BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17258_g1_i1 len=416 path=[394:0-415]

Length=416
                                                                      Score     E

ref|XP_011093147.1|  PREDICTED: actin-depolymerizing factor 10-like     120   9e-32   
ref|XP_009771651.1|  PREDICTED: actin-depolymerizing factor 12-like     120   2e-31   
ref|XP_006339546.1|  PREDICTED: actin-depolymerizing factor 12-like     119   5e-31   
gb|EYU32098.1|  hypothetical protein MIMGU_mgv1a026462mg                118   8e-31   
ref|XP_011091992.1|  PREDICTED: actin-depolymerizing factor 10-like     118   1e-30   
ref|XP_009787751.1|  PREDICTED: actin-depolymerizing factor 10-like     117   2e-30   
ref|XP_009630108.1|  PREDICTED: actin-depolymerizing factor 10-like     117   3e-30   
ref|XP_009595762.1|  PREDICTED: actin-depolymerizing factor 10-like     117   3e-30   
ref|XP_007051847.1|  Actin depolymerizing factor 11                     117   3e-30   
emb|CDP08835.1|  unnamed protein product                                117   4e-30   
ref|XP_009793423.1|  PREDICTED: actin-depolymerizing factor 10-like     117   4e-30   
ref|XP_008804935.1|  PREDICTED: actin-depolymerizing factor isofo...    116   5e-30   
gb|KFK30636.1|  hypothetical protein AALP_AA6G007700                    119   5e-30   
ref|XP_009615468.1|  PREDICTED: actin-depolymerizing factor 10-like     116   6e-30   
ref|XP_006285474.1|  hypothetical protein CARUB_v10006893mg             115   9e-30   
ref|XP_010433613.1|  PREDICTED: actin-depolymerizing factor 7-like      115   1e-29   
ref|XP_010555668.1|  PREDICTED: actin-depolymerizing factor 7           115   1e-29   
ref|NP_194289.2|  actin depolymerizing factor 7                         115   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171680.1|  actin depolymerizing factor 11                        115   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304638.1|  hypothetical protein CARUB_v10011760mg             115   2e-29   
ref|XP_010479839.1|  PREDICTED: actin-depolymerizing factor 10          115   2e-29   
ref|XP_009106793.1|  PREDICTED: actin-depolymerizing factor 7           114   3e-29   
ref|XP_009111466.1|  PREDICTED: actin-depolymerizing factor 8           114   3e-29   
ref|XP_010327379.1|  PREDICTED: actin-depolymerizing factor 10-like     114   3e-29   
ref|XP_006396264.1|  hypothetical protein EUTSA_v10029050mg             114   4e-29   
sp|P30175.1|ADF_LILLO  RecName: Full=Actin-depolymerizing factor;...    114   4e-29   Lilium longiflorum [Easter lily]
ref|XP_002867603.1|  actin binding protein                              114   4e-29   
ref|XP_008794195.1|  PREDICTED: actin-depolymerizing factor-like        114   4e-29   
ref|XP_006341722.1|  PREDICTED: actin-depolymerizing factor 10-like     114   4e-29   
emb|CBI40336.3|  unnamed protein product                                117   5e-29   
ref|XP_010448409.1|  PREDICTED: actin-depolymerizing factor 7           114   5e-29   
ref|XP_002271495.1|  PREDICTED: actin-depolymerizing factor 10          114   5e-29   Vitis vinifera
ref|XP_009770352.1|  PREDICTED: actin-depolymerizing factor 7           114   6e-29   
gb|AAL91667.1|  pollen specific actin-depolymerizing factor 2           113   6e-29   Nicotiana tabacum [American tobacco]
ref|XP_009384093.1|  PREDICTED: actin-depolymerizing factor 1           113   7e-29   
ref|XP_002892045.1|  hypothetical protein ARALYDRAFT_887267             113   8e-29   
ref|XP_009386059.1|  PREDICTED: actin-depolymerizing factor             113   9e-29   
ref|XP_010053689.1|  PREDICTED: actin-depolymerizing factor             113   9e-29   
gb|KFK26837.1|  hypothetical protein AALP_AA8G300400                    113   1e-28   
ref|XP_009127248.1|  PREDICTED: actin-depolymerizing factor 12          112   1e-28   
ref|XP_010662752.1|  PREDICTED: actin-depolymerizing factor 1           112   1e-28   
ref|XP_010544380.1|  PREDICTED: actin-depolymerizing factor 8 iso...    112   1e-28   
ref|XP_009132530.1|  PREDICTED: actin-depolymerizing factor 12-like     112   1e-28   
ref|XP_010910598.1|  PREDICTED: actin-depolymerizing factor             114   2e-28   
ref|XP_010249803.1|  PREDICTED: actin-depolymerizing factor             112   2e-28   
ref|XP_009599636.1|  PREDICTED: actin-depolymerizing factor 7           112   2e-28   
emb|CDY38025.1|  BnaCnng08860D                                          113   2e-28   
ref|XP_010444761.1|  PREDICTED: actin-depolymerizing factor 12-like     112   2e-28   
gb|KCW71635.1|  hypothetical protein EUGRSUZ_E00162                     112   2e-28   
ref|XP_006418454.1|  hypothetical protein EUTSA_v10009057mg             112   2e-28   
ref|XP_002865909.1|  hypothetical protein ARALYDRAFT_495305             112   2e-28   
ref|XP_009414703.1|  PREDICTED: actin-depolymerizing factor-like        112   3e-28   
ref|XP_009118832.1|  PREDICTED: actin-depolymerizing factor 10 is...    112   3e-28   
ref|XP_010427310.1|  PREDICTED: actin-depolymerizing factor 8           112   3e-28   
ref|XP_009411533.1|  PREDICTED: actin-depolymerizing factor 1-like      112   3e-28   
emb|CDY51146.1|  BnaA09g51810D                                          116   4e-28   
ref|XP_006413292.1|  hypothetical protein EUTSA_v10026532mg             111   4e-28   
gb|EPS69954.1|  hypothetical protein M569_04811                         112   5e-28   
ref|XP_010672167.1|  PREDICTED: actin-depolymerizing factor 10          111   5e-28   
ref|XP_002509779.1|  actin depolymerizing factor, putative              111   5e-28   Ricinus communis
ref|XP_011084418.1|  PREDICTED: actin-depolymerizing factor 7           111   6e-28   
gb|EYU35082.1|  hypothetical protein MIMGU_mgv1a015967mg                111   6e-28   
ref|XP_006401834.1|  hypothetical protein EUTSA_v10014982mg             111   6e-28   
ref|XP_010317604.1|  PREDICTED: actin-depolymerizing factor 12          110   8e-28   
ref|XP_008438059.1|  PREDICTED: actin-depolymerizing factor 7-like      110   9e-28   
ref|XP_010521323.1|  PREDICTED: actin-depolymerizing factor 7-like      110   9e-28   
ref|NP_567182.1|  actin depolymerizing factor 8                         110   9e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482597.1|  PREDICTED: actin-depolymerizing factor 12          110   1e-27   
ref|XP_002872934.1|  hypothetical protein ARALYDRAFT_490501             110   1e-27   
ref|XP_010419619.1|  PREDICTED: actin-depolymerizing factor 8-like      110   1e-27   
emb|CDY07204.1|  BnaCnng02190D                                          113   1e-27   
ref|NP_568769.1|  actin depolymerizing factor 10                        110   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010908104.1|  PREDICTED: zinc finger CCHC domain-containin...    114   1e-27   
gb|KGN57376.1|  hypothetical protein Csa_3G182120                       110   1e-27   
gb|AAM61402.1|  actin depolymerizing factor-like                        110   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118831.1|  PREDICTED: actin-depolymerizing factor 10 is...    110   2e-27   
ref|XP_007143417.1|  hypothetical protein PHAVU_007G070500g             110   2e-27   
ref|XP_006353297.1|  PREDICTED: actin-depolymerizing factor 12-like     110   2e-27   
ref|XP_010456252.1|  PREDICTED: actin-depolymerizing factor 8-like      110   2e-27   
ref|XP_008393892.1|  PREDICTED: actin-depolymerizing factor 1           109   2e-27   
ref|XP_011080987.1|  PREDICTED: actin-depolymerizing factor-like        109   2e-27   
emb|CDY69995.1|  BnaCnng66250D                                          114   2e-27   
ref|XP_010537182.1|  PREDICTED: actin-depolymerizing factor 7-lik...    109   2e-27   
ref|NP_001053519.1|  Os04g0555700                                       109   2e-27   Oryza sativa Japonica Group [Japonica rice]
emb|CDY27075.1|  BnaA02g10950D                                          114   3e-27   
gb|KGN56524.1|  hypothetical protein Csa_3G122480                       109   3e-27   
ref|XP_009793756.1|  PREDICTED: actin-depolymerizing factor 7-like      109   3e-27   
ref|XP_010544379.1|  PREDICTED: actin-depolymerizing factor 8 iso...    110   3e-27   
ref|XP_009119731.1|  PREDICTED: actin-depolymerizing factor 10-like     109   3e-27   
gb|EYU19548.1|  hypothetical protein MIMGU_mgv1a016233mg                108   4e-27   
gb|KDP22276.1|  hypothetical protein JCGZ_26107                         108   4e-27   
gb|KDO76170.1|  hypothetical protein CISIN_1g046281mg                   108   4e-27   
gb|KHN26651.1|  Actin-depolymerizing factor 7                           108   4e-27   
ref|XP_011029243.1|  PREDICTED: actin-depolymerizing factor isofo...    108   4e-27   
ref|XP_010442763.1|  PREDICTED: actin-depolymerizing factor 12-like     108   5e-27   
ref|XP_002318237.1|  actin-depolymerizing factor family protein         108   5e-27   Populus trichocarpa [western balsam poplar]
emb|CDY38916.1|  BnaA03g12630D                                          113   5e-27   
ref|XP_002969368.1|  hypothetical protein SELMODRAFT_146459             108   5e-27   
gb|AAL91666.1|  pollen specific actin-depolymerizing factor 1           108   6e-27   Nicotiana tabacum [American tobacco]
ref|XP_002322471.2|  hypothetical protein POPTR_0015s13080g             108   6e-27   Populus trichocarpa [western balsam poplar]
ref|XP_008804936.1|  PREDICTED: zinc finger CCHC domain-containin...    112   6e-27   
gb|KHG23104.1|  Actin-depolymerizing factor 1                           108   6e-27   
ref|XP_006656880.1|  PREDICTED: actin-depolymerizing factor 6-like      108   7e-27   
ref|XP_006281290.1|  hypothetical protein CARUB_v10027340mg             108   9e-27   
gb|KDP25456.1|  hypothetical protein JCGZ_20612                         108   1e-26   
ref|XP_002273958.2|  PREDICTED: actin-depolymerizing factor 1-like      109   1e-26   Vitis vinifera
ref|XP_004496563.1|  PREDICTED: actin-depolymerizing factor 7-like      107   1e-26   
ref|XP_009767736.1|  PREDICTED: actin-depolymerizing factor 7-lik...    107   1e-26   
ref|XP_009397611.1|  PREDICTED: actin-depolymerizing factor 1-like      107   1e-26   
ref|XP_006363318.1|  PREDICTED: actin-depolymerizing factor 7-like      107   1e-26   
ref|XP_006476590.1|  PREDICTED: actin-depolymerizing factor 1-like      107   1e-26   
gb|KGN50293.1|  hypothetical protein Csa_5G165880                       107   1e-26   
ref|XP_009389157.1|  PREDICTED: actin-depolymerizing factor 1-like      107   2e-26   
ref|NP_001151716.1|  LOC100285352                                       107   2e-26   Zea mays [maize]
ref|XP_010537181.1|  PREDICTED: actin-depolymerizing factor 7-lik...    107   2e-26   
ref|XP_009120511.1|  PREDICTED: actin-depolymerizing factor 3-like      107   2e-26   
ref|XP_008437023.1|  PREDICTED: actin-depolymerizing factor 7           107   2e-26   
ref|NP_001047657.1|  Os02g0663800                                       107   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006439576.1|  hypothetical protein CICLE_v10023304mg             107   2e-26   
emb|CDY15154.1|  BnaC05g00330D                                          107   3e-26   
ref|XP_007038697.1|  Actin depolymerizing factor 7                      107   3e-26   
ref|XP_002298043.1|  actin-depolymerizing factor family protein         107   3e-26   Populus trichocarpa [western balsam poplar]
gb|KHG06644.1|  Actin-depolymerizing factor 1                           106   4e-26   
ref|XP_009404611.1|  PREDICTED: actin-depolymerizing factor 7-like      106   4e-26   
gb|KFK27528.1|  hypothetical protein AALP_AA8G395200                    106   5e-26   
ref|XP_007027090.1|  Actin depolymerizing factor 4 isoform 2            107   5e-26   
ref|XP_006490391.1|  PREDICTED: actin-depolymerizing factor 7-like      106   5e-26   
ref|XP_008244913.1|  PREDICTED: actin-depolymerizing factor 10          106   6e-26   
ref|XP_007218574.1|  hypothetical protein PRUPE_ppa013108mg             105   6e-26   
gb|ADI78873.1|  actin-depolymerizing factor                             105   6e-26   
ref|XP_009131962.1|  PREDICTED: actin-depolymerizing factor 3           105   7e-26   
gb|AEW90956.1|  actin depolymerizing factor 4-2                         105   7e-26   
gb|KHG18554.1|  Actin-depolymerizing factor                             105   7e-26   
ref|XP_002448300.1|  hypothetical protein SORBIDRAFT_06g024870          105   8e-26   Sorghum bicolor [broomcorn]
gb|EYU18949.1|  hypothetical protein MIMGU_mgv1a015984mg                105   9e-26   
gb|AEP25120.1|  actin depolymerising factor                             105   1e-25   
gb|AGW22223.1|  actin-depolymerizing factor 4                           105   1e-25   
ref|XP_004953378.1|  PREDICTED: actin-depolymerizing factor 1-like      105   1e-25   
ref|XP_007040194.1|  Actin depolymerizing factor 8                      105   1e-25   
gb|KDO72931.1|  hypothetical protein CISIN_1g032504mg                   104   1e-25   
ref|XP_011016059.1|  PREDICTED: actin-depolymerizing factor 2-like      105   1e-25   
ref|XP_006424770.1|  hypothetical protein CICLE_v10029538mg             105   1e-25   
ref|XP_009421345.1|  PREDICTED: actin-depolymerizing factor 7-like      105   1e-25   
ref|XP_004240732.1|  PREDICTED: actin-depolymerizing factor 7           105   1e-25   
ref|XP_009767730.1|  PREDICTED: uncharacterized protein LOC104218...    108   1e-25   
ref|XP_009387944.1|  PREDICTED: zinc finger CCHC domain-containin...    109   1e-25   
ref|XP_006843593.1|  hypothetical protein AMTR_s00007p00126220          105   1e-25   
ref|XP_010535543.1|  PREDICTED: actin-depolymerizing factor 4           105   1e-25   
emb|CDX80216.1|  BnaC09g35260D                                          107   1e-25   
gb|EYU25097.1|  hypothetical protein MIMGU_mgv11b015928mg               104   2e-25   
ref|XP_010529845.1|  PREDICTED: actin-depolymerizing factor 2-like      104   2e-25   
ref|XP_011042674.1|  PREDICTED: actin-depolymerizing factor 2-lik...    104   2e-25   
ref|XP_007016496.1|  Actin depolymerizing factor 4                      104   2e-25   
ref|XP_010260094.1|  PREDICTED: actin-depolymerizing factor 2-like      104   2e-25   
ref|XP_011024249.1|  PREDICTED: actin-depolymerizing factor 1-lik...    103   2e-25   
gb|AEW90955.1|  actin depolymerizing factor 4-1                         104   2e-25   
gb|KGN58886.1|  hypothetical protein Csa_3G734880                       104   2e-25   
ref|XP_010253266.1|  PREDICTED: actin-depolymerizing factor 2           104   2e-25   
ref|XP_002314194.1|  actin-depolymerizing factor 3 family protein       104   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_008385227.1|  PREDICTED: actin-depolymerizing factor 1-like      104   3e-25   
ref|XP_009358343.1|  PREDICTED: actin-depolymerizing factor 1-like      104   3e-25   
dbj|BAK04382.1|  predicted protein                                      104   3e-25   
ref|XP_008357628.1|  PREDICTED: actin-depolymerizing factor 1-like      104   3e-25   
ref|XP_010096647.1|  Actin-depolymerizing factor 2                      104   3e-25   
ref|XP_006445079.1|  hypothetical protein CICLE_v10023747mg             103   3e-25   
gb|EPS73519.1|  actin-depolymerizing factor                             104   3e-25   
ref|XP_004142080.1|  PREDICTED: actin-depolymerizing factor 1-like      103   3e-25   
ref|XP_006400899.1|  hypothetical protein EUTSA_v10014975mg             103   4e-25   
gb|KHN05922.1|  Actin-depolymerizing factor 2                           103   4e-25   
ref|XP_004140838.1|  PREDICTED: uncharacterized protein LOC101212555    108   4e-25   
ref|XP_009353719.1|  PREDICTED: actin-depolymerizing factor 1-like      103   4e-25   
ref|XP_002299887.1|  hypothetical protein POPTR_0001s24330g             103   4e-25   Populus trichocarpa [western balsam poplar]
ref|XP_004157224.1|  PREDICTED: uncharacterized LOC101212555            108   4e-25   
ref|XP_008439227.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    108   4e-25   
gb|KDO72933.1|  hypothetical protein CISIN_1g032504mg                   102   4e-25   
emb|CAA18167.1|  actin depolymerizing factor-like protein               103   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008447631.1|  PREDICTED: actin-depolymerizing factor 1-like      103   4e-25   
ref|XP_004142738.1|  PREDICTED: actin-depolymerizing factor 2-like      103   5e-25   
ref|XP_009357677.1|  PREDICTED: actin-depolymerizing factor 1           103   5e-25   
ref|XP_007218580.1|  hypothetical protein PRUPE_ppa013189mg             103   5e-25   
ref|XP_008463478.1|  PREDICTED: actin-depolymerizing factor 2 iso...    103   6e-25   
ref|XP_002314195.1|  actin-depolymerizing factor family protein         103   6e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009388628.1|  PREDICTED: actin-depolymerizing factor 7           103   6e-25   
ref|XP_007144457.1|  hypothetical protein PHAVU_007G157800g             103   6e-25   
ref|NP_001148898.1|  actin-depolymerizing factor                        103   6e-25   Zea mays [maize]
ref|XP_008385142.1|  PREDICTED: actin-depolymerizing factor 1-like      103   6e-25   
ref|XP_002311154.2|  hypothetical protein POPTR_0008s05210g             105   6e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010533658.1|  PREDICTED: actin-depolymerizing factor 8-like      103   6e-25   
ref|XP_006846080.1|  hypothetical protein AMTR_s00012p00089320          103   6e-25   
gb|KCW88917.1|  hypothetical protein EUGRSUZ_A01245                     102   6e-25   
gb|ABD63906.1|  actin depolymerizing factor 2                           103   7e-25   Gossypium hirsutum [American cotton]
ref|XP_006647644.1|  PREDICTED: actin-depolymerizing factor 1-like      103   7e-25   
gb|ACR38016.1|  unknown                                                 103   7e-25   Zea mays [maize]
ref|XP_008343560.1|  PREDICTED: actin-depolymerizing factor 1           103   7e-25   
gb|ABD66505.1|  actin depolymerizing factor 3                           103   7e-25   Gossypium hirsutum [American cotton]
emb|CDY00526.1|  BnaA10g07470D                                          102   9e-25   
emb|CDX88730.1|  BnaA03g09190D                                          103   9e-25   
ref|XP_011077447.1|  PREDICTED: actin-depolymerizing factor 1-like      103   9e-25   
ref|XP_010669849.1|  PREDICTED: actin-depolymerizing factor 4-like      103   9e-25   
gb|KDP35600.1|  hypothetical protein JCGZ_09038                         102   9e-25   
ref|XP_010553292.1|  PREDICTED: actin-depolymerizing factor 1           102   9e-25   
ref|XP_010910431.1|  PREDICTED: actin-depolymerizing factor-like        102   9e-25   
ref|XP_010455704.1|  PREDICTED: actin-depolymerizing factor 3           102   9e-25   
ref|XP_008442569.1|  PREDICTED: actin-depolymerizing factor 2-like      102   9e-25   
gb|ADV04049.1|  actin depolymerizing factor 4                           102   9e-25   
ref|XP_006606908.1|  PREDICTED: uncharacterized protein LOC100783153    107   9e-25   
gb|ABK94603.1|  unknown                                                 102   9e-25   Populus trichocarpa [western balsam poplar]
emb|CDX71068.1|  BnaC03g11520D                                          103   1e-24   
ref|XP_009337572.1|  PREDICTED: actin-depolymerizing factor 1-like      102   1e-24   
gb|EYU36258.1|  hypothetical protein MIMGU_mgv1a015971mg                102   1e-24   
gb|AEZ00870.1|  putative actin depolymerizing factor protein            103   1e-24   
gb|KCW50259.1|  hypothetical protein EUGRSUZ_J00048                     102   1e-24   
ref|XP_009593022.1|  PREDICTED: actin-depolymerizing factor 2-like      102   1e-24   
ref|XP_010031003.1|  PREDICTED: actin-depolymerizing factor 2-like      102   1e-24   
ref|XP_006424771.1|  hypothetical protein CICLE_v10029538mg             102   1e-24   
gb|KCW88915.1|  hypothetical protein EUGRSUZ_A01245                     102   1e-24   
ref|XP_011000294.1|  PREDICTED: actin-depolymerizing factor 2-like      102   1e-24   
ref|XP_006590210.1|  PREDICTED: uncharacterized protein LOC100804471    106   1e-24   
ref|XP_010047513.1|  PREDICTED: actin-depolymerizing factor 2           102   1e-24   
gb|AFN53688.1|  putative actin-depolymerizing factor 12                 106   1e-24   
gb|KCW88916.1|  hypothetical protein EUGRSUZ_A01245                     101   1e-24   
ref|XP_004495011.1|  PREDICTED: actin-depolymerizing factor 2-like      102   1e-24   
ref|XP_002284292.1|  PREDICTED: actin-depolymerizing factor 2           102   1e-24   Vitis vinifera
gb|EAY95118.1|  hypothetical protein OsI_16935                          106   2e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_009137539.1|  PREDICTED: actin-depolymerizing factor-like        102   2e-24   
gb|EEE61469.1|  hypothetical protein OsJ_15732                          106   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148445.1|  actin-depolymerizing factor                        102   2e-24   Zea mays [maize]
gb|ABD66508.1|  actin depolymerizing factor 6                           102   2e-24   Gossypium hirsutum [American cotton]
ref|XP_002303579.1|  actin-depolymerizing factor family protein         102   2e-24   Populus trichocarpa [western balsam poplar]
gb|AAR23800.1|  putative actin-depolymerizing factor 2                  102   2e-24   Helianthus annuus
sp|Q9FVI1.1|ADF2_PETHY  RecName: Full=Actin-depolymerizing factor...    102   2e-24   Petunia x hybrida [garden petunia]
ref|XP_004172071.1|  PREDICTED: actin-depolymerizing factor 1-like      102   2e-24   
ref|XP_006843087.1|  hypothetical protein AMTR_s00140p00036970          102   2e-24   
gb|KDP29838.1|  hypothetical protein JCGZ_18413                         102   2e-24   
emb|CDY31909.1|  BnaC09g28350D                                          101   2e-24   
ref|XP_002533101.1|  actin depolymerizing factor, putative              102   2e-24   Ricinus communis
ref|XP_011030201.1|  PREDICTED: uncharacterized protein LOC105129717    105   2e-24   
ref|XP_009109200.1|  PREDICTED: actin-depolymerizing factor-like        102   2e-24   
ref|XP_009601830.1|  PREDICTED: uncharacterized protein LOC104097027    106   2e-24   
ref|XP_008371032.1|  PREDICTED: actin-depolymerizing factor 1           102   2e-24   
ref|XP_006436042.1|  hypothetical protein CICLE_v10033029mg             102   2e-24   
ref|XP_007206123.1|  hypothetical protein PRUPE_ppa013110mg             102   2e-24   
dbj|BAK06235.1|  predicted protein                                      102   2e-24   
ref|XP_002864656.1|  hypothetical protein ARALYDRAFT_496124             102   2e-24   
ref|NP_001238519.1|  uncharacterized protein LOC100499953               101   2e-24   
gb|AFK48761.1|  unknown                                                 101   3e-24   
ref|XP_004294585.1|  PREDICTED: actin-depolymerizing factor 2-lik...    102   3e-24   
ref|XP_002299888.1|  actin-depolymerizing factor family protein         101   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_009775372.1|  PREDICTED: actin-depolymerizing factor 2-like      101   3e-24   
ref|XP_011048781.1|  PREDICTED: uncharacterized protein LOC105142716    106   3e-24   
ref|XP_008776502.1|  PREDICTED: actin-depolymerizing factor 7           101   3e-24   
ref|NP_568915.2|  actin depolymerizing factor 3                         101   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|EPS60626.1|  hypothetical protein M569_14175                         101   3e-24   
ref|XP_007218573.1|  hypothetical protein PRUPE_ppa013105mg             101   3e-24   
ref|XP_010031001.1|  PREDICTED: actin-depolymerizing factor 2-like      101   3e-24   
ref|XP_004137944.1|  PREDICTED: actin-depolymerizing factor 2-like      102   4e-24   
ref|XP_003524462.1|  PREDICTED: actin-depolymerizing factor 7-like      102   4e-24   
ref|XP_009591841.1|  PREDICTED: actin-depolymerizing factor 2-like      101   4e-24   
ref|XP_010922979.1|  PREDICTED: actin-depolymerizing factor 7-like      103   4e-24   
ref|XP_008377514.1|  PREDICTED: uncharacterized protein LOC103440...    105   4e-24   
ref|XP_009612959.1|  PREDICTED: actin-depolymerizing factor 2-like      101   4e-24   
ref|XP_007211217.1|  hypothetical protein PRUPE_ppa013153mg             101   4e-24   
ref|XP_010669850.1|  PREDICTED: actin-depolymerizing factor 4           101   4e-24   
ref|XP_009342975.1|  PREDICTED: actin-depolymerizing factor 7           101   4e-24   
ref|NP_851227.1|  actin depolymerizing factor 3                         101   4e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDX91636.1|  BnaC02g15240D                                          100   5e-24   
gb|ABD66503.1|  actin depolymerizing factor 7                           101   5e-24   Gossypium hirsutum [American cotton]
gb|ACJ84058.1|  unknown                                                 100   5e-24   Medicago truncatula
ref|XP_009371344.1|  PREDICTED: uncharacterized protein LOC103960584    105   6e-24   
ref|XP_003637508.1|  Actin-depolymerizing factor                        100   6e-24   
gb|KCW46430.1|  hypothetical protein EUGRSUZ_K00262                     100   6e-24   
ref|XP_009586917.1|  PREDICTED: actin-depolymerizing factor 1           100   6e-24   
ref|XP_009420088.1|  PREDICTED: actin-depolymerizing factor 7-like      100   6e-24   
emb|CDP05195.1|  unnamed protein product                                100   6e-24   
ref|XP_010514926.1|  PREDICTED: actin-depolymerizing factor 1           100   6e-24   
gb|AEJ88268.1|  putative actin-depolymerizing factor                    100   7e-24   
ref|XP_002510785.1|  actin depolymerizing factor, putative              105   8e-24   Ricinus communis
gb|AAT42170.1|  putative actin depolymerizing factor                    105   8e-24   Sorghum bicolor [broomcorn]
emb|CAL25339.1|  actin-depolymerizing factor                            100   9e-24   Platanus x hispanica [London plane tree]
ref|XP_009406977.1|  PREDICTED: actin-depolymerizing factor 2 iso...    100   9e-24   
ref|XP_004503768.1|  PREDICTED: actin-depolymerizing factor 7-like      100   9e-24   
ref|XP_006365713.1|  PREDICTED: actin-depolymerizing factor 2-like      100   9e-24   
sp|Q9FVI2.1|ADF1_PETHY  RecName: Full=Actin-depolymerizing factor...    100   1e-23   
emb|CAJ38384.1|  actin-depolymerizing factor                            100   1e-23   
gb|AFN53632.1|  actin-depolymerizing factor 12                          103   1e-23   
emb|CBI22738.3|  unnamed protein product                                100   1e-23   
gb|EPS63340.1|  hypothetical protein M569_11446                         100   1e-23   
ref|XP_008377508.1|  PREDICTED: actin-depolymerizing factor 7-lik...    100   1e-23   
ref|XP_011094831.1|  PREDICTED: actin-depolymerizing factor 1 iso...    100   1e-23   
ref|XP_008376578.1|  PREDICTED: actin-depolymerizing factor 7 iso...    100   1e-23   
ref|XP_009600590.1|  PREDICTED: actin-depolymerizing factor 2           100   1e-23   
ref|XP_009400269.1|  PREDICTED: actin-depolymerizing factor-like      99.8    1e-23   
emb|CDX92721.1|  BnaC07g39790D                                          101   1e-23   
ref|XP_010503215.1|  PREDICTED: actin-depolymerizing factor 1-like      100   1e-23   
gb|ABD66504.1|  actin depolymerizing factor 8                           100   1e-23   
gb|AEJ90198.1|  actin depolymerizing factor 1                           100   1e-23   
ref|XP_004236758.1|  PREDICTED: actin-depolymerizing factor 2           100   1e-23   
gb|KHN16833.1|  Actin-depolymerizing factor 7                           100   1e-23   
ref|XP_003592288.1|  Actin depolymerizing factor                        105   1e-23   
gb|AES62539.2|  cofilin/actin-depolymerizing factor-like protein        105   1e-23   
ref|XP_009416252.1|  PREDICTED: actin-depolymerizing factor 7-like    99.8    2e-23   
ref|XP_006341057.1|  PREDICTED: actin-depolymerizing factor 1-like    99.8    2e-23   
gb|ACB32233.1|  actin-depolymerizing factor 1                         99.8    2e-23   
gb|EYU26572.1|  hypothetical protein MIMGU_mgv1a015955mg              99.8    2e-23   
gb|KHN21743.1|  Actin-depolymerizing factor 7                         99.4    2e-23   
ref|XP_004149045.1|  PREDICTED: actin-depolymerizing factor 2-lik...  99.8    2e-23   
ref|XP_009150048.1|  PREDICTED: actin-depolymerizing factor 2         99.8    2e-23   
ref|NP_566882.1|  actin depolymerizing factor 2                       99.8    2e-23   
gb|KHN48988.1|  Actin-depolymerizing factor 2                         99.8    2e-23   
gb|KHG04895.1|  Actin-depolymerizing factor 10 -like protein          99.4    2e-23   
ref|XP_008234462.1|  PREDICTED: uncharacterized protein LOC103333411    103   2e-23   
gb|ABK26220.1|  unknown                                               99.4    2e-23   
ref|XP_006292028.1|  hypothetical protein CARUB_v10018217mg           99.4    2e-23   
gb|AET05009.2|  cofilin/actin-depolymerizing factor-like protein      99.4    2e-23   
gb|ACR34799.1|  unknown                                               99.4    2e-23   
gb|ABK22764.1|  unknown                                               99.4    2e-23   
ref|XP_008369858.1|  PREDICTED: actin-depolymerizing factor 2-like    99.4    2e-23   
gb|ADV02778.1|  actin depolymerizing factor 1                         99.4    2e-23   
gb|ABX79380.1|  actin-depolymerizing factor                           99.4    2e-23   
ref|XP_007027089.1|  Actin depolymerizing factor 4 isoform 1            100   2e-23   
ref|XP_004294586.1|  PREDICTED: actin-depolymerizing factor 2-lik...  99.4    3e-23   
ref|NP_001105463.1|  actin-depolymerizing factor 1                    99.4    3e-23   
ref|XP_008387742.1|  PREDICTED: actin-depolymerizing factor 2-like    99.8    3e-23   
ref|XP_010426028.1|  PREDICTED: actin-depolymerizing factor 1-like    99.0    3e-23   
ref|XP_010503214.1|  PREDICTED: actin-depolymerizing factor 2         99.0    3e-23   
ref|XP_003532683.1|  PREDICTED: actin-depolymerizing factor 7-like    99.0    3e-23   
ref|XP_009346957.1|  PREDICTED: actin-depolymerizing factor 1 iso...  98.6    3e-23   
gb|ACU23570.1|  unknown                                               99.0    3e-23   
emb|CDP06641.1|  unnamed protein product                              99.8    3e-23   
ref|XP_009382377.1|  PREDICTED: actin-depolymerizing factor 1-like    99.0    3e-23   
emb|CAJ38388.1|  actin-depolymerizing factor                          99.0    3e-23   
ref|XP_009346958.1|  PREDICTED: actin-depolymerizing factor 1 iso...  99.0    3e-23   
ref|XP_010937681.1|  PREDICTED: actin-depolymerizing factor 7-like    99.0    3e-23   
ref|XP_008376580.1|  PREDICTED: uncharacterized protein LOC103439...    102   3e-23   
ref|XP_009340028.1|  PREDICTED: uncharacterized protein LOC103932...    102   3e-23   
ref|XP_009374667.1|  PREDICTED: actin-depolymerizing factor 2-lik...  99.0    4e-23   
ref|XP_010055150.1|  PREDICTED: actin-depolymerizing factor 8         98.6    4e-23   
gb|AHH02371.1|  actin depolymerizing factor 2                         97.1    4e-23   
ref|XP_011076485.1|  PREDICTED: uncharacterized protein C683.02c        102   4e-23   
dbj|BAB10533.1|  actin depolymerizing factor-like                     98.2    5e-23   
ref|XP_004246462.1|  PREDICTED: actin-depolymerizing factor 1         98.6    5e-23   
ref|XP_006281292.1|  hypothetical protein CARUB_v10027342mg           98.6    5e-23   
gb|ABK23520.1|  unknown                                               98.6    5e-23   
gb|AFK48601.1|  unknown                                               98.2    5e-23   
ref|XP_010426027.1|  PREDICTED: actin-depolymerizing factor 2-like    98.2    5e-23   
gb|EMS50122.1|  Actin-depolymerizing factor 4                         99.4    6e-23   
emb|CDY50194.1|  BnaA03g47540D                                          100   6e-23   
ref|XP_010920670.1|  PREDICTED: actin-depolymerizing factor 7         98.2    6e-23   
gb|AAC13618.1|  Similar to actin binding protein; F6N23.12            98.2    6e-23   
ref|XP_002284029.1|  PREDICTED: actin-depolymerizing factor 2-lik...  98.2    6e-23   
ref|XP_006292022.1|  hypothetical protein CARUB_v10018211mg           98.2    6e-23   
ref|XP_008233662.1|  PREDICTED: uncharacterized protein LOC103332693    103   6e-23   
ref|XP_009406976.1|  PREDICTED: actin-depolymerizing factor 7 iso...  98.2    7e-23   
ref|XP_007160047.1|  hypothetical protein PHAVU_002G288100g           99.4    7e-23   
gb|AFK35836.1|  unknown                                               98.2    7e-23   
ref|XP_003611106.1|  Actin depolymerizing factor                      98.2    7e-23   
ref|XP_004249528.1|  PREDICTED: actin-depolymerizing factor 1-like    97.8    7e-23   
ref|XP_002877448.1|  hypothetical protein ARALYDRAFT_484979           97.8    8e-23   
ref|NP_001236448.1|  uncharacterized protein LOC100305514             97.8    9e-23   
ref|XP_008788089.1|  PREDICTED: actin-depolymerizing factor 7-like    97.8    9e-23   
ref|XP_006586815.1|  PREDICTED: actin-depolymerizing factor 2-like    97.8    1e-22   
ref|XP_002528457.1|  actin depolymerizing factor, putative            97.8    1e-22   
ref|XP_007009414.1|  Actin depolymerizing factor 4 isoform 2            101   1e-22   
ref|XP_011027144.1|  PREDICTED: actin-depolymerizing factor 1-like    97.8    1e-22   
ref|XP_009419950.1|  PREDICTED: actin-depolymerizing factor 4         97.4    1e-22   
gb|ABK21557.1|  unknown                                               98.2    1e-22   
ref|XP_010514925.1|  PREDICTED: actin-depolymerizing factor 2-like    97.4    1e-22   
ref|XP_011094830.1|  PREDICTED: actin-depolymerizing factor 1 iso...  97.8    1e-22   
ref|XP_002316301.1|  actin-depolymerizing factor family protein       97.4    1e-22   
ref|XP_004302775.1|  PREDICTED: actin-depolymerizing factor 3-lik...  97.4    1e-22   
gb|KDP28647.1|  hypothetical protein JCGZ_14418                       97.4    1e-22   
emb|CBI31711.3|  unnamed protein product                              99.0    1e-22   
ref|XP_008380707.1|  PREDICTED: actin-depolymerizing factor 2-like    95.9    1e-22   
ref|XP_006418977.1|  hypothetical protein EUTSA_v10002714mg           97.4    1e-22   
ref|XP_007009413.1|  Actin depolymerizing factor 4 isoform 1            102   1e-22   
ref|XP_010038440.1|  PREDICTED: uncharacterized protein LOC104426974    101   1e-22   
ref|XP_007206122.1|  hypothetical protein PRUPE_ppa013109mg           97.4    1e-22   
ref|XP_003594440.1|  Actin depolymerizing factor                      97.1    1e-22   
ref|XP_004981256.1|  PREDICTED: actin-depolymerizing factor 3-like    97.1    1e-22   
ref|XP_002439159.1|  hypothetical protein SORBIDRAFT_09g001500        97.1    2e-22   
gb|AFK45315.1|  unknown                                               97.1    2e-22   
ref|XP_007158489.1|  hypothetical protein PHAVU_002G156700g           97.1    2e-22   
ref|XP_003630533.1|  Actin depolymerizing factor                      97.1    2e-22   
ref|XP_009126640.1|  PREDICTED: actin-depolymerizing factor 4 iso...  97.1    2e-22   
ref|XP_006650806.1|  PREDICTED: actin-depolymerizing factor 4-like    97.1    2e-22   
gb|ACJ84098.1|  unknown                                               97.1    2e-22   
gb|ABC49719.1|  actin depolymerizing factor-like protein              97.1    2e-22   
ref|XP_004511586.1|  PREDICTED: actin-depolymerizing factor 7-lik...  96.7    2e-22   
emb|CDX99133.1|  BnaA06g18240D                                        97.4    2e-22   
emb|CDX90057.1|  BnaA10g00250D                                        96.7    2e-22   
ref|XP_008651860.1|  PREDICTED: actin-depolymerizing factor 1 iso...  97.1    2e-22   
ref|XP_010909358.1|  PREDICTED: actin-depolymerizing factor 7-like    96.7    2e-22   
ref|NP_001051721.1|  Os03g0820600                                     96.7    2e-22   
ref|XP_009388955.1|  PREDICTED: actin-depolymerizing factor 11-like   97.1    2e-22   
dbj|BAK00003.1|  predicted protein                                    96.7    2e-22   
ref|XP_010534301.1|  PREDICTED: actin-depolymerizing factor 1-like    96.7    2e-22   
emb|CDX86048.1|  BnaC03g55630D                                        97.4    2e-22   
ref|XP_006339034.1|  PREDICTED: actin-depolymerizing factor 1-like    96.7    3e-22   
ref|XP_010245480.1|  PREDICTED: actin-depolymerizing factor 1-like    96.3    3e-22   
ref|XP_004240356.1|  PREDICTED: actin-depolymerizing factor 2-like    96.3    3e-22   
ref|XP_010558792.1|  PREDICTED: actin-depolymerizing factor 2-lik...  96.3    3e-22   
ref|XP_008457551.1|  PREDICTED: actin-depolymerizing factor 2         96.3    3e-22   
gb|EEE67172.1|  hypothetical protein OsJ_24260                        95.1    3e-22   
gb|EEC82036.1|  hypothetical protein OsI_26009                        96.3    3e-22   
ref|XP_004486422.1|  PREDICTED: actin-depolymerizing factor 2-like    96.3    3e-22   
emb|CDY72027.1|  BnaCnng75650D                                        95.5    3e-22   
ref|XP_009767744.1|  PREDICTED: actin-depolymerizing factor 7-lik...  95.9    4e-22   
ref|NP_001059648.1|  Os07g0484200                                     96.3    4e-22   
ref|XP_001777224.1|  predicted protein                                96.3    4e-22   
ref|XP_006491074.1|  PREDICTED: actin-depolymerizing factor 10-like   95.9    4e-22   
ref|XP_010238336.1|  PREDICTED: actin-depolymerizing factor 9         95.9    4e-22   
gb|EAY86979.1|  hypothetical protein OsI_08373                        95.9    4e-22   
gb|AFW74929.1|  hypothetical protein ZEAMMB73_452408                  95.1    5e-22   
gb|AIZ95472.1|  actin-depolymerizing factor 3                         95.9    5e-22   
ref|XP_008647356.1|  PREDICTED: hypothetical protein isoform X1       95.9    5e-22   
ref|NP_001131557.1|  hypothetical protein                             95.5    5e-22   
ref|XP_007162541.1|  hypothetical protein PHAVU_001G160700g           95.9    5e-22   
gb|EAY92368.1|  hypothetical protein OsI_14097                        96.3    5e-22   
ref|XP_008793580.1|  PREDICTED: actin-depolymerizing factor isofo...  95.1    5e-22   
ref|XP_009603156.1|  PREDICTED: actin-depolymerizing factor           95.9    5e-22   
ref|XP_004133872.1|  PREDICTED: actin-depolymerizing factor 10-like   95.5    5e-22   
ref|XP_010543331.1|  PREDICTED: actin-depolymerizing factor 1-like    95.5    6e-22   
ref|XP_008793579.1|  PREDICTED: actin-depolymerizing factor 11 is...  95.9    6e-22   
ref|XP_007035112.1|  Actin depolymerizing factor 6                    95.9    6e-22   
gb|EMS51874.1|  Actin-depolymerizing factor 6                         98.6    6e-22   
ref|XP_004152385.1|  PREDICTED: actin-depolymerizing factor 7-like    95.1    7e-22   
gb|AAD09110.1|  actin depolymerizing factor 4                         95.5    7e-22   
ref|XP_007147534.1|  hypothetical protein PHAVU_006G132700g           95.5    7e-22   
emb|CDY31586.1|  BnaA10g12850D                                        95.1    7e-22   
ref|XP_010227222.1|  PREDICTED: uncharacterized protein LOC100826202    100   7e-22   
ref|NP_851228.1|  actin depolymerizing factor 4                       95.5    7e-22   
ref|XP_003629907.1|  Actin depolymerizing factor-like protein         95.5    7e-22   
gb|AFK34162.1|  unknown                                               95.5    8e-22   
ref|XP_002468086.1|  hypothetical protein SORBIDRAFT_01g039300        95.5    8e-22   
gb|ABH11462.1|  actin depolymerizing factor                           93.6    1e-21   
gb|ACG37280.1|  actin-depolymerizing factor 1                         95.1    1e-21   
ref|XP_010455715.1|  PREDICTED: actin-depolymerizing factor 4         95.1    1e-21   
ref|XP_003538360.1|  PREDICTED: actin-depolymerizing factor 7-lik...  95.1    1e-21   
dbj|BAK05349.1|  predicted protein                                    95.1    1e-21   
ref|XP_004306801.1|  PREDICTED: actin-depolymerizing factor 10-like   94.7    1e-21   
ref|XP_008392560.1|  PREDICTED: actin-depolymerizing factor 7-like    94.7    1e-21   
gb|ACN27286.1|  unknown                                               94.7    1e-21   
ref|XP_009408567.1|  PREDICTED: actin-depolymerizing factor 11-like   94.7    1e-21   
ref|NP_001239657.1|  uncharacterized protein LOC100819975             94.7    1e-21   
ref|XP_004511585.1|  PREDICTED: actin-depolymerizing factor 7-lik...  94.7    1e-21   
ref|XP_006421922.1|  hypothetical protein CICLE_v10007087mg           94.4    2e-21   
ref|XP_008787347.1|  PREDICTED: actin-depolymerizing factor 11-li...  94.7    2e-21   
ref|XP_006657701.1|  PREDICTED: actin-depolymerizing factor 9-like    94.7    2e-21   
ref|NP_190187.1|  actin depolymerizing factor 1                       94.4    2e-21   
ref|XP_008787346.1|  PREDICTED: actin-depolymerizing factor-like ...  94.7    2e-21   
emb|CDO99231.1|  unnamed protein product                              94.4    2e-21   
gb|EMT04440.1|  Actin-depolymerizing factor 1                         94.0    2e-21   
ref|XP_002879310.1|  hypothetical protein ARALYDRAFT_902145           94.4    2e-21   
ref|XP_006418975.1|  hypothetical protein EUTSA_v10002704mg           94.4    2e-21   
ref|NP_001105474.1|  actin-depolymerizing factor 3                    94.0    2e-21   
ref|XP_009776477.1|  PREDICTED: actin-depolymerizing factor           94.0    3e-21   
ref|XP_009131961.1|  PREDICTED: actin-depolymerizing factor 4-like    94.0    3e-21   
gb|ADE75680.1|  unknown                                               94.0    3e-21   
gb|AFK34925.1|  unknown                                               94.0    3e-21   
gb|AAM63510.1|  Actin-depolymerizing factor ADF-6                     94.0    3e-21   
ref|NP_001236003.1|  uncharacterized protein LOC100527688             94.0    3e-21   
ref|XP_006590525.1|  PREDICTED: actin-depolymerizing factor 7-lik...  93.6    3e-21   
ref|NP_565719.1|  actin depolymerizing factor 6                       94.0    3e-21   
ref|XP_007050307.1|  Actin depolymerizing factor 6 isoform 1          93.6    4e-21   
gb|KFK33962.1|  hypothetical protein AALP_AA5G084200                  93.2    4e-21   
gb|KFK27529.1|  hypothetical protein AALP_AA8G395300                  93.2    4e-21   
ref|XP_004309205.1|  PREDICTED: uncharacterized protein LOC101314811  97.1    4e-21   
ref|NP_001067327.1|  Os12g0628100                                     93.6    5e-21   
ref|XP_002460700.1|  hypothetical protein SORBIDRAFT_02g033380        93.2    5e-21   
ref|XP_004247731.1|  PREDICTED: actin-depolymerizing factor-like      93.6    5e-21   
ref|XP_002452789.1|  hypothetical protein SORBIDRAFT_04g032550        93.2    5e-21   
ref|XP_009409826.1|  PREDICTED: actin-depolymerizing factor 11-like   92.0    5e-21   
emb|CDX88731.1|  BnaA03g09180D                                        94.7    5e-21   
emb|CDY09242.1|  BnaA02g06680D                                        93.6    5e-21   
ref|NP_001275618.1|  actin-depolymerizing factor-like                 93.2    6e-21   
ref|NP_001105590.1|  actin-depolymerizing factor 2                    93.2    6e-21   
gb|AFK44911.1|  unknown                                               93.2    6e-21   
ref|XP_004957704.1|  PREDICTED: actin-depolymerizing factor 2-like    92.8    6e-21   
ref|XP_006664223.1|  PREDICTED: actin-depolymerizing factor 11-like   93.2    6e-21   
gb|AFK42408.1|  unknown                                               92.8    7e-21   
ref|XP_009388500.1|  PREDICTED: actin-depolymerizing factor 11        92.8    9e-21   
ref|XP_011024326.1|  PREDICTED: actin-depolymerizing factor 1-lik...  91.7    9e-21   
gb|AFK39900.1|  unknown                                               92.4    1e-20   
ref|XP_006351677.1|  PREDICTED: actin-depolymerizing factor-like      92.4    1e-20   
ref|XP_010906282.1|  PREDICTED: actin-depolymerizing factor-like ...  91.7    1e-20   
ref|XP_010906274.1|  PREDICTED: actin-depolymerizing factor-like ...  92.4    1e-20   
gb|ABD66507.1|  actin depolymerizing factor 5                         92.0    1e-20   
gb|KDP44204.1|  hypothetical protein JCGZ_05671                       92.0    1e-20   
ref|XP_010414168.1|  PREDICTED: actin-depolymerizing factor 6         92.4    1e-20   
gb|KFK31228.1|  hypothetical protein AALP_AA6G084900                  92.0    1e-20   
ref|NP_001078247.1|  actin depolymerizing factor 1                    92.4    1e-20   
ref|XP_010555867.1|  PREDICTED: actin-depolymerizing factor 6-like    92.0    2e-20   
ref|XP_010557114.1|  PREDICTED: actin-depolymerizing factor 6 iso...  92.0    2e-20   
ref|XP_006418976.1|  hypothetical protein EUTSA_v10002704mg           92.0    2e-20   
ref|XP_010557113.1|  PREDICTED: actin-depolymerizing factor isofo...  92.0    2e-20   
emb|CDX94438.1|  BnaC01g17460D                                        91.3    2e-20   
ref|XP_002511837.1|  actin depolymerizing factor, putative            91.3    2e-20   
gb|EEC69719.1|  hypothetical protein OsI_39206                        91.7    2e-20   
gb|EMT14364.1|  Actin-depolymerizing factor 6                         91.3    2e-20   
ref|XP_004984753.1|  PREDICTED: actin-depolymerizing factor 7-lik...  91.3    2e-20   



>ref|XP_011093147.1| PREDICTED: actin-depolymerizing factor 10-like [Sesamum indicum]
Length=139

 Score =   120 bits (302),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRNFRYIVFKID+T Q V+VEK G H E ++DFT SL
Sbjct  1    MANSASGIAVNDECKLKFLELKAKRNFRYIVFKIDDTVQEVMVEKAGNHGENYEDFTNSL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFDYDF
Sbjct  61   PANECRYAVFDYDF  74



>ref|XP_009771651.1| PREDICTED: actin-depolymerizing factor 12-like [Nicotiana sylvestris]
Length=137

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKFMELK+KRN+RYIVFKI+  GQ VVVEK+G   ETH+DF  SL
Sbjct  1    MANSASGIAVSDECKLKFMELKAKRNYRYIVFKIE--GQQVVVEKVGEQGETHEDFANSL  58

Query  44   PSNDCRFAVFDYDF  3
            PSN+CR+AVFDYDF
Sbjct  59   PSNECRYAVFDYDF  72



>ref|XP_006339546.1| PREDICTED: actin-depolymerizing factor 12-like [Solanum tuberosum]
Length=137

 Score =   119 bits (298),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 62/74 (84%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKFMELK+KRN RYIVFKID  GQ VVVEK+G   ETHDDF  SL
Sbjct  1    MANSASGIAVSDECKLKFMELKAKRNHRYIVFKID--GQQVVVEKVGGQAETHDDFANSL  58

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AVFDYDF
Sbjct  59   PPNECRYAVFDYDF  72



>gb|EYU32098.1| hypothetical protein MIMGU_mgv1a026462mg, partial [Erythranthe 
guttata]
Length=138

 Score =   118 bits (296),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS+SG+ V DECKLKF+ELK+KRN RYIVFKID+T Q V+VEK+GT  ET++DF  SLP
Sbjct  1    ANSASGIAVSDECKLKFLELKAKRNHRYIVFKIDDTVQQVMVEKVGTQAETYEDFANSLP  60

Query  41   SNDCRFAVFDYDF  3
             NDCR+AVFDYDF
Sbjct  61   DNDCRYAVFDYDF  73



>ref|XP_011091992.1| PREDICTED: actin-depolymerizing factor 10-like [Sesamum indicum]
Length=139

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN+RYI+FKID+  Q V+VEK G H ET++ FT SL
Sbjct  1    MANSASGIAVSDECKLKFLELKAKRNYRYIIFKIDDNVQQVMVEKAGDHAETYEHFTSSL  60

Query  44   PSNDCRFAVFDYDF  3
            P NDCR+AVFDYDF
Sbjct  61   PDNDCRYAVFDYDF  74



>ref|XP_009787751.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana sylvestris]
Length=139

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KR+ RYIVFKID++G  VVVEK+G ++ETH+DF  +L
Sbjct  1    MANSASGIAVSDECKLKFLELKAKRDHRYIVFKIDDSGHQVVVEKVGRNDETHEDFANNL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AVFDYDF
Sbjct  61   PPNECRYAVFDYDF  74



>ref|XP_009630108.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana tomentosiformis]
Length=137

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKFMELK+KRN+RYIVFKI+  GQ VVV+K+G   ETH DF+ SL
Sbjct  1    MANSASGIAVSDECKLKFMELKAKRNYRYIVFKIE--GQQVVVDKVGEQGETHQDFSNSL  58

Query  44   PSNDCRFAVFDYDF  3
            PSN+CR+AVFDYD+
Sbjct  59   PSNECRYAVFDYDY  72



>ref|XP_009595762.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana tomentosiformis]
Length=139

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLK++ELK+KR+ RYIVFKID++G  VVVEK+G ++ETH+DF  +L
Sbjct  1    MANSASGIAVSDECKLKYLELKAKRDHRYIVFKIDDSGHQVVVEKVGRNDETHEDFANNL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AVFDYDF
Sbjct  61   PPNECRYAVFDYDF  74



>ref|XP_007051847.1| Actin depolymerizing factor 11 [Theobroma cacao]
 gb|EOX96004.1| Actin depolymerizing factor 11 [Theobroma cacao]
Length=139

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANSSSG+ + DECKLKF+ELK+KRN RYIVFKIDE  Q V+VEKLG+   T+DDFT SL
Sbjct  1    MANSSSGMAMNDECKLKFLELKAKRNHRYIVFKIDEKTQQVIVEKLGSPGATYDDFTNSL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFDY+F
Sbjct  61   PANECRYAVFDYNF  74



>emb|CDP08835.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS SG+ V DECKLKF+ELK+KRN+RYIVFKID+  + V +EKLG+H+ET++DFT SLP
Sbjct  23   ANSVSGIAVHDECKLKFLELKAKRNYRYIVFKIDDISKQVAIEKLGSHDETYEDFTNSLP  82

Query  41   SNDCRFAVFDYDF  3
            ++ CR+AVFDYDF
Sbjct  83   ADQCRYAVFDYDF  95



>ref|XP_009793423.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana sylvestris]
Length=140

 Score =   117 bits (292),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D+CKLKF+ELK+KRN RY+VFKI+E+ Q VVVEK+G   ETHDDF  SL
Sbjct  1    MANSASGIAVSDDCKLKFLELKAKRNHRYLVFKIEESVQQVVVEKVGGQAETHDDFASSL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AVFDYD+
Sbjct  61   PPNECRYAVFDYDW  74



>ref|XP_008804935.1| PREDICTED: actin-depolymerizing factor isoform X2 [Phoenix dactylifera]
Length=139

 Score =   116 bits (291),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRNFR+I+FKIDE  Q V VEKLG  +E++DDFT SL
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  61   PANECRYAVFDFDF  74



>gb|KFK30636.1| hypothetical protein AALP_AA6G007700 [Arabis alpina]
Length=239

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KR +RYIVF IDET Q V++EKLG  EET+DDFT S+
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRTYRYIVFTIDETAQQVLIEKLGNPEETYDDFTNSM  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  61   PENECRYAVYDFDF  74



>ref|XP_009615468.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana tomentosiformis]
Length=140

 Score =   116 bits (290),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D+CKLKF+ELK+KRN RYIVFKI+E+ Q VVVEK+G   ETH+DF  SL
Sbjct  1    MANSASGIAVSDDCKLKFLELKAKRNHRYIVFKIEESVQQVVVEKVGGQAETHEDFANSL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AVFDYD+
Sbjct  61   PPNECRYAVFDYDW  74



>ref|XP_006285474.1| hypothetical protein CARUB_v10006893mg [Capsella rubella]
 gb|EOA18372.1| hypothetical protein CARUB_v10006893mg [Capsella rubella]
Length=137

 Score =   115 bits (289),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELKSKRN+R+IVF+ID  GQ VVVEKLG  EET+DDFT SL
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIVFRID--GQQVVVEKLGNPEETYDDFTASL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  59   PADECRYAVFDFDF  72



>ref|XP_010433613.1| PREDICTED: actin-depolymerizing factor 7-like [Camelina sativa]
 ref|XP_010438859.1| PREDICTED: actin-depolymerizing factor 7-like [Camelina sativa]
Length=137

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELKSKRN+R+IVF+ID  GQ VVVEKLG  EET+DDFT SL
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIVFRID--GQQVVVEKLGKPEETYDDFTASL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  59   PADECRYAVFDFDF  72



>ref|XP_010555668.1| PREDICTED: actin-depolymerizing factor 7 [Tarenaya hassleriana]
Length=137

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+ EET+DDF +SL
Sbjct  1    MANSASGMAVDDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEETYDDFAESL  58

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+DF
Sbjct  59   PANECRYAVYDFDF  72



>ref|NP_194289.2| actin depolymerizing factor 7 [Arabidopsis thaliana]
 sp|Q67ZM4.1|ADF7_ARATH RecName: Full=Actin-depolymerizing factor 7; Short=ADF-7; Short=AtADF7 
[Arabidopsis thaliana]
 dbj|BAD43856.1| actin depolymerizing factor - like protein [Arabidopsis thaliana]
 gb|AEE85080.1| actin depolymerizing factor 7 [Arabidopsis thaliana]
Length=137

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELKSKRN+R+I+F+ID  GQ VVVEKLG  +ET+DDFT SL
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIIFRID--GQQVVVEKLGNPDETYDDFTASL  58

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  59   PANECRYAVFDFDF  72



>ref|NP_171680.1| actin depolymerizing factor 11 [Arabidopsis thaliana]
 sp|Q9LQ81.1|ADF10_ARATH RecName: Full=Actin-depolymerizing factor 10; Short=ADF-10; Short=AtADF10 
[Arabidopsis thaliana]
 gb|AAF78408.1|AC009273_14 Contains similarity to actin depolymerizing factor 4 from Arabidopsis 
thaliana gb|AF102822. It contains cofilin/tropomyosin-type 
actin-binding proteins PF|00241. EST gb|AA720247 comes 
from this gene [Arabidopsis thaliana]
 gb|AAL62402.1| actin depolymerizing factor, putative [Arabidopsis thaliana]
 gb|AAM65844.1| Actin-depolymerizing factor like At1g01750 (ADF-like) [Arabidopsis 
thaliana]
 gb|AAN65137.1| actin depolymerizing factor, putative [Arabidopsis thaliana]
 gb|AEE27331.1| actin depolymerizing factor 11 [Arabidopsis thaliana]
Length=140

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN+R+IVFKIDE  Q V+++KLG  EET++DFT+S+
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYEDFTRSI  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AV+DYDF
Sbjct  61   PEDECRYAVYDYDF  74



>ref|XP_006304638.1| hypothetical protein CARUB_v10011760mg [Capsella rubella]
 gb|EOA37536.1| hypothetical protein CARUB_v10011760mg [Capsella rubella]
Length=140

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN+R+IVFKIDE  Q V+++KLG  EET+DDFT+S+
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYDDFTRSI  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AV+D+DF
Sbjct  61   PEDECRYAVYDFDF  74



>ref|XP_010479839.1| PREDICTED: actin-depolymerizing factor 10 [Camelina sativa]
 ref|XP_010457085.1| PREDICTED: actin-depolymerizing factor 10 [Camelina sativa]
 ref|XP_010474795.1| PREDICTED: actin-depolymerizing factor 10 [Camelina sativa]
Length=140

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN+RYI+FKIDE  Q V+++KLG  EET+DDFT S+
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRYIIFKIDEKAQQVMIDKLGNPEETYDDFTGSI  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AV+D+DF
Sbjct  61   PEDECRYAVYDFDF  74



>ref|XP_009106793.1| PREDICTED: actin-depolymerizing factor 7 [Brassica rapa]
Length=137

 Score =   114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELKSKRN+R+I+F+ID  GQ VVVEKLG+ EE +DDF+ SL
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  59   PANECRYAVFDFDF  72



>ref|XP_009111466.1| PREDICTED: actin-depolymerizing factor 8 [Brassica rapa]
Length=139

 Score =   114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECK+KFMELK+KR +RYIVFKIDE  Q V +EKLG  +ET+DDFT S+
Sbjct  1    MANSASGMHVNDECKVKFMELKAKRTYRYIVFKIDEKAQEVQIEKLGNPQETYDDFTNSI  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+A++D+DF
Sbjct  61   PENECRYAIYDFDF  74



>ref|XP_010327379.1| PREDICTED: actin-depolymerizing factor 10-like [Solanum lycopersicum]
Length=146

 Score =   114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -1

Query  239  IATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDD  60
            I+    ANS+SG+ V DECKL+F+ELK+KRN RY+VFKIDE+ Q VVVEK+G   ETHDD
Sbjct  3    ISGSATANSASGIAVSDECKLRFLELKAKRNHRYLVFKIDESVQQVVVEKVGGQTETHDD  62

Query  59   FTKSLPSNDCRFAVFDYDF  3
            F  S+P ++CR+AVFDYD+
Sbjct  63   FANSMPPSECRYAVFDYDW  81



>ref|XP_006396264.1| hypothetical protein EUTSA_v10029050mg [Eutrema salsugineum]
 gb|ESQ37717.1| hypothetical protein EUTSA_v10029050mg [Eutrema salsugineum]
Length=141

 Score =   114 bits (285),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            +ANS+SG+ V DECKLKF+ELK+KR +R+IVFKIDE  Q V +EKLG  EET+DDFT S+
Sbjct  3    LANSASGMNVSDECKLKFLELKAKRTYRFIVFKIDENAQQVQIEKLGNPEETYDDFTNSI  62

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  63   PENECRYAVYDFDF  76



>sp|P30175.1|ADF_LILLO RecName: Full=Actin-depolymerizing factor; Short=ADF [Lilium 
longiflorum]
 emb|CAA78483.1| actin depolymerizing factor [Lilium longiflorum]
Length=139

 Score =   114 bits (285),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANSSSG+ V DECKLKFMELK+KRNFR+IVFKI+E  Q V VE+LG   E++DDFT+ L
Sbjct  1    MANSSSGMAVDDECKLKFMELKAKRNFRFIVFKIEEKVQQVTVERLGQPNESYDDFTECL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AVFD+DF
Sbjct  61   PPNECRYAVFDFDF  74



>ref|XP_002867603.1| actin binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43862.1| actin binding protein [Arabidopsis lyrata subsp. lyrata]
Length=137

 Score =   114 bits (285),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELKSKRN+R+I+F+ID  GQ VVVEKLG  EET+ DFT SL
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIIFRID--GQQVVVEKLGNPEETYGDFTASL  58

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  59   PANECRYAVFDFDF  72



>ref|XP_008794195.1| PREDICTED: actin-depolymerizing factor-like [Phoenix dactylifera]
Length=139

 Score =   114 bits (285),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRNFR+I+FKIDE  Q V VEKLG  +E++DDFT SL
Sbjct  1    MANSASGMAVNDECKLKFLELKTKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>ref|XP_006341722.1| PREDICTED: actin-depolymerizing factor 10-like [Solanum tuberosum]
Length=139

 Score =   114 bits (285),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKL+F+ELK+KRN R++VFKIDE+ Q VVVEK+G   ETHDDF  S+
Sbjct  1    MANSASGIAVSDECKLRFLELKAKRNHRFLVFKIDESVQQVVVEKVGGQAETHDDFANSM  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AVFDYD+
Sbjct  61   PPSECRYAVFDYDW  74



>emb|CBI40336.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -1

Query  257  TSSLRLIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTH  78
            T    L   H MANS+SG+ V DECKLKF+ELK+KRN R+IVFKIDE  Q V+VEKLG+ 
Sbjct  107  TEGSSLSGGHNMANSASGMAVHDECKLKFLELKAKRNHRFIVFKIDERIQQVMVEKLGSP  166

Query  77   EETHDDFTKSLPSNDCRFAVFDYDF  3
            +ET++DFT SLP+++CR+AVFD+DF
Sbjct  167  DETYEDFTNSLPADECRYAVFDFDF  191



>ref|XP_010448409.1| PREDICTED: actin-depolymerizing factor 7 [Camelina sativa]
Length=137

 Score =   114 bits (284),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELKSKRN+R+IVF+ID  GQ VVVEKLG  +ET+DDFT SL
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIVFRID--GQQVVVEKLGKPDETYDDFTASL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  59   PADECRYAVFDFDF  72



>ref|XP_002271495.1| PREDICTED: actin-depolymerizing factor 10 [Vitis vinifera]
 emb|CAN73839.1| hypothetical protein VITISV_012391 [Vitis vinifera]
Length=139

 Score =   114 bits (284),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN R+IVFKIDE  Q V+VEKLG+ +ET++DFT SL
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNHRFIVFKIDERIQQVMVEKLGSPDETYEDFTNSL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>ref|XP_009770352.1| PREDICTED: actin-depolymerizing factor 7 [Nicotiana sylvestris]
Length=137

 Score =   114 bits (284),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+IVFKI+  GQ VVVEKLG  EE +DDFT SL
Sbjct  1    MANAASGMAVLDECKLKFLELKAKRNYRFIVFKIE--GQQVVVEKLGNPEENYDDFTNSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  59   PADECRYAVFDFDF  72



>gb|AAL91667.1| pollen specific actin-depolymerizing factor 2 [Nicotiana tabacum]
Length=137

 Score =   113 bits (283),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+IVFKI+  GQ VVVEKLG  EE +DDFT SL
Sbjct  1    MANAASGMAVLDECKLKFLELKAKRNYRFIVFKIE--GQQVVVEKLGNPEENYDDFTNSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  59   PADECRYAVFDFDF  72



>ref|XP_009384093.1| PREDICTED: actin-depolymerizing factor 1 [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   113 bits (283),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRNFR+IVFKIDE  Q V+VEKLG   ET+DDF  S+
Sbjct  1    MANSASGMAVSDECKLKFLELKAKRNFRFIVFKIDERIQQVMVEKLGQPGETYDDFAASM  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>ref|XP_002892045.1| hypothetical protein ARALYDRAFT_887267 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68304.1| hypothetical protein ARALYDRAFT_887267 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   113 bits (283),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D+CKLKF+ELK+KRN+R+IVFKIDE  Q V+++KLG  EET+DDFT+S+
Sbjct  1    MANSASGMHVSDDCKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYDDFTRSI  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AV+D+DF
Sbjct  61   PEDECRYAVYDFDF  74



>ref|XP_009386059.1| PREDICTED: actin-depolymerizing factor [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   113 bits (282),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRNFR+IVFKIDE  Q V+VEKLG  +E++DDFT   
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNFRFIVFKIDEKIQQVMVEKLGRPDESYDDFTACF  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AVFD+DF
Sbjct  61   PPNECRYAVFDFDF  74



>ref|XP_010053689.1| PREDICTED: actin-depolymerizing factor [Eucalyptus grandis]
 gb|KCW78051.1| hypothetical protein EUGRSUZ_D02275 [Eucalyptus grandis]
Length=139

 Score =   113 bits (282),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN R+IVFKIDE  Q V VEK+G+ EET+DDFT  +
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNHRFIVFKIDEKIQQVSVEKVGSPEETYDDFTACM  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  61   PANECRYAVFDFDF  74



>gb|KFK26837.1| hypothetical protein AALP_AA8G300400 [Arabis alpina]
Length=137

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+ EE +DDF+ SL
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+DF
Sbjct  59   PANECRYAVYDFDF  72



>ref|XP_009127248.1| PREDICTED: actin-depolymerizing factor 12 [Brassica rapa]
Length=137

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+ EE +DDF+ SL
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+DF
Sbjct  59   PANECRYAVYDFDF  72



>ref|XP_010662752.1| PREDICTED: actin-depolymerizing factor 1 [Vitis vinifera]
Length=139

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN R+IVFKI+E  Q VVVEKLG+ +E++D FT SL
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNHRFIVFKIEEKIQQVVVEKLGSPDESYDAFTSSL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  61   PANECRYAVFDFDF  74



>ref|XP_010544380.1| PREDICTED: actin-depolymerizing factor 8 isoform X2 [Tarenaya 
hassleriana]
Length=139

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KR++R+IVFKIDE  Q VVV+K+G  EET+DDFT S+
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRSYRFIVFKIDEKVQKVVVDKIGNPEETYDDFTSSM  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  61   PENECRYAVYDFDF  74



>ref|XP_009132530.1| PREDICTED: actin-depolymerizing factor 12-like [Brassica rapa]
Length=137

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+ EE +DDF+ SL
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+DF
Sbjct  59   PANECRYAVYDFDF  72



>ref|XP_010910598.1| PREDICTED: actin-depolymerizing factor [Elaeis guineensis]
Length=178

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS SG+ V DECKLKF+ELK+KRNFR+IVFKIDE  Q V VE+LG  +E++DDFT  L
Sbjct  40   MANSPSGIAVDDECKLKFLELKAKRNFRFIVFKIDEKIQQVTVERLGQPDESYDDFTACL  99

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AVFD+DF
Sbjct  100  PPNECRYAVFDFDF  113



>ref|XP_010249803.1| PREDICTED: actin-depolymerizing factor [Nelumbo nucifera]
Length=139

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D+CKLKF+ELK+KRN+R+IVFKIDE  Q V+VE+LG  EE+++DFT  L
Sbjct  1    MANSASGMAVNDDCKLKFLELKAKRNYRFIVFKIDEKIQQVMVERLGNPEESYEDFTACL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  61   PANECRYAVFDFDF  74



>ref|XP_009599636.1| PREDICTED: actin-depolymerizing factor 7 [Nicotiana tomentosiformis]
Length=137

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+IVFKI+  GQ VVVEKLG  EE +DDFT SL
Sbjct  1    MANAASGMAVLDECKLKFLELKTKRNYRFIVFKIE--GQQVVVEKLGNPEENYDDFTNSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD DF
Sbjct  59   PADECRYAVFDLDF  72



>emb|CDY38025.1| BnaCnng08860D [Brassica napus]
Length=176

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 8/97 (8%)
 Frame = -1

Query  269  NPPQTSSLRLI--------ATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDET  114
            +P Q +S  L+            MANS+SG+ V DECKLKF+ELK+KRN+R+IVFKIDE 
Sbjct  14   DPAQPTSFSLLPPLVSDHQQAENMANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEK  73

Query  113  GQAVVVEKLGTHEETHDDFTKSLPSNDCRFAVFDYDF  3
             Q V++E +G  E+T+DDFTK +P N+CR+AV+D+DF
Sbjct  74   AQQVMIEMVGNPEKTYDDFTKCMPENECRYAVYDFDF  110



>ref|XP_010444761.1| PREDICTED: actin-depolymerizing factor 12-like [Camelina sativa]
Length=137

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+  ET+DDFT +L
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPAETYDDFTNAL  58

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  59   PPNECRYAVYDFDF  72



>gb|KCW71635.1| hypothetical protein EUGRSUZ_E00162 [Eucalyptus grandis]
Length=139

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANSSSG+ V DECKLKF+ELK+KR +R+IVFKI+E  Q V +EKLG+ EET+DDF+ SL
Sbjct  1    MANSSSGMAVDDECKLKFLELKTKRIYRFIVFKIEEKIQQVTIEKLGSPEETYDDFSSSL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>ref|XP_006418454.1| hypothetical protein EUTSA_v10009057mg [Eutrema salsugineum]
 gb|ESQ36807.1| hypothetical protein EUTSA_v10009057mg [Eutrema salsugineum]
Length=140

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN+R+IVFKIDE  Q V+++ +G  EET+DDFTK +
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDMVGNPEETYDDFTKCM  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  61   PENECRYAVYDFDF  74



>ref|XP_002865909.1| hypothetical protein ARALYDRAFT_495305 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006281622.1| hypothetical protein CARUB_v10027750mg [Capsella rubella]
 gb|EFH42168.1| hypothetical protein ARALYDRAFT_495305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA14520.1| hypothetical protein CARUB_v10027750mg [Capsella rubella]
Length=137

 Score =   112 bits (279),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+ EE +DDF+ SL
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  59   PPNECRYAVYDFDF  72



>ref|XP_009414703.1| PREDICTED: actin-depolymerizing factor-like [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRNFR+IVFKI+E  Q V VEKLG  ++++DD T SL
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNFRFIVFKINEKLQQVTVEKLGQPDDSYDDLTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AVFD+DF
Sbjct  61   PPNECRYAVFDFDF  74



>ref|XP_009118832.1| PREDICTED: actin-depolymerizing factor 10 isoform X2 [Brassica 
rapa]
Length=140

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN+R+IVFKIDE  Q V++E +G  E+T+DDFTK +
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIEMVGNPEKTYDDFTKCM  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  61   PENECRYAVYDFDF  74



>ref|XP_010427310.1| PREDICTED: actin-depolymerizing factor 8 [Camelina sativa]
Length=141

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECK+KF+ELK+KR +R+IVFKIDE  Q V +EKLG  EET+DDFT S+
Sbjct  1    MANSASGMNVSDECKIKFLELKAKRTYRFIVFKIDEKAQQVEIEKLGNPEETYDDFTSSI  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AV+D+DF
Sbjct  61   PDDECRYAVYDFDF  74



>ref|XP_009411533.1| PREDICTED: actin-depolymerizing factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=169

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  RLIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETH  66
            +L+   + AN++SG+ V DECKLKF+ELK+KRNFR+IVFKIDE  Q V+V+KLG  +E++
Sbjct  24   KLLFILEYANAASGMAVSDECKLKFLELKAKRNFRFIVFKIDERIQQVMVDKLGQPDESY  83

Query  65   DDFTKSLPSNDCRFAVFDYDF  3
            DDFT SLP+++CR+AVFD+DF
Sbjct  84   DDFTASLPADECRYAVFDFDF  104



>emb|CDY51146.1| BnaA09g51810D [Brassica napus]
Length=352

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -1

Query  269  NPPQTSSLRLIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEK  90
            N P     +L A HK ANS+SG+ V DECK+KFMELK+KR +RYIVFKIDE  Q V +EK
Sbjct  57   NAPMFFRPKLSAHHK-ANSASGMHVNDECKVKFMELKAKRTYRYIVFKIDEKAQEVQIEK  115

Query  89   LGTHEETHDDFTKSLPSNDCRFAVFDYDF  3
            LG  +ET+DDFT S+P N+CR+A++D+DF
Sbjct  116  LGNPQETYDDFTNSIPENECRYAIYDFDF  144



>ref|XP_006413292.1| hypothetical protein EUTSA_v10026532mg [Eutrema salsugineum]
 gb|ESQ54745.1| hypothetical protein EUTSA_v10026532mg [Eutrema salsugineum]
Length=137

 Score =   111 bits (278),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECK KF+ELKSKRN+R+I+F+ID  GQ VVVEKLG  +ET+DDFT SL
Sbjct  1    MANAASGMAVEDECKRKFLELKSKRNYRFIIFRID--GQQVVVEKLGNPQETYDDFTASL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  59   PADECRYAVFDFDF  72



>gb|EPS69954.1| hypothetical protein M569_04811 [Genlisea aurea]
Length=184

 Score =   112 bits (281),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS+SG+ V DECKL F+ELK++R +RY+VFKID+  Q V VEK G H E +DDFT SLP
Sbjct  47   ANSASGIAVSDECKLTFLELKARRTYRYVVFKIDDNVQQVTVEKAGEHSENYDDFTNSLP  106

Query  41   SNDCRFAVFDYDF  3
             NDCR+AV+DYDF
Sbjct  107  DNDCRYAVYDYDF  119



>ref|XP_010672167.1| PREDICTED: actin-depolymerizing factor 10 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score =   111 bits (277),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKFMELK+KRN R+IVFKI+E  Q V+VEK+G  +ET++DF  +L
Sbjct  1    MANAASGMAVNDECKLKFMELKAKRNHRFIVFKIEEKQQQVMVEKIGNPDETYEDFANAL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+DYDF
Sbjct  61   PANECRYAVYDYDF  74



>ref|XP_002509779.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF51166.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   111 bits (277),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANSSSG+ V DECKLKF+ELK+KR++R+IVFKI+E  Q V VEKLG  +E+++DFT SL
Sbjct  1    MANSSSGMAVNDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGQPQESYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D DF
Sbjct  61   PANECRYAVYDLDF  74



>ref|XP_011084418.1| PREDICTED: actin-depolymerizing factor 7 [Sesamum indicum]
Length=137

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN+R+I+FKI+  GQ VVVEKLG+ +E+++DFT SL
Sbjct  1    MANSASGMAVDDECKLKFLELKAKRNYRFIIFKIE--GQQVVVEKLGSPDESYEDFTASL  58

Query  44   PSNDCRFAVFDYDF  3
            PS++CR+AVFD+DF
Sbjct  59   PSDECRYAVFDFDF  72



>gb|EYU35082.1| hypothetical protein MIMGU_mgv1a015967mg [Erythranthe guttata]
Length=139

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS SG+ V DECKLKF+ELK+KRN RYIVFKID   Q VVVEK+G   E++ DF  SL
Sbjct  1    MANSVSGIAVNDECKLKFLELKAKRNHRYIVFKIDNNVQQVVVEKVGPQGESYQDFADSL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+DYDF
Sbjct  61   PANECRYAVYDYDF  74



>ref|XP_006401834.1| hypothetical protein EUTSA_v10014982mg [Eutrema salsugineum]
 gb|ESQ43287.1| hypothetical protein EUTSA_v10014982mg [Eutrema salsugineum]
Length=137

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+ EE +DDF+ SL
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  59   PADECRYAVYDFDF  72



>ref|XP_010317604.1| PREDICTED: actin-depolymerizing factor 12 [Solanum lycopersicum]
Length=137

 Score =   110 bits (276),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN+ SG  V DECKLKF+ELK+KRN+R+I+FKID  GQ VVVEKLG+ EE++D+FT SL
Sbjct  1    MANAVSGTAVQDECKLKFLELKAKRNYRFIIFKID--GQEVVVEKLGSPEESYDNFTNSL  58

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AVFD+DF
Sbjct  59   PPDECRYAVFDFDF  72



>ref|XP_008438059.1| PREDICTED: actin-depolymerizing factor 7-like [Cucumis melo]
Length=139

 Score =   110 bits (276),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANSSSG+ V DECKLKF++LK+KR +R+IVFKI+E  Q V VEK+G  +ET+DDFT S+
Sbjct  1    MANSSSGMAVHDECKLKFLDLKAKRKYRFIVFKIEEKMQQVTVEKVGGPDETYDDFTASI  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+DF
Sbjct  61   PANECRYAVYDFDF  74



>ref|XP_010521323.1| PREDICTED: actin-depolymerizing factor 7-like [Tarenaya hassleriana]
Length=137

 Score =   110 bits (276),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF ELK+KRN+RYI+F+ID  GQ VVVEKLG+ ++T+DDF  SL
Sbjct  1    MANAASGMAVEDECKLKFQELKAKRNYRYIIFRID--GQQVVVEKLGSPDDTYDDFADSL  58

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  59   PVNECRYAVYDFDF  72



>ref|NP_567182.1| actin depolymerizing factor 8 [Arabidopsis thaliana]
 sp|Q570Y6.2|ADF8_ARATH RecName: Full=Actin-depolymerizing factor 8; Short=ADF-8; Short=AtADF8 
[Arabidopsis thaliana]
 gb|AAM63658.1| putative actin-depolymerizing factor [Arabidopsis thaliana]
 gb|ABD60702.1| At4g00680 [Arabidopsis thaliana]
 gb|AEE81918.1| actin depolymerizing factor 8 [Arabidopsis thaliana]
Length=140

 Score =   110 bits (276),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECK+KF+ELK+KR +R+IVFKIDE  Q V +EKLG  EET+DDFT S+
Sbjct  1    MANSASGMHVNDECKIKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSSI  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AV+D+DF
Sbjct  61   PDDECRYAVYDFDF  74



>ref|XP_010482597.1| PREDICTED: actin-depolymerizing factor 12 [Camelina sativa]
Length=137

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+  E +DDFT +L
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPAENYDDFTNAL  58

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  59   PPNECRYAVYDFDF  72



>ref|XP_002872934.1| hypothetical protein ARALYDRAFT_490501 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49193.1| hypothetical protein ARALYDRAFT_490501 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KR +R+IVFKIDE  Q V +EKLG  EET+DDFT ++
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSAI  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AV+D+DF
Sbjct  61   PDDECRYAVYDFDF  74



>ref|XP_010419619.1| PREDICTED: actin-depolymerizing factor 8-like [Camelina sativa]
Length=141

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KR +R+IVFKIDE  Q V +EKLG  EET+DDFT  +
Sbjct  1    MANSASGMKVSDECKLKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSCI  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AV+D+DF
Sbjct  61   PDDECRYAVYDFDF  74



>emb|CDY07204.1| BnaCnng02190D [Brassica napus]
Length=271

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS+SG+ V DECK+KFMELK+KR +RYIVFKIDE  Q V +EKLG  EET+DDF  S+P
Sbjct  9    ANSASGMHVNDECKVKFMELKAKRTYRYIVFKIDEKAQEVQIEKLGNPEETYDDFANSIP  68

Query  41   SNDCRFAVFDYDF  3
             N+CR+A++D+DF
Sbjct  69   ENECRYAIYDFDF  81



>ref|NP_568769.1| actin depolymerizing factor 10 [Arabidopsis thaliana]
 sp|Q8LFH6.2|ADF12_ARATH RecName: Full=Actin-depolymerizing factor 12; Short=ADF-12; Short=AtADF12 
[Arabidopsis thaliana]
 gb|ABR46233.1| At5g52360 [Arabidopsis thaliana]
 gb|AED96205.1| actin depolymerizing factor 10 [Arabidopsis thaliana]
Length=137

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+ +E +DDFT  L
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPQENYDDFTNYL  58

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  59   PPNECRYAVYDFDF  72



>ref|XP_010908104.1| PREDICTED: zinc finger CCHC domain-containing protein 9-like 
[Elaeis guineensis]
Length=355

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            +ANS+SG+ V DECKLKF+ELK+KRNFR+I+FKIDE  Q V VEKLG  +E++DDFT SL
Sbjct  217  LANSASGMAVNDECKLKFLELKAKRNFRFIIFKIDEKIQQVTVEKLGQPDESYDDFTASL  276

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  277  PANECRYAVFDFDF  290



>gb|KGN57376.1| hypothetical protein Csa_3G182120 [Cucumis sativus]
Length=137

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+FKI+   Q VVVEKLG+ EET+DDF+ ++
Sbjct  1    MANAASGMAVRDECKLKFLELKTKRNYRFIIFKIE--NQEVVVEKLGSPEETYDDFSAAI  58

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  59   PANECRYAVFDFDF  72



>gb|AAM61402.1| actin depolymerizing factor-like [Arabidopsis thaliana]
Length=137

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+ +E +DDFT  L
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPQENYDDFTNYL  58

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  59   PPNECRYAVYDFDF  72



>ref|XP_009118831.1| PREDICTED: actin-depolymerizing factor 10 isoform X1 [Brassica 
rapa]
Length=145

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS+SG+ V DECKLKF+ELK+KRN+R+IVFKIDE  Q V++E +G  E+T+DDFTK +P
Sbjct  7    ANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIEMVGNPEKTYDDFTKCMP  66

Query  41   SNDCRFAVFDYDF  3
             N+CR+AV+D+DF
Sbjct  67   ENECRYAVYDFDF  79



>ref|XP_007143417.1| hypothetical protein PHAVU_007G070500g [Phaseolus vulgaris]
 gb|ESW15411.1| hypothetical protein PHAVU_007G070500g [Phaseolus vulgaris]
Length=138

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRNFR+IVFKI+     VVVEKLG+  ET++DFT SL
Sbjct  1    MANAASGMAVLDECKLKFLELKAKRNFRFIVFKIE--NYEVVVEKLGSPTETYEDFTASL  58

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  59   PANECRYAVFDFDF  72



>ref|XP_006353297.1| PREDICTED: actin-depolymerizing factor 12-like [Solanum tuberosum]
Length=137

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN+ SG  V DECKLKF+ELK+KRN+R+I+FKID  GQ VVVEKLG+ EE +DDF  SL
Sbjct  1    MANAVSGTAVQDECKLKFLELKAKRNYRFIIFKID--GQEVVVEKLGSPEENYDDFANSL  58

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AVFD+DF
Sbjct  59   PPDECRYAVFDFDF  72



>ref|XP_010456252.1| PREDICTED: actin-depolymerizing factor 8-like [Camelina sativa]
Length=141

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECK+KF+ELK+KR +R+IVFKIDE  Q V +EKLG  EET+DDFT  +
Sbjct  1    MANSASGMNVSDECKIKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSCI  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AV+D+DF
Sbjct  61   PDDECRYAVYDFDF  74



>ref|XP_008393892.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
 ref|XP_008353979.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KRNFR+IVFKI+E  Q V+VEKLG  +E++DDF+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRNFRFIVFKIEEKIQQVIVEKLGGPDESYDDFSASM  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_011080987.1| PREDICTED: actin-depolymerizing factor-like [Sesamum indicum]
Length=139

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKL+F++LK+KRN+R+I+FKI+E  Q VVVEKLG  EE ++DF+ SL
Sbjct  1    MANSASGMSVHDECKLRFLDLKAKRNYRFIIFKIEEKIQQVVVEKLGQPEEGYEDFSSSL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  61   PDNECRYAVYDFDF  74



>emb|CDY69995.1| BnaCnng66250D [Brassica napus]
Length=359

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = -1

Query  260  QTSSLRLIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGT  81
            Q   + L   + MANS+SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+
Sbjct  260  QGPKVNLHQPNAMANSASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGS  317

Query  80   HEETHDDFTKSLPSNDCRFAVFDYDF  3
             EE +DDF+ SLP+N+CR+AV+D+DF
Sbjct  318  PEENYDDFSNSLPANECRYAVYDFDF  343



>ref|XP_010537182.1| PREDICTED: actin-depolymerizing factor 7-like isoform X2 [Tarenaya 
hassleriana]
Length=137

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VV+EKLG  ++T+DDF +SL
Sbjct  1    MANSASGMAVDDECKLKFLELKAKRNYRFIIFRID--GQQVVIEKLGFPDQTYDDFAQSL  58

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  59   PVNECRYAVYDFDF  72



>ref|NP_001053519.1| Os04g0555700 [Oryza sativa Japonica Group]
 sp|Q7XSN9.2|ADF6_ORYSJ RecName: Full=Actin-depolymerizing factor 6; Short=ADF-6; Short=OsADF6 
[Oryza sativa Japonica Group]
 emb|CAE01864.2| OSJNBb0012E24.5 [Oryza sativa Japonica Group]
 dbj|BAF15433.1| Os04g0555700 [Oryza sativa Japonica Group]
 dbj|BAG91382.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF ELKSKR+FR+I FKIDE  Q VVV++LG   +T+DDFT S+
Sbjct  1    MANSASGMAVGDECKLKFQELKSKRSFRFITFKIDERTQQVVVDRLGQPGDTYDDFTASM  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PASECRYAVFDFDF  74



>emb|CDY27075.1| BnaA02g10950D [Brassica napus]
Length=401

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 72/90 (80%), Gaps = 6/90 (7%)
 Frame = -1

Query  272  QNPPQTSSLRLIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVE  93
            +N PQ  +      + MAN++SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVE
Sbjct  253  KNCPQNKN----GVYPMANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVE  306

Query  92   KLGTHEETHDDFTKSLPSNDCRFAVFDYDF  3
            KLG+ EE +DDF+ SLP+N+CR+AV+D+DF
Sbjct  307  KLGSPEENYDDFSNSLPANECRYAVYDFDF  336



>gb|KGN56524.1| hypothetical protein Csa_3G122480 [Cucumis sativus]
Length=139

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANSSSG+ V DECKLKF++LK+KR +R+IVFKI+E  Q V V+K+G  +ET+DDFT S+
Sbjct  1    MANSSSGMAVHDECKLKFLDLKAKRKYRFIVFKIEEKMQQVTVDKVGGPDETYDDFTASI  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+DY+F
Sbjct  61   PANECRYAVYDYNF  74



>ref|XP_009793756.1| PREDICTED: actin-depolymerizing factor 7-like [Nicotiana sylvestris]
Length=137

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN+ SG+ V DECKLKF+ELK+KRN+R+I+FKID  GQ VVVEKLG+ EE+++DF+ SL
Sbjct  1    MANAVSGMAVQDECKLKFLELKAKRNYRFIIFKID--GQEVVVEKLGSPEESYEDFSNSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD DF
Sbjct  59   PADECRYAVFDLDF  72



>ref|XP_010544379.1| PREDICTED: actin-depolymerizing factor 8 isoform X1 [Tarenaya 
hassleriana]
Length=177

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS+SG+ V DECKLKF+ELK+KR++R+IVFKIDE  Q VVV+K+G  EET+DDFT S+P
Sbjct  40   ANSASGMHVNDECKLKFLELKAKRSYRFIVFKIDEKVQKVVVDKIGNPEETYDDFTSSMP  99

Query  41   SNDCRFAVFDYDF  3
             N+CR+AV+D+DF
Sbjct  100  ENECRYAVYDFDF  112



>ref|XP_009119731.1| PREDICTED: actin-depolymerizing factor 10-like [Brassica rapa]
Length=140

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN+R+IVFKIDE  Q V ++ +G  EET+D FTK +
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVTIDMVGNPEETYDSFTKCM  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  61   PENECRYAVYDFDF  74



>gb|EYU19548.1| hypothetical protein MIMGU_mgv1a016233mg [Erythranthe guttata]
Length=129

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN+R+IVF+I+  GQ VVV+KLG  +E+++DFT SL
Sbjct  1    MANSASGMAVEDECKLKFLELKAKRNYRFIVFRIE--GQQVVVDKLGCPDESYEDFTSSL  58

Query  44   PSNDCRFAVFDYDF  3
            PS++CR+AVFD+DF
Sbjct  59   PSDECRYAVFDFDF  72



>gb|KDP22276.1| hypothetical protein JCGZ_26107 [Jatropha curcas]
Length=137

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D+CKLKF+ELK+KRN+R+I FKI++  Q V+++KLGT ++T+DDFT SL
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNYRFITFKIED--QQVIIDKLGTPQQTYDDFTASL  58

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  59   PANECRYAVFDFDF  72



>gb|KDO76170.1| hypothetical protein CISIN_1g046281mg, partial [Citrus sinensis]
Length=133

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANSSSG+ V DECKLKF+ELK+KR++R+IVFKI+E  Q V VEKLG   E+++DFT SL
Sbjct  1    MANSSSGMAVHDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>gb|KHN26651.1| Actin-depolymerizing factor 7, partial [Glycine soja]
Length=136

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            AN++SG+ V DECKLKF+ELK+KRN+R+IVFKI+     VVVEKLG+ EET+DDF+ SLP
Sbjct  1    ANAASGMAVIDECKLKFLELKAKRNYRFIVFKIE--NYEVVVEKLGSPEETYDDFSASLP  58

Query  41   SNDCRFAVFDYDF  3
            +N+CR+AVFD+DF
Sbjct  59   ANECRYAVFDFDF  71



>ref|XP_011029243.1| PREDICTED: actin-depolymerizing factor isoform X2 [Populus euphratica]
Length=139

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKL+FMELK+KR+ R+IVFKI+E  Q VVVE LG  ++++DDFT SL
Sbjct  1    MANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+DF
Sbjct  61   PANECRYAVYDFDF  74



>ref|XP_010442763.1| PREDICTED: actin-depolymerizing factor 12-like [Camelina sativa]
 ref|XP_010442764.1| PREDICTED: actin-depolymerizing factor 12-like [Camelina sativa]
Length=137

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+  E +DDFT +L
Sbjct  1    MANAASGMAVEDKCKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPAENYDDFTNAL  58

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  59   PPNECRYAVYDFDF  72



>ref|XP_002318237.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|EEE96457.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=137

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+FKI+   Q VVVEKLG+ EET+++F  SL
Sbjct  1    MANAASGMAVDDECKLKFLELKAKRNYRFIIFKIE--SQQVVVEKLGSPEETYEEFAASL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFDYDF
Sbjct  59   PADECRYAVFDYDF  72



>emb|CDY38916.1| BnaA03g12630D [Brassica napus]
Length=405

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = -1

Query  260  QTSSLRLIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGT  81
            Q   + L   + MAN++SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VVVEKLG+
Sbjct  257  QGPKVNLHQPNAMANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGS  314

Query  80   HEETHDDFTKSLPSNDCRFAVFDYDF  3
             EE +DDF+ SLP+N+CR+AV+D+DF
Sbjct  315  PEENYDDFSNSLPANECRYAVYDFDF  340



>ref|XP_002969368.1| hypothetical protein SELMODRAFT_146459 [Selaginella moellendorffii]
 ref|XP_002970699.1| hypothetical protein SELMODRAFT_270871 [Selaginella moellendorffii]
 gb|EFJ28025.1| hypothetical protein SELMODRAFT_270871 [Selaginella moellendorffii]
 gb|EFJ29456.1| hypothetical protein SELMODRAFT_146459 [Selaginella moellendorffii]
Length=144

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKFMELK K+  RY+VFKIDE  Q VVVEKLG  +E+++ FT SL
Sbjct  1    MANAASGIAVHDDCKLKFMELKRKKTHRYVVFKIDEKAQQVVVEKLGGPDESYEAFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P NDCR+AV+D+DF
Sbjct  61   PENDCRYAVYDFDF  74



>gb|AAL91666.1| pollen specific actin-depolymerizing factor 1 [Nicotiana tabacum]
Length=137

 Score =   108 bits (270),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN+ SG+ V DECKLKF+ELK+KRN+R+I+FKID  GQ VVVEKLG+ EE+++DF  SL
Sbjct  1    MANAVSGMAVQDECKLKFLELKTKRNYRFIIFKID--GQEVVVEKLGSPEESYEDFANSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD DF
Sbjct  59   PADECRYAVFDLDF  72



>ref|XP_002322471.2| hypothetical protein POPTR_0015s13080g [Populus trichocarpa]
 gb|EEF06598.2| hypothetical protein POPTR_0015s13080g [Populus trichocarpa]
Length=137

 Score =   108 bits (270),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+FKI+   Q VVVEKLG+ EET+++F  SL
Sbjct  1    MANAASGMAVDDECKLKFLELKAKRNYRFIIFKIE--SQQVVVEKLGSPEETYEEFAASL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFDYDF
Sbjct  59   PADECRYAVFDYDF  72



>ref|XP_008804936.1| PREDICTED: zinc finger CCHC domain-containing protein 9 isoform 
X3 [Phoenix dactylifera]
Length=351

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS+SG+ V DECKLKF+ELK+KRNFR+I+FKIDE  Q V VEKLG  +E++DDFT SLP
Sbjct  214  ANSASGMAVNDECKLKFLELKAKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASLP  273

Query  41   SNDCRFAVFDYDF  3
            +N+CR+AVFD+DF
Sbjct  274  ANECRYAVFDFDF  286



>gb|KHG23104.1| Actin-depolymerizing factor 1 [Gossypium arboreum]
Length=139

 Score =   108 bits (270),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +RYIVFKI+E  + VVVEKLG   +++DDFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRYIVFKIEEKQKQVVVEKLGEPSQSYDDFTSSL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_006656880.1| PREDICTED: actin-depolymerizing factor 6-like [Oryza brachyantha]
Length=149

 Score =   108 bits (270),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS+SG+ V DECKLKF ELKSKR+FR+I FKIDE  Q VVV++LG   +T+DDFT S+P
Sbjct  12   ANSASGMAVGDECKLKFQELKSKRSFRFITFKIDEQTQQVVVDRLGQPGDTYDDFTASMP  71

Query  41   SNDCRFAVFDYDF  3
            ++DCR+AVFD+DF
Sbjct  72   ASDCRYAVFDFDF  84



>ref|XP_006281290.1| hypothetical protein CARUB_v10027340mg [Capsella rubella]
 gb|EOA14188.1| hypothetical protein CARUB_v10027340mg [Capsella rubella]
Length=139

 Score =   108 bits (269),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKFMELK+KR++RYIV+KI+E  + V+VEK+G   ETH+D   SL
Sbjct  1    MANAASGMAVHDDCKLKFMELKTKRSYRYIVYKIEEQQKQVIVEKIGEPAETHEDLAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PAHECRYAVFDFDF  74



>gb|KDP25456.1| hypothetical protein JCGZ_20612 [Jatropha curcas]
Length=139

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D+CKLKF ELK+KR++R+IVFKI+E  Q V VEKLG  +++++DFT SL
Sbjct  1    MANSASGMAVHDDCKLKFQELKAKRSYRFIVFKIEEGIQQVTVEKLGKPQQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  61   PANECRYAVFDFDF  74



>ref|XP_002273958.2| PREDICTED: actin-depolymerizing factor 1-like [Vitis vinifera]
 emb|CBI32606.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  260  QTSSLRLIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGT  81
            Q S L +  T KMAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + VVVEK+G 
Sbjct  39   QVSVLVVDRTAKMANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGE  98

Query  80   HEETHDDFTKSLPSNDCRFAVFDYDF  3
              ++++DFT SLP+++CR+AV+D+DF
Sbjct  99   PAQSYEDFTASLPADECRYAVYDFDF  124



>ref|XP_004496563.1| PREDICTED: actin-depolymerizing factor 7-like [Cicer arietinum]
Length=137

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+IVFKI+   Q VVVEKLG  EET++DF  SL
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRNYRFIVFKIE--NQEVVVEKLGGPEETYEDFNASL  58

Query  44   PSNDCRFAVFDYDF  3
            PS++CR+AVFD+DF
Sbjct  59   PSDECRYAVFDFDF  72



>ref|XP_009767736.1| PREDICTED: actin-depolymerizing factor 7-like isoform X2 [Nicotiana 
sylvestris]
Length=137

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELKSKRN+RYI+FKI+   Q VVVEKLG  EE+++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKSKRNYRYIIFKIE--SQQVVVEKLGGTEESYEDFTNSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+ VFD+DF
Sbjct  59   PADECRYTVFDFDF  72



>ref|XP_009397611.1| PREDICTED: actin-depolymerizing factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KR+FR+IVF+I+E  Q V+VEKLG  E+++DD   SL
Sbjct  1    MANSASGMAVSDECKLKFLELKAKRSFRFIVFRIEEKIQRVMVEKLGQPEQSYDDLAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P +DCR+AVFD DF
Sbjct  61   PPDDCRYAVFDLDF  74



>ref|XP_006363318.1| PREDICTED: actin-depolymerizing factor 7-like [Solanum tuberosum]
Length=137

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KR +R+I+FKID   Q VVVEKLG  EET++DFT +L
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRIYRFIIFKID--AQQVVVEKLGNPEETYEDFTNAL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  59   PADECRYAVFDFDF  72



>ref|XP_006476590.1| PREDICTED: actin-depolymerizing factor 1-like [Citrus sinensis]
Length=139

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANSSSG+ V D+CKLKF+ELK+KR++R+IVFKI+E  Q V VEKLG   E+++DFT SL
Sbjct  1    MANSSSGMAVHDDCKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>gb|KGN50293.1| hypothetical protein Csa_5G165880 [Cucumis sativus]
Length=137

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+FKI++  Q VVVEKLG  +ET++DFT SL
Sbjct  1    MANAASGMAVRDECKLKFLELKAKRNYRFIIFKIEQ--QEVVVEKLGQPDETYEDFTGSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  59   PADECRYAVFDFDF  72



>ref|XP_009389157.1| PREDICTED: actin-depolymerizing factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=143

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS+SG+ V DECKLKF+ELK+KRNFR+IVFKI+E  Q V VE+LG   E++DD T SLP
Sbjct  6    ANSASGMAVSDECKLKFLELKAKRNFRFIVFKIEEKIQQVKVERLGQPGESYDDLTASLP  65

Query  41   SNDCRFAVFDYDF  3
             +DCR+AVFD+DF
Sbjct  66   DDDCRYAVFDFDF  78



>ref|NP_001151716.1| LOC100285352 [Zea mays]
 gb|ACG44105.1| actin-depolymerizing factor [Zea mays]
 tpg|DAA36509.1| TPA: actin-depolymerizing factor [Zea mays]
Length=139

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF ELKSKR+FR+I FKI+E  Q VVV++LG   +T+DDFT S+
Sbjct  1    MANSASGMAVSDECKLKFQELKSKRSFRFITFKINEQTQQVVVDRLGQPGDTYDDFTGSM  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AVFD+DF
Sbjct  61   PESECRYAVFDFDF  74



>ref|XP_010537181.1| PREDICTED: actin-depolymerizing factor 7-like isoform X1 [Tarenaya 
hassleriana]
Length=141

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS+SG+ V DECKLKF+ELK+KRN+R+I+F+ID  GQ VV+EKLG  ++T+DDF +SLP
Sbjct  6    ANSASGMAVDDECKLKFLELKAKRNYRFIIFRID--GQQVVIEKLGFPDQTYDDFAQSLP  63

Query  41   SNDCRFAVFDYDF  3
             N+CR+AV+D+DF
Sbjct  64   VNECRYAVYDFDF  76



>ref|XP_009120511.1| PREDICTED: actin-depolymerizing factor 3-like [Brassica rapa]
Length=139

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR FR+IV+KI+E  + VVVEKLG   ++HDDF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTFRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>ref|XP_008437023.1| PREDICTED: actin-depolymerizing factor 7 [Cucumis melo]
Length=137

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+FKI++  Q VVVEKLG  +ET++DFT SL
Sbjct  1    MANAASGMAVRDECKLKFLELKAKRNYRFIIFKIEQ--QEVVVEKLGRPDETYEDFTGSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  59   PADECRYAVFDFDF  72



>ref|NP_001047657.1| Os02g0663800 [Oryza sativa Japonica Group]
 sp|Q6EUH7.1|ADF1_ORYSJ RecName: Full=Actin-depolymerizing factor 1; Short=ADF-1; Short=OsADF1 
[Oryza sativa Japonica Group]
 dbj|BAD27692.1| putative actin-depolymerizing factor [Oryza sativa Japonica Group]
 dbj|BAF09571.1| Os02g0663800 [Oryza sativa Japonica Group]
 dbj|BAG91513.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            M+NS+SG+ V DECKLKF+ELK+KR+FR+IVFKI+E  Q VVV++LG   E++DDFT  L
Sbjct  1    MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGQPGESYDDFTACL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>ref|XP_006439576.1| hypothetical protein CICLE_v10023304mg [Citrus clementina]
 gb|ESR52816.1| hypothetical protein CICLE_v10023304mg [Citrus clementina]
Length=140

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANSSSG+ V DECKLKF+ELK+KR++R+IVFKI+E  Q V VEKLG   E+++DFT SLP
Sbjct  3    ANSSSGMAVHDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASLP  62

Query  41   SNDCRFAVFDYDF  3
            +++CR+AV+D+DF
Sbjct  63   ADECRYAVYDFDF  75



>emb|CDY15154.1| BnaC05g00330D [Brassica napus]
Length=150

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS+SG+ V DECKLKF+ELK+KRN+R+IVFKIDE  Q V ++ +G  EET+D FTK +P
Sbjct  12   ANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVTIDMVGNPEETYDSFTKCMP  71

Query  41   SNDCRFAVFDYDF  3
             N+CR+AV+D+DF
Sbjct  72   ENECRYAVYDFDF  84



>ref|XP_007038697.1| Actin depolymerizing factor 7 [Theobroma cacao]
 gb|EOY23198.1| Actin depolymerizing factor 7 [Theobroma cacao]
Length=137

 Score =   107 bits (266),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF+ELK+KRN+R+IVFKI +  Q VVV+K+G+ +ET+DDF  SL
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNYRFIVFKIQD--QQVVVDKVGSPQETYDDFQASL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  59   PADECRYAVFDFDF  72



>ref|XP_002298043.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011029242.1| PREDICTED: actin-depolymerizing factor isoform X1 [Populus euphratica]
 gb|EEE82848.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=141

 Score =   107 bits (266),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS+SG+ V DECKL+FMELK+KR+ R+IVFKI+E  Q VVVE LG  ++++DDFT SLP
Sbjct  4    ANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASLP  63

Query  41   SNDCRFAVFDYDF  3
            +N+CR+AV+D+DF
Sbjct  64   ANECRYAVYDFDF  76



>gb|KHG06644.1| Actin-depolymerizing factor 1 [Gossypium arboreum]
Length=139

 Score =   106 bits (265),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + VVVEKLG   +++DDFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSQSYDDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_009404611.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   106 bits (265),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+I+FKIDE  + V+VEKLG    T+DDFT +L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIDEKQKQVIVEKLGEPNLTYDDFTATL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+A++D+DF
Sbjct  61   PTNECRYAIYDFDF  74



>gb|KFK27528.1| hypothetical protein AALP_AA8G395200 [Arabis alpina]
Length=139

 Score =   106 bits (264),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + VVVEK+G   ++HDDF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKVGEPGQSHDDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+A+FD+DF
Sbjct  61   PANECRYAIFDFDF  74



>ref|XP_007027090.1| Actin depolymerizing factor 4 isoform 2, partial [Theobroma cacao]
 gb|EOY07592.1| Actin depolymerizing factor 4 isoform 2, partial [Theobroma cacao]
Length=173

 Score =   107 bits (267),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -1

Query  227  KMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKS  48
            +MAN++SG+ V DECKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG   ++++DF KS
Sbjct  34   EMANAASGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPAQSYEDFAKS  93

Query  47   LPSNDCRFAVFDYDF  3
            LP+++CR+AV+D+DF
Sbjct  94   LPADECRYAVYDFDF  108



>ref|XP_006490391.1| PREDICTED: actin-depolymerizing factor 7-like [Citrus sinensis]
Length=137

 Score =   106 bits (264),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKFMELK+KRN+R+I+FKID   Q VVVEKLG+  +++DDFT SL
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRNYRFIIFKID--NQQVVVEKLGSPGDSYDDFTTSL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  59   PADECRYAVYDFDF  72



>ref|XP_008244913.1| PREDICTED: actin-depolymerizing factor 10 [Prunus mume]
Length=139

 Score =   106 bits (264),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D+CKLKF+ELK+KRN R+IVFKI+E  Q V+VEK+G  +E++DDF  S+
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKVGGPDESYDDFASSM  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_007218574.1| hypothetical protein PRUPE_ppa013108mg [Prunus persica]
 gb|EMJ19773.1| hypothetical protein PRUPE_ppa013108mg [Prunus persica]
Length=139

 Score =   105 bits (263),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D+CKLKF+ELK+KRN R+IVFKI+E  Q V+VEK+G  +E++DDF  S+
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKVGGPDESYDDFAASM  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>gb|ADI78873.1| actin-depolymerizing factor [Hevea brasiliensis]
Length=139

 Score =   105 bits (263),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKL+F+ELK+KR +RYIVFKI+E  + V+VEKLG   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRYIVFKIEEKAKQVIVEKLGEPTQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_009131962.1| PREDICTED: actin-depolymerizing factor 3 [Brassica rapa]
Length=139

 Score =   105 bits (263),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + VVVEKLG   ++HDDF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+A+FD+DF
Sbjct  61   PADECRYAIFDFDF  74



>gb|AEW90956.1| actin depolymerizing factor 4-2 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=139

 Score =   105 bits (263),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            M+NS+SG+ V D+CKLKF ELK+KR+FR+IVFKIDE  Q VVV+++G   E++DDFT  L
Sbjct  1    MSNSASGMAVCDDCKLKFQELKAKRSFRFIVFKIDEKVQQVVVDRVGEKTESYDDFTACL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>gb|KHG18554.1| Actin-depolymerizing factor [Gossypium arboreum]
Length=139

 Score =   105 bits (263),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECK++F+ELK+KR++R+IVFKI+E  Q V+VEKLG  +E +DDF+  L
Sbjct  1    MANSASGMAVNDECKMRFLELKAKRSYRFIVFKIEENIQQVMVEKLGGPKEKYDDFSACL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AVFD+DF
Sbjct  61   PHNECRYAVFDFDF  74



>ref|XP_002448300.1| hypothetical protein SORBIDRAFT_06g024870 [Sorghum bicolor]
 gb|EES12628.1| hypothetical protein SORBIDRAFT_06g024870 [Sorghum bicolor]
Length=139

 Score =   105 bits (262),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF ELKSKR+FR+I FKI+E  Q VVV++LG   +++DDFT S+
Sbjct  1    MANSASGMAVSDECKLKFQELKSKRSFRFITFKINEQTQQVVVDRLGQPGDSYDDFTGSM  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AVFD+DF
Sbjct  61   PDSECRYAVFDFDF  74



>gb|EYU18949.1| hypothetical protein MIMGU_mgv1a015984mg [Erythranthe guttata]
Length=139

 Score =   105 bits (262),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D+CKLKFMELK+KR  R+IV+KI+E  + V+VEKLG   ET++DFT SL
Sbjct  1    MANSASGMAVHDDCKLKFMELKAKRTHRFIVYKIEEKQKQVMVEKLGEPIETYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>gb|AEP25120.1| actin depolymerising factor [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AIT97057.1| actin-depolymerizing factor 11 [Triticum aestivum]
Length=139

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            M+NS+SG+ V DECKLKF ELK+KR+FR+IVFKI+E  Q VVV+++G   E++DDFT  L
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKTESYDDFTACL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>gb|AGW22223.1| actin-depolymerizing factor 4 [Triticum aestivum]
Length=139

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            M+NS+SG+ V DECKLKF ELK+KR+FR+IVFKI+E  Q VVV+++G   E++DDFT  L
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKTESYDDFTACL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>ref|XP_004953378.1| PREDICTED: actin-depolymerizing factor 1-like [Setaria italica]
Length=139

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            M+NS+SG+ V DECKLKF+ELK+KR+FR+IVFKI+E  Q VVV++LG   E+++DFT  L
Sbjct  1    MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGEPGESYEDFTACL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>ref|XP_007040194.1| Actin depolymerizing factor 8 [Theobroma cacao]
 gb|EOY24695.1| Actin depolymerizing factor 8 [Theobroma cacao]
Length=139

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECK KF+ELK+KR++R+IVFKI+E  Q VVVEKLG   +++DD + SL
Sbjct  1    MANSASGMAVNDECKRKFLELKAKRSYRFIVFKIEEKIQQVVVEKLGGPSDSYDDLSASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+DF
Sbjct  61   PANECRYAVYDFDF  74



>gb|KDO72931.1| hypothetical protein CISIN_1g032504mg [Citrus sinensis]
Length=125

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG   +T++DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+ +CR+AV+DYDF
Sbjct  61   PAEECRYAVYDYDF  74



>ref|XP_011016059.1| PREDICTED: actin-depolymerizing factor 2-like [Populus euphratica]
Length=139

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KR +R+IV+KI+E  + V+VEKLG   ++++DFT SL
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRFIVYKIEEEQKQVIVEKLGEPAQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_006424770.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 ref|XP_006488280.1| PREDICTED: actin-depolymerizing factor 1-like isoform X2 [Citrus 
sinensis]
 gb|ESR38010.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 gb|KDO72932.1| hypothetical protein CISIN_1g032504mg [Citrus sinensis]
Length=139

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG   +T++DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+ +CR+AV+DYDF
Sbjct  61   PAEECRYAVYDYDF  74



>ref|XP_009421345.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKIDE  + V+VE LG    T+DDFT SL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVIVETLGEPNLTYDDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+A++D+DF
Sbjct  61   PTNECRYAIYDFDF  74



>ref|XP_004240732.1| PREDICTED: actin-depolymerizing factor 7 [Solanum lycopersicum]
Length=137

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+I+FKID   Q VVVEKLG  EE+++DFT +L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRIYRFIIFKID--AQQVVVEKLGNPEESYEDFTNAL  58

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  59   PADECRYAVFDFDF  72



>ref|XP_009767730.1| PREDICTED: uncharacterized protein LOC104218842 isoform X1 [Nicotiana 
sylvestris]
Length=285

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 64/75 (85%), Gaps = 2/75 (3%)
 Frame = -1

Query  227  KMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKS  48
            + AN++SG+ V D+CKLKF+ELKSKRN+RYI+FKI+   Q VVVEKLG  EE+++DFT S
Sbjct  148  EQANAASGMAVHDDCKLKFLELKSKRNYRYIIFKIE--SQQVVVEKLGGTEESYEDFTNS  205

Query  47   LPSNDCRFAVFDYDF  3
            LP+++CR+ VFD+DF
Sbjct  206  LPADECRYTVFDFDF  220



>ref|XP_009387944.1| PREDICTED: zinc finger CCHC domain-containing protein 9-like 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            AN+ SG+ V DECKLKF++LK+KRN+R+IVFKIDE  Q V VEKLG  +ET+DDFT SLP
Sbjct  223  ANAVSGMAVHDECKLKFLDLKAKRNYRFIVFKIDEKIQQVTVEKLGQPDETYDDFTASLP  282

Query  41   SNDCRFAVFDYDF  3
            +++CR+AVFD+DF
Sbjct  283  ADECRYAVFDFDF  295



>ref|XP_006843593.1| hypothetical protein AMTR_s00007p00126220 [Amborella trichopoda]
 gb|ERN05268.1| hypothetical protein AMTR_s00007p00126220 [Amborella trichopoda]
Length=139

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D CKL+F+ELK+KR+ R+IVFKIDE  Q V+VEKLG   +T+DDF  SL
Sbjct  1    MANSASGMAVHDNCKLRFLELKTKRSHRFIVFKIDEKIQQVMVEKLGQPNDTYDDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AVFD+DF
Sbjct  61   PPDECRYAVFDFDF  74



>ref|XP_010535543.1| PREDICTED: actin-depolymerizing factor 4 [Tarenaya hassleriana]
Length=139

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKL+F+ELK+KR +R+IV+KI+E  + V+VEK+G   +T++DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVYKIEEQQKQVIVEKVGEPAQTYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+A+FD+DF
Sbjct  61   PANECRYAIFDFDF  74



>emb|CDX80216.1| BnaC09g35260D [Brassica napus]
Length=252

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR FR+IV+KI+E  + VVVEKLG   ++HDDF  SL
Sbjct  114  MANAASGMAVHDDCKLKFLELKAKRTFRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  173

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  174  PADECRYAVFDFDF  187



>gb|EYU25097.1| hypothetical protein MIMGU_mgv11b015928mg [Erythranthe guttata]
Length=138

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            ANS SG+ V DECKLKF++LK+KRN+R+IVFKI+  GQ VVVEKLG  +E++++FT SLP
Sbjct  3    ANSGSGMAVDDECKLKFLDLKAKRNYRFIVFKIE--GQKVVVEKLGQPDESYENFTASLP  60

Query  41   SNDCRFAVFDYDF  3
            S++CR+AVFD+DF
Sbjct  61   SDECRYAVFDFDF  73



>ref|XP_010529845.1| PREDICTED: actin-depolymerizing factor 2-like [Tarenaya hassleriana]
Length=139

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN+ SG+ V DECKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG   ++++DFT SL
Sbjct  1    MANAVSGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPSQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_011042674.1| PREDICTED: actin-depolymerizing factor 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011042675.1| PREDICTED: actin-depolymerizing factor 2-like isoform X2 [Populus 
euphratica]
Length=139

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + V+VEKLG   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPAQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CRFAV+D+DF
Sbjct  61   PADECRFAVYDFDF  74



>ref|XP_007016496.1| Actin depolymerizing factor 4 [Theobroma cacao]
 gb|EOY34115.1| Actin depolymerizing factor 4 [Theobroma cacao]
Length=139

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + VVVEKLG   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_010260094.1| PREDICTED: actin-depolymerizing factor 2-like [Nelumbo nucifera]
Length=139

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + VVVEKLG   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_011024249.1| PREDICTED: actin-depolymerizing factor 1-like isoform X1 [Populus 
euphratica]
Length=119

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKLKQVIVEKLGKPTDSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+D+
Sbjct  61   PANECRYAVYDFDY  74



>gb|AEW90955.1| actin depolymerizing factor 4-1 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=139

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            M+NS+SG+ V D+CKLKF ELK+KR+FR+IVFKI+E  Q VVV+++G   E++DDFT  L
Sbjct  1    MSNSASGMAVCDQCKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKNESYDDFTACL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>gb|KGN58886.1| hypothetical protein Csa_3G734880 [Cucumis sativus]
Length=139

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + VVVEK+G   ++++DF KSL
Sbjct  1    MANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAKSL  60

Query  44   PSNDCRFAVFDYDF  3
            PS++CR+A++D+DF
Sbjct  61   PSDECRYAIYDFDF  74



>ref|XP_010253266.1| PREDICTED: actin-depolymerizing factor 2 [Nelumbo nucifera]
Length=139

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + VVVEK+G   E+++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTESYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_002314194.1| actin-depolymerizing factor 3 family protein [Populus trichocarpa]
 gb|ABK96064.1| unknown [Populus trichocarpa]
 gb|EEE88149.1| actin-depolymerizing factor 3 family protein [Populus trichocarpa]
Length=139

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + V+VEKLG   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPAQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CRFAV+D+DF
Sbjct  61   PADECRFAVYDFDF  74



>ref|XP_008385227.1| PREDICTED: actin-depolymerizing factor 1-like, partial [Malus 
domestica]
Length=147

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -1

Query  248  LRLIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEET  69
            L  +++++ AN++SG  V D+CKLKF+ELK+KR +R+IVFKIDE    V+VEKLG   E+
Sbjct  1    LSSVSSYEQANAASGFXVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGXPAES  60

Query  68   HDDFTKSLPSNDCRFAVFDYDF  3
            ++DFT +LP N+CR+AV+D+DF
Sbjct  61   YEDFTANLPDNECRYAVYDFDF  82



>ref|XP_009358343.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
Length=139

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG  V D+CKLKF+ELK+KR +R+IVFKIDE    V+VEKLG   E+++DFT +L
Sbjct  1    MANAASGFAVNDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGQPAESYEDFTANL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  61   PDNECRYAVYDFDF  74



>dbj|BAK04382.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            M+NS+SG+ V DECKLKF ELK+KR+FR+IVFKI+E  Q VVV+++G   E++DDF   L
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKNESYDDFAACL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>ref|XP_008357628.1| PREDICTED: actin-depolymerizing factor 1-like [Malus domestica]
Length=139

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG  V D+CKLKF+ELK+KR +R+IVFKIDE    V+VEKLG   E+++DFT +L
Sbjct  1    MANAASGFAVNDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGEPAESYEDFTANL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  61   PDNECRYAVYDFDF  74



>ref|XP_010096647.1| Actin-depolymerizing factor 2 [Morus notabilis]
 gb|EXB65315.1| Actin-depolymerizing factor 2 [Morus notabilis]
Length=159

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 67/93 (72%), Gaps = 9/93 (10%)
 Frame = -1

Query  281  FSFQNPPQTSSLRLIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAV  102
              FQ+ P   S         AN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + V
Sbjct  11   LDFQSQPSDGS---------ANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQV  61

Query  101  VVEKLGTHEETHDDFTKSLPSNDCRFAVFDYDF  3
            +VEKLG   ++++DFT SLP N+CR+AV+DYDF
Sbjct  62   IVEKLGEPTQSYEDFTASLPDNECRYAVYDYDF  94



>ref|XP_006445079.1| hypothetical protein CICLE_v10023747mg, partial [Citrus clementina]
 gb|ESR58319.1| hypothetical protein CICLE_v10023747mg, partial [Citrus clementina]
Length=138

 Score =   103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            AN+ SG+ V DECKLKF+ELK+KRN R+IVFKIDE  Q V VE++G+ + +++DFTKSLP
Sbjct  1    ANAVSGMAVHDECKLKFLELKAKRNHRFIVFKIDEKIQQVTVERVGSPQASYEDFTKSLP  60

Query  41   SNDCRFAVFDYDF  3
            +++CR AVFD+DF
Sbjct  61   ADECRHAVFDFDF  73



>gb|EPS73519.1| actin-depolymerizing factor, partial [Genlisea aurea]
Length=143

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKFMELK+KR  R+IV+KI+E  + VVVEKLG   +T++DFT SL
Sbjct  5    MANAASGMAVHDDCKLKFMELKAKRTHRFIVYKIEEKQKQVVVEKLGEPTQTYEDFTASL  64

Query  44   PSNDCRFAVFDYDF  3
            P+ +CR+AV+D+DF
Sbjct  65   PAQECRYAVYDFDF  78



>ref|XP_004142080.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis sativus]
 ref|XP_004169676.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis sativus]
 gb|KGN54230.1| hypothetical protein Csa_4G294380 [Cucumis sativus]
Length=139

 Score =   103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELKSKR  R+IVFKI+E  + VVVEKLG   ++++DF  SL
Sbjct  1    MANAASGMAVNDECKLKFLELKSKRTHRFIVFKIEEKLKQVVVEKLGGPSQSYEDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+DF
Sbjct  61   PANECRYAVYDFDF  74



>ref|XP_006400899.1| hypothetical protein EUTSA_v10014975mg [Eutrema salsugineum]
 gb|ESQ42352.1| hypothetical protein EUTSA_v10014975mg [Eutrema salsugineum]
Length=139

 Score =   103 bits (258),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + V+VEK+G   ++HDDF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVIVEKVGEPGQSHDDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+A+FD+DF
Sbjct  61   PADECRYAIFDFDF  74



>gb|KHN05922.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=139

 Score =   103 bits (258),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KR +RYIVFKI+E  + V+VEKLG     +D+F  SL
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRYIVFKIEEKSKQVIVEKLGDPANGYDEFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_004140838.1| PREDICTED: uncharacterized protein LOC101212555 [Cucumis sativus]
Length=396

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 67/75 (89%), Gaps = 2/75 (3%)
 Frame = -1

Query  227  KMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKS  48
            K+AN++SG+ V DECKLKF+ELK+KRN+R+I+FKI+   Q VVVEKLG+ EET+DDF+ +
Sbjct  259  KVANAASGMAVRDECKLKFLELKTKRNYRFIIFKIE--NQEVVVEKLGSPEETYDDFSAA  316

Query  47   LPSNDCRFAVFDYDF  3
            +P+N+CR+AVFD+DF
Sbjct  317  IPANECRYAVFDFDF  331



>ref|XP_009353719.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
 ref|XP_009338379.1| PREDICTED: actin-depolymerizing factor 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009338380.1| PREDICTED: actin-depolymerizing factor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=139

 Score =   103 bits (258),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG  V D+CKLKF+ELK+KR +R+IVFKIDE    V+VEKLG   E+++DFT +L
Sbjct  1    MANAASGFAVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGEPAESYEDFTANL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  61   PDNECRYAVYDFDF  74



>ref|XP_002299887.1| hypothetical protein POPTR_0001s24330g [Populus trichocarpa]
 ref|XP_006387927.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011000286.1| PREDICTED: actin-depolymerizing factor 2 [Populus euphratica]
 gb|ABK92579.1| unknown [Populus trichocarpa]
 gb|ABK96321.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE84692.1| hypothetical protein POPTR_0001s24330g [Populus trichocarpa]
 gb|ERP46841.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   103 bits (258),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + V+VEKLG   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPAQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_004157224.1| PREDICTED: uncharacterized LOC101212555 [Cucumis sativus]
Length=396

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 67/75 (89%), Gaps = 2/75 (3%)
 Frame = -1

Query  227  KMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKS  48
            K+AN++SG+ V DECKLKF+ELK+KRN+R+I+FKI+   Q VVVEKLG+ EET+DDF+ +
Sbjct  259  KVANAASGMAVRDECKLKFLELKTKRNYRFIIFKIE--NQEVVVEKLGSPEETYDDFSAA  316

Query  47   LPSNDCRFAVFDYDF  3
            +P+N+CR+AVFD+DF
Sbjct  317  IPANECRYAVFDFDF  331



>ref|XP_008439227.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103484078 
[Cucumis melo]
Length=386

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = -1

Query  242  LIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHD  63
            ++     AN++SG+ V DECKLKF+ELK+KRN+R+I+FKI+   Q VVVEKLG+ EET+D
Sbjct  244  ILVVMNXANAASGMAVRDECKLKFLELKAKRNYRFIIFKIE--NQEVVVEKLGSPEETYD  301

Query  62   DFTKSLPSNDCRFAVFDYDF  3
            DFT ++P+N+CR+AVFD+DF
Sbjct  302  DFTAAIPANECRYAVFDFDF  321



>gb|KDO72933.1| hypothetical protein CISIN_1g032504mg [Citrus sinensis]
Length=92

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            AN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG   +T++DF  SLP
Sbjct  11   ANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLP  70

Query  41   SNDCRFAVFDYDF  3
            + +CR+AV+DYDF
Sbjct  71   AEECRYAVYDYDF  83



>emb|CAA18167.1| actin depolymerizing factor-like protein [Arabidopsis thaliana]
 emb|CAB81369.1| actin depolymerizing factor-like protein [Arabidopsis thaliana]
 gb|AAQ65136.1| At4g25590 [Arabidopsis thaliana]
Length=130

 Score =   103 bits (257),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 59/67 (88%), Gaps = 2/67 (3%)
 Frame = -1

Query  203  VGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLPSNDCRF  24
            + V DECKLKF+ELKSKRN+R+I+F+ID  GQ VVVEKLG  +ET+DDFT SLP+N+CR+
Sbjct  1    MAVEDECKLKFLELKSKRNYRFIIFRID--GQQVVVEKLGNPDETYDDFTASLPANECRY  58

Query  23   AVFDYDF  3
            AVFD+DF
Sbjct  59   AVFDFDF  65



>ref|XP_008447631.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis melo]
Length=139

 Score =   103 bits (258),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELKSKR  R+IVFKI+E  + VVVEKLG   ++++DF  SL
Sbjct  1    MANAASGMAVNDECKLKFLELKSKRTHRFIVFKIEEKLKQVVVEKLGGPSQSYEDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+DF
Sbjct  61   PANECRYAVYDFDF  74



>ref|XP_004142738.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis sativus]
 ref|XP_004156722.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis sativus]
 gb|KGN51280.1| hypothetical protein Csa_5G512870 [Cucumis sativus]
Length=139

 Score =   103 bits (257),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKL+F++LK+KR +R+IVFKI+E  + VVVEKLG   E+++DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVVVEKLGKPSESYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_009357677.1| PREDICTED: actin-depolymerizing factor 1 [Pyrus x bretschneideri]
Length=139

 Score =   103 bits (257),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK++R +R+IV+KI+E    VVVEKLG   ++++DF+ SL
Sbjct  1    MANAASGMAVHDECKLKFLELKARRTYRFIVYKIEEKQNGVVVEKLGEPTDSYEDFSASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+D+
Sbjct  61   PANECRYAVYDFDY  74



>ref|XP_007218580.1| hypothetical protein PRUPE_ppa013189mg [Prunus persica]
 gb|EMJ19779.1| hypothetical protein PRUPE_ppa013189mg [Prunus persica]
Length=135

 Score =   103 bits (257),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 61/71 (86%), Gaps = 2/71 (3%)
 Frame = -1

Query  215  SSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLPSN  36
            ++SG+ V DECKLKF+ELK+KRN RYI+FKI+   Q VVVEK+GT EET+DDF  SLP++
Sbjct  2    AASGMAVSDECKLKFLELKAKRNHRYIIFKIE--IQQVVVEKVGTKEETYDDFAASLPAD  59

Query  35   DCRFAVFDYDF  3
            +CR+AVFD+DF
Sbjct  60   ECRYAVFDFDF  70



>ref|XP_008463478.1| PREDICTED: actin-depolymerizing factor 2 isoform X1 [Cucumis 
melo]
 ref|XP_008463479.1| PREDICTED: actin-depolymerizing factor 2 isoform X2 [Cucumis 
melo]
Length=139

 Score =   103 bits (257),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKL+F++LK+KR +R+IVFKI+E  + VVVEKLG   E+++DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVVVEKLGEPSESYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_002314195.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|EEE88150.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   103 bits (257),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + V+VEKLG   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEEQKQVIVEKLGEPAQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_009388628.1| PREDICTED: actin-depolymerizing factor 7 [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   103 bits (257),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKIDE  + VVVEK+G     +DDF+ SL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVVVEKVGEPTLGYDDFSASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  61   PTNECRYAVFDFDF  74



>ref|XP_007144457.1| hypothetical protein PHAVU_007G157800g [Phaseolus vulgaris]
 gb|AGV54234.1| actin-depolymerizing factor [Phaseolus vulgaris]
 gb|ESW16451.1| hypothetical protein PHAVU_007G157800g [Phaseolus vulgaris]
Length=139

 Score =   103 bits (257),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +RYIV+KI+E  + VVVEKLG     ++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRYIVYKIEEKQKQVVVEKLGEPANGYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|NP_001148898.1| actin-depolymerizing factor [Zea mays]
 gb|ACG33344.1| actin-depolymerizing factor [Zea mays]
Length=139

 Score =   103 bits (257),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            M+NS+SG+ V DECKLKF ELK+KR+FR+IVFKI+E  Q VVV++LG   E++D FT   
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINENVQQVVVDRLGEPGESYDAFTACF  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  61   PANECRYAVFDFDF  74



>ref|XP_008385142.1| PREDICTED: actin-depolymerizing factor 1-like [Malus domestica]
Length=132

 Score =   103 bits (256),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG  V D+CKLKF+ELK+KR +R+IVFKIDE    V+VEKLG   E+++DFT +L
Sbjct  1    MANAASGFXVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGXPAESYEDFTANL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AV+D+DF
Sbjct  61   PDNECRYAVYDFDF  74



>ref|XP_002311154.2| hypothetical protein POPTR_0008s05210g [Populus trichocarpa]
 gb|EEE88521.2| hypothetical protein POPTR_0008s05210g [Populus trichocarpa]
Length=218

 Score =   105 bits (262),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  227  KMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKS  48
            KMAN++SG+ V D+CKLKF+ELK+KR  R+IVFKI+E  + V+VEKLG   ++++DFT S
Sbjct  79   KMANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGKPTDSYEDFTAS  138

Query  47   LPSNDCRFAVFDYDF  3
            LP+N+CR+AV+D+D+
Sbjct  139  LPANECRYAVYDFDY  153



>ref|XP_010533658.1| PREDICTED: actin-depolymerizing factor 8-like [Tarenaya hassleriana]
Length=139

 Score =   103 bits (257),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANSSSG+ V DECK++F ELK+KR +R+IVFK+DE  Q V VEKLG   E++DDF   L
Sbjct  1    MANSSSGMHVDDECKIRFQELKAKRIYRFIVFKVDEKLQRVTVEKLGGPTESYDDFASEL  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AVFDYDF
Sbjct  61   PQDECRYAVFDYDF  74



>ref|XP_006846080.1| hypothetical protein AMTR_s00012p00089320 [Amborella trichopoda]
 gb|ERN07755.1| hypothetical protein AMTR_s00012p00089320 [Amborella trichopoda]
Length=139

 Score =   103 bits (256),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KR +RY+VFKI+E  + V+VEKLG   + ++ FT SL
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYVVFKIEEKLKQVIVEKLGEPTDGYEAFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+DF
Sbjct  61   PANECRYAVYDFDF  74



>gb|KCW88917.1| hypothetical protein EUGRSUZ_A01245 [Eucalyptus grandis]
Length=114

 Score =   102 bits (255),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKL+F+ELK+KR +R+IVFKI+E  + VVVEK+G   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>gb|ABD63906.1| actin depolymerizing factor 2 [Gossypium hirsutum]
 gb|KHG27900.1| Actin-depolymerizing factor 2 [Gossypium arboreum]
 gb|KHG27902.1| Actin-depolymerizing factor 2 [Gossypium arboreum]
Length=139

 Score =   103 bits (256),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR  R+IVFKI+E  + V+VEKLG   E+++DFTK L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGEPTESYEDFTKCL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_006647644.1| PREDICTED: actin-depolymerizing factor 1-like [Oryza brachyantha]
Length=139

 Score =   103 bits (256),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            M+NS+SG+ V DECKLKF +LK+KR+FR+IVFKI+E  Q VVV++LG   E++DDF+  L
Sbjct  1    MSNSASGMAVCDECKLKFQDLKAKRSFRFIVFKINEKVQQVVVDRLGQPGESYDDFSACL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>gb|ACR38016.1| unknown [Zea mays]
 gb|AFW63299.1| actin-depolymerizing factor [Zea mays]
Length=139

 Score =   103 bits (256),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            M+NS+SG+ V DECKLKF ELK+KR+FR+IVFKI+E  Q VVV++LG   E++D FT   
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINENVQQVVVDRLGGPGESYDAFTACF  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  61   PANECRYAVFDFDF  74



>ref|XP_008343560.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   103 bits (256),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK++R +R+IV+KI+E    V+VEKLG   ++++DF+ SL
Sbjct  1    MANAASGMAVHDECKLKFLELKARRTYRFIVYKIEEKQNGVIVEKLGEPTDSYEDFSASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+D+
Sbjct  61   PANECRYAVYDFDY  74



>gb|ABD66505.1| actin depolymerizing factor 3 [Gossypium hirsutum]
Length=139

 Score =   103 bits (256),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR  R+IVFKI+E  + V+VEKLG   E+++DFTK L
Sbjct  1    MANAASGMAVHDDCKLKFLELKTKRTHRFIVFKIEEKQKQVIVEKLGEPTESYEDFTKCL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>emb|CDY00526.1| BnaA10g07470D [Brassica napus]
Length=130

 Score =   102 bits (255),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 59/67 (88%), Gaps = 2/67 (3%)
 Frame = -1

Query  203  VGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLPSNDCRF  24
            + V DECKLKF+ELKSKRN+R+I+F+ID  GQ VVVEKLG+ EE +DDF+ SLP+N+CR+
Sbjct  1    MAVEDECKLKFLELKSKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSLPANECRY  58

Query  23   AVFDYDF  3
            AVFD+DF
Sbjct  59   AVFDFDF  65



>emb|CDX88730.1| BnaA03g09190D [Brassica napus]
Length=154

 Score =   103 bits (257),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            AN++SG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + VVVEKLG   ++HDDF  SLP
Sbjct  17   ANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASLP  76

Query  41   SNDCRFAVFDYDF  3
            +++CR+A+FD+DF
Sbjct  77   ADECRYAIFDFDF  89



>ref|XP_011077447.1| PREDICTED: actin-depolymerizing factor 1-like [Sesamum indicum]
Length=173

 Score =   103 bits (258),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 70/99 (71%), Gaps = 11/99 (11%)
 Frame = -1

Query  299  LISLSPFSFQNPPQTSSLRLIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKID  120
            + S SP S    P+           MAN++SG+ V D+CKL+F+ELK+KR +R+I+FKI+
Sbjct  21   VFSWSPRSLPEAPE-----------MANAASGMAVHDDCKLRFLELKAKRTYRFIIFKIE  69

Query  119  ETGQAVVVEKLGTHEETHDDFTKSLPSNDCRFAVFDYDF  3
            E  + VVVEK+G   +++DDFT SLP ++CR+AV+D+DF
Sbjct  70   EKQKQVVVEKVGEPTQSYDDFTASLPVDECRYAVYDFDF  108



>ref|XP_010669849.1| PREDICTED: actin-depolymerizing factor 4-like [Beta vulgaris 
subsp. vulgaris]
Length=139

 Score =   103 bits (256),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+I+FKI+E  + V+VEK+G   E+++DFT S+
Sbjct  1    MANAASGMAVDDQCKLKFLELKTKRTYRFIIFKIEEKQKQVIVEKVGEPSESYEDFTASI  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>gb|KDP35600.1| hypothetical protein JCGZ_09038 [Jatropha curcas]
Length=139

 Score =   102 bits (255),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + V+VEK+G   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPNQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_010553292.1| PREDICTED: actin-depolymerizing factor 1 [Tarenaya hassleriana]
Length=139

 Score =   102 bits (255),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELKSKR +R+IV+KI+E  + V+VEKLG   ++++DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKSKRTYRFIVYKIEEKQKQVIVEKLGEPSQSYEDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_010910431.1| PREDICTED: actin-depolymerizing factor-like [Elaeis guineensis]
Length=132

 Score =   102 bits (255),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -1

Query  203  VGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLPSNDCRF  24
            + V D+CKLKF+ELK+KRNFR+I+FKIDE  Q V VEKLG  +E++DDFT SLP+N+CR+
Sbjct  1    MAVNDDCKLKFLELKAKRNFRFIIFKIDEKIQQVTVEKLGQPDESYDDFTASLPANECRY  60

Query  23   AVFDYDF  3
            AVFD+DF
Sbjct  61   AVFDFDF  67



>ref|XP_010455704.1| PREDICTED: actin-depolymerizing factor 3 [Camelina sativa]
 ref|XP_010443774.1| PREDICTED: actin-depolymerizing factor 3 [Camelina sativa]
 ref|XP_010483636.1| PREDICTED: actin-depolymerizing factor 3 [Camelina sativa]
Length=139

 Score =   102 bits (255),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKFMELK+KR +R+IV+KI+E  + V+VEK+G   ++H+D   SL
Sbjct  1    MANAASGMAVHDDCKLKFMELKTKRTYRFIVYKIEEQQKQVMVEKIGEPNQSHEDLAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>ref|XP_008442569.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis melo]
Length=139

 Score =   102 bits (255),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + VVVEK+G   ++++DF KSL
Sbjct  1    MANAASGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAKSL  60

Query  44   PSNDCRFAVFDYDF  3
            PS++CR+A++D+DF
Sbjct  61   PSDECRYAIYDFDF  74



>gb|ADV04049.1| actin depolymerizing factor 4 [Hevea brasiliensis]
Length=139

 Score =   102 bits (255),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG    +++DFT SL
Sbjct  1    MANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTNSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+D+
Sbjct  61   PADECRYAVYDFDY  74



>ref|XP_006606908.1| PREDICTED: uncharacterized protein LOC100783153 [Glycine max]
Length=402

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            AN++SG+ V DECKLKF+ELK+KRN+R+IVFKI+     VVVEKLG+ EET+DDF+ SLP
Sbjct  267  ANAASGMAVIDECKLKFLELKAKRNYRFIVFKIENY--EVVVEKLGSPEETYDDFSASLP  324

Query  41   SNDCRFAVFDYDF  3
            +N+CR+AVFD+DF
Sbjct  325  ANECRYAVFDFDF  337



>gb|ABK94603.1| unknown [Populus trichocarpa]
Length=139

 Score =   102 bits (255),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR  R+IVFKI+E  + V+VEKLG   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGKPTDSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+D+
Sbjct  61   PANECRYAVYDFDY  74



>emb|CDX71068.1| BnaC03g11520D [Brassica napus]
Length=164

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            AN++SG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + VVVEKLG   ++HDDF  SLP
Sbjct  27   ANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASLP  86

Query  41   SNDCRFAVFDYDF  3
            +++CR+A+FD+DF
Sbjct  87   ADECRYAIFDFDF  99



>ref|XP_009337572.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
Length=139

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN+ SG+ V DECKLKF+ELK+KR +R+IV+KI+E    V+VEKLG   ++++DF+ SL
Sbjct  1    MANARSGMAVHDECKLKFLELKAKRTYRFIVYKIEEKQNEVIVEKLGEPTDSYEDFSASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+D+
Sbjct  61   PANECRYAVYDFDY  74



>gb|EYU36258.1| hypothetical protein MIMGU_mgv1a015971mg [Erythranthe guttata]
Length=139

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D+CKLKFMELK+KR  R+IVFKI+E  + V+VEKLG   +T++DFT +L
Sbjct  1    MANSASGMAVHDDCKLKFMELKTKRTHRFIVFKIEEKQKQVLVEKLGEPVQTYEDFTANL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>gb|AEZ00870.1| putative actin depolymerizing factor protein, partial [Elaeis 
guineensis]
Length=179

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = -1

Query  305  PTLISLSPFSFQNPPQTSSLRLIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFK  126
            P L + S  S  NP  +++   IA  +MAN++SG+ V D+CKLKF+ELK+KR  RYI+FK
Sbjct  16   PRLQAQSHRSSSNP--SAARAPIAFAEMANAASGMAVNDDCKLKFLELKAKRTHRYIIFK  73

Query  125  IDETGQAVVVEKLGTHEETHDDFTKSLPSNDCRFAVFDYDF  3
            IDE  + V+VEK+G    +++DFT +LP+++CR+A++D+DF
Sbjct  74   IDEKLKQVIVEKVGEPTLSYEDFTAALPADECRYAIYDFDF  114



>gb|KCW50259.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=139

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + V+VEKLG    +++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPANSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_009593022.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009801697.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana sylvestris]
Length=139

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG   E+++DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPAESYEDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+ VFD+DF
Sbjct  61   PADECRYTVFDFDF  74



>ref|XP_010031003.1| PREDICTED: actin-depolymerizing factor 2-like [Eucalyptus grandis]
 gb|KCW50263.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=139

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + V+VEKLG    +++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPANSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_006424771.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 ref|XP_006488279.1| PREDICTED: actin-depolymerizing factor 1-like isoform X1 [Citrus 
sinensis]
 gb|ESR38011.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
Length=141

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            AN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG   +T++DF  SLP
Sbjct  4    ANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLP  63

Query  41   SNDCRFAVFDYDF  3
            + +CR+AV+DYDF
Sbjct  64   AEECRYAVYDYDF  76



>gb|KCW88915.1| hypothetical protein EUGRSUZ_A01245 [Eucalyptus grandis]
Length=113

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKL+F+ELK+KR +R+IVFKI+E  + VVVEK+G   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_011000294.1| PREDICTED: actin-depolymerizing factor 2-like [Populus euphratica]
Length=139

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R IVFKI+E  + V+VEKLG   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKLKQVIVEKLGEPAQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_006590210.1| PREDICTED: uncharacterized protein LOC100804471 [Glycine max]
Length=403

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            AN++SG+ V DECKLKF+ELK+KRN+R+IVFKI+     VVVEKLG+ EET+DDF+ SLP
Sbjct  268  ANAASGMAVIDECKLKFLELKAKRNYRFIVFKIENY--EVVVEKLGSPEETYDDFSASLP  325

Query  41   SNDCRFAVFDYDF  3
            +N+CR+AVFD+DF
Sbjct  326  ANECRYAVFDFDF  338



>ref|XP_010047513.1| PREDICTED: actin-depolymerizing factor 2 [Eucalyptus grandis]
Length=139

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKL+F+ELK+KR +R+IVFKI+E  + VVVEK+G   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>gb|AFN53688.1| putative actin-depolymerizing factor 12 [Linum usitatissimum]
Length=388

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 69/86 (80%), Gaps = 5/86 (6%)
 Frame = -1

Query  260  QTSSLRLIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGT  81
            + S L+ +AT   ANS+SG+ V D+CKLKF+ELK+KRN+R+IVFKI    Q V VEKLG+
Sbjct  243  KPSDLKEVAT---ANSASGMAVHDDCKLKFLELKAKRNYRFIVFKI--MNQQVSVEKLGS  297

Query  80   HEETHDDFTKSLPSNDCRFAVFDYDF  3
             EET++DFT SLP N+CR+AV+D+DF
Sbjct  298  PEETYEDFTSSLPPNECRYAVYDFDF  323



>gb|KCW88916.1| hypothetical protein EUGRSUZ_A01245 [Eucalyptus grandis]
Length=108

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKL+F+ELK+KR +R+IVFKI+E  + VVVEK+G   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_004495011.1| PREDICTED: actin-depolymerizing factor 2-like [Cicer arietinum]
Length=139

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KR +RYI++KI+E  + VVV+KLG     +DDFT +L
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYIIYKIEEKQKQVVVDKLGEPANGYDDFTANL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_002284292.1| PREDICTED: actin-depolymerizing factor 2 [Vitis vinifera]
Length=139

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + VVVEK+G   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>gb|EAY95118.1| hypothetical protein OsI_16935 [Oryza sativa Indica Group]
Length=403

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -1

Query  233  THKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFT  54
            T   ANS+SG+ V DECKLKF ELKSKR+FR+I FKIDE  Q VVV++LG   +T+DDFT
Sbjct  262  TKAKANSASGMAVGDECKLKFQELKSKRSFRFITFKIDERTQQVVVDRLGQPGDTYDDFT  321

Query  53   KSLPSNDCRFAVFDYDF  3
             S+P+++CR+AVFD+DF
Sbjct  322  ASMPASECRYAVFDFDF  338



>ref|XP_009137539.1| PREDICTED: actin-depolymerizing factor-like [Brassica rapa]
Length=136

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 62/74 (84%), Gaps = 3/74 (4%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D CKLKF+ELK KR +R+I+F+ID  GQ VVVEKLG  +ET+DDFT SL
Sbjct  1    MANAASGMAVEDNCKLKFLELK-KRTYRFIIFRID--GQQVVVEKLGNPQETYDDFTNSL  57

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD DF
Sbjct  58   PADECRYAVFDLDF  71



>gb|EEE61469.1| hypothetical protein OsJ_15732 [Oryza sativa Japonica Group]
Length=403

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -1

Query  233  THKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFT  54
            T   ANS+SG+ V DECKLKF ELKSKR+FR+I FKIDE  Q VVV++LG   +T+DDFT
Sbjct  262  TKAKANSASGMAVGDECKLKFQELKSKRSFRFITFKIDERTQQVVVDRLGQPGDTYDDFT  321

Query  53   KSLPSNDCRFAVFDYDF  3
             S+P+++CR+AVFD+DF
Sbjct  322  ASMPASECRYAVFDFDF  338



>ref|NP_001148445.1| actin-depolymerizing factor [Zea mays]
 gb|ACG31487.1| actin-depolymerizing factor [Zea mays]
 gb|AFW72692.1| actin-depolymerizing factor [Zea mays]
Length=139

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            M+NS+SG+ V DECKLKF+ELK+KR+FR+IVFKI+E  Q VVV++LG   E++D F    
Sbjct  1    MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINENVQQVVVDRLGGPGESYDAFRACF  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AVFD+DF
Sbjct  61   PANECRYAVFDFDF  74



>gb|ABD66508.1| actin depolymerizing factor 6 [Gossypium hirsutum]
Length=139

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF ELK+KR  R+IVFKI+E  + V+VEKLG   E+++DFTK L
Sbjct  1    MANAASGMAVHDDCKLKFQELKAKRTHRFIVFKIEEKQKQVIVEKLGEPTESYEDFTKCL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_002303579.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011022717.1| PREDICTED: actin-depolymerizing factor 1-like [Populus euphratica]
 gb|EEE78558.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D CKL+F+ELK+KR+ R+IVFKI+E  Q VVVE LG  ++++DDFT SL
Sbjct  1    MANSASGMAVNDGCKLRFLELKAKRSHRFIVFKIEEKTQQVVVETLGEPQQSYDDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P ++CR+AV+D+DF
Sbjct  61   PIDECRYAVYDFDF  74



>gb|AAR23800.1| putative actin-depolymerizing factor 2 [Helianthus annuus]
Length=139

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKFM+LK+KR  R+I++KI+E  + V+VEK+G   +T+D+F   L
Sbjct  1    MANAASGMAVHDECKLKFMDLKAKRTHRFIIYKIEEKQKQVMVEKVGEPAQTYDEFAACL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AVFDYDF
Sbjct  61   PENECRYAVFDYDF  74



>sp|Q9FVI1.1|ADF2_PETHY RecName: Full=Actin-depolymerizing factor 2; Short=ADF-2 [Petunia 
x hybrida]
 gb|AAG16974.1|AF183904_1 actin-depolymerizing factor 2 [Petunia x hybrida]
 gb|AAK72616.1| actin-depolymerizing factor 2 [Petunia x hybrida]
Length=143

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+I++KI+E  + VVVEKLG   E+++DFT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKEVVVEKLGEPTESYEDFTAGL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_004172071.1| PREDICTED: actin-depolymerizing factor 1-like, partial [Cucumis 
sativus]
Length=138

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  ANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLP  42
            AN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + VVVEK+G   ++++DF KSLP
Sbjct  1    ANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAKSLP  60

Query  41   SNDCRFAVFDYDF  3
            S++CR+A++D+DF
Sbjct  61   SDECRYAIYDFDF  73



>ref|XP_006843087.1| hypothetical protein AMTR_s00140p00036970 [Amborella trichopoda]
 gb|ERN04762.1| hypothetical protein AMTR_s00140p00036970 [Amborella trichopoda]
Length=139

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D+C+ +F+ELK+KR++R+IVFKI+E  Q V VEK+G   +T+DDF  SL
Sbjct  1    MANSASGMAVNDDCQQRFLELKAKRSYRFIVFKIEEKIQQVTVEKIGMPNDTYDDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P N+CR+AVFD+DF
Sbjct  61   PPNECRYAVFDFDF  74



>gb|KDP29838.1| hypothetical protein JCGZ_18413 [Jatropha curcas]
Length=139

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR  R+IVFKI+E  + VVVEKLG    +++DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVVVEKLGEPANSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>emb|CDY31909.1| BnaC09g28350D [Brassica napus]
Length=130

 Score =   101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 59/67 (88%), Gaps = 2/67 (3%)
 Frame = -1

Query  203  VGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSLPSNDCRF  24
            + V DECK+KF+ELKSKRN+R+I+F+ID  GQ VVVEKLG+ EE +DDF+ SLP+N+CR+
Sbjct  1    MAVEDECKIKFLELKSKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSLPANECRY  58

Query  23   AVFDYDF  3
            AVFD+DF
Sbjct  59   AVFDFDF  65



>ref|XP_002533101.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF29273.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKL+F+ELK+KR +R+IVFKI+E  + V+VEK+G   ++++DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_011030201.1| PREDICTED: uncharacterized protein LOC105129717 [Populus euphratica]
Length=296

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            +AN++SG+ V DECKLKF+ELK+KRN+R+I+FKI+   Q VVVEKLG+ EET+++F  SL
Sbjct  160  IANAASGMAVDDECKLKFLELKAKRNYRFIIFKIE--SQQVVVEKLGSPEETYEEFAASL  217

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFDYDF
Sbjct  218  PADECRYAVFDYDF  231



>ref|XP_009109200.1| PREDICTED: actin-depolymerizing factor-like [Brassica rapa]
Length=136

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 63/74 (85%), Gaps = 3/74 (4%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D CKLKF+ELK KR  R+I+F+ID  GQ VVVEKLG+ +ET+DDFT SL
Sbjct  1    MANAASGMAVEDNCKLKFLELK-KRTHRFIIFRID--GQQVVVEKLGSPQETYDDFTASL  57

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  58   PADECRYAVFDFDF  71



>ref|XP_009601830.1| PREDICTED: uncharacterized protein LOC104097027 [Nicotiana tomentosiformis]
Length=470

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN+ SG+ V DECKLKF+ELK+KRN+R+I+FKID  GQ VVVEKLG+ EE+++DF  SL
Sbjct  334  MANAVSGMAVQDECKLKFLELKTKRNYRFIIFKID--GQEVVVEKLGSPEESYEDFANSL  391

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD DF
Sbjct  392  PADECRYAVFDLDF  405



>ref|XP_008371032.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN+ SG+ V DECK+KF+ELK+KR +R+IV+KI+E    V+VEKLG   ++++DF+ SL
Sbjct  1    MANARSGMAVHDECKIKFLELKAKRTYRFIVYKIEEKQNEVIVEKLGQPTDSYEDFSASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+N+CR+AV+D+D+
Sbjct  61   PANECRYAVYDFDY  74



>ref|XP_006436042.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 ref|XP_006486066.1| PREDICTED: actin-depolymerizing factor 2-like [Citrus sinensis]
 gb|ESR49282.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 gb|KDO67706.1| hypothetical protein CISIN_1g032498mg [Citrus sinensis]
Length=139

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + VVVEKLG   +++++FT SL
Sbjct  1    MANAASGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSDSYENFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_007206123.1| hypothetical protein PRUPE_ppa013110mg [Prunus persica]
 ref|XP_008223136.1| PREDICTED: actin-depolymerizing factor 2 [Prunus mume]
 gb|EMJ07322.1| hypothetical protein PRUPE_ppa013110mg [Prunus persica]
Length=139

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG  V D+CKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG   E++++FT SL
Sbjct  1    MANAASGFAVDDDCKLKFLELKAKRTYRFIVFKIEEEQKQVIVEKLGEPAESYENFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>dbj|BAK06235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V DECKLKF +LK+KR+FR+I FKI+E  Q VVV+++G   +T+ DFT S+
Sbjct  1    MANSASGMAVSDECKLKFQDLKAKRSFRFITFKINENTQQVVVDRVGQPGDTYADFTASM  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFD+DF
Sbjct  61   PADECRYAVFDFDF  74



>ref|XP_002864656.1| hypothetical protein ARALYDRAFT_496124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40915.1| hypothetical protein ARALYDRAFT_496124 [Arabidopsis lyrata subsp. 
lyrata]
Length=139

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKL+FMELK+KR +R+IV+KI+E  + VVVEK+G   ETH+     L
Sbjct  1    MANAASGMAVHDDCKLRFMELKTKRTYRFIVYKIEEQQKQVVVEKIGEPAETHEALAACL  60

Query  44   PSNDCRFAVFDYDF  3
            PS++CR+AVFD+DF
Sbjct  61   PSDECRYAVFDFDF  74



>ref|NP_001238519.1| uncharacterized protein LOC100499953 [Glycine max]
 gb|ACU14320.1| unknown [Glycine max]
Length=139

 Score =   101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG     +DDF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPANGYDDFAASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>gb|AFK48761.1| unknown [Lotus japonicus]
Length=139

 Score =   101 bits (252),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN+ SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + VVVEKLG     +DDFT SL
Sbjct  1    MANAVSGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPANGYDDFTASL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_004294585.1| PREDICTED: actin-depolymerizing factor 2-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=147

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -1

Query  242  LIATHKMANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHD  63
            LI T+  AN++SG  V D+CKLKF++LK+KR +R+IVFKI+E  + VVVEKLG   ++++
Sbjct  3    LIYTYDQANAASGFAVDDDCKLKFLDLKAKRTYRFIVFKIEEKLKQVVVEKLGEPAQSYE  62

Query  62   DFTKSLPSNDCRFAVFDYDF  3
            +FT SLP+++CR+AV+D+DF
Sbjct  63   EFTASLPADECRYAVYDFDF  82



>ref|XP_002299888.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|ABK93478.1| unknown [Populus trichocarpa]
 gb|ABK93508.1| unknown [Populus trichocarpa]
 gb|ABK93744.1| unknown [Populus trichocarpa]
 gb|ABK93767.1| unknown [Populus trichocarpa]
 gb|EEE84693.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   101 bits (252),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V D+CKLKF+ELK+KR +R IVFKI+E  + V+VEKLG   ++++DFT S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKLKQVIVEKLGEPAQSYEDFTASI  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_009775372.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana sylvestris]
Length=139

 Score =   101 bits (252),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MANS+SG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG   E+++DF   L
Sbjct  1    MANSASGMAVHDDCKLKFLELKTKRTYRFIVFKIEEKQKQVIVEKLGEPAESYEDFCTHL  60

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AV+D+DF
Sbjct  61   PADECRYAVYDFDF  74



>ref|XP_011048781.1| PREDICTED: uncharacterized protein LOC105142716 [Populus euphratica]
Length=479

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -1

Query  224  MANSSSGVGVFDECKLKFMELKSKRNFRYIVFKIDETGQAVVVEKLGTHEETHDDFTKSL  45
            MAN++SG+ V DECKLKF+ELK+KRN+R+I+FKI+   Q VVVEKLG+ EET+++F  SL
Sbjct  343  MANAASGMAVDDECKLKFLELKAKRNYRFIIFKIE--SQQVVVEKLGSPEETYEEFAASL  400

Query  44   PSNDCRFAVFDYDF  3
            P+++CR+AVFDYDF
Sbjct  401  PADECRYAVFDYDF  414



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 529956302715