L SD +AV V I++ A  R     D L+GT +  +  L            +   RF+A+Q
Sbjct  82   LRSDTAAVTVNIFA-ARPRFLPGSDNLIGTARALLSTLRP----------STTTRFVAVQ  130

Query  676  IRRP-SGDPQGMLNMGVALFDSASRSKPKYSEVS  774
            +RRP S  PQG+LN+GV+L D+  RS P ++E++
Sbjct  131  VRRPQSLRPQGILNLGVSLLDAYVRSFPIFAELA  164



>gb|KDO86360.1| hypothetical protein CISIN_1g047341mg [Citrus sinensis]
Length=254

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 88/152 (58%), Gaps = 12/152 (8%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             ILEI LISAQ L + S   R   TYAL+W++ + K  T +D  G  +P WN KF F+V 
Sbjct  4    QILEIILISAQGLKSPSSKMRRMQTYALVWIDSSTKLCTRVDRAGAESPIWNEKFLFKVT  63

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             +FL S+ SA++VEIY+  + RD L+GTV+  V ++    A        K   F A QIR
Sbjct  64   PEFLSSETSAISVEIYASGYLRDYLIGTVRFLVSNISLSVA-------TKTPSFTAFQIR  116

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSG  777
            RPSG  QG+L++G  L D +    P + EVS 
Sbjct  117  RPSGRFQGVLSIGSMLIDGS--DLPAFDEVSA  146



>ref|XP_006444911.1| hypothetical protein CICLE_v10021815mg [Citrus clementina]
 ref|XP_006491213.1| PREDICTED: BON1-associated protein 2-like [Citrus sinensis]
 gb|ESR58151.1| hypothetical protein CICLE_v10021815mg [Citrus clementina]
Length=254

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 88/152 (58%), Gaps = 12/152 (8%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             ILEI LISAQ L + S   R   TYAL+W++ + K  T +D  G  +P WN KF F+V 
Sbjct  4    QILEIILISAQGLKSPSSKMRRMQTYALVWIDSSTKLCTRVDRAGAESPIWNEKFLFKVT  63

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             +FL S+ SA++VEIY+  + RD L+GTV+  V ++    A        K   F A QIR
Sbjct  64   PEFLSSETSAISVEIYASGYLRDYLIGTVRFLVSNISLSVA-------TKTPSFTAFQIR  116

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSG  777
            RPSG  QG+L++G  L D +    P + EVS 
Sbjct  117  RPSGRFQGVLSIGSMLIDGS--DLPAFDEVSA  146



>ref|XP_010092894.1| hypothetical protein L484_022489 [Morus notabilis]
 gb|EXB52712.1| hypothetical protein L484_022489 [Morus notabilis]
Length=266

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 88/160 (55%), Gaps = 18/160 (11%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            +LEI LISAQ L   S S R   TYALIW++   K  T +D  G  NPTWN +F FRV  
Sbjct  12   VLEINLISAQGLKPSSGSSRPVHTYALIWIDSTTKLRTGVDKVGGENPTWNDRFLFRVTP  71

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRR  684
            +FL  D S + VEIY+V   RD L+GTV++ + + L   A        K   F ALQIRR
Sbjct  72   EFLSGDTSGIYVEIYTVGRIRDSLIGTVRLLIGNFLDVRA--------KTPSFTALQIRR  123

Query  685  PSGDPQGMLNMGVALFDSA-------SRSKPKYSEVSGSS  783
            PSG   G+LN+G  +   A       +RS   Y ++ G S
Sbjct  124  PSGRFHGVLNVGATVISGADFAIALSNRSAIAYRDLMGES  163



>ref|XP_007147256.1| hypothetical protein PHAVU_006G109100g [Phaseolus vulgaris]
 gb|ESW19250.1| hypothetical protein PHAVU_006G109100g [Phaseolus vulgaris]
Length=249

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 85/141 (60%), Gaps = 9/141 (6%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRV  498
            H +LEI LISAQ L   S  +R   TYA+ W++P+ K  T +D  G  NPTWN KF FRV
Sbjct  7    HQVLEINLISAQGLKPPSSPRRRLQTYAVTWIHPDTKLRTRVDKLGGHNPTWNDKFLFRV  66

Query  499  GDDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQI  678
              +FL SD S++ + IY+V  FRD LVGT++  + ++L+  A   T        F A QI
Sbjct  67   SPEFLSSDTSSICIAIYAVGTFRDHLVGTLRFLISNILSRDADESTPC------FSAFQI  120

Query  679  RRPSGDPQGMLNMGVALFDSA  741
            RRPSG   G++N+G  + + +
Sbjct  121  RRPSGRFHGVMNIGAMVMEGS  141



>ref|XP_008437926.1| PREDICTED: uncharacterized protein LOC103483209 [Cucumis melo]
 gb|ADN34173.1| c2 domain-containing protein [Cucumis melo subsp. melo]
Length=279

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 102/167 (61%), Gaps = 15/167 (9%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKS---QRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            +LEI LISAQDL   S     + TYA+ W++P+ +  T +D+ G  NPTWN KF FRV  
Sbjct  19   VLEINLISAQDLKVPSNPFNPKHTYAVAWIHPSHRLRTRLDTIGGENPTWNDKFLFRVSP  78

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRR  684
            +FL  + S V++EIYS+  F D LVGTV+  + +++A      + D +    F A+Q+RR
Sbjct  79   EFLARETSGVSIEIYSLGRFCDTLVGTVRFLIGNVVA------SNDCSATPAFTAVQVRR  132

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSS-DCRDLLEKKMNK  822
            PSG   G+LN+GV +  ++      ++ ++G S+   RDL+ + +N+
Sbjct  133  PSGRFHGVLNIGVMVNGNSD-----FASLNGVSAIGYRDLMGESLNR  174



>ref|XP_009401202.1| PREDICTED: uncharacterized protein LOC103985274 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 111/198 (56%), Gaps = 19/198 (10%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            H+LEIT+ISAQ+L   ++  +TYA  WV+P  K  T +D  G  +PTWN K  FRV D F
Sbjct  28   HLLEITIISAQELYPAARCLKTYASAWVDPEHKLYTRVDRAGHADPTWNDKLVFRVDDSF  87

Query  511  LGSDDSAVNVEIYSV----AWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQI  678
            L SD +AV V +++     +   D L+GTV++ V   L P A           R +ALQ+
Sbjct  88   LRSDMAAVTVHLHATRGRFSPLPDHLLGTVRV-VLSALGPAA--------GPRRCVALQV  138

Query  679  RRPSG-DPQGMLNMGVALFDSASRSKPKYSEV-SGSSSDCRDLLEKKMNK----FFPDSE  840
            RRPS   P G++N+GVA+ DS +++ P Y ++ S S+   +DL+  K  K     +P  +
Sbjct  139  RRPSSLRPHGIINLGVAILDSFAKNMPLYYDLNSKSAFAYKDLIGAKRGKSNGPRWPSID  198

Query  841  SAVEFPAKGGSVCNSSAV  894
                 P + GSV  +S V
Sbjct  199  CDGWQPERNGSVEMASGV  216



>ref|XP_010456220.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=252

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 83/140 (59%), Gaps = 10/140 (7%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LEI LISAQDL   +   R   TYA +WV+ + K  T ID  G  NP WN KF F+V 
Sbjct  6    HVLEINLISAQDLKEPTGKLRQLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVS  65

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             +FL S+ S V++EIY+V + RD L+GTV+  V + L   A  +          +ALQIR
Sbjct  66   PEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPS-------LVALQIR  118

Query  682  RPSGDPQGMLNMGVALFDSA  741
            RPSG   G+LN+   + D++
Sbjct  119  RPSGKFHGVLNIAAMVMDAS  138



>emb|CDP08734.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 89/167 (53%), Gaps = 5/167 (3%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             ILEI LISAQ L   S S+R   TYAL WV+P  K  T  D  G  NPTWN KF FRV 
Sbjct  21   QILEINLISAQGLKTPSGSRRRMHTYALAWVDPTAKLRTRTDRVGAENPTWNDKFLFRVS  80

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
              FL  + S V VEIY+V + RD L+GTV+  +   L     S          F A+QI+
Sbjct  81   SRFLACETSGVTVEIYAVGYIRDYLIGTVRFLLSSCLGKFPSSADAIAIGTPAFTAVQIQ  140

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNK  822
            RPSG   G+LN+  ++  SA      +S  S  S   RDL+  ++ K
Sbjct  141  RPSGRFHGVLNIAASVCSSACSDFEIFSGASAIS--FRDLVGAELEK  185



>ref|XP_010422779.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=252

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 82/140 (59%), Gaps = 10/140 (7%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LEI LISAQ L   +   R   TYA +WV+ + K  T ID  G  NP WN KF F+V 
Sbjct  6    HVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVS  65

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             DFL S+ S V++EIY+V + RD L+GTV+  V + L   A  +          +ALQIR
Sbjct  66   PDFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPS-------LVALQIR  118

Query  682  RPSGDPQGMLNMGVALFDSA  741
            RPSG   G+LN+   + D++
Sbjct  119  RPSGKFHGVLNIAAMVMDAS  138



>ref|XP_009111426.1| PREDICTED: uncharacterized protein LOC103836878 [Brassica rapa]
Length=256

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 10/140 (7%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LEI LISAQ L   +   R   TYA +WV+ + K  T ID  G  NP WN KF F+V 
Sbjct  6    HVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSTKLRTRIDRIGAENPIWNDKFVFQVS  65

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             +FL S+ S V++EIY+V + RD L+GTV+  V + L   A  +          +ALQIR
Sbjct  66   SEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAEKVPS-------LVALQIR  118

Query  682  RPSGDPQGMLNMGVALFDSA  741
            RPSG  +G+LN+   + D++
Sbjct  119  RPSGKFRGVLNIAAMVIDAS  138



>emb|CDP17419.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 89/168 (53%), Gaps = 7/168 (4%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRV  498
            + ILEI LISAQ L   S S+R   TYAL WV+P  K  T  D  G  NPTWN  F FRV
Sbjct  19   NQILEINLISAQGLKTPSGSRRRMQTYALAWVDPATKLRTRTDRVGAENPTWNELFLFRV  78

Query  499  GDDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQI  678
               FL  + S V VEIY+V + RD L+GTV+  +   L     S    G     F A+QI
Sbjct  79   SSHFLACEPSGVTVEIYAVGYIRDYLIGTVRFLLSSCLGKFPSSADAIGTPA--FTAVQI  136

Query  679  RRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNK  822
            RRPSG   G+LN+  ++  S       +S  S  S   RDL+  ++ K
Sbjct  137  RRPSGRFHGVLNIAASVCSSTCSDFEIFSGASAIS--FRDLMGAEIKK  182



>ref|XP_006396291.1| hypothetical protein EUTSA_v10028892mg [Eutrema salsugineum]
 gb|ESQ37744.1| hypothetical protein EUTSA_v10028892mg [Eutrema salsugineum]
Length=260

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 82/140 (59%), Gaps = 10/140 (7%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LE+ LISAQ L   +   R   TYA +WV+ + K  T ID  G  NP WN KF F+V 
Sbjct  12   HVLELNLISAQGLKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVS  71

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             DFL S+ S V++EIY+V + RD L+GTV+  V + L   A  +          +ALQIR
Sbjct  72   SDFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPS-------LVALQIR  124

Query  682  RPSGDPQGMLNMGVALFDSA  741
            RPSG   G+LN+   + D++
Sbjct  125  RPSGKFHGVLNIAAMVIDAS  144



>ref|XP_010936043.1| PREDICTED: uncharacterized protein LOC105055767 [Elaeis guineensis]
Length=280

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 86/142 (61%), Gaps = 16/142 (11%)
 Frame = +1

Query  331  HILEITLISAQDL-AAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            H+LE+T+ISAQDL  A +++ R YA  WV+P+KK ST  D  G T PTWN K  FRV D 
Sbjct  21   HLLELTVISAQDLFPATARAMRAYATAWVHPDKKLSTRTDRAGHTEPTWNDKLVFRVDDA  80

Query  508  FLGSDDSAVNVEIYSVAW-----FRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMAL  672
            FL S  SA+ V+I++V        +D  +GTV++ +  L   P            RF AL
Sbjct  81   FLLSVTSAITVDIFAVRHRLSPRLQDPHLGTVRVLLSALRPDPG---------ARRFAAL  131

Query  673  QIRRP-SGDPQGMLNMGVALFD  735
            Q+RRP S  PQG+LN+GVAL D
Sbjct  132  QVRRPNSLRPQGILNVGVALLD  153



>ref|XP_002276427.1| PREDICTED: uncharacterized protein LOC100258448 [Vitis vinifera]
Length=265

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 93/166 (56%), Gaps = 9/166 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             +LEI LISAQ L   S + R   TYA+ W++   K  T +D  G  NPTWN KF FRV 
Sbjct  4    QLLEIILISAQGLKPPSGNLRRMQTYAIAWIDSANKLRTQVDRVGAENPTWNDKFIFRVS  63

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             DFL  D SAV VEIY+V   RD L+GTV+I + + L            +     A+QIR
Sbjct  64   SDFLACDTSAVAVEIYAVGVIRDHLIGTVRILISNCLPAADLRSRNFAARSPSLTAVQIR  123

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGS-SSDCRDLLEKKM  816
            RPSG   G+LN+  A+ +++      ++ ++G  + D RDL+ + +
Sbjct  124  RPSGRFHGVLNVAAAVVNASD-----FASLTGMLAIDHRDLMGQSL  164



>ref|XP_009377282.1| PREDICTED: BON1-associated protein 2 [Pyrus x bretschneideri]
Length=223

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 93/163 (57%), Gaps = 14/163 (9%)
 Frame = +1

Query  331  HILEITLISAQDL---AAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LEI LISAQDL   +A  +  +TYAL WV+   K  + +D  G  NPTWN +F F+V 
Sbjct  13   HVLEINLISAQDLKPPSAALRRMQTYALAWVDSAHKIRSRVDKIGGENPTWNDRFLFKVP  72

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
              FL S+ S V+++IY+V  F D LVGTV++ + + L           +K   F A+QIR
Sbjct  73   SAFLSSETSQVSIQIYAVGCFSDHLVGTVRLLINNFL--------DVASKVPSFTAIQIR  124

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEK  810
            RPSG  QG+LN+   + D  S   P  SE S      RDL+ K
Sbjct  125  RPSGRFQGVLNVAAMVID-GSYLAPAVSEWSAVG--YRDLVGK  164



>ref|XP_004494776.1| PREDICTED: uncharacterized protein LOC101496947 [Cicer arietinum]
Length=260

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 93/164 (57%), Gaps = 13/164 (8%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            +LEI LISAQ L   S  +R   TYAL W++ + K  T +D  G  NPTWN KF FRV  
Sbjct  10   VLEINLISAQGLKPPSSPRRRFQTYALTWIDSSTKLRTQVDKIGGQNPTWNDKFLFRVTP  69

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRR  684
            +FL S+ S V V IY+V  FRD +VGTV+    ++L+      +  GN+   F A QIRR
Sbjct  70   EFLASETSGVCVAIYAVGTFRDHIVGTVRFLTSNILS------SDGGNRTPCFSACQIRR  123

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKM  816
             SG   G++N+G  + D +    P   ++S      RDL+ +K+
Sbjct  124  ESGRFHGVMNIGAMVIDGS--GFPALEKISAIGY--RDLMGEKL  163



>ref|XP_002301388.2| hypothetical protein POPTR_0002s16800g, partial [Populus trichocarpa]
 gb|EEE80661.2| hypothetical protein POPTR_0002s16800g, partial [Populus trichocarpa]
Length=243

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 88/140 (63%), Gaps = 9/140 (6%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            +LEI LISAQ L   S + R   TYA++W++P+ K  T  D  G  NPTWN KF F+V  
Sbjct  5    VLEINLISAQGLKPPSANLRRMQTYAIVWIDPSTKLRTRTDRVGSENPTWNDKFLFKVTP  64

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHL-LAPPARSITQDGNKKERFMALQIR  681
            ++L S+ S V++EIY++   RD L+GTV+  V +L L+ P+ +IT         +ALQIR
Sbjct  65   EYLSSETSGVSIEIYAIGCIRDALIGTVRFLVGNLRLSTPSAAITM-----PSCIALQIR  119

Query  682  RPSGDPQGMLNMGVALFDSA  741
            RPSG   G++N+G  + D +
Sbjct  120  RPSGRFHGVINIGANVIDGS  139



>ref|XP_008362824.1| PREDICTED: uncharacterized protein LOC103426513 [Malus domestica]
 ref|XP_008362377.1| PREDICTED: uncharacterized protein LOC103426067 [Malus domestica]
Length=270

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 93/163 (57%), Gaps = 14/163 (9%)
 Frame = +1

Query  331  HILEITLISAQDL---AAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LEI LISAQ L   +A  +  +TYAL WV+   K  + +D  G  NPTWN +F F+V 
Sbjct  13   HVLEINLISAQGLKPPSAALRRMQTYALAWVDSAHKIRSRVDKIGGENPTWNDRFLFKVP  72

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
              FL S+ S V+++IY+V  F D LVGTV++ + + L           +K   F A+QIR
Sbjct  73   SAFLSSETSQVSIQIYAVGCFSDHLVGTVRLLINNFL--------DVASKVPSFTAIQIR  124

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEK  810
            RPSG  QG+LN+   + D  S   P  SE+S      RDL+ K
Sbjct  125  RPSGRFQGVLNVAAMVID-GSYLAPAVSELSAVG--YRDLMGK  164



>ref|XP_002511946.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50615.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 96/164 (59%), Gaps = 13/164 (8%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            ILEI LISAQDL   S S R   TYA++W++   K  T ID  G  NPTWN KF F+V  
Sbjct  6    ILEINLISAQDLKPPSASLRQMQTYAVVWLDSTAKLRTRIDRVGGENPTWNDKFLFKVTP  65

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRR  684
            + L  + S V+ EIY+V  FRD L+GTV+  +  +  P     T    +    +ALQI+R
Sbjct  66   EILSRETSGVSFEIYAVGCFRDPLIGTVRFLISTIPLPSPIKPT----RTPSCIALQIQR  121

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSS-DCRDLLEKK  813
            PSG  QG+LN+G  + D +      ++ ++G+S+   RDL+ +K
Sbjct  122  PSGRFQGVLNIGAMVIDGSD-----FATLNGASAIGYRDLMGEK  160



>gb|AES82742.2| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=256

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 86/139 (62%), Gaps = 6/139 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            +LEI LISAQ L   S  +R   TYAL W++ + K  T +D  G  NPTWN KF FR+  
Sbjct  14   VLEINLISAQGLKPPSSPRRNFQTYALTWIDSSTKLRTRVDKIGGQNPTWNDKFLFRITP  73

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRR  684
            +FL S+ S V+V IY+V  FRD LVGTV+  + ++L   + S    GN+   F A+QIRR
Sbjct  74   EFLASETSGVSVAIYAVGTFRDHLVGTVRFLISNIL---SSSSADSGNRTPCFSAVQIRR  130

Query  685  PSGDPQGMLNMGVALFDSA  741
            PSG   G+LN+G  + D +
Sbjct  131  PSGSFCGILNIGAMVVDGS  149



>ref|XP_010427687.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=256

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 81/140 (58%), Gaps = 10/140 (7%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LEI LISAQ L   +   R   TYA +WV  + K  T ID  G  NP WN KF F+V 
Sbjct  6    HVLEINLISAQRLKEPTGKLRRLQTYASVWVESSNKLRTRIDRIGAENPIWNDKFVFQVS  65

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             +FL S+ S V++EIY+V + RD L+GTV+  V + L   A  +          +ALQIR
Sbjct  66   PEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPS-------LVALQIR  118

Query  682  RPSGDPQGMLNMGVALFDSA  741
            RPSG   G+LN+   + D++
Sbjct  119  RPSGKFHGVLNIAAMVMDAS  138



>ref|XP_003626524.1| hypothetical protein MTR_7g116840 [Medicago truncatula]
Length=284

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 86/139 (62%), Gaps = 6/139 (4%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            +LEI LISAQ L   S  +R   TYAL W++ + K  T +D  G  NPTWN KF FR+  
Sbjct  14   VLEINLISAQGLKPPSSPRRNFQTYALTWIDSSTKLRTRVDKIGGQNPTWNDKFLFRITP  73

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRR  684
            +FL S+ S V+V IY+V  FRD LVGTV+  + ++L   + S    GN+   F A+QIRR
Sbjct  74   EFLASETSGVSVAIYAVGTFRDHLVGTVRFLISNIL---SSSSADSGNRTPCFSAVQIRR  130

Query  685  PSGDPQGMLNMGVALFDSA  741
            PSG   G+LN+G  + D +
Sbjct  131  PSGSFCGILNIGAMVVDGS  149



>gb|KDP28538.1| hypothetical protein JCGZ_14309 [Jatropha curcas]
Length=259

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 86/141 (61%), Gaps = 11/141 (8%)
 Frame = +1

Query  334  ILEITLISAQDL---AAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            ILEI LISAQ L   +A  +  +TYA++W++ + K  T +D  G  +P WN KF F+V  
Sbjct  6    ILEINLISAQGLKPPSANIRRMQTYAVVWIDSSTKLRTRVDRVGSGDPIWNDKFLFKVSP  65

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKH--LLAPPARSITQDGNKKERFMALQI  678
            +FL  + S V VEIY+V + RD L+GTV++ + +  L  P  R  T        F+ALQI
Sbjct  66   EFLAGETSGVCVEIYAVGYLRDALLGTVRLLISNIPLFLPNERMRTPS------FIALQI  119

Query  679  RRPSGDPQGMLNMGVALFDSA  741
            RRPSG  QG+LN+G  + D +
Sbjct  120  RRPSGRFQGLLNIGAVISDGS  140



>ref|XP_010251574.1| PREDICTED: uncharacterized protein LOC104593437 [Nelumbo nucifera]
Length=269

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 97/165 (59%), Gaps = 19/165 (12%)
 Frame = +1

Query  331  HILEITLISAQDL---AAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LEI LISAQ L   +A  +  +TYA+ W++   K  T +D  G  NPTWN KF FRV 
Sbjct  6    HLLEINLISAQGLKPPSANLRRMQTYAVAWIDSAIKLRTRVDRVGCENPTWNDKFIFRVS  65

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
              FL +D SAV+VEIY V + +D L+GTV+  + + L+  A +          F ALQIR
Sbjct  66   SAFLSTDTSAVSVEIYVVGYLKDTLIGTVRFLIGNCLSSSAPT----------FSALQIR  115

Query  682  RP-SGDPQGMLNMGVALFDSASRSKPKYSEVSG-SSSDCRDLLEK  810
            RP SG   G+LN+G  +     +++  ++ ++G S+   RDL+ K
Sbjct  116  RPSSGRFHGVLNIGAMVI----KNRTDFAALNGFSAIGYRDLMGK  156



>ref|XP_009420756.1| PREDICTED: uncharacterized protein LOC104000435 [Musa acuminata 
subsp. malaccensis]
Length=266

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 86/149 (58%), Gaps = 14/149 (9%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            H+LEIT+ISAQ L   ++S  TYA  WV+P  K  T +D  G  +PTWN KF FRV D F
Sbjct  22   HLLEITIISAQGLYPATRSINTYASAWVDPKHKLCTRVDRAGHADPTWNDKFIFRVDDAF  81

Query  511  LGSDDSAVNVEIYS----VAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQI  678
            L SD + V+V +++    ++   D L+GTV++ +  L   P            RF+AL +
Sbjct  82   LRSDTACVDVHLHAARSRLSPLPDHLLGTVRVVLSSLSPAPG---------VRRFVALLV  132

Query  679  RRPSG-DPQGMLNMGVALFDSASRSKPKY  762
            RRPS   P G+LN+ VA+ +   RS P Y
Sbjct  133  RRPSSLRPHGILNLSVAILEPHVRSMPLY  161



>ref|XP_007218843.1| hypothetical protein PRUPE_ppa010336mg [Prunus persica]
 gb|EMJ20042.1| hypothetical protein PRUPE_ppa010336mg [Prunus persica]
Length=253

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 96/162 (59%), Gaps = 14/162 (9%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            +LEI LISAQ L A + + R   TYAL WV+   K  + +D  G +NPTWN +F F+V  
Sbjct  14   VLEIHLISAQGLKAPTGTLRRMQTYALAWVDSAHKLRSRVDKIGASNPTWNDRFLFKVPP  73

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRR  684
             FL S+ SAV+V+IY+V  FRD LVG+V+  + + L           +K   F A+QIRR
Sbjct  74   GFLSSETSAVSVQIYTVGTFRDHLVGSVRFLINNFL--------DVHSKMPSFTAVQIRR  125

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEK  810
            PSG   G+LN+G  + D +  + P  +E+  S+   RDL+ K
Sbjct  126  PSGRFYGVLNVGAMVIDGSDLA-PAVNEM--SAIGYRDLMGK  164



>ref|XP_010669605.1| PREDICTED: uncharacterized protein LOC104886787 [Beta vulgaris 
subsp. vulgaris]
Length=271

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 88/141 (62%), Gaps = 10/141 (7%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LEI LISAQ+L   S + R   TYA+ ++NP++K  T +D  G  NPTWN KF FR+ 
Sbjct  19   HLLEINLISAQNLKPPSTNLRRLQTYAVAYINPSRKLRTRVDRLGAENPTWNDKFIFRIS  78

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
            D FL S  S+  V+I+SV   +D ++G+V+  + +        +T++       +A+QIR
Sbjct  79   DAFLSSQTSSFTVDIFSVGVLKDAILGSVRFILSN-------CVTRNSIGLPSCVAVQIR  131

Query  682  RPSGDPQGMLNMGVALFDSAS  744
            RPSG   G+LN+GV + D++S
Sbjct  132  RPSGRFHGVLNVGVMVIDASS  152



>ref|XP_011023248.1| PREDICTED: uncharacterized protein LOC105124808 [Populus euphratica]
Length=260

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 87/140 (62%), Gaps = 9/140 (6%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            +LE+ LISAQ L   S + R   TYA++W++P+ K  T  D  G  NPTWN KF F+V  
Sbjct  5    VLEVNLISAQGLKPPSANLRRMQTYAIVWIDPSTKLRTRTDRVGSENPTWNDKFLFKVTP  64

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHL-LAPPARSITQDGNKKERFMALQIR  681
            ++L S+ S V+++IY++   RD L+GTV+  V +L L+ P  +IT         +ALQIR
Sbjct  65   EYLSSETSGVSIQIYAIGCIRDALIGTVRFLVSNLPLSTPRAAITMPS-----CIALQIR  119

Query  682  RPSGDPQGMLNMGVALFDSA  741
            RPSG   G++N+G  + D +
Sbjct  120  RPSGRFHGVINIGANVIDGS  139



>ref|XP_008233233.1| PREDICTED: uncharacterized protein LOC103332288 [Prunus mume]
Length=273

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            +LEI LISAQ L A + + R   TYAL WV+   K  + +D  G +NPTWN +F F+V  
Sbjct  15   VLEIHLISAQGLKAPAGTLRRMQTYALAWVDSAHKLRSRVDKIGASNPTWNDRFLFKVPP  74

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRR  684
             FL S+ SAV+V+IY+V  FRD LVG+V+  + + L           +K   F A+QIRR
Sbjct  75   GFLSSETSAVSVQIYAVGTFRDHLVGSVRFLINNFL--------DVHSKMPSFTAVQIRR  126

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEK  810
            PSG   G+LN+G  + D +  + P  +E+S      RDL+ K
Sbjct  127  PSGRFYGVLNVGAMVIDGSDLA-PAVNEMSAIG--YRDLMGK  165



>ref|XP_011093070.1| PREDICTED: uncharacterized protein LOC105173112 [Sesamum indicum]
Length=258

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 93/165 (56%), Gaps = 10/165 (6%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             ILEI LISAQ L   S + R   TYA+ W+N   K  T  DS G  NP WN KF FRV 
Sbjct  4    QILEIDLISAQGLKTPSGNLRRLQTYAVTWINSAAKLRTCTDSLGGENPNWNDKFLFRVS  63

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
            ++F+  + SAV VEI+ V   +D+L+G+V+  +   L   A  +         F A+QIR
Sbjct  64   NEFISRETSAVAVEIFVVGRIKDILIGSVRFLLSTCL-KRATPLASGSTGTPVFTAVQIR  122

Query  682  RPSGDPQGMLNMGVALFDSASRS-KPKYSEVSGSSSDCRDLLEKK  813
            RPSG  QG+LN+  A++ S+  +   K S VS      R+L+EKK
Sbjct  123  RPSGRFQGVLNIAAAVYHSSDYAILEKVSAVS-----FRELMEKK  162



>ref|XP_002872904.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49163.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 10/140 (7%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LEI LISAQ L   +   R   TYA +WV+ + K  T ID  G  NP WN KF F+V 
Sbjct  5    HVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGSENPIWNDKFVFQVS  64

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             +FL S+ S V++EIY+V + RD  +GTV+  V + L  P  ++     K    +ALQIR
Sbjct  65   PEFLSSETSGVSIEIYAVGYLRDHQIGTVRFLVSNFL--PTAAV-----KVPSLVALQIR  117

Query  682  RPSGDPQGMLNMGVALFDSA  741
            RPSG   G+LN+   + D++
Sbjct  118  RPSGKFHGVLNIAAMVMDAS  137



>ref|XP_006289671.1| hypothetical protein CARUB_v10003230mg [Capsella rubella]
 gb|EOA22569.1| hypothetical protein CARUB_v10003230mg [Capsella rubella]
Length=244

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 83/140 (59%), Gaps = 10/140 (7%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             +LEI LISAQ +   +   R   TYA +WV+ + K  T ID  G  NP WN KF F+V 
Sbjct  5    QVLEINLISAQGIKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVS  64

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             +FL S+ S V++EIY+V + RD L+GTV+  V + L  P  ++     K    +ALQIR
Sbjct  65   PEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFL--PTAAV-----KVPSLVALQIR  117

Query  682  RPSGDPQGMLNMGVALFDSA  741
            RPSG   G+LN+   + D++
Sbjct  118  RPSGKFHGVLNIAAMVMDAS  137



>ref|NP_192029.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 emb|CAB80929.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL87353.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45098.1| unknown protein [Arabidopsis thaliana]
 gb|AEE81993.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=250

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 10/140 (7%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             +LEI LISAQ L   +   R   TYA +WV+ + K  T ID  G  NP WN KF F+V 
Sbjct  5    QVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSSKLRTRIDRIGSENPIWNDKFVFQVS  64

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             +FL S+ S V++EIY+V + RD L+GTV+  V + L  P  ++     K    +ALQIR
Sbjct  65   PEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFL--PTAAV-----KVPSLVALQIR  117

Query  682  RPSGDPQGMLNMGVALFDSA  741
            RPSG   G+LN+   + D++
Sbjct  118  RPSGKFHGVLNIAAMVMDAS  137



>ref|XP_008796382.1| PREDICTED: uncharacterized protein LOC103711856 [Phoenix dactylifera]
Length=282

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 83/142 (58%), Gaps = 16/142 (11%)
 Frame = +1

Query  331  HILEITLISAQDL-AAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDD  507
            H+LE+T+ISAQDL  A ++S R YA  WV+P++K  T  D  G T+PTWN K  FRV   
Sbjct  21   HLLELTVISAQDLFPATARSMRAYATAWVHPDRKLLTRTDRAGRTDPTWNDKLVFRVDAA  80

Query  508  FLGSDDSAVNVEIYSV-----AWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMAL  672
            FL S  SAV V+I++         RD  +GTV++ +      P            RF AL
Sbjct  81   FLLSVTSAVTVDIFAARRRLSPRLRDPHLGTVRVLLSAFRPEPG---------SRRFAAL  131

Query  673  QIRRP-SGDPQGMLNMGVALFD  735
            Q+RRP S  PQG+LN+G+AL D
Sbjct  132  QVRRPNSLRPQGILNVGIALLD  153



>emb|CDY07180.1| BnaCnng01950D [Brassica napus]
Length=1640

 Score =   111 bits (278),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 10/140 (7%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             H+LEI LISAQ L   +   R   TYA +WV+ + K  T ID  G  NP WN KF F+V 
Sbjct  1015  HVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSDKLRTRIDRIGAENPIWNDKFVFQVS  1074

Query  502   DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
              +FL S+ S V++EIY+V + RD L+GTV+  V + L   A  +          +ALQIR
Sbjct  1075  SEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAEKVPS-------LVALQIR  1127

Query  682   RPSGDPQGMLNMGVALFDSA  741
             RPSG  +G+LN+   + D++
Sbjct  1128  RPSGKFRGVLNIAAMVIDAS  1147



>emb|CDY48509.1| BnaA09g00140D [Brassica napus]
Length=1733

 Score =   111 bits (278),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 10/140 (7%)
 Frame = +1

Query  331   HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             H+LEI LISAQ L   +   R   TYA +WV+ + K  T ID  G  NP WN KF F+V 
Sbjct  1011  HVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSTKLRTRIDRIGAENPIWNDKFVFQVS  1070

Query  502   DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
              +FL S+ S V++EIY+V + RD L+GTV+  V + L   A  +          +ALQIR
Sbjct  1071  SEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAEKVPS-------LVALQIR  1123

Query  682   RPSGDPQGMLNMGVALFDSA  741
             RPSG  +G+LN+   + D++
Sbjct  1124  RPSGKFRGVLNIAAMVIDAS  1143



>ref|XP_009350266.1| PREDICTED: uncharacterized protein LOC103941795 [Pyrus x bretschneideri]
 ref|XP_009350267.1| PREDICTED: uncharacterized protein LOC103941796 [Pyrus x bretschneideri]
Length=271

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 89/154 (58%), Gaps = 20/154 (13%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LEI L+SAQ L A S + R   TYAL WV+   K  + +D  G  NPTWN +  F+V 
Sbjct  13   HVLEINLVSAQGLKAPSVTLRRMQTYALAWVDSAHKIRSRVDKVGGENPTWNDRCLFKVP  72

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLL----APPARSITQDGNKKERFMA  669
              FL S+ S V+V+IY+V  FRD LVGTV+  + + L    A P+            F A
Sbjct  73   SGFLSSETSQVSVQIYAVGCFRDHLVGTVRFLINNFLDVSSAIPS------------FTA  120

Query  670  LQIRRPSGDPQGMLNMGVALFDSASRSKPKYSEV  771
            +QIRRPSG  +G+LN+   + D +S + P  SE+
Sbjct  121  IQIRRPSGRFRGVLNVAALVIDGSSLA-PAVSEL  153



>ref|XP_009347863.1| PREDICTED: uncharacterized protein LOC103939495 [Pyrus x bretschneideri]
Length=271

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 87/150 (58%), Gaps = 12/150 (8%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            H+LEI L+SAQ L A S + R   TYAL WV+   K  + +D  G  NPTWN +  F+V 
Sbjct  13   HVLEINLVSAQGLKAPSVTLRRMQTYALAWVDSAHKIRSRLDKVGGENPTWNDRCLFKVP  72

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
              FL S+ S V+V+IY+V  FRD LVGTV+  + + L           +    F A+QIR
Sbjct  73   SGFLSSETSQVSVQIYAVGCFRDHLVGTVRFLINNFL--------DVSSTIPSFTAIQIR  124

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEV  771
            RPSG  +G+LN+   + D +S + P  SE+
Sbjct  125  RPSGRFRGVLNVAALVIDGSSLA-PAVSEL  153



>gb|KDP30266.1| hypothetical protein JCGZ_17048 [Jatropha curcas]
Length=200

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 96/161 (60%), Gaps = 15/161 (9%)
 Frame = +1

Query  334  ILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            ILEI LISAQ L   S S+R   TYA++ ++ + K  + ID  G  +P W  KF F+V  
Sbjct  3    ILEINLISAQGLNPPSSSRRRMQTYAVVSIDSSTKLRSRIDLDGGEDPIWGDKFLFKVTP  62

Query  505  DFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRR  684
            +FL  + ++V+VEI++V   RD L+GTV++ + ++       +     +   F+A+QIRR
Sbjct  63   EFLSGETTSVSVEIFAVGCLRDKLLGTVRLLISNI------PLFSQEMRTPSFVAMQIRR  116

Query  685  PSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDC-RDLL  804
            PSG  QG+LN+G  + D++      ++ + G S+ C RDL+
Sbjct  117  PSGRFQGLLNIGAIIHDASD-----FASLDGVSAICYRDLV  152



>emb|CAN79006.1| hypothetical protein VITISV_040896 [Vitis vinifera]
Length=380

 Score =   103 bits (257),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 99/194 (51%), Gaps = 10/194 (5%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             +LEI LIS QDL   S + R   T AL+WV+   K  T +D  G+ NPTWN KF FR  
Sbjct  27   QLLEIILISTQDLKPPSGNLRRMQTCALVWVDSANKLRTQVDRVGVENPTWNDKFIFRAS  86

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             DFL    S V VEIY+V   RD L+GTV+I + + L            +     A+QIR
Sbjct  87   SDFLACATSIVAVEIYAVGVIRDHLIGTVRILISNCLPAADLRSRNFAARSPSLTAVQIR  146

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGS-SSDCRDLLEKKMN-KFFPDSESAVEF  855
            RPSG    +LN+  A+ +++      ++ ++G+ + D  DL+ + +  +      +A   
Sbjct  147  RPSGRFHSVLNVAAAVVNASD-----FASLTGTLAIDHHDLMGQSLRCRRGHRQRTAKSE  201

Query  856  PAKGGSVCNSSAVN  897
               GG  C+ S  +
Sbjct  202  QLSGGESCDHSCAD  215



>ref|XP_004308328.1| PREDICTED: uncharacterized protein LOC101301728 [Fragaria vesca 
subsp. vesca]
Length=293

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 75/133 (56%), Gaps = 11/133 (8%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR---TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
             +LEI LIS Q L   S + R   TYA+ WV  + K  T +D  G  NPTWN +F F+V 
Sbjct  11   QVLEINLISGQGLKPPSGTLRRMKTYAVAWVESSHKIRTRVDKVGAENPTWNDRFLFKVS  70

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             +FL  + S + +EIY+V  FRD LVGTV++ + + L           +K   F ALQIR
Sbjct  71   SEFLARETSGITIEIYAVGSFRDHLVGTVRLILSNFL--------DLDSKIPSFTALQIR  122

Query  682  RPSGDPQGMLNMG  720
            R SG   G+LN+ 
Sbjct  123  RRSGRFHGVLNVA  135



>ref|XP_008798687.1| PREDICTED: uncharacterized protein LOC103713510 [Phoenix dactylifera]
Length=238

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 95/179 (53%), Gaps = 14/179 (8%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRT--YALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            H+LEI LISAQ L      +R   YA+ WV+P  K  T +D  G  NPTWN KF FRV  
Sbjct  4    HVLEINLISAQGLKPPFGLRRVQAYAVAWVDPAFKVRTRVDRTGGENPTWNDKFIFRVPA  63

Query  505  DFLGSDD-SAVNVEIYSVA-W-FRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQ  675
             FL  D  SAV++EIY+ A W   D L+GTV++ V +L       +         F A+ 
Sbjct  64   GFLADDSTSAVSIEIYAAAGWILPDPLLGTVRLLVGNL------RLLSRRRACPAFDAVG  117

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKF--FPDSESA  846
            IRRPSG   G+LN+G  L    S    + +  +  +   RDL+ K+ +K   FP + +A
Sbjct  118  IRRPSGRFHGILNVGATLLHCVSLVATE-ALAACPAVGYRDLMGKEASKIRRFPVTPAA  175



>ref|XP_007031704.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY02630.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=306

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 88/160 (55%), Gaps = 11/160 (7%)
 Frame = +1

Query  334  ILEITLISAQDLAAVS----KSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            +LE+  ISAQ L   S    +  +TYA+ WV+ + K  T +D  G  NPTWN KF F+V 
Sbjct  7    VLELNFISAQGLVHPSLIPDRHLKTYAVAWVDSSTKLHTRVDRVGGENPTWNDKFLFKVS  66

Query  502  DDFLGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             +FL +  S V+VEIY+   FRD L+G+V++ + H   P A +      K   F AL I 
Sbjct  67   PEFLFNKTSTVSVEIYAAGTFRDRLIGSVRLLI-HNFIPTASAAAM---KTPAFAALLIH  122

Query  682  RPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDL  801
             P G   G LN+G  + D  SR +   S+V  S+ D RDL
Sbjct  123  SPFGQFFGTLNVGGMVLD-GSRFQLALSKV--STIDYRDL  159



>ref|XP_006605265.1| PREDICTED: uncharacterized protein LOC102668124 [Glycine max]
Length=165

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 63/101 (62%), Gaps = 7/101 (7%)
 Frame = +1

Query  538  VEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRRPSGDPQGMLNM  717
            VEIYS AW R VL+GTV + V +LL PP R        K RF+ALQIRRPSG PQG+LN+
Sbjct  2    VEIYSHAWLRQVLIGTVAVLVTNLL-PPNRK------PKLRFVALQIRRPSGRPQGILNI  54

Query  718  GVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKFFPDSE  840
            G+ L DS  RS P YSE+S S+    D + K  N    D +
Sbjct  55   GINLLDSTMRSMPLYSELSSSAVGYWDNIIKNKNAKTEDDD  95



>ref|XP_008791481.1| PREDICTED: uncharacterized protein LOC103708363 [Phoenix dactylifera]
Length=244

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 81/141 (57%), Gaps = 13/141 (9%)
 Frame = +1

Query  328  HHILEITLISAQDLAAVSKSQRT--YALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVG  501
            +H LEI LI AQ L   +  +R   YA+ WV+P  K  T +D  G  NPTWN KF F V 
Sbjct  3    YHFLEINLICAQGLKPPAGFRRAQAYAVAWVDPAFKLRTRVDRTGGENPTWNDKFIFHVP  62

Query  502  DDFLGSD-DSAVNVEIYSVA-W-FRDVLVGTVKINVKHLLAPPARSIT-QDGNKKERFMA  669
              FL  D  SAV+VEIY+ A W   D L+GTV++ V +L     R ++ +DG     F A
Sbjct  63   AGFLADDSSSAVSVEIYATAGWILTDSLLGTVRLLVGNL-----RLLSRRDGCPV--FDA  115

Query  670  LQIRRPSGDPQGMLNMGVALF  732
            + IRRPSG   G+LN+G  L 
Sbjct  116  VGIRRPSGRLHGVLNVGAMLL  136



>gb|ABK22654.1| unknown [Picea sitchensis]
Length=203

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 84/160 (53%), Gaps = 19/160 (12%)
 Frame = +1

Query  337  LEITLISAQDLAAVS--KSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            +E+ +ISAQDL  V      R YA+++++P  K ST ID  G  NP WN     +  D+ 
Sbjct  18   IEVRIISAQDLEDVKLIGKMRCYAVLYIDPEHKASTRIDENGGINPFWNELLVLQADDEL  77

Query  511  LGSDDSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERF------MAL  672
            L  + +AVNV+IY+    RD LVGT +I +  +L        + G+    +      M +
Sbjct  78   LSQNMAAVNVDIYARGHMRDKLVGTSRILISQVL--------KGGDAANLYDNPIGCMPV  129

Query  673  QIRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDC  792
             +RRPSG PQG+LN+ +     A +   + S +S S  DC
Sbjct  130  LVRRPSGRPQGILNIWIP---PAGKFLLRRSSLSFSRVDC  166



>ref|XP_010914657.1| PREDICTED: uncharacterized protein LOC105039993 [Elaeis guineensis]
Length=251

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 93/179 (52%), Gaps = 14/179 (8%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQRT--YALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
             +LEI LISAQ L      +R   YA+ WV P  K  T +D  G  NPTWN KF FRV  
Sbjct  4    QLLEINLISAQSLKPPFGLRRVQAYAVAWVEPAFKVRTLVDRTGGENPTWNDKFIFRVPS  63

Query  505  DFLGSDD-SAVNVEIYSVA--WFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQ  675
             FL +D  S V VEIY+ A     D L+GTV++ V +L     R +++  +    F A+ 
Sbjct  64   GFLANDSASTVAVEIYAAAGRILPDPLLGTVRLLVGNL-----RLLSRRRDCPA-FDAVG  117

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKF--FPDSESA  846
            IRRPSG   G+LN+G  L    S    K      + S  RDL+ K+ +K   FP +  A
Sbjct  118  IRRPSGRFHGVLNVGATLLRCVSLVAAKALATCPAVS-YRDLMGKEASKIRRFPATPVA  175



>ref|XP_009400560.1| PREDICTED: uncharacterized protein LOC103984726 [Musa acuminata 
subsp. malaccensis]
Length=251

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 82/139 (59%), Gaps = 11/139 (8%)
 Frame = +1

Query  337  LEITLISAQDLAAVSKSQR--TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDF  510
            LEI LISAQ L     ++R   YA+IW++ + K  T +D  G  NPTWN KF FRV   F
Sbjct  11   LEINLISAQGLQPPGGNRRLQAYAVIWIDSSIKLRTLVDRVGGENPTWNDKFLFRVHPSF  70

Query  511  LGSDDS-AVNVEIYSV-AWF-RDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
            L  D   A +VEIY+   W+  D LVG+V+  V +L     R +++  ++   F A+ IR
Sbjct  71   LAYDSPCAYSVEIYAAGGWYLPDSLVGSVRFLVGNL-----RLLSRHSDRPV-FDAVGIR  124

Query  682  RPSGDPQGMLNMGVALFDS  738
            RPSG  QG+LN+G A+  S
Sbjct  125  RPSGRFQGVLNVGAAVLGS  143



>ref|XP_008679175.1| PREDICTED: uncharacterized protein LOC103654122 [Zea mays]
 gb|AFW64016.1| hypothetical protein ZEAMMB73_220242 [Zea mays]
Length=271

 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 89/167 (53%), Gaps = 17/167 (10%)
 Frame = +1

Query  331  HILEITLISAQDL--AAVSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
            H+LE+T+ISAQDL    + +  R YA+ W +  +K  T +D  G   PTWN +F FRV  
Sbjct  16   HLLEVTVISAQDLQRRRLGRRVRAYAVAWADARQKLRTGVDHAGGAAPTWNDRFLFRVDG  75

Query  505  DFLGSDDSAVNVEIYSVAWF-RDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             FL S+ +AV VE+        D ++G  +I V   + P   +         +  ALQ+R
Sbjct  76   AFLRSETAAVTVEVRGAGVLGGDTVLGVTRIVVSTFVRPAGGA---------QVAALQLR  126

Query  682  RP-SGDPQGMLNMGVALFDSASRSKPKYSEVSGS--SSDCRDLLEKK  813
            RP S  PQG++N+ VAL D+A    P    V GS  +   +DL+ ++
Sbjct  127  RPRSLRPQGIVNVAVALLDAA--RAPPLDGVPGSPDAVAVKDLVMRR  171



>ref|XP_010914471.1| PREDICTED: uncharacterized protein LOC105039856 [Elaeis guineensis]
Length=251

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 90/170 (53%), Gaps = 12/170 (7%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQ--RTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
             +LEI LISAQ L    + +  + YA+ WV P  K  T +D  G  NPTWN KF FRV  
Sbjct  4    QLLEINLISAQSLKPPFRLRHVQAYAVAWVEPAFKVRTLVDRTGGENPTWNDKFIFRVPS  63

Query  505  DFLGSDD-SAVNVEIYSVA--WFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQ  675
             FL +D  S V VEIY+ A     D L+GTV++ V +L     R +++  +    F A+ 
Sbjct  64   GFLANDSTSTVAVEIYAAAGRILPDPLLGTVRLLVGNL-----RLLSRRRDCPA-FDAVG  117

Query  676  IRRPSGDPQGMLNMGVALFDSASRSKPKYSEVSGSSSDCRDLLEKKMNKF  825
            IRRPSG   G+LN+G  +    S    K      + S  RDL+ K+ +K 
Sbjct  118  IRRPSGRFHGVLNVGATILRCVSLVAAKVLATCPAVS-YRDLMGKEASKI  166



>gb|ABK23345.1| unknown [Picea sitchensis]
Length=194

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 66/113 (58%), Gaps = 6/113 (5%)
 Frame = +1

Query  391  RTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFLGSDDSAVNVEIYSVAWFRD  570
            R YA+ +++P +K ST ID  G  NPTWN K      D+ L +  +A+ VEIYS +  RD
Sbjct  2    RCYAVAYIDPEQKASTRIDQDGGINPTWNEKLVLAADDELLSNVLAAITVEIYSYSHIRD  61

Query  571  VLVGTVKINVKHLL--APPARSITQDGNKKERFMALQIRRPSGDPQGMLNMGV  723
             LVGT +I +  LL    PA       +   + +A+Q+RRPS  PQG+LN+ V
Sbjct  62   KLVGTARILISDLLKGGDPANP----SDNPIQCIAVQVRRPSSRPQGILNVWV  110



>ref|XP_010245272.1| PREDICTED: uncharacterized protein LOC104588843 [Nelumbo nucifera]
Length=195

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 83/140 (59%), Gaps = 18/140 (13%)
 Frame = +1

Query  337  LEITLISAQDLAA--VSKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRV-GDD  507
            +E+ LISAQ L +    K  +TYA+ W+NP +K  + ID+ G +NPTWN KF F + G+ 
Sbjct  9    VELNLISAQGLNSGRWWKGMKTYAVSWINPTQKLRSRIDTVGRSNPTWNDKFIFVMDGER  68

Query  508  FLGSDDSAVNVEIYSVAWF-RDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIRR  684
             LG+  SA+ +EIY+V  F +D  +G V I + +L+             K  FMA+++  
Sbjct  69   DLGNSTSALEIEIYTVRRFWKDQCIGVVSIPLDNLM-------------KGGFMAIELHH  115

Query  685  P-SGDPQGMLNMGVALFDSA  741
            P SG  +G+LN+GV + D+ 
Sbjct  116  PSSGAVEGILNVGVTMLDNV  135



>gb|EAY87999.1| hypothetical protein OsI_09421 [Oryza sativa Indica Group]
Length=281

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 79/140 (56%), Gaps = 6/140 (4%)
 Frame = +1

Query  331  HILEITLISAQDLAAV--SKSQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGD  504
             +LE+T+ISAQDL      + +  YA+ W +   K  T +D  G  +PTWN +F FRV +
Sbjct  24   QLLEVTVISAQDLHRRLGRRVRAAYAVAWADVAHKLRTGVDLAGGADPTWNDRFLFRVDE  83

Query  505  DFLGSDDSAVNVEIYSVAWF-RDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQIR  681
             FL SD +AV VE+ +   F  D ++G  +I V   +     S +  G    +  ALQ+R
Sbjct  84   AFLRSDTAAVTVEVRAPRRFGGDAVLGVTRIVVSTFVGSA--SSSARGTTGRQVAALQLR  141

Query  682  RP-SGDPQGMLNMGVALFDS  738
            RP S  PQG++N+ VA+ D+
Sbjct  142  RPRSLRPQGIVNVAVAVLDA  161



>gb|AEW08214.1| hypothetical protein 2_3193_01, partial [Pinus radiata]
 gb|AFG52317.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52318.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52322.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52323.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52324.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52328.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52329.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52331.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52332.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 49/126 (39%), Positives = 72/126 (57%), Gaps = 8/126 (6%)
 Frame = +1

Query  358  AQDLAAVSK--SQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFLGSDDSA  531
            A+DL  V +    + YA+ +++P+ K ST ID  G  NP W+ K      D+ L +  +A
Sbjct  1    AEDLKNVKRIRKMKCYAVAYIDPDHKASTRIDQDGGINPNWHQKLVLAADDELLSNVLAA  60

Query  532  VNVEIYSVAWFRDVLVGTVKINVKHLL--APPARSITQDGNKKERFMALQIRRPSGDPQG  705
            + V+IYS +  RD LVGT +I V  LL    PA       +   + +A+Q+RRPSG PQG
Sbjct  61   ITVDIYSYSHIRDKLVGTARILVPDLLKGGDPANP----SDNPIQCIAVQVRRPSGRPQG  116

Query  706  MLNMGV  723
            +LN+ V
Sbjct  117  ILNIWV  122



>gb|AFG52320.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52321.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52326.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 8/126 (6%)
 Frame = +1

Query  358  AQDLAAVSK--SQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFLGSDDSA  531
            A+DL  V +    + YA+ +++P+ K ST ID  G  NP W+ K      D+ L +  +A
Sbjct  1    AEDLKNVKRIRKMKCYAVAYIDPDHKASTRIDQDGGINPNWHQKLVLAADDELLSNVLAA  60

Query  532  VNVEIYSVAWFRDVLVGTVKINVKHLL--APPARSITQDGNKKERFMALQIRRPSGDPQG  705
            + V+IYS +  RD LVGT +I V  LL    PA       +   +  A+Q+RRPSG PQG
Sbjct  61   ITVDIYSYSHIRDKLVGTARILVPDLLKGGDPANPF----DNPIQCSAVQVRRPSGRPQG  116

Query  706  MLNMGV  723
            +LN+ V
Sbjct  117  ILNIWV  122



>gb|AFG52315.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52316.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52319.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52325.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52327.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52330.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 8/126 (6%)
 Frame = +1

Query  358  AQDLAAVSK--SQRTYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFRVGDDFLGSDDSA  531
            A+DL  V +    + YA+ +++P+ K ST ID  G  NP W+ K      D+ L +  +A
Sbjct  1    AEDLKNVKRIRKMKCYAVAYIDPDHKASTRIDQDGGINPNWHQKLVLAADDELLSNVLAA  60

Query  532  VNVEIYSVAWFRDVLVGTVKINVKHLL--APPARSITQDGNKKERFMALQIRRPSGDPQG  705
            + V+IYS +  RD LVGT +I V  LL    PA       +   +  A+Q+RRPSG PQG
Sbjct  61   ITVDIYSYSHIRDKLVGTARILVPDLLKGGDPANP----SDNPIQCSAVQVRRPSGRPQG  116

Query  706  MLNMGV  723
            +LN+ V
Sbjct  117  ILNIWV  122



>ref|XP_003572941.1| PREDICTED: uncharacterized protein LOC100843074 [Brachypodium 
distachyon]
Length=278

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 87/177 (49%), Gaps = 12/177 (7%)
 Frame = +1

Query  331  HILEITLISAQDLAAVSKSQR-----TYALIWVNPNKKRSTSIDSKGLTNPTWNHKFSFR  495
            H+LE+T+ISAQDL              YA+ W +  +K  T +D  G  +PTWN +F FR
Sbjct  14   HLLEVTVISAQDLHRGRLGLGRRRVRAYAMAWTDGARKLRTGVDLAGGADPTWNDRFLFR  73

Query  496  VGDDFLGSDDSAVNVEIYSVAWFR--DVLVGTVKINVKHLLAPPARSITQDGNKKERFMA  669
            V   FL S+ ++V VE+         D ++G  +I V   ++         G ++    A
Sbjct  74   VDPGFLRSETASVAVEVRGARSLLGGDAVLGHTRIVVSAFVSASRGDGRPIGGRQ--VAA  131

Query  670  LQIRRP-SGDPQGMLNMGVALFDSASRSKPKYSEVSGSSS--DCRDLLEKKMNKFFP  831
            LQ+RRP S  PQG++N+ VAL D A+ + P      GS      +DL+     +  P
Sbjct  132  LQLRRPRSLRPQGIVNVAVALLDGATHAVPPVYNAPGSPDAFAVKDLMAVAARQLPP  188



>ref|XP_002989504.1| hypothetical protein SELMODRAFT_428112 [Selaginella moellendorffii]
 gb|EFJ09380.1| hypothetical protein SELMODRAFT_428112 [Selaginella moellendorffii]
Length=174

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 78/136 (57%), Gaps = 14/136 (10%)
 Frame = +1

Query  337  LEITLISAQDLAAVSKSQRT--YALIWVNPNK--KRSTSIDSKGLTNPTWNHKFSFRVGD  504
            LEI +ISAQ L+ VS  QRT  YA+ W++     K ST +D KG  NP+WN   +F V  
Sbjct  19   LEIHIISAQRLSKVSYFQRTRAYAVAWIDSQHETKLSTPVDRKGGRNPSWNAILTFYVDT  78

Query  505  DFLGSD---DSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQ  675
            D L      ++ + +EIY+ AW RD L+G+V++    L+A   + + +       FM + 
Sbjct  79   DDLVERHGINAGMTIEIYTKAWVRDKLIGSVRV----LIADLVKGMRESKGLCLSFMVI-  133

Query  676  IRRPSGDPQGMLNMGV  723
              RPSG  +G+LN+GV
Sbjct  134  --RPSGLRKGLLNLGV  147



>ref|XP_002964639.1| hypothetical protein SELMODRAFT_406042 [Selaginella moellendorffii]
 gb|EFJ34972.1| hypothetical protein SELMODRAFT_406042 [Selaginella moellendorffii]
Length=174

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 79/136 (58%), Gaps = 14/136 (10%)
 Frame = +1

Query  337  LEITLISAQDLAAVSKSQRT--YALIWVNPNK--KRSTSIDSKGLTNPTWNHKFSFRVG-  501
            LEI +ISAQ L+ VS  QRT  YA+ W++     K ST +D KG  NP+WN   +F V  
Sbjct  19   LEIHIISAQRLSKVSYFQRTRAYAVAWIDSQHETKLSTPVDRKGGRNPSWNAILTFYVDM  78

Query  502  DDFLGSD--DSAVNVEIYSVAWFRDVLVGTVKINVKHLLAPPARSITQDGNKKERFMALQ  675
            DD +     ++ + +EIY+ AW RD L+G+V++    L+A   + + +       FM + 
Sbjct  79   DDLVERHGINAGMTIEIYTKAWVRDKLIGSVRV----LIADLVKGMRESKGLCLSFMVI-  133

Query  676  IRRPSGDPQGMLNMGV  723
              RPSG  +G+LN+GV
Sbjct  134  --RPSGLRKGLLNLGV  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4015464122670