BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17244_g1_i3 len=1459 path=[1542:0-410 @1953@!:411-1039
46:1040-1458]

Length=1459
                                                                      Score     E

emb|CDP08989.1|  unnamed protein product                                296   2e-105   
ref|XP_006363374.1|  PREDICTED: DNA repair protein RAD51 homolog ...    306   6e-105   
ref|XP_010313620.1|  PREDICTED: pentatricopeptide repeat-containi...    291   1e-99    
emb|CBI16200.3|  unnamed protein product                                268   2e-97    
ref|XP_009790034.1|  PREDICTED: DNA repair protein RAD51 homolog 4      279   5e-96    
ref|XP_009594024.1|  PREDICTED: DNA repair protein RAD51 homolog ...    278   8e-96    
ref|XP_007016541.1|  Tetratricopeptide repeat-like superfamily pr...    264   2e-95    
gb|EYU36249.1|  hypothetical protein MIMGU_mgv1a010206mg                290   1e-94    
ref|XP_002531104.1|  DNA repair and recombination protein radB, p...    267   4e-94    Ricinus communis
emb|CAN80345.1|  hypothetical protein VITISV_003133                     258   1e-93    Vitis vinifera
ref|XP_007132116.1|  hypothetical protein PHAVU_011G067900g             262   7e-93    
ref|XP_006590287.1|  PREDICTED: uncharacterized protein LOC100780...    254   6e-92    
gb|KHN21996.1|  DNA repair protein RAD51 like 4                         253   1e-91    
ref|XP_010253339.1|  PREDICTED: DNA repair protein RAD51 homolog ...    256   2e-91    
ref|XP_004505898.1|  PREDICTED: DNA repair protein RAD51 homolog ...    257   3e-91    
gb|KEH30102.1|  DNA repair protein RAD51                                256   5e-91    
ref|XP_009594023.1|  PREDICTED: DNA repair protein RAD51 homolog ...    261   9e-91    
gb|KDP44181.1|  hypothetical protein JCGZ_05648                         256   9e-91    
ref|XP_008385174.1|  PREDICTED: DNA repair protein RAD51 homolog ...    247   2e-90    
ref|XP_009594022.1|  PREDICTED: DNA repair protein RAD51 homolog ...    259   3e-90    
ref|XP_008385173.1|  PREDICTED: DNA repair protein RAD51 homolog ...    247   3e-90    
gb|KEH30103.1|  DNA repair protein RAD51                                253   6e-90    
gb|KHG11218.1|  DNA repair RAD51 -like protein                          252   2e-89    
ref|XP_004294616.1|  PREDICTED: DNA repair protein RAD51 homolog ...    249   4e-89    
ref|XP_006590288.1|  PREDICTED: uncharacterized protein LOC100780...    244   1e-88    
ref|XP_008385172.1|  PREDICTED: DNA repair protein RAD51 homolog ...    241   2e-88    
ref|XP_008385171.1|  PREDICTED: DNA repair protein RAD51 homolog ...    241   2e-88    
ref|NP_001242445.1|  uncharacterized protein LOC100780427               242   3e-88    
ref|XP_007206485.1|  hypothetical protein PRUPE_ppa019062mg             239   3e-88    
ref|XP_004505899.1|  PREDICTED: DNA repair protein RAD51 homolog ...    257   1e-87    
ref|XP_008222815.1|  PREDICTED: DNA repair protein RAD51 homolog 4      243   1e-87    
ref|XP_008448361.1|  PREDICTED: DNA repair protein RAD51 homolog ...    242   1e-85    
ref|XP_010651069.1|  PREDICTED: DNA repair protein RAD51 homolog 4      276   7e-85    
gb|KGN47353.1|  hypothetical protein Csa_6G302700                       240   4e-84    
ref|XP_004148219.1|  PREDICTED: DNA repair protein RAD51 homolog ...    237   2e-83    
ref|XP_007207819.1|  hypothetical protein PRUPE_ppa023822mg             220   8e-83    
ref|XP_010112923.1|  DNA repair protein RAD51-4-like protein            240   2e-81    
ref|XP_008448360.1|  PREDICTED: DNA repair protein RAD51 homolog ...    241   5e-81    
ref|XP_011089831.1|  PREDICTED: DNA repair protein RAD51 homolog ...    263   8e-81    
ref|XP_010922424.1|  PREDICTED: DNA repair protein RAD51 homolog ...    259   6e-79    
ref|XP_010033171.1|  PREDICTED: DNA repair protein RAD51 homolog ...    224   7e-79    
ref|XP_010521813.1|  PREDICTED: DNA repair protein RAD51 homolog 4      235   1e-78    
gb|KCW52729.1|  hypothetical protein EUGRSUZ_J02088                     222   3e-78    
ref|XP_010922422.1|  PREDICTED: DNA repair protein RAD51 homolog ...    258   4e-78    
ref|XP_010033172.1|  PREDICTED: DNA repair protein RAD51 homolog ...    221   7e-78    
ref|XP_006844260.1|  hypothetical protein AMTR_s00145p00033710          226   1e-77    
ref|XP_010253340.1|  PREDICTED: DNA repair protein RAD51 homolog ...    256   1e-77    
gb|KFK32439.1|  hypothetical protein AALP_AA6G241700                    234   3e-77    
ref|NP_172254.2|  DNA repair protein RAD51 homolog 4                    230   1e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110922.1|  PREDICTED: DNA repair protein RAD51 homolog 4      233   1e-76    
ref|XP_011089829.1|  PREDICTED: DNA repair protein RAD51 homolog ...    251   3e-76    
ref|XP_011089833.1|  PREDICTED: DNA repair protein RAD51 homolog ...    251   3e-76    
ref|XP_011089830.1|  PREDICTED: DNA repair protein RAD51 homolog ...    251   5e-76    
ref|XP_011089832.1|  PREDICTED: DNA repair protein RAD51 homolog ...    250   7e-76    
ref|XP_008788055.1|  PREDICTED: DNA repair protein RAD51 homolog ...    252   7e-76    
ref|XP_010033173.1|  PREDICTED: DNA repair protein RAD51 homolog ...    225   2e-75    
emb|CDY67670.1|  BnaCnng55870D                                          225   3e-75    
ref|XP_009397501.1|  PREDICTED: DNA repair protein RAD51 homolog ...    249   1e-74    
ref|XP_010457979.1|  PREDICTED: DNA repair protein RAD51 homolog ...    218   4e-74    
ref|XP_010487958.1|  PREDICTED: DNA repair protein RAD51 homolog ...    220   9e-73    
ref|XP_006417773.1|  hypothetical protein EUTSA_v10008243mg             204   2e-70    
ref|NP_001077479.1|  DNA repair protein RAD51 homolog 4                 231   6e-68    Arabidopsis thaliana [mouse-ear cress]
gb|KEH30104.1|  DNA repair protein RAD51                                177   1e-67    
gb|EPS64672.1|  hypothetical protein M569_10104                         216   2e-67    
gb|AAF75078.1|AC007583_14  Contains similarity to DNA repair prot...    229   3e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475545.1|  PREDICTED: DNA repair protein RAD51 homolog ...    227   8e-67    
ref|XP_006305443.1|  hypothetical protein CARUB_v10009852mg             228   1e-66    
ref|XP_008366341.1|  PREDICTED: DNA repair protein RAD51 homolog ...    223   5e-66    
ref|XP_008366340.1|  PREDICTED: DNA repair protein RAD51 homolog ...    223   9e-66    
ref|XP_008448362.1|  PREDICTED: DNA repair protein RAD51 homolog ...    188   4e-65    
gb|ACR37601.1|  unknown                                                 222   3e-64    Zea mays [maize]
ref|NP_001149161.1|  LOC100282783                                       221   3e-64    Zea mays [maize]
ref|XP_008448363.1|  PREDICTED: DNA repair protein RAD51 homolog ...    185   3e-64    
ref|XP_008366339.1|  PREDICTED: DNA repair protein RAD51 homolog ...    217   1e-63    
ref|XP_008366338.1|  PREDICTED: DNA repair protein RAD51 homolog ...    217   2e-63    
ref|XP_010033174.1|  PREDICTED: DNA repair protein RAD51 homolog ...    172   3e-63    
ref|XP_003563123.1|  PREDICTED: DNA repair protein RAD51 homolog ...    217   5e-63    
gb|AHN60060.1|  RAD51D variant 1                                        218   5e-63    
gb|AHN60062.1|  RAD51D variant 3                                        216   7e-63    
ref|XP_010238415.1|  PREDICTED: DNA repair protein RAD51 homolog ...    214   2e-62    
ref|XP_010686176.1|  PREDICTED: uncharacterized protein LOC104900458    228   4e-62    
gb|ACH42255.1|  RAD51D protein                                          214   5e-62    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006661024.1|  PREDICTED: DNA repair protein RAD51 homolog ...    212   2e-61    
dbj|BAD34152.1|  Trad-like protein                                      212   5e-61    Oryza sativa Japonica Group [Japonica rice]
gb|ADE77590.1|  unknown                                                 197   6e-61    
gb|EAZ08086.1|  hypothetical protein OsI_30353                          212   7e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_010253342.1|  PREDICTED: DNA repair protein RAD51 homolog ...    153   2e-60    
gb|ABE02576.1|  RAD51D splice variant g                                 171   5e-59    Arabidopsis thaliana [mouse-ear cress]
gb|KEH30105.1|  DNA repair protein RAD51                                148   1e-58    
gb|KEH30100.1|  DNA repair protein RAD51                                145   9e-58    
gb|KEH30101.1|  DNA repair protein RAD51                                145   1e-57    
ref|XP_008788056.1|  PREDICTED: DNA repair protein RAD51 homolog ...    202   4e-57    
gb|EMS53753.1|  DNA repair protein RAD51-like protein 4                 200   3e-56    
ref|XP_011089834.1|  PREDICTED: DNA repair protein RAD51 homolog ...    192   5e-54    
ref|XP_008448364.1|  PREDICTED: DNA repair protein RAD51 homolog ...    144   4e-52    
gb|ABE02571.1|  RAD51D splice variant b                                 141   4e-50    Arabidopsis thaliana [mouse-ear cress]
gb|KEH30107.1|  DNA repair protein RAD51                                119   6e-50    
gb|KCW52730.1|  hypothetical protein EUGRSUZ_J02088                     117   9e-47    
ref|XP_001771392.1|  predicted protein                                  170   4e-46    
gb|KEH30106.1|  DNA repair protein RAD51                                108   2e-40    
ref|XP_009397502.1|  PREDICTED: DNA repair protein RAD51 homolog ...    148   2e-37    
ref|XP_002963606.1|  hypothetical protein SELMODRAFT_80718              144   3e-36    
ref|XP_010501364.1|  PREDICTED: DNA repair protein RAD51 homolog ...  94.7    4e-35    
ref|XP_002463279.1|  hypothetical protein SORBIDRAFT_02g041080          140   1e-34    Sorghum bicolor [broomcorn]
ref|XP_006305442.1|  hypothetical protein CARUB_v10009852mg             137   8e-34    
ref|XP_002974702.1|  hypothetical protein SELMODRAFT_101803             132   4e-32    
ref|XP_007436222.1|  PREDICTED: DNA repair protein RAD51 homolog ...    135   4e-32    
ref|XP_005327816.1|  PREDICTED: DNA repair protein RAD51 homolog ...    134   8e-32    
ref|XP_006025805.1|  PREDICTED: DNA repair protein RAD51 homolog 4      133   2e-31    
gb|EMT02415.1|  DNA repair RAD51-4-like protein                         129   2e-31    
gb|ABE02575.1|  RAD51D splice variant f                               85.5    2e-31    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009558453.1|  PREDICTED: DNA repair protein RAD51 homolog 4      132   3e-31    
gb|KFQ52520.1|  DNA repair protein RAD51 4                              132   4e-31    
ref|XP_007067196.1|  PREDICTED: DNA repair protein RAD51 homolog 4      132   5e-31    
gb|KFV11722.1|  DNA repair protein RAD51 4                              130   1e-30    
ref|XP_008846371.1|  PREDICTED: DNA repair protein RAD51 homolog 4      130   2e-30    
ref|XP_005309892.1|  PREDICTED: DNA repair protein RAD51 homolog 4      130   3e-30    
ref|XP_548263.2|  PREDICTED: DNA repair protein RAD51 homolog 4 i...    129   3e-30    Canis lupus familiaris [dogs]
ref|XP_010132247.1|  PREDICTED: DNA repair protein RAD51 homolog 4      129   5e-30    
gb|AHN60061.1|  RAD51D variant 2                                        125   5e-30    
ref|XP_008928651.1|  PREDICTED: DNA repair protein RAD51 homolog 4      129   6e-30    
ref|XP_009483052.1|  PREDICTED: DNA repair protein RAD51 homolog 4      129   6e-30    
ref|XP_009978659.1|  PREDICTED: DNA repair protein RAD51 homolog 4      128   8e-30    
gb|KFM62106.1|  DNA repair protein RAD51-like protein                   128   9e-30    
ref|XP_006219509.1|  PREDICTED: DNA repair protein RAD51 homolog 4      128   1e-29    
gb|KFW86401.1|  DNA repair protein RAD51 4                              128   1e-29    
ref|XP_010170093.1|  PREDICTED: DNA repair protein RAD51 homolog 4      127   2e-29    
ref|XP_005327817.1|  PREDICTED: DNA repair protein RAD51 homolog ...    127   2e-29    
gb|KGL83685.1|  DNA repair protein RAD51 4                              127   2e-29    
ref|XP_005010701.1|  PREDICTED: DNA repair protein RAD51 homolog 4      127   2e-29    
ref|XP_009705022.1|  PREDICTED: DNA repair protein RAD51 homolog 4      127   2e-29    
emb|CDQ64183.1|  unnamed protein product                                127   2e-29    
gb|KFO98486.1|  DNA repair protein RAD51 4                              127   3e-29    
ref|XP_005502029.1|  PREDICTED: DNA repair protein RAD51 homolog 4      127   3e-29    
ref|XP_010950147.1|  PREDICTED: DNA repair protein RAD51 homolog 4      127   3e-29    
ref|XP_010293844.1|  PREDICTED: DNA repair protein RAD51 homolog 4      127   3e-29    
ref|XP_006181449.1|  PREDICTED: DNA repair protein RAD51 homolog 4      124   3e-29    
ref|XP_008488934.1|  PREDICTED: DNA repair protein RAD51 homolog 4      126   4e-29    
ref|XP_006101991.1|  PREDICTED: DNA repair protein RAD51 homolog ...    126   4e-29    
ref|XP_010297991.1|  PREDICTED: DNA repair protein RAD51 homolog 4      126   4e-29    
ref|XP_010121918.1|  PREDICTED: DNA repair protein RAD51 homolog 4      126   4e-29    
ref|XP_006154463.1|  PREDICTED: DNA repair protein RAD51 homolog 4      126   5e-29    
ref|XP_009643313.1|  PREDICTED: DNA repair protein RAD51 homolog 4      126   6e-29    
ref|XP_003495849.1|  PREDICTED: DNA repair protein RAD51 homolog 4      126   6e-29    
ref|NP_996959.1|  DNA repair protein RAD51 homolog 4                    126   6e-29    Danio rerio [leopard danio]
gb|KFP70732.1|  DNA repair protein RAD51 4                              125   7e-29    
ref|XP_010400787.1|  PREDICTED: DNA repair protein RAD51 homolog 4      125   7e-29    
ref|XP_006274258.1|  PREDICTED: DNA repair protein RAD51 homolog ...    125   7e-29    
ref|XP_009573114.1|  PREDICTED: DNA repair protein RAD51 homolog 4      125   8e-29    
ref|XP_009076072.1|  PREDICTED: DNA repair protein RAD51 homolog 4      125   8e-29    
ref|XP_010201104.1|  PREDICTED: DNA repair protein RAD51 homolog 4      125   8e-29    
gb|EPQ03939.1|  DNA repair protein RAD51 like protein 4                 125   9e-29    
ref|NP_001086359.1|  RAD51 paralog D                                    125   1e-28    Xenopus laevis [clawed frog]
ref|XP_008152065.1|  PREDICTED: DNA repair protein RAD51 homolog 4      125   1e-28    
ref|XP_010869139.1|  PREDICTED: DNA repair protein RAD51 homolog ...    125   1e-28    
ref|XP_009807082.1|  PREDICTED: DNA repair protein RAD51 homolog 4      124   1e-28    
ref|XP_009324339.1|  PREDICTED: DNA repair protein RAD51 homolog 4      125   1e-28    
ref|NP_001100499.1|  DNA repair protein RAD51 homolog 4                 125   1e-28    Rattus norvegicus [brown rat]
ref|XP_010735544.1|  PREDICTED: DNA repair protein RAD51 homolog 4      124   2e-28    
ref|XP_009932816.1|  PREDICTED: DNA repair protein RAD51 homolog 4      125   2e-28    
ref|XP_004076854.1|  PREDICTED: DNA repair protein RAD51 homolog ...    124   2e-28    
ref|XP_007245347.1|  PREDICTED: DNA repair protein RAD51 homolog ...    124   2e-28    
ref|XP_006779455.1|  PREDICTED: LOW QUALITY PROTEIN: RAD51 paralog D    124   2e-28    
ref|XP_006045430.1|  PREDICTED: DNA repair protein RAD51 homolog ...    124   3e-28    
gb|KFO64220.1|  DNA repair protein RAD51 4                              124   3e-28    
ref|XP_005860284.1|  PREDICTED: DNA repair protein RAD51 homolog 4      124   3e-28    
ref|XP_009285288.1|  PREDICTED: DNA repair protein RAD51 homolog 4      124   3e-28    
ref|XP_008638583.1|  PREDICTED: DNA repair protein RAD51 homolog 4      124   3e-28    
ref|XP_005077004.1|  PREDICTED: DNA repair protein RAD51 homolog ...    124   3e-28    
ref|XP_009954008.1|  PREDICTED: DNA repair protein RAD51 homolog 4      123   4e-28    
gb|EOB07843.1|  DNA repair protein RAD51-like protein 4                 123   4e-28    
ref|XP_005916078.1|  PREDICTED: DNA repair protein RAD51 homolog ...    124   4e-28    
ref|XP_005077005.1|  PREDICTED: DNA repair protein RAD51 homolog ...    123   4e-28    
ref|NP_001290859.1|  RAD51 paralog D                                    123   6e-28    
ref|XP_005525888.1|  PREDICTED: DNA repair protein RAD51 homolog 4      122   1e-27    
gb|KFQ09385.1|  DNA repair protein RAD51 4                              122   1e-27    
ref|XP_005425456.1|  PREDICTED: DNA repair protein RAD51 homolog 4      122   1e-27    
ref|XP_006641024.1|  PREDICTED: DNA repair protein RAD51 homolog ...    122   1e-27    
ref|XP_005495079.1|  PREDICTED: DNA repair protein RAD51 homolog 4      122   1e-27    
ref|XP_010156501.1|  PREDICTED: DNA repair protein RAD51 homolog 4      122   2e-27    
ref|XP_009906136.1|  PREDICTED: DNA repair protein RAD51 homolog 4      122   2e-27    
ref|XP_004551221.1|  PREDICTED: DNA repair protein RAD51 homolog ...    122   2e-27    
ref|XP_008766246.1|  PREDICTED: DNA repair protein RAD51 homolog ...    122   2e-27    
ref|XP_005725471.1|  PREDICTED: DNA repair protein RAD51 homolog ...    121   2e-27    
ref|XP_005056584.1|  PREDICTED: DNA repair protein RAD51 homolog ...    120   2e-27    
ref|XP_006990137.1|  PREDICTED: DNA repair protein RAD51 homolog ...    121   3e-27    
ref|XP_009092943.1|  PREDICTED: DNA repair protein RAD51 homolog 4      121   3e-27    
gb|ADF97633.1|  DNA repair protein RAD51 4-like protein                 120   3e-27    
ref|XP_010222291.1|  PREDICTED: DNA repair protein RAD51 homolog 4      121   3e-27    
ref|XP_006785181.1|  PREDICTED: DNA repair protein RAD51 homolog ...    120   4e-27    
ref|XP_008349730.1|  PREDICTED: DNA repair protein RAD51 homolog ...    114   4e-27    
ref|NP_035365.1|  DNA repair protein RAD51 homolog 4 isoform 1          120   4e-27    Mus musculus [mouse]
gb|KFV86858.1|  DNA repair protein RAD51 4                              120   4e-27    
ref|XP_009967903.1|  PREDICTED: DNA repair protein RAD51 homolog 4      120   4e-27    
ref|XP_009467190.1|  PREDICTED: DNA repair protein RAD51 homolog 4      120   5e-27    
ref|NP_001264868.1|  DNA repair protein RAD51 homolog 4 isoform 3       120   5e-27    
ref|XP_005056583.1|  PREDICTED: DNA repair protein RAD51 homolog ...    120   5e-27    
ref|XP_009684175.1|  PREDICTED: DNA repair protein RAD51 homolog 4      120   6e-27    
ref|XP_006532650.1|  PREDICTED: DNA repair protein RAD51 homolog ...    120   6e-27    
ref|XP_003453486.1|  PREDICTED: DNA repair protein RAD51 homolog ...    120   6e-27    
ref|XP_003469653.1|  PREDICTED: DNA repair protein RAD51 homolog ...    120   7e-27    
ref|XP_007894858.1|  PREDICTED: DNA repair protein RAD51 homolog 4      119   7e-27    
ref|XP_010085771.1|  PREDICTED: DNA repair protein RAD51 homolog 4      119   9e-27    
ref|XP_010571858.1|  PREDICTED: DNA repair protein RAD51 homolog 4      119   1e-26    
ref|XP_003970950.1|  PREDICTED: DNA repair protein RAD51 homolog ...    119   1e-26    
ref|XP_004608899.1|  PREDICTED: DNA repair protein RAD51 homolog 4      119   1e-26    
ref|XP_007517000.1|  PREDICTED: DNA repair protein RAD51 homolog ...    119   2e-26    
ref|XP_009923891.1|  PREDICTED: DNA repair protein RAD51 homolog 4      119   2e-26    
ref|XP_001373739.1|  PREDICTED: DNA repair protein RAD51 homolog ...    119   2e-26    Monodelphis domestica
dbj|BAB19970.1|  Trad                                                   119   2e-26    Mus musculus [mouse]
ref|XP_004664545.1|  PREDICTED: DNA repair protein RAD51 homolog 4      118   2e-26    
ref|XP_010720057.1|  PREDICTED: DNA repair protein RAD51 homolog 4      118   2e-26    
ref|XP_005349431.1|  PREDICTED: DNA repair protein RAD51 homolog ...    118   3e-26    
gb|EDL15676.1|  RAD51-like 3 (S. cerevisiae), isoform CRA_c             116   3e-26    
ref|XP_009510043.1|  PREDICTED: DNA repair protein RAD51 homolog 4      117   3e-26    
ref|XP_005349430.1|  PREDICTED: DNA repair protein RAD51 homolog ...    118   3e-26    
ref|XP_006832385.1|  PREDICTED: DNA repair protein RAD51 homolog ...    117   4e-26    
gb|EDL15678.1|  RAD51-like 3 (S. cerevisiae), isoform CRA_e             116   4e-26    
ref|XP_002503137.1|  Rad51 DNA recombinase 4                            117   5e-26    Micromonas commoda
ref|XP_010998674.1|  PREDICTED: DNA repair protein RAD51 homolog ...    115   6e-26    
ref|XP_009800889.1|  PREDICTED: DNA repair protein RAD51 homolog ...    107   8e-26    
ref|XP_007485578.1|  PREDICTED: DNA repair protein RAD51 homolog ...    116   8e-26    
ref|XP_009883436.1|  PREDICTED: DNA repair protein RAD51 homolog 4      117   9e-26    
ref|NP_001005687.1|  RAD51 paralog D                                    116   1e-25    Xenopus tropicalis [western clawed frog]
gb|KFQ37373.1|  DNA repair protein RAD51 4                              116   1e-25    
ref|XP_005077006.1|  PREDICTED: DNA repair protein RAD51 homolog ...    116   1e-25    
ref|XP_010184455.1|  PREDICTED: DNA repair protein RAD51 homolog 4      116   1e-25    
ref|XP_008570833.1|  PREDICTED: DNA repair protein RAD51 homolog 4      115   2e-25    
gb|AAG42287.1|  RAD5113                                                 115   2e-25    Mus musculus [mouse]
ref|XP_002195631.2|  PREDICTED: DNA repair protein RAD51 homolog 4      118   2e-25    Taeniopygia guttata
ref|XP_010021074.1|  PREDICTED: DNA repair protein RAD51 homolog 4      115   3e-25    
ref|NP_001185575.1|  DNA repair protein RAD51 homolog 4                 115   3e-25    
ref|XP_003726418.1|  PREDICTED: DNA repair protein RAD51 homolog ...    115   4e-25    
ref|XP_003996621.1|  PREDICTED: DNA repair protein RAD51 homolog 4      115   4e-25    
ref|XP_007096120.1|  PREDICTED: DNA repair protein RAD51 homolog 4      114   5e-25    
ref|XP_002923663.1|  PREDICTED: DNA repair protein RAD51 homolog ...    114   6e-25    
gb|EFB17511.1|  hypothetical protein PANDA_012831                       114   6e-25    Ailuropoda melanoleuca
ref|XP_010639671.1|  PREDICTED: DNA repair protein RAD51 homolog 4      114   7e-25    
ref|XP_010002132.1|  PREDICTED: DNA repair protein RAD51 homolog 4      114   7e-25    
ref|XP_008693804.1|  PREDICTED: DNA repair protein RAD51 homolog 4      113   1e-24    
ref|XP_006990138.1|  PREDICTED: DNA repair protein RAD51 homolog ...    113   1e-24    
gb|KFU94305.1|  DNA repair protein RAD51 4                              113   1e-24    
ref|XP_007563937.1|  PREDICTED: DNA repair protein RAD51 homolog 4      113   1e-24    
ref|XP_010341997.1|  PREDICTED: DNA repair protein RAD51 homolog 4      113   1e-24    
ref|NP_001264867.1|  DNA repair protein RAD51 homolog 4 isoform 2       113   1e-24    
ref|XP_009874974.1|  PREDICTED: DNA repair protein RAD51 homolog 4      113   2e-24    
ref|XP_004416858.1|  PREDICTED: DNA repair protein RAD51 homolog ...    112   2e-24    
ref|XP_008072483.1|  PREDICTED: DNA repair protein RAD51 homolog ...    112   2e-24    
ref|XP_008072482.1|  PREDICTED: DNA repair protein RAD51 homolog ...    112   2e-24    
ref|XP_004685091.1|  PREDICTED: DNA repair protein RAD51 homolog 4      113   3e-24    
emb|CAG00889.1|  unnamed protein product                                112   3e-24    Tetraodon nigroviridis
ref|XP_005003574.1|  PREDICTED: DNA repair protein RAD51 homolog ...    112   3e-24    
ref|XP_002748405.2|  PREDICTED: DNA repair protein RAD51 homolog ...    112   3e-24    Callithrix jacchus [common marmoset]
ref|XP_004385514.1|  PREDICTED: DNA repair protein RAD51 homolog 4      112   3e-24    
ref|XP_010377855.1|  PREDICTED: DNA repair protein RAD51 homolog ...    112   3e-24    
ref|XP_010592536.1|  PREDICTED: DNA repair protein RAD51 homolog ...    112   4e-24    
ref|XP_003770045.1|  PREDICTED: DNA repair protein RAD51 homolog 4      112   4e-24    
ref|XP_003797244.1|  PREDICTED: DNA repair protein RAD51 homolog 4      112   5e-24    
ref|XP_004707407.1|  PREDICTED: DNA repair protein RAD51 homolog 4      111   5e-24    
ref|XP_009800888.1|  PREDICTED: DNA repair protein RAD51 homolog ...    107   5e-24    
dbj|BAB19971.1|  Trad-d2                                                111   6e-24    Mus musculus [mouse]
ref|XP_008531362.1|  PREDICTED: DNA repair protein RAD51 homolog 4      112   7e-24    
ref|XP_007935502.1|  PREDICTED: DNA repair protein RAD51 homolog ...    111   7e-24    
ref|XP_003912657.1|  PREDICTED: DNA repair protein RAD51 homolog ...    111   8e-24    
gb|EDL15677.1|  RAD51-like 3 (S. cerevisiae), isoform CRA_d             111   1e-23    
ref|XP_009188372.1|  PREDICTED: DNA repair protein RAD51 homolog ...    110   1e-23    
dbj|BAA25914.1|  Trad                                                   110   1e-23    Homo sapiens [man]
ref|XP_003278423.1|  PREDICTED: LOW QUALITY PROTEIN: DNA repair p...    110   1e-23    
ref|XP_005583509.1|  PREDICTED: DNA repair protein RAD51 homolog ...    111   1e-23    
ref|XP_001501542.3|  PREDICTED: DNA repair protein RAD51 homolog 4      112   1e-23    Equus caballus [domestic horse]
ref|XP_008269345.1|  PREDICTED: DNA repair protein RAD51 homolog 4      110   1e-23    
ref|XP_005349432.1|  PREDICTED: DNA repair protein RAD51 homolog ...    110   1e-23    
ref|NP_002869.3|  DNA repair protein RAD51 homolog 4 isoform 1          110   2e-23    Homo sapiens [man]
ref|XP_004012509.1|  PREDICTED: DNA repair protein RAD51 homolog ...    110   2e-23    
ref|XP_001174459.1|  PREDICTED: DNA repair protein RAD51 homolog ...    110   2e-23    Pan troglodytes
gb|AAC39719.1|  RAD51D                                                  109   2e-23    Homo sapiens [man]
gb|EAW80194.1|  hCG1989222, isoform CRA_l                               110   2e-23    
ref|XP_009430675.1|  PREDICTED: DNA repair protein RAD51 homolog ...    110   2e-23    
ref|XP_008009236.1|  PREDICTED: DNA repair protein RAD51 homolog ...    111   3e-23    
ref|XP_004441924.1|  PREDICTED: DNA repair protein RAD51 homolog 4      109   3e-23    
gb|EFA79112.1|  putative DNA repair protein                             109   3e-23    
ref|XP_004271739.1|  PREDICTED: DNA repair protein RAD51 homolog ...    109   3e-23    
ref|XP_005154460.1|  PREDICTED: DNA repair protein RAD51 homolog 4      109   3e-23    
ref|XP_004449465.1|  PREDICTED: DNA repair protein RAD51 homolog ...    109   3e-23    
ref|XP_005693394.1|  PREDICTED: DNA repair protein RAD51 homolog 4      109   4e-23    
ref|XP_005583508.1|  PREDICTED: DNA repair protein RAD51 homolog ...    110   4e-23    
ref|NP_001039769.1|  DNA repair protein RAD51 homolog 4                 108   5e-23    
ref|XP_001111649.2|  PREDICTED: DNA repair protein RAD51 homolog ...    110   5e-23    
ref|XP_004449466.1|  PREDICTED: DNA repair protein RAD51 homolog ...    107   5e-23    
ref|XP_002946920.1|  hypothetical protein VOLCADRAFT_103167             110   5e-23    
ref|XP_006045429.1|  PREDICTED: DNA repair protein RAD51 homolog ...    109   6e-23    
gb|EFW40681.2|  hypothetical protein CAOG_05813                         108   6e-23    
ref|XP_005899746.1|  PREDICTED: DNA repair protein RAD51 homolog 4      108   7e-23    
ref|XP_004747172.1|  PREDICTED: DNA repair protein RAD51 homolog ...    109   9e-23    
ref|XP_004888167.1|  PREDICTED: DNA repair protein RAD51 homolog ...    108   9e-23    
ref|XP_006925017.1|  PREDICTED: DNA repair protein RAD51 homolog ...    108   1e-22    
gb|ELT88390.1|  hypothetical protein CAPTEDRAFT_222156                  107   1e-22    
ref|XP_004316591.1|  PREDICTED: DNA repair protein RAD51 homolog ...    107   1e-22    
ref|XP_004594053.1|  PREDICTED: DNA repair protein RAD51 homolog 4      107   1e-22    
ref|NP_001125321.1|  DNA repair protein RAD51 homolog 4                 107   2e-22    
ref|NP_001136043.1|  DNA repair protein RAD51 homolog 4 isoform 6       107   2e-22    
ref|XP_007105639.1|  PREDICTED: DNA repair protein RAD51 homolog ...    107   2e-22    
ref|XP_003315568.1|  PREDICTED: DNA repair protein RAD51 homolog ...    107   2e-22    
ref|XP_001420800.1|  predicted protein                                  106   2e-22    
ref|XP_002128226.1|  PREDICTED: DNA repair protein RAD51 homolog ...    107   3e-22    
ref|XP_008426732.1|  PREDICTED: DNA repair protein RAD51 homolog 4      107   3e-22    
ref|XP_005402921.1|  PREDICTED: DNA repair protein RAD51 homolog ...    106   3e-22    
gb|ELR53567.1|  DNA repair protein RAD51-like protein 4                 106   3e-22    
gb|EXX71260.1|  Dmc1p                                                   105   4e-22    
gb|EXX71259.1|  Dmc1p                                                   105   9e-22    
gb|EHB05117.1|  DNA repair protein RAD51-like protein 4                 105   1e-21    
ref|XP_007105638.1|  PREDICTED: DNA repair protein RAD51 homolog ...    105   1e-21    
ref|XP_005809379.1|  PREDICTED: DNA repair protein RAD51 homolog ...    104   2e-21    
ref|XP_005973084.1|  PREDICTED: DNA repair protein RAD51 homolog 4      105   2e-21    
ref|XP_008331224.1|  PREDICTED: DNA repair protein RAD51 homolog 4      104   2e-21    
ref|XP_006890969.1|  PREDICTED: DNA repair protein RAD51 homolog ...    104   2e-21    
ref|XP_005624860.1|  PREDICTED: DNA repair protein RAD51 homolog ...    103   2e-21    
ref|XP_007190246.1|  PREDICTED: DNA repair protein RAD51 homolog ...    104   2e-21    
ref|XP_004345403.1|  predicted protein                                  103   4e-21    
ref|XP_005439852.1|  PREDICTED: DNA repair protein RAD51 homolog 4      103   5e-21    
ref|XP_005240524.1|  PREDICTED: DNA repair protein RAD51 homolog 4      103   6e-21    
ref|XP_008179643.1|  PREDICTED: DNA repair protein RAD51 homolog ...    100   1e-20    
ref|XP_006560932.1|  PREDICTED: DNA repair protein RAD51 homolog ...    102   1e-20    
ref|XP_008179642.1|  PREDICTED: DNA repair protein RAD51 homolog ...    101   2e-20    
gb|KHJ49596.1|  hypothetical protein D918_00723                         100   3e-20    
ref|XP_004888168.1|  PREDICTED: DNA repair protein RAD51 homolog ...    100   4e-20    
ref|XP_007446647.1|  PREDICTED: DNA repair protein RAD51 homolog 4      100   7e-20    
emb|CDW53896.1|  dna repair protein rad51                             98.6    7e-20    
ref|XP_005327818.1|  PREDICTED: DNA repair protein RAD51 homolog ...  99.4    7e-20    
ref|XP_007190245.1|  PREDICTED: DNA repair protein RAD51 homolog ...    100   8e-20    
ref|XP_005402922.1|  PREDICTED: DNA repair protein RAD51 homolog ...  99.8    9e-20    
ref|XP_001134538.1|  hypothetical protein DDB_G0285287                  100   1e-19    
ref|XP_006045428.1|  PREDICTED: DNA repair protein RAD51 homolog ...  99.8    2e-19    
gb|KHN21994.1|  DNA repair protein RAD51 like 4                       71.6    3e-19    
ref|NP_001062559.2|  Os09g0104200                                     92.8    3e-19    
ref|XP_005648631.1|  P-loop containing nucleoside triphosphate hy...  96.3    4e-19    
gb|KFD54555.1|  hypothetical protein M513_04500                         100   5e-19    
gb|KFD64893.1|  hypothetical protein M514_04500                       99.8    7e-19    
gb|ETE67053.1|  DNA repair protein RAD51-like 4                       96.3    9e-19    
ref|XP_005327820.1|  PREDICTED: DNA repair protein RAD51 homolog ...  95.1    9e-19    
ref|XP_006616340.1|  PREDICTED: DNA repair protein RAD51 homolog ...  96.7    1e-18    
gb|EKC30424.1|  DNA repair protein RAD51-like protein 4               94.4    1e-18    
emb|CBN77668.1|  conserved unknown protein                            97.1    2e-18    
ref|XP_005097224.1|  PREDICTED: DNA repair protein RAD51 homolog ...  95.5    2e-18    
ref|XP_004994701.1|  hypothetical protein PTSG_04608                  95.9    3e-18    
ref|WP_028831734.1|  hypothetical protein                             94.4    7e-18    
ref|XP_003394258.1|  PREDICTED: LOW QUALITY PROTEIN: DNA repair p...  93.2    9e-18    
ref|XP_006591571.1|  PREDICTED: DNA repair protein RAD51 homolog ...  71.2    1e-17    
ref|XP_003698614.1|  PREDICTED: DNA repair protein RAD51 homolog ...  93.2    1e-17    
ref|XP_003486459.1|  PREDICTED: DNA repair protein RAD51 homolog ...  92.8    2e-17    
ref|XP_003699875.1|  PREDICTED: DNA repair protein RAD51 homolog ...  92.4    2e-17    
ref|XP_004341700.1|  hypothetical protein ACA1_198280                 92.4    2e-17    
dbj|GAM20522.1|  hypothetical protein SAMD00019534_036970             92.4    3e-17    
ref|XP_003435344.1|  PREDICTED: DNA repair protein RAD51 homolog ...  90.1    4e-17    
ref|XP_003061152.1|  Rad51 DNA recombinase 4                          92.4    4e-17    
ref|XP_002405692.1|  DNA repair protein RAD51/RHP55, putative         91.3    7e-17    
ref|XP_004888166.1|  PREDICTED: DNA repair protein RAD51 homolog ...  90.9    1e-16    
ref|XP_007436223.1|  PREDICTED: DNA repair protein RAD51 homolog ...  90.1    1e-16    
gb|AIY89120.1|  DNA repair and recombination protein RadB             88.6    1e-16    
ref|XP_008281487.1|  PREDICTED: DNA repair protein RAD51 homolog 4    89.7    1e-16    
gb|ENN70302.1|  hypothetical protein YQE_12813                        92.8    2e-16    
gb|ERL92770.1|  hypothetical protein D910_10078                       92.8    2e-16    
gb|EDM05456.1|  RAD51-like 3 (S. cerevisiae) (predicted), isoform...  88.6    3e-16    
ref|XP_005168680.1|  PREDICTED: DNA repair protein RAD51 homolog ...  86.7    3e-16    
gb|ACF40975.1|  RAD51D transcript variant delta 9,10                  88.2    3e-16    
ref|XP_005077008.1|  PREDICTED: DNA repair protein RAD51 homolog ...  88.6    3e-16    
gb|EMP28895.1|  DNA repair protein RAD51 like protein 4               89.0    4e-16    
ref|XP_004888165.1|  PREDICTED: DNA repair protein RAD51 homolog ...  89.4    5e-16    
ref|XP_005003575.1|  PREDICTED: DNA repair protein RAD51 homolog ...  88.2    5e-16    
gb|KFB48686.1|  AGAP006164-PA-like protein                            88.6    5e-16    
ref|XP_006045431.1|  PREDICTED: DNA repair protein RAD51 homolog ...  87.0    6e-16    
ref|XP_006101992.1|  PREDICTED: DNA repair protein RAD51 homolog ...  86.7    6e-16    
gb|EDM05453.1|  RAD51-like 3 (S. cerevisiae) (predicted), isoform...  87.0    6e-16    
ref|XP_009692387.1|  uncharacterized protein TOT_040000462            87.8    7e-16    
ref|WP_015591738.1|  DNA repair and recombination protein RadB        86.7    7e-16    
ref|XP_003082302.1|  AtRAD51D (ISS)                                   87.4    7e-16    
ref|WP_013684744.1|  DNA repair protein RadB                          86.7    8e-16    
ref|XP_002736634.1|  PREDICTED: DNA repair protein RAD51 homolog ...  87.0    1e-15    
ref|XP_004888170.1|  PREDICTED: DNA repair protein RAD51 homolog ...  87.0    1e-15    
ref|NP_001264870.1|  DNA repair protein RAD51 homolog 4 isoform 4     86.7    2e-15    
emb|CEF99864.1|  DNA recombination and repair protein Rad51, C-te...  87.4    2e-15    
gb|KDR21422.1|  DNA repair protein RAD51-like protein 4               87.8    2e-15    
ref|XP_005931163.1|  PREDICTED: DNA repair protein RAD51 homolog ...  86.7    3e-15    
ref|XP_004997327.1|  hypothetical protein PTSG_01354                  86.7    4e-15    
gb|EDM05455.1|  RAD51-like 3 (S. cerevisiae) (predicted), isoform...  84.0    4e-15    
dbj|BAB19973.1|  Trad-d6                                              85.1    5e-15    
ref|XP_005003577.1|  PREDICTED: DNA repair protein RAD51 homolog ...  84.0    6e-15    
gb|EZA58516.1|  DNA repair protein RAD51-like protein                 85.5    6e-15    
ref|XP_006990139.1|  PREDICTED: DNA repair protein RAD51 homolog ...  84.7    7e-15    
ref|XP_004568199.1|  PREDICTED: DNA repair protein RAD51 homolog ...  85.5    7e-15    
ref|XP_007485579.1|  PREDICTED: DNA repair protein RAD51 homolog ...  84.3    7e-15    
ref|XP_009782416.1|  PREDICTED: DNA repair protein RAD51 homolog ...  69.3    8e-15    
ref|XP_010765904.1|  PREDICTED: DNA repair protein RAD51 homolog 2    85.1    1e-14    
ref|XP_006803769.1|  PREDICTED: DNA repair protein RAD51 homolog ...  85.1    1e-14    
ref|XP_009292854.1|  PREDICTED: DNA repair protein RAD51 homolog ...  85.1    1e-14    
ref|XP_003979991.1|  PREDICTED: DNA repair protein RAD51 homolog ...  84.3    2e-14    
ref|NP_998577.1|  DNA repair protein RAD51 homolog 2                  84.7    2e-14    
ref|XP_010880575.1|  PREDICTED: DNA repair protein RAD51 homolog ...  84.0    2e-14    
dbj|BAB19974.1|  Trad-d1                                              82.4    2e-14    
ref|XP_006045427.1|  PREDICTED: DNA repair protein RAD51 homolog ...  85.1    2e-14    
ref|XP_005748039.1|  PREDICTED: DNA repair protein RAD51 homolog ...  84.0    3e-14    
ref|XP_010880573.1|  PREDICTED: DNA repair protein RAD51 homolog ...  84.0    3e-14    
ref|XP_003457669.1|  PREDICTED: DNA repair protein RAD51 homolog ...  83.6    3e-14    
ref|XP_005669093.1|  PREDICTED: DNA repair protein RAD51 homolog ...  82.4    3e-14    
ref|XP_003472338.2|  PREDICTED: DNA repair protein RAD51 homolog ...  83.2    5e-14    
ref|XP_004624825.1|  PREDICTED: DNA repair protein RAD51 homolog ...  83.2    5e-14    
ref|XP_010880576.1|  PREDICTED: DNA repair protein RAD51 homolog ...  82.8    5e-14    
ref|XP_005349433.1|  PREDICTED: DNA repair protein RAD51 homolog ...  81.6    6e-14    
ref|XP_006990141.1|  PREDICTED: DNA repair protein RAD51 homolog ...  80.9    7e-14    
ref|XP_002177796.1|  Rad51 DNA recombination/repair protein           82.8    7e-14    
ref|XP_005399117.1|  PREDICTED: DNA repair protein RAD51 homolog ...  82.8    7e-14    
ref|XP_005399116.1|  PREDICTED: DNA repair protein RAD51 homolog ...  82.8    7e-14    
ref|XP_005349435.1|  PREDICTED: DNA repair protein RAD51 homolog ...  80.1    1e-13    
ref|XP_005399114.1|  PREDICTED: DNA repair protein RAD51 homolog ...  82.4    1e-13    
ref|XP_005399111.1|  PREDICTED: DNA repair protein RAD51 homolog ...  82.4    1e-13    
ref|XP_005399113.1|  PREDICTED: DNA repair protein RAD51 homolog ...  82.4    1e-13    
ref|XP_005399112.1|  PREDICTED: DNA repair protein RAD51 homolog ...  82.4    1e-13    
ref|XP_005399115.1|  PREDICTED: DNA repair protein RAD51 homolog ...  82.0    1e-13    
ref|XP_007517001.1|  PREDICTED: DNA repair protein RAD51 homolog ...  80.1    1e-13    
ref|XP_006138730.1|  PREDICTED: DNA repair protein RAD51 homolog ...  82.0    1e-13    
ref|XP_005399108.1|  PREDICTED: DNA repair protein RAD51 homolog ...  82.4    1e-13    
ref|XP_005399110.1|  PREDICTED: DNA repair protein RAD51 homolog ...  82.0    2e-13    
ref|XP_004908002.1|  PREDICTED: DNA repair protein RAD51 homolog ...  81.6    2e-13    
ref|XP_008269432.1|  PREDICTED: DNA repair protein RAD51 homolog ...  81.6    2e-13    
ref|XP_010643647.1|  PREDICTED: DNA repair protein RAD51 homolog 2    82.0    2e-13    
ref|XP_010592537.1|  PREDICTED: DNA repair protein RAD51 homolog ...  80.5    2e-13    
ref|XP_005852115.1|  hypothetical protein CHLNCDRAFT_133185           81.6    2e-13    
ref|XP_005298812.1|  PREDICTED: DNA repair protein RAD51 homolog ...  81.3    2e-13    
ref|XP_004998933.1|  hypothetical protein PTSG_00384                  81.3    2e-13    
ref|XP_008400555.1|  PREDICTED: DNA repair protein RAD51 homolog 3    80.9    3e-13    
ref|XP_005298814.1|  PREDICTED: DNA repair protein RAD51 homolog ...  80.9    3e-13    
ref|XP_002130341.1|  PREDICTED: DNA repair protein RAD51 homolog ...  80.9    4e-13    
ref|XP_001869974.1|  RAD51D                                           79.7    4e-13    
ref|XP_006265689.1|  PREDICTED: DNA repair protein RAD51 homolog 3    80.5    4e-13    
ref|XP_004041985.1|  PREDICTED: DNA repair protein RAD51 homolog ...  78.2    5e-13    
ref|XP_005495616.1|  PREDICTED: DNA repair protein RAD51 homolog 3    79.7    5e-13    
ref|XP_011051415.1|  PREDICTED: DNA repair protein RAD51 homolog 4    79.7    5e-13    
ref|XP_008197800.1|  PREDICTED: DNA repair protein RAD51 homolog 4    79.3    5e-13    
gb|AAH02723.1|  RAD51L3 protein                                       78.2    6e-13    
ref|XP_009430677.1|  PREDICTED: DNA repair protein RAD51 homolog ...  77.8    6e-13    
ref|XP_008269431.1|  PREDICTED: DNA repair protein RAD51 homolog ...  79.7    7e-13    
emb|CBJ27499.1|  Rad51 DNA recombinase 2                              79.3    7e-13    
ref|XP_007512150.1|  Rad51 DNA recombinase 4                          80.1    7e-13    
gb|ERG86293.1|  dna repair protein rad51-like protein 4               78.6    7e-13    
gb|EFZ15082.1|  hypothetical protein SINV_06079                       78.6    8e-13    
ref|WP_013413999.1|  DNA repair protein RadB                          77.8    8e-13    
gb|EHK00609.1|  DNA repair and recombination protein RadB             77.8    9e-13    
ref|XP_007057708.1|  PREDICTED: DNA repair protein RAD51 homolog 3    79.3    9e-13    
ref|XP_004883013.1|  PREDICTED: DNA repair protein RAD51 homolog ...  79.3    9e-13    
ref|XP_009976524.1|  PREDICTED: DNA repair protein RAD51 homolog 3    79.0    1e-12    
gb|AGL11960.1|  DNA repair protein RAD51-like protein                 79.3    1e-12    
gb|KFU99616.1|  DNA repair protein RAD51 3                            79.0    1e-12    
emb|CDQ66119.1|  unnamed protein product                              79.7    1e-12    
ref|XP_006247059.1|  PREDICTED: DNA repair protein RAD51 homolog ...  77.8    1e-12    
gb|EFN88264.1|  DNA repair protein RAD51-like protein 1               78.6    1e-12    
ref|WP_012966642.1|  DNA repair protein RadB                          77.0    1e-12    
ref|XP_006676461.1|  hypothetical protein BATDEDRAFT_85216            79.3    1e-12    
gb|KFP70121.1|  DNA repair protein RAD51 3                            77.8    2e-12    
ref|XP_008543628.1|  PREDICTED: DNA repair protein RAD51 homolog 4    77.8    2e-12    
ref|XP_010749631.1|  PREDICTED: DNA repair protein RAD51 homolog ...  77.4    2e-12    
ref|XP_006832386.1|  PREDICTED: DNA repair protein RAD51 homolog ...  76.3    2e-12    
ref|WP_013644190.1|  DNA repair protein RadB                          76.6    2e-12    
ref|XP_005321627.1|  PREDICTED: DNA repair protein RAD51 homolog ...  77.8    2e-12    
ref|XP_010880577.1|  PREDICTED: DNA repair protein RAD51 homolog ...  77.4    2e-12    
gb|KFV48001.1|  DNA repair protein RAD51 3                            77.4    3e-12    
ref|XP_007623402.1|  PREDICTED: DNA repair protein RAD51 homolog ...  77.8    3e-12    
ref|XP_008303064.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.4    3e-12    
ref|XP_006016178.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.8    3e-12    
ref|XP_009962788.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.4    3e-12    
ref|XP_010311701.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.4    3e-12    
ref|XP_008693716.1|  PREDICTED: DNA repair protein RAD51 homolog ...  77.8    3e-12    
gb|KFQ18187.1|  DNA repair protein RAD51 3                            77.0    3e-12    
ref|XP_007541982.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.8    3e-12    
gb|EAW80188.1|  hCG1989222, isoform CRA_h                             76.3    3e-12    
ref|XP_008928866.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.8    3e-12    
gb|KFP62679.1|  DNA repair protein RAD51 3                            77.0    3e-12    
ref|XP_009071147.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.4    4e-12    
ref|XP_005014478.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.4    4e-12    
ref|XP_005693163.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.8    4e-12    
ref|XP_001712469.1|  rad51                                            77.0    4e-12    
ref|XP_002785713.1|  meiotic recombination protein DMC1, putative     76.3    4e-12    
gb|KFW86513.1|  DNA repair protein RAD51 3                            77.4    4e-12    
ref|XP_010170218.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.0    4e-12    
ref|XP_005962472.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.8    4e-12    
ref|XP_004685073.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.8    4e-12    
gb|KFH71329.1|  hypothetical protein MVEG_01629                       77.8    4e-12    
ref|XP_009693766.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.0    4e-12    
ref|XP_005072792.1|  PREDICTED: DNA repair protein RAD51 homolog 2    77.4    4e-12    
gb|KFV69436.1|  DNA repair protein RAD51 3                            77.0    4e-12    
ref|XP_002765679.1|  meiotic recombination protein DMC1, putative     75.9    4e-12    
ref|XP_005512016.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.0    4e-12    
gb|EMC80589.1|  DNA repair protein RAD51 like protein 3               77.0    4e-12    
ref|XP_003290606.1|  hypothetical protein DICPUDRAFT_18874            76.3    4e-12    
ref|XP_764088.1|  hypothetical protein                                76.3    5e-12    
gb|KFQ37531.1|  DNA repair protein RAD51 3                            76.6    5e-12    
ref|XP_009188371.1|  PREDICTED: DNA repair protein RAD51 homolog ...  76.3    5e-12    
ref|XP_005233768.1|  PREDICTED: DNA repair protein RAD51 homolog 3    76.6    5e-12    
ref|XP_010214097.1|  PREDICTED: DNA repair protein RAD51 homolog 3    77.0    5e-12    
ref|XP_005439916.1|  PREDICTED: DNA repair protein RAD51 homolog 3    76.6    5e-12    
gb|ELQ75893.1|  Meiotic recombination protein Dmc1                    76.6    5e-12    



>emb|CDP08989.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   296 bits (757),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 179/227 (79%), Gaps = 1/227 (0%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCNSFS  881
             ST  + ID FL GG ++G L ELVGPSSSGKTQVC + ASNV +S  GRV+FLDT NSFS
Sbjct  90    STGCERIDAFLRGGFQEGVLTELVGPSSSGKTQVCLLAASNVTKSGLGRVLFLDTGNSFS  149

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
             P RVA+ VS  S+ + +++ K L  V+ NI C SVFDIFT+ DV+H L   +R Q G   
Sbjct  150   PTRVAQFVSSSSELADTESSKILPQVLDNIECRSVFDIFTLLDVLHQLLQNLRYQVGQNL  209

Query  700   RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLK  521
             RMLIIDS+SSLITP+LGG+G HG ALMASAGF+LK+LA E+NL VL+TNHMVAG+ G++K
Sbjct  210   RMLIIDSVSSLITPVLGGAGTHGHALMASAGFVLKKLAYEYNLSVLMTNHMVAGDGGMIK  269

Query  520   PALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQIL  380
             PALGESWKSIPHIRLLLSRD   +I S+S+L+HP+MA G+RVEF IL
Sbjct  270   PALGESWKSIPHIRLLLSRDVLNNICSMSILRHPSMAIGERVEFAIL  316


 Score =   116 bits (291),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSLE  YPIIDS+F+ FCASH IFSVEDFL+HD++ L+  AE+H+TS RLKQ I Q
Sbjct  1     MAPLKSLESEYPIIDSDFRQFCASHAIFSVEDFLVHDIYVLMALAEEHDTSDRLKQAITQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL+ IDA HQPWL+ L
Sbjct  61    VLSIIDAQHQPWLDGL  76



>ref|XP_006363374.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Solanum tuberosum]
Length=314

 Score =   306 bits (785),  Expect(2) = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 186/228 (82%), Gaps = 1/228 (0%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNS  887
             R   T  + ID FL+GGLR+G+L ELVG SSSGKTQ+C   AS VA+S G++VF+D+ NS
Sbjct  87    RFLPTGCRSIDTFLHGGLREGYLTELVGTSSSGKTQICLQAASAVAKSWGKIVFVDSGNS  146

Query  886   FSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC  707
             FSPKRVA++V+Q SD S  +  KSL+ VM NIVC+SVFDIFT+F+V+H LK+ +RSQ   
Sbjct  147   FSPKRVAQIVTQTSDLSAYEVDKSLQQVMKNIVCFSVFDIFTLFEVLHQLKNNLRSQKDE  206

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGL  527
               RMLIIDSISSLI PILGGS AHG ALM SAGF+LK+LA+EH++ +LVTNHMVAGE G 
Sbjct  207   HIRMLIIDSISSLIAPILGGS-AHGHALMLSAGFLLKRLAHEHDISILVTNHMVAGERGT  265

Query  526   LKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
              KPALGESW+SIPH+ LLLS+D   +ISSISVL+HP+MATGDRVEF++
Sbjct  266   SKPALGESWRSIPHVSLLLSKDHISNISSISVLRHPHMATGDRVEFEL  313


 Score =   103 bits (257),  Expect(2) = 6e-105, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MA L+ LE  YP+IDS+F+ FCASH I SVEDFLLHD++ LV+S EQH+ S RLK+GI Q
Sbjct  1     MAALRCLECDYPLIDSDFRNFCASHNIISVEDFLLHDLYVLVISTEQHHNSERLKEGITQ  60

Query  1083  VLASIDALHQPWLNA  1039
             VL  I+  HQPW++ 
Sbjct  61    VLTIINKQHQPWVDG  75



>ref|XP_010313620.1| PREDICTED: pentatricopeptide repeat-containing protein At1g07740, 
mitochondrial-like [Solanum lycopersicum]
Length=777

 Score =   291 bits (744),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 177/219 (81%), Gaps = 1/219 (0%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNS  887
             R   T  + ID FL+GGLR+G+L ELVG SSSGKTQ+C   AS VA+S G+++FLD+ NS
Sbjct  87    RFLPTGCRSIDTFLHGGLREGYLTELVGTSSSGKTQICLQAASAVAKSWGKIIFLDSGNS  146

Query  886   FSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC  707
             FSPKRVA++V+Q SD S  +  K+L+ VM+NIVC+SVFDIF +F+V+H LK+ +RSQ   
Sbjct  147   FSPKRVAQIVTQTSDLSAYEVDKALQEVMNNIVCFSVFDIFPLFEVLHQLKNNLRSQKDQ  206

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGL  527
               RMLIIDSISSLI PILGG GAHG ALM S GF+LK+LA+EH++ +LVTNHMVAGE G 
Sbjct  207   HIRMLIIDSISSLIAPILGG-GAHGHALMVSVGFLLKRLAHEHDISILVTNHMVAGEKGT  265

Query  526   LKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMA  410
              KPALGESW+SIPHIRLLLS+D   +ISSISVL+HP+M+
Sbjct  266   SKPALGESWRSIPHIRLLLSKDQISNISSISVLRHPHMS  304


 Score =   102 bits (253),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MA L  LE  YP+IDS+F+ FCASH I SVEDFLLHD++ LV+S EQH+ S RLK+GI Q
Sbjct  1     MAALMYLECGYPLIDSDFRNFCASHNIISVEDFLLHDLYVLVISTEQHHNSERLKEGITQ  60

Query  1083  VLASIDALHQPWLNA  1039
             VL  I+  HQPW++ 
Sbjct  61    VLTIINKQHQPWVDG  75



>emb|CBI16200.3| unnamed protein product [Vitis vinifera]
Length=1093

 Score =   268 bits (684),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 169/220 (77%), Gaps = 5/220 (2%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  + ID  L+GGL  GHL ELVGPSS+GKTQ+C  +AS VA R  G VVF+DT NSFS
Sbjct  142   STGCEGIDMLLHGGLCVGHLTELVGPSSAGKTQICLKVASGVATRYMGGVVFIDTGNSFS  201

Query  880   PKRVAEVVSQMSDNSTSKAKKS-LEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---S  713
             P R+A  ++Q+ D    + K++ LE VMS I+C+SVFDIF M DVVH L+ ++RSQ    
Sbjct  202   PLRIAHFINQIPDTIFKEVKQNILEKVMSQILCHSVFDIFAMLDVVHQLEYSLRSQVQTG  261

Query  712   GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA  533
               + R+LI+DSISSLITPILGGSG+HGRALM SAGF+LK+LA+EHNL V+VTNHMV GE 
Sbjct  262   ADQVRLLIVDSISSLITPILGGSGSHGRALMISAGFLLKKLAHEHNLAVVVTNHMVGGEG  321

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNM  413
             G+LKPALGESWKSIPH+RLLLSRD    I  +S+LKH  M
Sbjct  322   GILKPALGESWKSIPHVRLLLSRDPGSSICHMSILKHSYM  361


 Score =   117 bits (294),  Expect(2) = 2e-97, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  1269  RAMAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGI  1090
             R M  LKSLE  YPIIDS+FQ FCASHGIFSVED L+HD++ LV  AEQ +TS RLKQGI
Sbjct  51    REMGSLKSLECEYPIIDSDFQNFCASHGIFSVEDILIHDLYMLVAFAEQQSTSERLKQGI  110

Query  1089  NQVLASIDALHQPWLNAL  1036
              Q+L+ ID  HQPWLN +
Sbjct  111   TQILSIIDGQHQPWLNGM  128



>ref|XP_009790034.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Nicotiana sylvestris]
Length=315

 Score =   279 bits (713),  Expect(2) = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 183/224 (82%), Gaps = 0/224 (0%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSPK  875
             T  + ID FL+GGL+ GHL ELVGPSSSGKTQ+C   AS VA+  G+++FLD+ NSFS K
Sbjct  91    TGCRRIDVFLHGGLKKGHLSELVGPSSSGKTQICLRAASRVAKGWGKIIFLDSGNSFSSK  150

Query  874   RVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRARM  695
             RVA+ V+Q SD+S  +  K+L+ VM+NIVC SVFDIFT+F+V+H LK+ + SQ     RM
Sbjct  151   RVAQFVTQTSDSSAYEVDKALQQVMNNIVCLSVFDIFTLFEVLHQLKNNLISQVDQHIRM  210

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPA  515
             +IIDSISSLITPILGG GA G ALM S GF+LK+LA+EH++ +LVTNHMVAGE G  KPA
Sbjct  211   IIIDSISSLITPILGGGGAQGHALMVSVGFLLKRLAHEHDICILVTNHMVAGEKGTSKPA  270

Query  514   LGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             LGESW+ IPH+RLLLSRD AR+ISS+SVL+HP+MATGDR+EF++
Sbjct  271   LGESWRGIPHVRLLLSRDRARNISSMSVLRHPHMATGDRIEFEV  314


 Score =   101 bits (252),  Expect(2) = 5e-96, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             M  L S+E  YP+IDSNF+ FCASH I+SVEDFLL D++ LV+S EQH+ S RLK+GI Q
Sbjct  1     MPLLSSMECDYPLIDSNFRDFCASHVIYSVEDFLLRDLYVLVISTEQHHNSERLKEGITQ  60

Query  1083  VLASIDALHQPWLNA  1039
             VL  I+  HQPW+N 
Sbjct  61    VLTIINGQHQPWVNG  75



>ref|XP_009594024.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X3 [Nicotiana 
tomentosiformis]
Length=315

 Score =   278 bits (711),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 182/228 (80%), Gaps = 0/228 (0%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNS  887
             R+  T  + ID FL+GGL+ GHL ELVGPSSSGKTQ+C   AS+VA S G+++FLD+ NS
Sbjct  87    RSLPTGCRSIDAFLHGGLKKGHLTELVGPSSSGKTQICLRAASSVAESWGKIIFLDSGNS  146

Query  886   FSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC  707
             FS KRVA+ V+Q SD S  +  ++L+ VM+NIVC SVFDIFT+F+V+H LK+ + SQ   
Sbjct  147   FSSKRVAQFVTQTSDPSAYEVDRALQAVMNNIVCLSVFDIFTLFEVLHQLKNNLISQVDQ  206

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGL  527
                M+IIDSISSLITPILGG GA G ALM S GF+LK+L +EH++ +LVTNHMVAGE G 
Sbjct  207   HISMIIIDSISSLITPILGGGGAQGHALMVSVGFLLKRLTHEHDICILVTNHMVAGEKGT  266

Query  526   LKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
              KPALGESW+ IPH+RLLLSRD  R+ISS+SVL+HP+MATGDRVEF++
Sbjct  267   SKPALGESWRGIPHVRLLLSRDHTRNISSMSVLRHPHMATGDRVEFEV  314


 Score =   102 bits (253),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             M    S+E  YP+ID NF+ FCASH I+SVEDFLLHD++ LV+S EQH+ S RLK+GI Q
Sbjct  1     MPLFSSMECDYPLIDPNFRDFCASHAIYSVEDFLLHDLYVLVISTEQHHNSERLKEGITQ  60

Query  1083  VLASIDALHQPWLNA  1039
             VL  I+  HQPW+N 
Sbjct  61    VLTIINGQHQPWVNG  75



>ref|XP_007016541.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY34160.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=951

 Score =   264 bits (675),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 170/222 (77%), Gaps = 4/222 (2%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCNSFSP  878
             T ++ ID  L GG+R G L ELVGPSSSGKTQVC   ASNV  +  G VV+LDT NSFSP
Sbjct  91    TGIQGIDFLLGGGIRVGQLTELVGPSSSGKTQVCLQTASNVVSNHMGTVVYLDTGNSFSP  150

Query  877   KRVAEVVSQMSDNSTSKAKKS-LEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS--GC  707
             +R+A  +   +D ++S+ K   L+ VMSNI+C+SVFDIF MFDV+H L+  +RSQ   GC
Sbjct  151   QRIAHFLGVTNDLASSEIKNQILQRVMSNILCHSVFDIFEMFDVLHKLEYQLRSQDRGGC  210

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGL  527
             + R+LIIDSIS LITP+LGG+ + GRALM SAG++LK+LA++HNL VLVTNH V GE G 
Sbjct  211   QMRLLIIDSISLLITPVLGGTSSQGRALMVSAGYLLKKLADQHNLAVLVTNHTVGGEGGT  270

Query  526   LKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGD  401
              KPALGESWKSIPH RLLLS D   ++ ++S+LKHP+MA+G+
Sbjct  271   SKPALGESWKSIPHSRLLLSCDRGSNVCNVSILKHPSMASGE  312


 Score =   114 bits (285),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK+LEQ Y IIDSNF  FCASHGIFSVEDFL+HD++ L   AEQ+ +S RLK+GI Q
Sbjct  1     MAPLKNLEQDYTIIDSNFLNFCASHGIFSVEDFLIHDLYKLAAFAEQNISSERLKEGITQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL+ ID +HQPWLN +
Sbjct  61    VLSIIDDMHQPWLNGM  76



>gb|EYU36249.1| hypothetical protein MIMGU_mgv1a010206mg [Erythranthe guttata]
Length=319

 Score =   290 bits (741),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 177/226 (78%), Gaps = 1/226 (0%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST  + ID  L GG R+GH+ ELVGPSSSGKTQVC   AS+VAR  SG V++ DT NSFS
Sbjct  88    STGYESIDSLLQGGFREGHVTELVGPSSSGKTQVCLKAASHVARKYSGTVMYFDTGNSFS  147

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
             PKR+A+ V Q SD + ++   +++HVM +IVC+ VFD+F + D++H L S ++SQ G + 
Sbjct  148   PKRIAQFVCQSSDPTNTEGNNTIQHVMRSIVCHPVFDMFALLDMLHQLMSDLKSQIGYKV  207

Query  700   RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLK  521
             RMLI+DS+SSLI P+LGGSGAHG ALM +AGF+LK+LA+EHN+ V+VTNHMV GEAG+ K
Sbjct  208   RMLIVDSLSSLIAPVLGGSGAHGHALMVTAGFLLKELAHEHNISVVVTNHMVGGEAGVSK  267

Query  520   PALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             PALGESWKSIPH+RLL+SR SA   S+IS+LKHP +ATG   +F +
Sbjct  268   PALGESWKSIPHVRLLISRYSATKDSTISILKHPYLATGKTADFTV  313


 Score = 86.7 bits (213),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL++LE  YP+IDS F+ F AS GIF+VEDFL+HD+HAL   A++ N   +L QGI Q
Sbjct  1     MAPLEALEFDYPLIDSIFRLFSASRGIFTVEDFLVHDLHALEAFAKRGNAPDKLIQGIKQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL+ I+   +PW N L
Sbjct  61    VLSIIEYQSRPWSNGL  76



>ref|XP_002531104.1| DNA repair and recombination protein radB, putative [Ricinus 
communis]
 gb|EEF31269.1| DNA repair and recombination protein radB, putative [Ricinus 
communis]
Length=315

 Score =   267 bits (683),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 175/229 (76%), Gaps = 10/229 (4%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCNSFS  881
             ST    ID  L GG+R+G L ELVG SSSGKTQVC  +A+NVA+   GRV+F+DT NSFS
Sbjct  91    STGFDGIDSLLGGGVREGQLTELVGSSSSGKTQVCLQVAANVAKQHMGRVIFVDTGNSFS  150

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SG-  710
             P+R+ + V ++S ++ ++       VMSNI+C+SVFDIF+MFDV+H L+ ++RSQ  SG 
Sbjct  151   PRRIEQFVGRISGSALNQT------VMSNILCHSVFDIFSMFDVLHQLEISLRSQGHSGD  204

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
              + + LI+DSISSLITPILGG G+ G ALM SAG +LK+LA+EHN+ VLVTNHMVAGE G
Sbjct  205   FKVQSLIVDSISSLITPILGGGGSQGHALMTSAGILLKKLAHEHNIAVLVTNHMVAGEGG  264

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
               KPALGESWKSIPH+RLLLSRD  +++ ++++LKHP+ A+G    F +
Sbjct  265   NFKPALGESWKSIPHVRLLLSRDQGKNVCNVTILKHPSQASGKAARFTV  313


 Score =   107 bits (267),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSLE+ Y I+DSNFQ FCASH IF+VEDFL+ D+ AL   AEQ  TS RLK+GINQ
Sbjct  1     MAPLKSLEKSYSILDSNFQSFCASHAIFTVEDFLIQDLDALATLAEQEPTSQRLKEGINQ  60

Query  1083  VLASIDA-LHQPWLNAL  1036
             +L+ ID   HQPWLN  
Sbjct  61    ILSIIDKQQHQPWLNGF  77



>emb|CAN80345.1| hypothetical protein VITISV_003133 [Vitis vinifera]
Length=1051

 Score =   258 bits (659),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 169/240 (70%), Gaps = 24/240 (10%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  + ID  L GGL  GHL ELVGPSSSGKTQ+C  +AS VA R  G VVF+DT NSFS
Sbjct  90    STGCEGIDMLLQGGLCVGHLTELVGPSSSGKTQICLKVASGVATRYMGGVVFIDTGNSFS  149

Query  880   PKRVAEVVSQMSDNSTSKAKKS-LEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---S  713
             P R+A  ++Q+ D    + K++ LE VMS I+C+SVFDIF M DVVH L+ ++RSQ    
Sbjct  150   PLRIAHFINQIPDTIFKEVKQNILEKVMSQILCHSVFDIFAMLDVVHQLEYSLRSQVQTG  209

Query  712   GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVL----------  563
               + R+LI+DSISSLITPILGGSG+HGRALM SAGF+LK+LA+EHNL V+          
Sbjct  210   ADQVRLLIVDSISSLITPILGGSGSHGRALMISAGFLLKKLAHEHNLAVVPIIKVSILTI  269

Query  562   ---------VTNHMVAGEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMA  410
                      VTNHMV GE G+LKPALGESWKSIPH+RLLLSRD    I  +S+LKH  M+
Sbjct  270   ITIMIHWLKVTNHMVGGEGGILKPALGESWKSIPHVRLLLSRDPGSSICHMSILKHSYMS  329


 Score =   114 bits (285),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             M  LKSLE  YPIIDS+FQ FCASHGIFSVED L+HD++ LV  AEQ +TS RLKQGI Q
Sbjct  1     MGSLKSLECEYPIIDSDFQNFCASHGIFSVEDILIHDLYMLVAFAEQQSTSERLKQGITQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ ID  HQPWLN +
Sbjct  61    ILSIIDGQHQPWLNGM  76



>ref|XP_007132116.1| hypothetical protein PHAVU_011G067900g [Phaseolus vulgaris]
 gb|ESW04110.1| hypothetical protein PHAVU_011G067900g [Phaseolus vulgaris]
Length=318

 Score =   262 bits (669),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSP  878
             ST  + ID  L GGLR+G L ELVG SSSGKTQ C + AS VA+    V++LDT NSFSP
Sbjct  90    STGCERIDALLGGGLREGQLTELVGSSSSGKTQACLLTASTVAKHKSSVIYLDTGNSFSP  149

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGC  707
              R+A  V Q S  S ++A   L+ V+  I+CYSVFDI+ MFDV+H LK+ +RS+   S  
Sbjct  150   HRIARFVGQ-SSASDNQAAHKLKEVLDRIICYSVFDIYQMFDVLHQLKTNLRSEIVKSNQ  208

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGL  527
               R+LI+DSISSL+TPILGGSG  G ALM SAGF+LK+L +EHN+ VLVTNH+V GE G+
Sbjct  209   HVRLLIVDSISSLVTPILGGSGPQGHALMISAGFLLKKLGHEHNIAVLVTNHVVGGEDGV  268

Query  526   LKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATG  404
              KPALGESWKS+PH+RLL S+D   ++ +IS+LKHP+MA+G
Sbjct  269   SKPALGESWKSVPHVRLLFSQDCGSNVCNISMLKHPSMASG  309


 Score =   108 bits (269),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSLE+ YP+IDS FQ FCASH IFSVEDFLLHD+ AL+  A+ H  S  LKQGINQ
Sbjct  1     MAPLKSLEKEYPLIDSIFQSFCASHAIFSVEDFLLHDIDALIALADNHCASQTLKQGINQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ IDA H P LN L
Sbjct  61    LLSIIDARHPPLLNGL  76



>ref|XP_006590287.1| PREDICTED: uncharacterized protein LOC100780427 isoform X1 [Glycine 
max]
Length=321

 Score =   254 bits (650),  Expect(2) = 6e-92, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 167/223 (75%), Gaps = 5/223 (2%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNV-ARSSGRVVFLDTCNSFS  881
             ST  + ID  L GGLR+G L ELVG SSSGKTQ C + AS V A+    V++LDT NSFS
Sbjct  90    STGCEGIDALLRGGLREGQLTELVGSSSSGKTQACLLSASTVVAKHKSSVIYLDTGNSFS  149

Query  880   PKRVAEVVSQMSDN-STSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---S  713
             P+R+A  V Q S +   ++A   L+ V+  I+CYSVFD++ MFDV+H LK  +RS+   S
Sbjct  150   PQRIAHFVGQSSGHIFGNQADHMLKKVLDRIICYSVFDVYQMFDVLHQLKINLRSEIVKS  209

Query  712   GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA  533
                 R+LI+DSISSLITPILGGSG  G ALM SAGF+LK+LA+EHN+ VLVTNH+V G+ 
Sbjct  210   NQHVRLLIVDSISSLITPILGGSGPQGHALMISAGFLLKKLAHEHNIAVLVTNHVVGGDD  269

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATG  404
             G+ KPA+GESWKS+PH+R+LLSRD   ++ +IS+LKHP+MA+G
Sbjct  270   GISKPAMGESWKSVPHVRILLSRDCGSNVCNISILKHPSMASG  312


 Score =   112 bits (281),  Expect(2) = 6e-92, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL+SLE+ YP+IDSNFQ FCASHGIFSVEDFLLHD+ AL+   + H+TS  LKQGI+Q
Sbjct  1     MAPLESLEKEYPLIDSNFQSFCASHGIFSVEDFLLHDLDALLSFTDNHSTSQTLKQGIDQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +++ IDALH P LN L
Sbjct  61    LISIIDALHPPLLNGL  76



>gb|KHN21996.1| DNA repair protein RAD51 like 4 [Glycine soja]
Length=321

 Score =   253 bits (647),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 166/223 (74%), Gaps = 5/223 (2%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNV-ARSSGRVVFLDTCNSFS  881
             ST  + ID  L GGLR+G L ELVG SSSGKTQ C + AS V A+    V++LDT NSFS
Sbjct  90    STGCEGIDALLRGGLREGQLTELVGSSSSGKTQACLLSASTVVAKHKSSVIYLDTGNSFS  149

Query  880   PKRVAEVVSQMSDN-STSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---S  713
             P+R+A  V Q S +   ++A   L+ V+  I+CYSVFD++ MFDV+H LK  +RS+   S
Sbjct  150   PQRIAHFVGQSSGHIFGNQADHMLKKVLDRIICYSVFDVYHMFDVLHQLKINLRSEIVKS  209

Query  712   GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA  533
                 R+LI+DSISSLITPILGGSG  G ALM SAGF+LK+LA+EHN+ VLVTNH+V G+ 
Sbjct  210   NQHVRLLIVDSISSLITPILGGSGPQGHALMISAGFLLKKLAHEHNIAVLVTNHVVGGDD  269

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATG  404
             G+ KPA+GESWKS+PH+R+LLSRD   ++  IS+LKHP+MA+G
Sbjct  270   GISKPAMGESWKSVPHVRILLSRDCGSNVCDISILKHPSMASG  312


 Score =   112 bits (281),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL+SLE+ YP+IDSNFQ FCASHGIFSVEDFLLHD+ AL+   + H+TS  LKQGI+Q
Sbjct  1     MAPLESLEKEYPLIDSNFQSFCASHGIFSVEDFLLHDLDALLSFTDNHSTSQTLKQGIDQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +++ IDALH P LN L
Sbjct  61    LISIIDALHPPLLNGL  76



>ref|XP_010253339.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Nelumbo 
nucifera]
Length=321

 Score =   256 bits (654),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 166/224 (74%), Gaps = 5/224 (2%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAE  863
             ID  L GGLR GH+ ELVGPS SGKTQVC   ASNVA +  G V+FLDTCNSFSP+R+A 
Sbjct  96    IDMLLQGGLRVGHVTELVGPSPSGKTQVCLQAASNVAVKFMGVVMFLDTCNSFSPRRMAC  155

Query  862   VVSQMSDNSTSK-AKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARM  695
              ++Q  +    +  +K L+ VMS+I+C SVFDIF++ DV+  L+  ++ Q     C+ R+
Sbjct  156   FINQHFNTPVEEVTQKGLKRVMSSILCQSVFDIFSLLDVLRQLELKLQFQVNTGDCKLRL  215

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPA  515
             LIIDSISSLITPILGG+GAHG +LM   GF+LK+LA+E+N+ VLVTNHMV GE G+LKPA
Sbjct  216   LIIDSISSLITPILGGNGAHGHSLMIFTGFLLKKLAHEYNISVLVTNHMVCGEGGILKPA  275

Query  514   LGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             LGESWKSIPH+RLLLS D   +  +IS+LKHP M +G    F +
Sbjct  276   LGESWKSIPHVRLLLSHDRRSNSYNISILKHPVMVSGRAASFTV  319


 Score =   109 bits (272),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSL++ +PIID NFQ FCASHGI+SVEDFL+HD+++LV SAEQ ++S  L++GI+Q
Sbjct  1     MAPLKSLQREFPIIDCNFQQFCASHGIYSVEDFLVHDLYSLVASAEQQSSSEELREGISQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             V++ I + HQPW N +
Sbjct  61    VISIIGSQHQPWSNGV  76



>ref|XP_004505898.1| PREDICTED: DNA repair protein RAD51 homolog 4-like isoform X1 
[Cicer arietinum]
Length=322

 Score =   257 bits (656),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 164/223 (74%), Gaps = 5/223 (2%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSP  878
             ST  + ID  L GGLR G L ELVGPSSSGKTQVC M AS  A+  G V++LDT NSFSP
Sbjct  90    STGCEGIDALLGGGLRAGQLTELVGPSSSGKTQVCLMSASTFAKHKGSVIYLDTGNSFSP  149

Query  877   KRVAEVVSQMSD--NSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---S  713
             +R+A  V Q SD  +     ++SL+ V+  I+CY VFD++ MFD++H LK  + S+   S
Sbjct  150   QRIAHFVGQSSDCVSGNQADRRSLQKVLDRIICYPVFDVYEMFDMLHQLKINLTSEIVKS  209

Query  712   GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA  533
                 ++LI+DSISSLITPIL G+G  G ALM SAGF+LK+LA+EHN+ VLVTNH+V GE 
Sbjct  210   DRHVQLLIVDSISSLITPILRGNGPQGHALMISAGFLLKKLAHEHNIAVLVTNHVVGGED  269

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATG  404
             G  KPALGESWKS+PH+RLLLSRD   ++ +IS++KHP MA+G
Sbjct  270   GNSKPALGESWKSVPHVRLLLSRDCGGNVCNISIIKHPAMASG  312


 Score =   108 bits (269),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL SLE+ YP+ID+NFQ FCASH I+SVEDFLLHD+ AL  SA   +TS RLKQGI+Q
Sbjct  1     MAPLNSLEKEYPLIDANFQTFCASHAIYSVEDFLLHDLDALFASASNPSTSHRLKQGIHQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ IDALH P +N L
Sbjct  61    LLSIIDALHPPLINGL  76



>gb|KEH30102.1| DNA repair protein RAD51 [Medicago truncatula]
Length=322

 Score =   256 bits (654),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 170/223 (76%), Gaps = 5/223 (2%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSP  878
             ST  + ID  L GGLR G L ELVGPSSSGKTQVC M +S VA++   V++LDT NSFSP
Sbjct  90    STGCEGIDALLGGGLRVGQLTELVGPSSSGKTQVCLMSSSTVAKNKCSVIYLDTGNSFSP  149

Query  877   KRVAEVVSQMSDN-STSKAK-KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---S  713
             +R+A  V Q SD  S ++A  + L++++  I+CY VFD++ MFD++H LK  +RSQ   S
Sbjct  150   QRIAYFVGQSSDYVSVNQADHRLLQNILDRIICYPVFDVYQMFDLLHQLKINLRSQIVKS  209

Query  712   GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA  533
               + ++LI+DSISSLITPIL G+G  G ALM S+GF+LKQLA+EHN+ VLVTNH+V G+ 
Sbjct  210   DHQVQVLIVDSISSLITPILRGNGPQGHALMISSGFLLKQLAHEHNIAVLVTNHVVGGDD  269

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATG  404
             G  KPALGESWKS+PH+RLLLSRD   ++S+IS++KHP MA+G
Sbjct  270   GNPKPALGESWKSVPHVRLLLSRDCRSNVSNISIIKHPAMASG  312


 Score =   107 bits (268),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL SL + YP+IDSNFQ FCASH I+SVEDFLLHD+ AL  SA  H+ S RLKQGI+Q
Sbjct  1     MAPLNSLSKEYPLIDSNFQTFCASHAIYSVEDFLLHDLDALFASAANHSNSERLKQGIHQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L  +DALH P LN L
Sbjct  61    LLLIVDALHPPVLNGL  76



>ref|XP_009594023.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Nicotiana 
tomentosiformis]
Length=316

 Score =   261 bits (667),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 173/220 (79%), Gaps = 0/220 (0%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNS  887
             R+  T  + ID FL+GGL+ GHL ELVGPSSSGKTQ+C   AS+VA S G+++FLD+ NS
Sbjct  87    RSLPTGCRSIDAFLHGGLKKGHLTELVGPSSSGKTQICLRAASSVAESWGKIIFLDSGNS  146

Query  886   FSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC  707
             FS KRVA+ V+Q SD S  +  ++L+ VM+NIVC SVFDIFT+F+V+H LK+ + SQ   
Sbjct  147   FSSKRVAQFVTQTSDPSAYEVDRALQAVMNNIVCLSVFDIFTLFEVLHQLKNNLISQVDQ  206

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGL  527
                M+IIDSISSLITPILGG GA G ALM S GF+LK+L +EH++ +LVTNHMVAGE G 
Sbjct  207   HISMIIIDSISSLITPILGGGGAQGHALMVSVGFLLKRLTHEHDICILVTNHMVAGEKGT  266

Query  526   LKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMAT  407
              KPALGESW+ IPH+RLLLSRD  R+ISS+SVL+HP+M T
Sbjct  267   SKPALGESWRGIPHVRLLLSRDHTRNISSMSVLRHPHMET  306


 Score =   102 bits (253),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             M    S+E  YP+ID NF+ FCASH I+SVEDFLLHD++ LV+S EQH+ S RLK+GI Q
Sbjct  1     MPLFSSMECDYPLIDPNFRDFCASHAIYSVEDFLLHDLYVLVISTEQHHNSERLKEGITQ  60

Query  1083  VLASIDALHQPWLNA  1039
             VL  I+  HQPW+N 
Sbjct  61    VLTIINGQHQPWVNG  75



>gb|KDP44181.1| hypothetical protein JCGZ_05648 [Jatropha curcas]
Length=318

 Score =   256 bits (655),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 172/227 (76%), Gaps = 6/227 (3%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  + ID  L GG+R+G L ELVGPSSSGKTQVC  +A+NVA + +G V+F+DT NSFS
Sbjct  90    STGFEGIDALLGGGVREGQLTELVGPSSSGKTQVCLQVAANVAIQHTGSVIFMDTGNSFS  149

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS---G  710
             P+R+   V ++S ++ ++    ++ VMSNI+C+SVFDIF+MFDV+  ++  ++SQ     
Sbjct  150   PQRIEHFVHRISGSAFNE--NFVQKVMSNILCHSVFDIFSMFDVLRQVEIGLKSQQCKGD  207

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
             C+ R +I+DSISSLITP+LGGSG+ G ALM SAGF+LK+LA+EHN+ VLVTNHMV GE G
Sbjct  208   CKVRSIIVDSISSLITPVLGGSGSQGHALMTSAGFLLKKLAHEHNIAVLVTNHMVTGEGG  267

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEF  389
               KPALGESWKSIPH+RLLLS D   +   IS+LKH ++A+G+   F
Sbjct  268   NPKPALGESWKSIPHVRLLLSCDHRNNACKISILKHTSLASGETARF  314


 Score =   106 bits (264),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSLE +Y I+DSNFQ FCASHGIF+VEDFL+HD+  L   AEQ   S RLK+GI Q
Sbjct  1     MAPLKSLEAQYSILDSNFQLFCASHGIFTVEDFLIHDVSVLTALAEQKPFSGRLKEGITQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ ID  HQPW N L
Sbjct  61    MLSIIDEQHQPWSNGL  76



>ref|XP_008385174.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X4 [Malus 
domestica]
Length=318

 Score =   247 bits (631),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 173/229 (76%), Gaps = 4/229 (2%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  + ID  L GGLR+G + ELVGPS+SGKTQVC + A+NVA +  G VV+LDT NSFS
Sbjct  90    STGCEGIDLLLGGGLREGQVTELVGPSTSGKTQVCLLSAANVATKHMGTVVYLDTGNSFS  149

Query  880   PKRVAEVVSQMSDNSTSKA-KKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SG  710
             P+R+   V  +S+++  +A ++  + VM+NI+C+ VFDIFTMF+++H L+ ++ SQ   G
Sbjct  150   PERIVHFVGDISNHAFDQAGQRVFQKVMNNILCHHVFDIFTMFNLLHQLEFSLPSQMQKG  209

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
              + R+LI+DSISSLITPILG SG+ GRALM SAG++LK+LA+EHNL VLVTNH V GE G
Sbjct  210   EQVRLLIVDSISSLITPILGNSGSQGRALMISAGYLLKKLAHEHNLAVLVTNHTVGGEKG  269

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             + KPALG++WKSIPH+RLLLS D      +ISVL+H +MA+G    F I
Sbjct  270   IPKPALGQTWKSIPHVRLLLSGDQGNSTRTISVLRHSSMASGKSTRFTI  318


 Score =   114 bits (285),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSLE  +P+IDSNFQ FCASHGIFSVE+FL+HD+  L  +A+QH T  +LKQGI +
Sbjct  1     MAPLKSLEAEHPVIDSNFQXFCASHGIFSVEEFLIHDLDELAGAAQQHPTCEKLKQGITE  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL++ID+ HQPWLN +
Sbjct  61    VLSTIDSQHQPWLNGM  76



>ref|XP_009594022.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Nicotiana 
tomentosiformis]
Length=320

 Score =   259 bits (663),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 172/218 (79%), Gaps = 0/218 (0%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNS  887
             R+  T  + ID FL+GGL+ GHL ELVGPSSSGKTQ+C   AS+VA S G+++FLD+ NS
Sbjct  87    RSLPTGCRSIDAFLHGGLKKGHLTELVGPSSSGKTQICLRAASSVAESWGKIIFLDSGNS  146

Query  886   FSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC  707
             FS KRVA+ V+Q SD S  +  ++L+ VM+NIVC SVFDIFT+F+V+H LK+ + SQ   
Sbjct  147   FSSKRVAQFVTQTSDPSAYEVDRALQAVMNNIVCLSVFDIFTLFEVLHQLKNNLISQVDQ  206

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGL  527
                M+IIDSISSLITPILGG GA G ALM S GF+LK+L +EH++ +LVTNHMVAGE G 
Sbjct  207   HISMIIIDSISSLITPILGGGGAQGHALMVSVGFLLKRLTHEHDICILVTNHMVAGEKGT  266

Query  526   LKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNM  413
              KPALGESW+ IPH+RLLLSRD  R+ISS+SVL+HP+M
Sbjct  267   SKPALGESWRGIPHVRLLLSRDHTRNISSMSVLRHPHM  304


 Score =   102 bits (253),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             M    S+E  YP+ID NF+ FCASH I+SVEDFLLHD++ LV+S EQH+ S RLK+GI Q
Sbjct  1     MPLFSSMECDYPLIDPNFRDFCASHAIYSVEDFLLHDLYVLVISTEQHHNSERLKEGITQ  60

Query  1083  VLASIDALHQPWLNA  1039
             VL  I+  HQPW+N 
Sbjct  61    VLTIINGQHQPWVNG  75



>ref|XP_008385173.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X3 [Malus 
domestica]
Length=320

 Score =   247 bits (630),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 172/231 (74%), Gaps = 6/231 (3%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  + ID  L GGLR+G + ELVGPS+SGKTQVC + A+NVA +  G VV+LDT NSFS
Sbjct  90    STGCEGIDLLLGGGLREGQVTELVGPSTSGKTQVCLLSAANVATKHMGTVVYLDTGNSFS  149

Query  880   PKRVAEVVSQMSDNSTSKA-KKSLEHVMSNIVCYSVFDIFTMFDVVHHLK----STMRSQ  716
             P+R+   V  +S+++  +A ++  + VM+NI+C+ VFDIFTMF+++H L+    S  + Q
Sbjct  150   PERIVHFVGDISNHAFDQAGQRVFQKVMNNILCHHVFDIFTMFNLLHQLEFSLPSQFQMQ  209

Query  715   SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGE  536
              G + R+LI+DSISSLITPILG SG+ GRALM SAG++LK+LA+EHNL VLVTNH V GE
Sbjct  210   KGEQVRLLIVDSISSLITPILGNSGSQGRALMISAGYLLKKLAHEHNLAVLVTNHTVGGE  269

Query  535   AGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
              G+ KPALG++WKSIPH+RLLLS D      +ISVL+H +MA+G    F I
Sbjct  270   KGIPKPALGQTWKSIPHVRLLLSGDQGNSTRTISVLRHSSMASGKSTRFTI  320


 Score =   114 bits (285),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSLE  +P+IDSNFQ FCASHGIFSVE+FL+HD+  L  +A+QH T  +LKQGI +
Sbjct  1     MAPLKSLEAEHPVIDSNFQXFCASHGIFSVEEFLIHDLDELAGAAQQHPTCEKLKQGITE  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL++ID+ HQPWLN +
Sbjct  61    VLSTIDSQHQPWLNGM  76



>gb|KEH30103.1| DNA repair protein RAD51 [Medicago truncatula]
Length=315

 Score =   253 bits (645),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 165/221 (75%), Gaps = 8/221 (4%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSP  878
             ST  + ID  L GGLR G L ELVGPSSSGKTQVC M +S VA++   V++LDT NSFSP
Sbjct  90    STGCEGIDALLGGGLRVGQLTELVGPSSSGKTQVCLMSSSTVAKNKCSVIYLDTGNSFSP  149

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGC  707
             +R+A  V Q SD  +       ++++  I+CY VFD++ MFD++H LK  +RSQ   S  
Sbjct  150   QRIAYFVGQSSDYVSVN-----QNILDRIICYPVFDVYQMFDLLHQLKINLRSQIVKSDH  204

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGL  527
             + ++LI+DSISSLITPIL G+G  G ALM S+GF+LKQLA+EHN+ VLVTNH+V G+ G 
Sbjct  205   QVQVLIVDSISSLITPILRGNGPQGHALMISSGFLLKQLAHEHNIAVLVTNHVVGGDDGN  264

Query  526   LKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATG  404
              KPALGESWKS+PH+RLLLSRD   ++S+IS++KHP MA+G
Sbjct  265   PKPALGESWKSVPHVRLLLSRDCRSNVSNISIIKHPAMASG  305


 Score =   107 bits (268),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL SL + YP+IDSNFQ FCASH I+SVEDFLLHD+ AL  SA  H+ S RLKQGI+Q
Sbjct  1     MAPLNSLSKEYPLIDSNFQTFCASHAIYSVEDFLLHDLDALFASAANHSNSERLKQGIHQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L  +DALH P LN L
Sbjct  61    LLLIVDALHPPVLNGL  76



>gb|KHG11218.1| DNA repair RAD51 -like protein [Gossypium arboreum]
Length=317

 Score =   252 bits (643),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 166/228 (73%), Gaps = 5/228 (2%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSPK  875
             T ++ ID  L GG+R G L ELVGPSSSGKTQVC   ASNVAR+   V++LDT NSFSP+
Sbjct  91    TGIQGIDLLLGGGIRVGQLTELVGPSSSGKTQVCLRTASNVARNH-MVLYLDTGNSFSPQ  149

Query  874   RVAEVVSQMSDNSTSKAKKS-LEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSG---C  707
             R+A  + +  + S+++AK   L+ VMSNI C+SVFDIF MFDV+H L+S +R Q G   C
Sbjct  150   RIAYFLGKTINPSSAQAKNQFLQKVMSNISCHSVFDIFAMFDVLHQLESYLRCQDGRGGC  209

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGL  527
             + R+LI+DSISSLI+P+LG S   GRALM S G++LK+LA++HNL VL+ NH V GE G 
Sbjct  210   QMRLLIVDSISSLISPLLGSSSTQGRALMTSTGYLLKKLAHQHNLAVLIINHTVGGEGGY  269

Query  526   LKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
              KPALG+SWK IPH RL LS D   +  ++S+L+HP+MA+G    F I
Sbjct  270   SKPALGDSWKCIPHSRLFLSCDRGSNNYNVSILRHPSMASGKAARFVI  317


 Score =   106 bits (265),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MA L +LE  YP++DS  + FCASHGIFSVEDFL+HD++ L   AEQ+N+S RLK+GI Q
Sbjct  1     MARLANLETEYPVLDSTVRNFCASHGIFSVEDFLIHDLYMLAAFAEQNNSSERLKEGIAQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL+ ID +HQPWLN +
Sbjct  61    VLSIIDDMHQPWLNGM  76



>ref|XP_004294616.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Fragaria 
vesca subsp. vesca]
Length=316

 Score =   249 bits (635),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 164/206 (80%), Gaps = 2/206 (1%)
 Frame = -1

Query  994  ELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEVVSQMSDNSTSKA-K  821
            ELVGPSSSGKTQVC + ASN+A +  G VV+LDT NSFS +R+AE V + S+++ S+A +
Sbjct  111  ELVGPSSSGKTQVCLLAASNLASQHMGTVVYLDTGNSFSTQRIAEFVGRFSNHTFSQAGQ  170

Query  820  KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRARMLIIDSISSLITPILGGSG  641
            ++ +  M+NI+C+SVFDIFTMF+V+H L+ +++SQ G + ++LI+DSISSLITPILG + 
Sbjct  171  RNFQKAMNNILCHSVFDIFTMFNVLHRLEFSLKSQKGGQVQLLIVDSISSLITPILGNTS  230

Query  640  AHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGESWKSIPHIRLLLSRD  461
            + GRALM SAG++LK+LA+EHN+ VLVTNH V GE G+ KPALG++WKS+ H+RLLLS D
Sbjct  231  SQGRALMTSAGYLLKKLAHEHNIAVLVTNHTVGGEKGIAKPALGQTWKSVAHVRLLLSAD  290

Query  460  SARHISSISVLKHPNMATGDRVEFQI  383
                  SISVLKHP+MA+G    F++
Sbjct  291  HGNDTRSISVLKHPSMASGKVARFRV  316


 Score =   108 bits (270),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK+LE  YPIIDSNFQ FCASHGI SVEDFL+HDM+ L   A+Q   S +LKQ I Q
Sbjct  1     MAPLKALELEYPIIDSNFQAFCASHGILSVEDFLIHDMYELTAFAKQQPNSEKLKQSITQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ IDA H PW+N +
Sbjct  61    ILSIIDAQHPPWVNGM  76



>ref|XP_006590288.1| PREDICTED: uncharacterized protein LOC100780427 isoform X2 [Glycine 
max]
Length=319

 Score =   244 bits (622),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 158/208 (76%), Gaps = 5/208 (2%)
 Frame = -1

Query  1021  GGLRDGHLIELVGPSSSGKTQVCFMIASNV-ARSSGRVVFLDTCNSFSPKRVAEVVSQMS  845
             GGLR+G L ELVG SSSGKTQ C + AS V A+    V++LDT NSFSP+R+A  V Q S
Sbjct  96    GGLREGQLTELVGSSSSGKTQACLLSASTVVAKHKSSVIYLDTGNSFSPQRIAHFVGQSS  155

Query  844   DN-STSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARMLIIDSI  677
              +   ++A   L+ V+  I+CYSVFD++ MFDV+H LK  +RS+   S    R+LI+DSI
Sbjct  156   GHIFGNQADHMLKKVLDRIICYSVFDVYQMFDVLHQLKINLRSEIVKSNQHVRLLIVDSI  215

Query  676   SSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGESWK  497
             SSLITPILGGSG  G ALM SAGF+LK+LA+EHN+ VLVTNH+V G+ G+ KPA+GESWK
Sbjct  216   SSLITPILGGSGPQGHALMISAGFLLKKLAHEHNIAVLVTNHVVGGDDGISKPAMGESWK  275

Query  496   SIPHIRLLLSRDSARHISSISVLKHPNM  413
             S+PH+R+LLSRD   ++ +IS+LKHP+M
Sbjct  276   SVPHVRILLSRDCGSNVCNISILKHPSM  303


 Score =   112 bits (280),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL+SLE+ YP+IDSNFQ FCASHGIFSVEDFLLHD+ AL+   + H+TS  LKQGI+Q
Sbjct  1     MAPLESLEKEYPLIDSNFQSFCASHGIFSVEDFLLHDLDALLSFTDNHSTSQTLKQGIDQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +++ IDALH P LN L
Sbjct  61    LISIIDALHPPLLNGL  76



>ref|XP_008385172.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Malus 
domestica]
Length=322

 Score =   241 bits (616),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 173/233 (74%), Gaps = 8/233 (3%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  + ID  L GGLR+G + ELVGPS+SGKTQVC + A+NVA +  G VV+LDT NSFS
Sbjct  90    STGCEGIDLLLGGGLREGQVTELVGPSTSGKTQVCLLSAANVATKHMGTVVYLDTGNSFS  149

Query  880   PKRVAEVVSQMSDNSTSKA-KKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SG  710
             P+R+   V  +S+++  +A ++  + VM+NI+C+ VFDIFTMF+++H L+ ++ SQ   G
Sbjct  150   PERIVHFVGDISNHAFDQAGQRVFQKVMNNILCHHVFDIFTMFNLLHQLEFSLPSQMQKG  209

Query  709   CRARMLIIDSISSLITPILGGSGAHG----RALMASAGFILKQLANEHNLPVLVTNHMVA  542
              + R+LI+DSISSLITPILG SG+ G    RALM SAG++LK+LA+EHNL VLVTNH V 
Sbjct  210   EQVRLLIVDSISSLITPILGNSGSQGIYHWRALMISAGYLLKKLAHEHNLAVLVTNHTVG  269

Query  541   GEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             GE G+ KPALG++WKSIPH+RLLLS D      +ISVL+H +MA+G    F I
Sbjct  270   GEKGIPKPALGQTWKSIPHVRLLLSGDQGNSTRTISVLRHSSMASGKSTRFTI  322


 Score =   114 bits (284),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSLE  +P+IDSNFQ FCASHGIFSVE+FL+HD+  L  +A+QH T  +LKQGI +
Sbjct  1     MAPLKSLEAEHPVIDSNFQXFCASHGIFSVEEFLIHDLDELAGAAQQHPTCEKLKQGITE  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL++ID+ HQPWLN +
Sbjct  61    VLSTIDSQHQPWLNGM  76



>ref|XP_008385171.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Malus 
domestica]
Length=324

 Score =   241 bits (615),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 172/235 (73%), Gaps = 10/235 (4%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  + ID  L GGLR+G + ELVGPS+SGKTQVC + A+NVA +  G VV+LDT NSFS
Sbjct  90    STGCEGIDLLLGGGLREGQVTELVGPSTSGKTQVCLLSAANVATKHMGTVVYLDTGNSFS  149

Query  880   PKRVAEVVSQMSDNSTSKA-KKSLEHVMSNIVCYSVFDIFTMFDVVHHLK----STMRSQ  716
             P+R+   V  +S+++  +A ++  + VM+NI+C+ VFDIFTMF+++H L+    S  + Q
Sbjct  150   PERIVHFVGDISNHAFDQAGQRVFQKVMNNILCHHVFDIFTMFNLLHQLEFSLPSQFQMQ  209

Query  715   SGCRARMLIIDSISSLITPILGGSGAHG----RALMASAGFILKQLANEHNLPVLVTNHM  548
              G + R+LI+DSISSLITPILG SG+ G    RALM SAG++LK+LA+EHNL VLVTNH 
Sbjct  210   KGEQVRLLIVDSISSLITPILGNSGSQGIYHWRALMISAGYLLKKLAHEHNLAVLVTNHT  269

Query  547   VAGEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             V GE G+ KPALG++WKSIPH+RLLLS D      +ISVL+H +MA+G    F I
Sbjct  270   VGGEKGIPKPALGQTWKSIPHVRLLLSGDQGNSTRTISVLRHSSMASGKSTRFTI  324


 Score =   114 bits (284),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSLE  +P+IDSNFQ FCASHGIFSVE+FL+HD+  L  +A+QH T  +LKQGI +
Sbjct  1     MAPLKSLEAEHPVIDSNFQXFCASHGIFSVEEFLIHDLDELAGAAQQHPTCEKLKQGITE  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL++ID+ HQPWLN +
Sbjct  61    VLSTIDSQHQPWLNGM  76



>ref|NP_001242445.1| uncharacterized protein LOC100780427 [Glycine max]
 gb|ACU18022.1| unknown [Glycine max]
Length=325

 Score =   242 bits (618),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 162/220 (74%), Gaps = 5/220 (2%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNV-ARSSGRVVFLDTCNSFS  881
             ST  + ID  L GGLR+G L ELVG SSSGKTQ C + AS V A+    V++LDT NSFS
Sbjct  90    STGCEGIDALLRGGLREGQLTELVGSSSSGKTQACLLSASTVVAKHKSSVIYLDTGNSFS  149

Query  880   PKRVAEVVSQMSDN-STSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---S  713
             P+R+A  V Q S +   ++A   L+ V+  I+CYSVFD++ MFDV+H LK  +RS+   S
Sbjct  150   PQRIAHFVGQSSGHIFGNQADHMLKKVLDRIICYSVFDVYQMFDVLHQLKINLRSEIVKS  209

Query  712   GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA  533
                 R+LI+DSISSLITPILGGSG  G ALM SAGF+LK+LA+EHN+ VLVTNH+V G+ 
Sbjct  210   NQHVRLLIVDSISSLITPILGGSGPQGHALMISAGFLLKKLAHEHNIAVLVTNHVVGGDD  269

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNM  413
             G+ K A+GESWKS+PH+R+LLSRD   ++ +IS+LK P+M
Sbjct  270   GISKTAMGESWKSVPHVRILLSRDCGSNVCNISILKPPSM  309


 Score =   112 bits (281),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL+SLE+ YP+IDSNFQ FCASHGIFSVEDFLLHD+ AL+   + H+TS  LKQGI+Q
Sbjct  1     MAPLESLEKEYPLIDSNFQSFCASHGIFSVEDFLLHDLDALLSFTDNHSTSQTLKQGIDQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +++ IDALH P LN L
Sbjct  61    LISIIDALHPPLLNGL  76



>ref|XP_007206485.1| hypothetical protein PRUPE_ppa019062mg, partial [Prunus persica]
 gb|EMJ07684.1| hypothetical protein PRUPE_ppa019062mg, partial [Prunus persica]
Length=308

 Score =   239 bits (609),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 154/198 (78%), Gaps = 4/198 (2%)
 Frame = -1

Query  994  ELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEVVSQMSDNSTSKA-K  821
            ELVGPSS GKTQVC + ASNVA +  G VV+LDT NSFSP+R+A+ V  ++  +  +A K
Sbjct  111  ELVGPSSCGKTQVCLLAASNVATKHMGNVVYLDTGNSFSPQRIAQFVGHIAGRAFDEAGK  170

Query  820  KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SGCRARMLIIDSISSLITPILGG  647
            +  + +M+ IVC+SVFDIFTMF+V+H L     SQ   G + RMLI+DSISSLITPILG 
Sbjct  171  RIFQRIMNGIVCHSVFDIFTMFNVLHRLVINFPSQLQKGGQVRMLIVDSISSLITPILGN  230

Query  646  SGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGESWKSIPHIRLLLS  467
            SG+ GRALM SAG++LK+LA+EHN+ VLVTNH V GE G+ KPALG++WKSIPH+RLLLS
Sbjct  231  SGSQGRALMISAGYMLKKLAHEHNVAVLVTNHTVGGERGIPKPALGQTWKSIPHVRLLLS  290

Query  466  RDSARHISSISVLKHPNM  413
             D   ++ SISVL+HP+M
Sbjct  291  GDHGNNVRSISVLRHPSM  308


 Score =   115 bits (288),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK+LE  YPI+D NFQ FCASHGIFSVEDFL+HD++ L   AEQ  TS +LKQGI Q
Sbjct  1     MAPLKALEAEYPILDPNFQAFCASHGIFSVEDFLIHDLYELAAFAEQQPTSEKLKQGITQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL+ ID  HQPWLN +
Sbjct  61    VLSIIDTQHQPWLNGM  76



>ref|XP_004505899.1| PREDICTED: DNA repair protein RAD51 homolog 4-like isoform X2 
[Cicer arietinum]
Length=318

 Score =   257 bits (656),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 164/223 (74%), Gaps = 5/223 (2%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSP  878
             ST  + ID  L GGLR G L ELVGPSSSGKTQVC M AS  A+  G V++LDT NSFSP
Sbjct  86    STGCEGIDALLGGGLRAGQLTELVGPSSSGKTQVCLMSASTFAKHKGSVIYLDTGNSFSP  145

Query  877   KRVAEVVSQMSD--NSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---S  713
             +R+A  V Q SD  +     ++SL+ V+  I+CY VFD++ MFD++H LK  + S+   S
Sbjct  146   QRIAHFVGQSSDCVSGNQADRRSLQKVLDRIICYPVFDVYEMFDMLHQLKINLTSEIVKS  205

Query  712   GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA  533
                 ++LI+DSISSLITPIL G+G  G ALM SAGF+LK+LA+EHN+ VLVTNH+V GE 
Sbjct  206   DRHVQLLIVDSISSLITPILRGNGPQGHALMISAGFLLKKLAHEHNIAVLVTNHVVGGED  265

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATG  404
             G  KPALGESWKS+PH+RLLLSRD   ++ +IS++KHP MA+G
Sbjct  266   GNSKPALGESWKSVPHVRLLLSRDCGGNVCNISIIKHPAMASG  308


 Score = 96.3 bits (238),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 4/76 (5%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL SLE+ YP+ID+NFQ FCASH I+SVEDFLLHD+ AL  SA   +TS RLK    Q
Sbjct  1     MAPLNSLEKEYPLIDANFQTFCASHAIYSVEDFLLHDLDALFASASNPSTSHRLK----Q  56

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ IDALH P +N L
Sbjct  57    LLSIIDALHPPLINGL  72



>ref|XP_008222815.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Prunus mume]
Length=319

 Score =   243 bits (620),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 159/208 (76%), Gaps = 4/208 (2%)
 Frame = -1

Query  994  ELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEVVSQMSDNSTSKA-K  821
            ELVGPSS GKTQVC + ASNVA +  G VV+LDT NSFSP+R+A+ V  ++  +  +A K
Sbjct  112  ELVGPSSCGKTQVCLLAASNVATKHMGNVVYLDTGNSFSPQRIAQFVGHIAGRAFDEAGK  171

Query  820  KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SGCRARMLIIDSISSLITPILGG  647
            +  + +M+ IVC+SVFDIFTMF+V+H L     SQ   G + R+LI+DSISSLITPILG 
Sbjct  172  RIFQSIMNGIVCHSVFDIFTMFNVLHRLVINFPSQLQKGGQVRLLIVDSISSLITPILGN  231

Query  646  SGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGESWKSIPHIRLLLS  467
            SG+ GRALM SAG++LK+LA+EHN+ VLVTNH V GE G+ KPALG++WKSIPH+RLLLS
Sbjct  232  SGSQGRALMISAGYMLKKLAHEHNVAVLVTNHTVGGERGIPKPALGQTWKSIPHVRLLLS  291

Query  466  RDSARHISSISVLKHPNMATGDRVEFQI  383
             D   ++ SISVL+HP+M +G   +F I
Sbjct  292  GDHGNNVRSISVLRHPSMDSGKAAKFSI  319


 Score =   110 bits (274),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLK-QGIN  1087
             MAPLK+LE  YPI+D NFQ FCASHGIFSVEDFL+HD++ L   AEQ  TS +LK QG+ 
Sbjct  1     MAPLKALEAEYPILDPNFQAFCASHGIFSVEDFLIHDLYELAAFAEQQPTSEKLKQQGVT  60

Query  1086  QVLASIDALHQPWLNAL  1036
             Q+L+ ID  HQPWLN +
Sbjct  61    QILSIIDTQHQPWLNGM  77



>ref|XP_008448361.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Cucumis 
melo]
Length=322

 Score =   242 bits (618),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 164/223 (74%), Gaps = 7/223 (3%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L GGLR+G L E+VGPSSSGKTQVC   ASNVA++ +  V ++DT NSFSP+R++ 
Sbjct  97    VDVLLGGGLREGQLTEIVGPSSSGKTQVCLRAASNVAKNYNAEVFYVDTGNSFSPQRISG  156

Query  862   VVSQMSDNSTSKAKKS-LEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC----RAR  698
              V+     +   +++S L+ VMS+I C+SVFDIF +FDV+H L+  +RSQ+ C    R +
Sbjct  157   FVNWKPGTALDWSEQSMLQQVMSSISCHSVFDIFALFDVLHRLEFNLRSQT-CKGDRRVQ  215

Query  697   MLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKP  518
              LIIDSISSLITPILGGS + G ALM SAG +LK++A+EHN+ VLVTNH V G+ G  KP
Sbjct  216   FLIIDSISSLITPILGGSSSQGHALMISAGTLLKKIAHEHNIAVLVTNHTVGGDRGTSKP  275

Query  517   ALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEF  389
             ALGESWKS+PH+RL LSRD+  ++   S+LKH +MA+G    F
Sbjct  276   ALGESWKSVPHVRLQLSRDAGSNVYQASILKHSSMASGTAARF  318


 Score =   103 bits (257),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK LE+ YP IDSNF  FCASHGIF+VEDFL+HD++ L   AEQ   S +LKQGI Q
Sbjct  1     MAPLKFLEELYPFIDSNFLTFCASHGIFTVEDFLIHDLYVLAAFAEQQPASEKLKQGITQ  60

Query  1083  VLASIDAL-HQPWLNAL  1036
             +L+ ID    QPWLN L
Sbjct  61    ILSIIDVTERQPWLNGL  77



>ref|XP_010651069.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Vitis vinifera]
Length=319

 Score =   276 bits (706),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 175/233 (75%), Gaps = 5/233 (2%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCN  890
             +  ST  + ID  L+GGL  GHL ELVGPSS+GKTQ+C  +AS VA R  G VVF+DT N
Sbjct  87    QVLSTGCEGIDMLLHGGLCVGHLTELVGPSSAGKTQICLKVASGVATRYMGGVVFIDTGN  146

Query  889   SFSPKRVAEVVSQMSDNSTSKAKKS-LEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-  716
             SFSP R+A  ++Q+ D    + K++ LE VMS I+C+SVFDIF M DVVH L+ ++RSQ 
Sbjct  147   SFSPLRIAHFINQIPDTIFKEVKQNILEKVMSQILCHSVFDIFAMLDVVHQLEYSLRSQV  206

Query  715   --SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA  542
                  + R+LI+DSISSLITPILGGSG+HGRALM SAGF+LK+LA+EHNL V+VTNHMV 
Sbjct  207   QTGADQVRLLIVDSISSLITPILGGSGSHGRALMISAGFLLKKLAHEHNLAVVVTNHMVG  266

Query  541   GEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             GE G+LKPALGESWKSIPH+RLLLSRD    I  +S+LKH  MA+G    F I
Sbjct  267   GEGGILKPALGESWKSIPHVRLLLSRDPGSSICHMSILKHSYMASGRAARFMI  319


 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             M  LKSLE  YPIIDS+FQ FCASHGIFSVED L+HD++ LV  AEQ +TS RLKQGI Q
Sbjct  1     MGSLKSLECEYPIIDSDFQNFCASHGIFSVEDILIHDLYMLVAFAEQQSTSERLKQGITQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ ID  HQPWLN +
Sbjct  61    ILSIIDGQHQPWLNGM  76



>gb|KGN47353.1| hypothetical protein Csa_6G302700 [Cucumis sativus]
Length=322

 Score =   240 bits (613),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 165/225 (73%), Gaps = 7/225 (3%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L GGLR+G L E+VGPSSSGKTQVC   ASNVA++    V ++DT NSFSP+R++ 
Sbjct  97    VDVLLGGGLREGQLTEIVGPSSSGKTQVCLRAASNVAKNYKAEVFYMDTGNSFSPQRISG  156

Query  862   VVSQMSDNSTSKAKKS-LEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC----RAR  698
              V+     +   +++S L+ VM++I C+SVF+IF +FDV+H L+  +RSQ+ C    R +
Sbjct  157   FVNWKPGTALDWSEQSMLQRVMTSISCHSVFNIFALFDVLHQLEFNLRSQT-CKGDRRVQ  215

Query  697   MLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKP  518
             +LIIDSISSLITPILGGS + G ALM SAG +LK++A+EHN+ VLVTNH V G+ G  KP
Sbjct  216   LLIIDSISSLITPILGGSSSQGHALMISAGTLLKKIAHEHNIAVLVTNHTVGGDRGTSKP  275

Query  517   ALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             ALGESWKS+PH+RL LSRD+  ++   S+LKH +MA+G    F I
Sbjct  276   ALGESWKSVPHVRLQLSRDAGSNVCQASILKHSSMASGMTARFVI  320


 Score =   100 bits (250),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSLE+  P IDSNF  FCASHGIF+VEDFL+ D++ L   AEQ   S +LKQGI Q
Sbjct  1     MAPLKSLEELCPFIDSNFLTFCASHGIFTVEDFLIRDLYVLAAFAEQQPASEKLKQGITQ  60

Query  1083  VLASIDAL-HQPWLNAL  1036
             +L+ IDA   QPW+N L
Sbjct  61    ILSIIDATERQPWVNGL  77



>ref|XP_004148219.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Cucumis sativus]
 ref|XP_004166484.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Cucumis sativus]
Length=314

 Score =   237 bits (605),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 161/224 (72%), Gaps = 13/224 (6%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L GGLR+G L E+VGPSSSGKTQVC   ASNVA++    V ++DT NSFSP+R++ 
Sbjct  97    VDVLLGGGLREGQLTEIVGPSSSGKTQVCLRAASNVAKNYKAEVFYMDTGNSFSPQRISG  156

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC----RARM  695
              V        +  +  L+ VM++I C+SVF+IF +FDV+H L+  +RSQ+ C    R ++
Sbjct  157   FV-------CTSEQSMLQRVMTSISCHSVFNIFALFDVLHQLEFNLRSQT-CKGDRRVQL  208

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPA  515
             LIIDSISSLITPILGGS + G ALM SAG +LK++A+EHN+ VLVTNH V G+ G  KPA
Sbjct  209   LIIDSISSLITPILGGSSSQGHALMISAGTLLKKIAHEHNIAVLVTNHTVGGDRGTSKPA  268

Query  514   LGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             LGESWKS+PH+RL LSRD+  ++   S+LKH +MA+G    F I
Sbjct  269   LGESWKSVPHVRLQLSRDAGSNVCQASILKHSSMASGMTARFVI  312


 Score =   101 bits (251),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSLE+  P IDSNF  FCASHGIF+VEDFL+ D++ L   AEQ   S +LKQGI Q
Sbjct  1     MAPLKSLEELCPFIDSNFLTFCASHGIFTVEDFLIRDLYVLAAFAEQQPASEKLKQGITQ  60

Query  1083  VLASIDAL-HQPWLNAL  1036
             +L+ IDA   QPW+N L
Sbjct  61    ILSIIDATERQPWVNGL  77



>ref|XP_007207819.1| hypothetical protein PRUPE_ppa023822mg [Prunus persica]
 gb|EMJ09018.1| hypothetical protein PRUPE_ppa023822mg [Prunus persica]
Length=312

 Score =   220 bits (561),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 151/207 (73%), Gaps = 8/207 (4%)
 Frame = -1

Query  994  ELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEVVSQMSDNSTSKAKK  818
            E+VGPSS GKTQVC + ASNVA +  G VV+LDT NSFSP+R+A+ V  ++  +  +   
Sbjct  111  EIVGPSSCGKTQVCLLAASNVATKQMGNVVYLDTGNSFSPQRIAQFVGHIAGCAFDEVIP  170

Query  817  SLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SGCRARMLIIDSISSLITPILGGS  644
            S+  +M++IVC+SVFDIFTMF+V+H L     SQ   G + R+LI+DSISSLITPILG S
Sbjct  171  SVLEIMNSIVCHSVFDIFTMFNVLHRLVINFPSQLQKGGQVRLLIVDSISSLITPILGNS  230

Query  643  GAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGESWKSIPHIRLLLSR  464
            G+ GRALM SAG++LK+LA+EHN+ VL       G+     PALG++WKSIPH+RLLLS 
Sbjct  231  GSQGRALMISAGYMLKKLAHEHNVAVLWV-----GKEVFQNPALGQTWKSIPHVRLLLSG  285

Query  463  DSARHISSISVLKHPNMATGDRVEFQI  383
            D   ++ SISVL+HP+MA+G   +F I
Sbjct  286  DHGNNVRSISVLRHPSMASGKAAKFSI  312


 Score =   116 bits (290),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK+LE  YPI+D NFQ FCASHGIFSVEDFL+HD++ L   AEQ  TS +LKQGI Q
Sbjct  1     MAPLKALEAEYPILDPNFQAFCASHGIFSVEDFLIHDLYELAAFAEQQPTSEKLKQGITQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL+ ID  HQPWLN L
Sbjct  61    VLSIIDTQHQPWLNGL  76



>ref|XP_010112923.1| DNA repair protein RAD51-4-like protein [Morus notabilis]
 gb|EXC35072.1| DNA repair protein RAD51-4-like protein [Morus notabilis]
Length=359

 Score =   240 bits (613),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 151/196 (77%), Gaps = 9/196 (5%)
 Frame = -1

Query  994  ELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEVVSQMSDNSTSKAKK  818
            ELVGPSSSGKTQVC   ASNVA +  GRVV+LDT NSFSP+R+A+ V   + N       
Sbjct  112  ELVGPSSSGKTQVCLQAASNVAEKHMGRVVYLDTSNSFSPQRIADFVDLATHNF------  165

Query  817  SLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCR-ARMLIIDSISSLITPILGGSG  641
             L++VM NI+C+SVFDIFTMFD++H L+  +RSQ+G R  R+LI+DSISSLITPILGGSG
Sbjct  166  -LQNVMKNILCHSVFDIFTMFDILHQLELDLRSQNGPRRVRLLIVDSISSLITPILGGSG  224

Query  640  AHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGESWKSIPHIRLLLSRD  461
              G +LM SAG +LK+LA++HNL VLVTNH V GE G  KPALGE WKSIPH+RL+LSRD
Sbjct  225  LQGHSLMVSAGCLLKKLAHQHNLVVLVTNHTVGGEGGAPKPALGEYWKSIPHVRLMLSRD  284

Query  460  SARHISSISVLKHPNM  413
               +  SIS+LKH +M
Sbjct  285  RGNNTCSISILKHSSM  300


 Score = 91.7 bits (226),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSLEQ   II+S+F  FCASHGI +VEDFLLHD++ L   AEQ      LK+GI +
Sbjct  1     MAPLKSLEQYPRIINSHFLAFCASHGILTVEDFLLHDIYELAALAEQQPDPEGLKEGIEE  60

Query  1083  VLASIDA-LHQPWLNAL  1036
             +L+ +D  LHQPW+N +
Sbjct  61    LLSMVDGELHQPWMNGM  77



>ref|XP_008448360.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Cucumis 
melo]
Length=349

 Score =   241 bits (616),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 164/223 (74%), Gaps = 7/223 (3%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L GGLR+G L E+VGPSSSGKTQVC   ASNVA++ +  V ++DT NSFSP+R++ 
Sbjct  124   VDVLLGGGLREGQLTEIVGPSSSGKTQVCLRAASNVAKNYNAEVFYVDTGNSFSPQRISG  183

Query  862   VVSQMSDNSTSKAKKS-LEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC----RAR  698
              V+     +   +++S L+ VMS+I C+SVFDIF +FDV+H L+  +RSQ+ C    R +
Sbjct  184   FVNWKPGTALDWSEQSMLQQVMSSISCHSVFDIFALFDVLHRLEFNLRSQT-CKGDRRVQ  242

Query  697   MLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKP  518
              LIIDSISSLITPILGGS + G ALM SAG +LK++A+EHN+ VLVTNH V G+ G  KP
Sbjct  243   FLIIDSISSLITPILGGSSSQGHALMISAGTLLKKIAHEHNIAVLVTNHTVGGDRGTSKP  302

Query  517   ALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEF  389
             ALGESWKS+PH+RL LSRD+  ++   S+LKH +MA+G    F
Sbjct  303   ALGESWKSVPHVRLQLSRDAGSNVYQASILKHSSMASGTAARF  345


 Score = 89.4 bits (220),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 57/104 (55%), Gaps = 28/104 (27%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLK-----  1099
             MAPLK LE+ YP IDSNF  FCASHGIF+VEDFL+HD++ L   AEQ   S +LK     
Sbjct  1     MAPLKFLEELYPFIDSNFLTFCASHGIFTVEDFLIHDLYVLAAFAEQQPASEKLKQVKPS  60

Query  1098  ----------------------QGINQVLASIDAL-HQPWLNAL  1036
                                   QGI Q+L+ ID    QPWLN L
Sbjct  61    LHFPFSCLSFTVLNFSISCMCTQGITQILSIIDVTERQPWLNGL  104



>ref|XP_011089831.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X3 [Sesamum 
indicum]
Length=253

 Score =   263 bits (672),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 178/229 (78%), Gaps = 1/229 (0%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCN  890
             R  ST  + ID  L GGLR GH+ EL GPSSSGKTQVC  +AS+VAR  SG V++ D+ N
Sbjct  24    RILSTGCERIDLLLQGGLRVGHVTELAGPSSSGKTQVCLKVASHVARKYSGTVMYFDSGN  83

Query  889   SFSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSG  710
             SFSPKR+ + ++Q SD + ++  + ++ VMS+IVCYS+FDIFT+ D++H L + ++S+ G
Sbjct  84    SFSPKRIVQFLTQESDPANTEVDEIVQRVMSSIVCYSIFDIFTLLDMLHQLMNNLKSEIG  143

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
             C  RMLIIDS+SSLI P+LGG GAHG ALM +AGF+LK+LA+EHNL ++VTNHMVAGEAG
Sbjct  144   CNVRMLIIDSLSSLIAPVLGGGGAHGHALMVTAGFLLKELAHEHNLSIVVTNHMVAGEAG  203

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
               KPALG+SWKSIPH+RLLL R  A + S IS+LKHP +ATG  +EF I
Sbjct  204   SSKPALGDSWKSIPHVRLLLHRYRATNDSCISILKHPYLATGKTMEFMI  252



>ref|XP_010922424.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Elaeis 
guineensis]
Length=269

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 170/224 (76%), Gaps = 5/224 (2%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAE  863
             ID  L GGL +G L E+VGPSSSGKTQVC   A+ VA +  G V+F+DTCNSFSPKR+A 
Sbjct  33    IDVLLGGGLCEGQLTEMVGPSSSGKTQVCLYSAALVADKHFGVVMFVDTCNSFSPKRIAC  92

Query  862   VVSQMSDNSTSKAK-KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SG-CRARM  695
             +V Q+S + + +AK + L+ VMSNI C+SVFDIF + DV+H L+  ++ Q  SG  +  +
Sbjct  93    IVDQLSSSFSGEAKERRLKRVMSNIFCHSVFDIFALLDVLHQLEFKLKQQVKSGDTKICL  152

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPA  515
             LIIDSISSL+TP+LGG G+ GR LM SAG ILK+LANE+N+ VLVTNHMV GE G+LKPA
Sbjct  153   LIIDSISSLLTPVLGGKGSEGRLLMVSAGIILKKLANEYNISVLVTNHMVGGEGGILKPA  212

Query  514   LGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             LGESWKSIPH+RL L+RD   +I ++S+LKH  MATG   +F I
Sbjct  213   LGESWKSIPHVRLQLTRDQGSNICNVSILKHTFMATGRTAKFVI  256



>ref|XP_010033171.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Eucalyptus 
grandis]
Length=322

 Score =   224 bits (572),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 172/231 (74%), Gaps = 6/231 (3%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  + +D  L GGLR G + EL GPSSSGKTQ C + AS VA +  G V+++DT NSFS
Sbjct  90    STGCEGMDFLLRGGLRRGQVTELAGPSSSGKTQFCLLTASTVAYKHMGGVIYIDTGNSFS  149

Query  880   PKRVAEVVSQMSDNSTSKAK-KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCR  704
              KR+A  ++Q+S  ++ + + + L+ VM++I+C+SV+DIF+MFDV+H L+S ++ Q  CR
Sbjct  150   AKRIARFLNQISCPASEEMQPRVLQEVMNSILCHSVYDIFSMFDVLHCLESKLKYQVMCR  209

Query  703   A----RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGE  536
                  R++IIDSISSLITPILG SG+ GRALM SA  +LK+LA+E+NL VLVTNH V G+
Sbjct  210   GDNDERLIIIDSISSLITPILGSSGSQGRALMVSAMSLLKKLAHEYNLAVLVTNHTVGGD  269

Query  535   AGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
              G+ KPALGESWK++PH+RLLLSRD   +   +S+LKHP++A+G   +F I
Sbjct  270   GGIPKPALGESWKTLPHVRLLLSRDCGSNTYQVSLLKHPSIASGKAAKFII  320


 Score = 98.6 bits (244),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MA LK LE  +PI+D +FQ FCA  GIF+V+DFL+ D+ +LV  AEQ  +S R  Q INQ
Sbjct  1     MASLKRLETEFPILDPDFQSFCALRGIFTVQDFLIRDLQSLVADAEQQPSSERFMQAINQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL  ID LHQPWLN +
Sbjct  61    VLYVIDGLHQPWLNGV  76



>ref|XP_010521813.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Tarenaya hassleriana]
Length=316

 Score =   235 bits (599),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 156/218 (72%), Gaps = 12/218 (6%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAE  863
             +D  L GG R+G L ELVGPSSSGKTQVC   A++VA    GRV+++DT NSFS +RVA+
Sbjct  95    VDSLLRGGFREGQLTELVGPSSSGKTQVCLQAAASVAGMHMGRVLYIDTGNSFSARRVAQ  154

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ----SGCRARM  695
              +S  SD +  K       VMS I C  V+DIFTMFD +  L+ T RSQ    S  R R+
Sbjct  155   FISPCSDANVEK------EVMSRISCQPVYDIFTMFDELQRLEFTSRSQTNKESEYRLRL  208

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV-AGEAGLLKP  518
             L+IDSISSLITPILGG+G+ GRALM +AG++LK+LA+EHN+ VLVTNH V  GE G  KP
Sbjct  209   LVIDSISSLITPILGGNGSQGRALMVAAGYLLKKLAHEHNIAVLVTNHTVGGGEGGNAKP  268

Query  517   ALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATG  404
             ALG++WKSIPH+RL+LSRD      +++VLKH  M +G
Sbjct  269   ALGQTWKSIPHVRLMLSRDCGNCHFTVAVLKHTCMPSG  306


 Score = 88.2 bits (217),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK+LE+  P+ID++F+ FCASHGIF+VEDFLLHD++ L   AE+   + RLK+GI  
Sbjct  1     MAPLKNLERENPMIDADFRDFCASHGIFTVEDFLLHDLYRLAAFAERKKNADRLKEGITL  60

Query  1083  VLASIDALHQPWLNALMTFLM  1021
             +L+ I++  +P  N  M  LM
Sbjct  61    MLSIIESECRPLSNG-MEMLM  80



>gb|KCW52729.1| hypothetical protein EUGRSUZ_J02088 [Eucalyptus grandis]
Length=366

 Score =   222 bits (565),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 172/231 (74%), Gaps = 7/231 (3%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  + +D  L GGLR G + EL GPSSSGKTQ C + AS VA +  G V+++DT NSFS
Sbjct  135   STGCEGMDFLLRGGLRRGQVTELAGPSSSGKTQFCLLTASTVAYKHMGGVIYIDTGNSFS  194

Query  880   PKRVAEVVSQMSDNSTSKAK-KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCR  704
              KR+A  ++Q+S  ++ + + + L+ VM++I+C+SV+DIF+MFDV+H L+S ++ Q  CR
Sbjct  195   AKRIARFLNQISCPASEEMQPRVLQEVMNSILCHSVYDIFSMFDVLHCLESKLKYQM-CR  253

Query  703   A----RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGE  536
                  R++IIDSISSLITPILG SG+ GRALM SA  +LK+LA+E+NL VLVTNH V G+
Sbjct  254   GDNDERLIIIDSISSLITPILGSSGSQGRALMVSAMSLLKKLAHEYNLAVLVTNHTVGGD  313

Query  535   AGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
              G+ KPALGESWK++PH+RLLLSRD   +   +S+LKHP++A+G   +F I
Sbjct  314   GGIPKPALGESWKTLPHVRLLLSRDCGSNTYQVSLLKHPSIASGKAAKFII  364


 Score = 99.4 bits (246),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -2

Query  1269  RAMAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGI  1090
             + MA LK LE  +PI+D +FQ FCA  GIF+V+DFL+ D+ +LV  AEQ  +S R  Q I
Sbjct  44    QGMASLKRLETEFPILDPDFQSFCALRGIFTVQDFLIRDLQSLVADAEQQPSSERFMQAI  103

Query  1089  NQVLASIDALHQPWLNAL  1036
             NQVL  ID LHQPWLN +
Sbjct  104   NQVLYVIDGLHQPWLNGV  121



>ref|XP_010922422.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010922423.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Elaeis 
guineensis]
Length=322

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 170/224 (76%), Gaps = 5/224 (2%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAE  863
             ID  L GGL +G L E+VGPSSSGKTQVC   A+ VA +  G V+F+DTCNSFSPKR+A 
Sbjct  86    IDVLLGGGLCEGQLTEMVGPSSSGKTQVCLYSAALVADKHFGVVMFVDTCNSFSPKRIAC  145

Query  862   VVSQMSDNSTSKAK-KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SG-CRARM  695
             +V Q+S + + +AK + L+ VMSNI C+SVFDIF + DV+H L+  ++ Q  SG  +  +
Sbjct  146   IVDQLSSSFSGEAKERRLKRVMSNIFCHSVFDIFALLDVLHQLEFKLKQQVKSGDTKICL  205

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPA  515
             LIIDSISSL+TP+LGG G+ GR LM SAG ILK+LANE+N+ VLVTNHMV GE G+LKPA
Sbjct  206   LIIDSISSLLTPVLGGKGSEGRLLMVSAGIILKKLANEYNISVLVTNHMVGGEGGILKPA  265

Query  514   LGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             LGESWKSIPH+RL L+RD   +I ++S+LKH  MATG   +F I
Sbjct  266   LGESWKSIPHVRLQLTRDQGSNICNVSILKHTFMATGRTAKFVI  309



>ref|XP_010033172.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Eucalyptus 
grandis]
Length=321

 Score =   221 bits (564),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 172/231 (74%), Gaps = 7/231 (3%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  + +D  L GGLR G + EL GPSSSGKTQ C + AS VA +  G V+++DT NSFS
Sbjct  90    STGCEGMDFLLRGGLRRGQVTELAGPSSSGKTQFCLLTASTVAYKHMGGVIYIDTGNSFS  149

Query  880   PKRVAEVVSQMSDNSTSKAK-KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCR  704
              KR+A  ++Q+S  ++ + + + L+ VM++I+C+SV+DIF+MFDV+H L+S ++ Q  CR
Sbjct  150   AKRIARFLNQISCPASEEMQPRVLQEVMNSILCHSVYDIFSMFDVLHCLESKLKYQM-CR  208

Query  703   A----RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGE  536
                  R++IIDSISSLITPILG SG+ GRALM SA  +LK+LA+E+NL VLVTNH V G+
Sbjct  209   GDNDERLIIIDSISSLITPILGSSGSQGRALMVSAMSLLKKLAHEYNLAVLVTNHTVGGD  268

Query  535   AGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
              G+ KPALGESWK++PH+RLLLSRD   +   +S+LKHP++A+G   +F I
Sbjct  269   GGIPKPALGESWKTLPHVRLLLSRDCGSNTYQVSLLKHPSIASGKAAKFII  319


 Score = 98.6 bits (244),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MA LK LE  +PI+D +FQ FCA  GIF+V+DFL+ D+ +LV  AEQ  +S R  Q INQ
Sbjct  1     MASLKRLETEFPILDPDFQSFCALRGIFTVQDFLIRDLQSLVADAEQQPSSERFMQAINQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL  ID LHQPWLN +
Sbjct  61    VLYVIDGLHQPWLNGV  76



>ref|XP_006844260.1| hypothetical protein AMTR_s00145p00033710 [Amborella trichopoda]
 gb|ERN05935.1| hypothetical protein AMTR_s00145p00033710 [Amborella trichopoda]
Length=324

 Score =   226 bits (575),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 161/228 (71%), Gaps = 10/228 (4%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCNSFSPKRVAE  863
             ID  L GGL +G+L EL GPSSSGKTQ C   A++VA +    V++LDT NSFS KR++ 
Sbjct  96    IDTLLCGGLCEGNLTELAGPSSSGKTQFCLHAAAHVAYTYMCSVLYLDTSNSFSSKRISY  155

Query  862   VVSQM--SDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ------SGC  707
              V+++  S N   K + SLE +MS+I+ +SVFDIF+MF+ +H L+ ++ SQ         
Sbjct  156   RVNRLLASPNKGEKGR-SLEGIMSSILSHSVFDIFSMFETLHQLELSLSSQLFQAEIQNS  214

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGL  527
             + R+LI+DSISSLITPILGG G  G +LM + GFILK+LA ++NL VLVTNH V GE G 
Sbjct  215   KLRLLIVDSISSLITPILGGKGPQGHSLMLNVGFILKKLAIDYNLAVLVTNHTVVGEGGN  274

Query  526   LKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
              KPALGESWKS+PH RLLLSRD   +I ++S+LKH +MA G    F++
Sbjct  275   SKPALGESWKSVPHTRLLLSRDQMSNICNMSILKHTSMACGQTASFRL  322


 Score = 93.6 bits (231),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             M PLKSL+ ++P IDSN   FCASHGIFSVEDFL+HD++ LV  AE+  +S  LK+GI Q
Sbjct  1     MPPLKSLQHQFPSIDSNLLHFCASHGIFSVEDFLVHDLYMLVALAERQTSSKGLKEGIAQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL  ++  H PW+N +
Sbjct  61    VLTFLNNQHFPWMNGV  76



>ref|XP_010253340.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Nelumbo 
nucifera]
Length=292

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 166/224 (74%), Gaps = 5/224 (2%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAE  863
             ID  L GGLR GH+ ELVGPS SGKTQVC   ASNVA +  G V+FLDTCNSFSP+R+A 
Sbjct  67    IDMLLQGGLRVGHVTELVGPSPSGKTQVCLQAASNVAVKFMGVVMFLDTCNSFSPRRMAC  126

Query  862   VVSQMSDNSTSK-AKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARM  695
              ++Q  +    +  +K L+ VMS+I+C SVFDIF++ DV+  L+  ++ Q     C+ R+
Sbjct  127   FINQHFNTPVEEVTQKGLKRVMSSILCQSVFDIFSLLDVLRQLELKLQFQVNTGDCKLRL  186

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPA  515
             LIIDSISSLITPILGG+GAHG +LM   GF+LK+LA+E+N+ VLVTNHMV GE G+LKPA
Sbjct  187   LIIDSISSLITPILGGNGAHGHSLMIFTGFLLKKLAHEYNISVLVTNHMVCGEGGILKPA  246

Query  514   LGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             LGESWKSIPH+RLLLS D   +  +IS+LKHP M +G    F +
Sbjct  247   LGESWKSIPHVRLLLSHDRRSNSYNISILKHPVMVSGRAASFTV  290


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  1176  VEDFLLHDMHALVVSAEQHNTSARLKQGINQVLASIDALHQPWLNAL  1036
             +EDFL+HD+++LV SAEQ ++S  L++GI+QV++ I + HQPW N +
Sbjct  1     MEDFLVHDLYSLVASAEQQSSSEELREGISQVISIIGSQHQPWSNGV  47



>gb|KFK32439.1| hypothetical protein AALP_AA6G241700 [Arabis alpina]
Length=319

 Score =   234 bits (596),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 166/235 (71%), Gaps = 13/235 (6%)
 Frame = -1

Query  1063  TASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNS  887
             T ST  K  D  L  GLR+G L ELVGPSSSGKTQ C   A++VA +  G V+++DT NS
Sbjct  88    TLSTGDKGADSLLQNGLREGQLTELVGPSSSGKTQFCMQAAASVAEKHVGGVLYIDTGNS  147

Query  886   FSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---  716
             FS +R+A+ +   SD +       ++ VMS I C++VFDI+TMFD +  L+ T++SQ   
Sbjct  148   FSARRIAQYICSSSDAAL------VQKVMSRISCHTVFDIYTMFDTLQCLEVTLKSQGQM  201

Query  715   --SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV-  545
               +  R R+L++DSISSLITPILGGSG+ GRALM + G++LK+LA+EHN+ +LVTNH V 
Sbjct  202   NVNEYRLRLLVVDSISSLITPILGGSGSQGRALMVAIGYLLKKLAHEHNIAILVTNHTVA  261

Query  544   AGEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQIL  380
             AGE G  KPALGE+WKSIPH+RL+LSR+   +  +IS+LKH +M +G  V+   L
Sbjct  262   AGEDGKTKPALGETWKSIPHVRLMLSREHNNNNCTISILKHTSMPSGQTVKTMTL  316


 Score = 84.3 bits (207),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK LE+  PIID +F+ FC+SHGI +VEDFLLHD++ L   AE+   + RLK+GI  
Sbjct  1     MAPLKHLEKENPIIDVSFRDFCSSHGILTVEDFLLHDLYELAAFAERQKNADRLKEGITL  60

Query  1083  VLASIDALHQPWLNAL  1036
             +++ I+   +P LN +
Sbjct  61    LISLIELQCRPLLNGM  76



>ref|NP_172254.2| DNA repair protein RAD51 homolog 4 [Arabidopsis thaliana]
 sp|Q9LQQ2.2|RA51D_ARATH RecName: Full=DNA repair protein RAD51 homolog 4; Short=AtRAD51D 
[Arabidopsis thaliana]
 emb|CAD70703.1| putative DNA recombination protein [Arabidopsis thaliana]
 dbj|BAD89165.1| AtRAD51D [Arabidopsis thaliana]
 gb|ABE02570.1| RAD51D splice variant a [Arabidopsis thaliana]
 gb|ABE02658.1| RAD51D splice variant a [Arabidopsis thaliana]
 gb|AEE28173.1| DNA repair protein RAD51-like 4 [Arabidopsis thaliana]
Length=322

 Score =   230 bits (587),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 160/226 (71%), Gaps = 12/226 (5%)
 Frame = -1

Query  1063  TASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCNS  887
             T ST  K  D  L GG R+G L ELVGPSSSGKTQ C   A++VA +  GRV++LDT NS
Sbjct  88    TLSTGDKETDSLLQGGFREGQLTELVGPSSSGKTQFCMQAAASVAENHLGRVLYLDTGNS  147

Query  886   FSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---  716
             FS +R+A+ +   SD +        + VMS I+C++V+DI+T+FD +  L+ T+R Q   
Sbjct  148   FSARRIAQFICSSSDATLG------QKVMSRILCHTVYDIYTLFDTLQDLEITLRLQMNV  201

Query  715   SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV--A  542
             +  R R+L++DSISSLITPILGGSG+ GRALM + G++LK+LA+EH++ +LVTNH V   
Sbjct  202   NESRLRLLVVDSISSLITPILGGSGSQGRALMVAIGYLLKKLAHEHSIAILVTNHTVGAG  261

Query  541   GEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATG  404
             GE G  KPALGE+WKSIPH+RL LSRD      +IS+LKH ++ +G
Sbjct  262   GEGGKTKPALGETWKSIPHVRLSLSRDHKNSNCTISILKHTSLPSG  307


 Score = 85.5 bits (210),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK LE+  PIID+ FQ FCASHGI ++EDFLLHD++ L   +++   + RLK+GI  
Sbjct  1     MAPLKHLEKENPIIDACFQDFCASHGILTIEDFLLHDLYELTAFSQRQTNADRLKEGITL  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ I+   +P +N L
Sbjct  61    ILSLIERQCRPLVNGL  76



>ref|XP_009110922.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Brassica rapa]
 emb|CDY15629.1| BnaA08g29130D [Brassica napus]
Length=324

 Score =   233 bits (595),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 159/221 (72%), Gaps = 12/221 (5%)
 Frame = -1

Query  1036  DDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEV  860
             D  L GGLR+G L ELVGPSSSGKTQ C   +++VA +  GRV ++DT NSF  +R+A+ 
Sbjct  97    DSLLQGGLREGQLTELVGPSSSGKTQFCMQASASVAEKQDGRVFYIDTGNSFCARRIAQF  156

Query  859   VSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-----SGCRARM  695
             +   SD +  + +     V+S I C++V+DI+TMFD +  L+  +RSQ     +  R R+
Sbjct  157   ICGSSDAAALRKR-----VLSRISCHTVYDIYTMFDTLQGLEVALRSQVQMNVNEYRLRL  211

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV-AGEAGLLKP  518
             L++DSISSLITPILGGSG+ GRALM + G++LK+LA+EHN+ VLVTNH V AGE+G  KP
Sbjct  212   LVVDSISSLITPILGGSGSQGRALMVALGYLLKKLAHEHNIAVLVTNHTVGAGESGKTKP  271

Query  517   ALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRV  395
             ALGE+WKSIPH+RL+LSRD      +IS+LKH +M +G  V
Sbjct  272   ALGETWKSIPHVRLMLSRDHRNSNCTISILKHTSMPSGKTV  312


 Score = 82.8 bits (203),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK LE    IID+ F+ FCASHGI +VEDFLLHD++ L   AE+   + RLK+GI  
Sbjct  1     MAPLKHLEMENSIIDACFRDFCASHGILTVEDFLLHDLYELAAFAEREANADRLKEGITV  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ I+   +P LN +
Sbjct  61    MLSLIEVKCRPLLNGM  76



>ref|XP_011089829.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Sesamum 
indicum]
Length=255

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 172/221 (78%), Gaps = 1/221 (0%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCN  890
             R  ST  + ID  L GGLR GH+ EL GPSSSGKTQVC  +AS+VAR  SG V++ D+ N
Sbjct  24    RILSTGCERIDLLLQGGLRVGHVTELAGPSSSGKTQVCLKVASHVARKYSGTVMYFDSGN  83

Query  889   SFSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSG  710
             SFSPKR+ + ++Q SD + ++  + ++ VMS+IVCYS+FDIFT+ D++H L + ++S+ G
Sbjct  84    SFSPKRIVQFLTQESDPANTEVDEIVQRVMSSIVCYSIFDIFTLLDMLHQLMNNLKSEIG  143

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
             C  RMLIIDS+SSLI P+LGG GAHG ALM +AGF+LK+LA+EHNL ++VTNHMVAGEAG
Sbjct  144   CNVRMLIIDSLSSLIAPVLGGGGAHGHALMVTAGFLLKELAHEHNLSIVVTNHMVAGEAG  203

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMAT  407
               KPALG+SWKSIPH+RLLL R  A + S IS+LKHP + +
Sbjct  204   SSKPALGDSWKSIPHVRLLLHRYRATNDSCISILKHPYLVS  244



>ref|XP_011089833.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X5 [Sesamum 
indicum]
Length=245

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 171/219 (78%), Gaps = 1/219 (0%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCN  890
             R  ST  + ID  L GGLR GH+ EL GPSSSGKTQVC  +AS+VAR  SG V++ D+ N
Sbjct  24    RILSTGCERIDLLLQGGLRVGHVTELAGPSSSGKTQVCLKVASHVARKYSGTVMYFDSGN  83

Query  889   SFSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSG  710
             SFSPKR+ + ++Q SD + ++  + ++ VMS+IVCYS+FDIFT+ D++H L + ++S+ G
Sbjct  84    SFSPKRIVQFLTQESDPANTEVDEIVQRVMSSIVCYSIFDIFTLLDMLHQLMNNLKSEIG  143

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
             C  RMLIIDS+SSLI P+LGG GAHG ALM +AGF+LK+LA+EHNL ++VTNHMVAGEAG
Sbjct  144   CNVRMLIIDSLSSLIAPVLGGGGAHGHALMVTAGFLLKELAHEHNLSIVVTNHMVAGEAG  203

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNM  413
               KPALG+SWKSIPH+RLLL R  A + S IS+LKHP +
Sbjct  204   SSKPALGDSWKSIPHVRLLLHRYRATNDSCISILKHPYL  242



>ref|XP_011089830.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Sesamum 
indicum]
Length=254

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 171/219 (78%), Gaps = 1/219 (0%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCN  890
             R  ST  + ID  L GGLR GH+ EL GPSSSGKTQVC  +AS+VAR  SG V++ D+ N
Sbjct  24    RILSTGCERIDLLLQGGLRVGHVTELAGPSSSGKTQVCLKVASHVARKYSGTVMYFDSGN  83

Query  889   SFSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSG  710
             SFSPKR+ + ++Q SD + ++  + ++ VMS+IVCYS+FDIFT+ D++H L + ++S+ G
Sbjct  84    SFSPKRIVQFLTQESDPANTEVDEIVQRVMSSIVCYSIFDIFTLLDMLHQLMNNLKSEIG  143

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
             C  RMLIIDS+SSLI P+LGG GAHG ALM +AGF+LK+LA+EHNL ++VTNHMVAGEAG
Sbjct  144   CNVRMLIIDSLSSLIAPVLGGGGAHGHALMVTAGFLLKELAHEHNLSIVVTNHMVAGEAG  203

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNM  413
               KPALG+SWKSIPH+RLLL R  A + S IS+LKHP +
Sbjct  204   SSKPALGDSWKSIPHVRLLLHRYRATNDSCISILKHPYL  242



>ref|XP_011089832.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X4 [Sesamum 
indicum]
Length=253

 Score =   250 bits (639),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 171/219 (78%), Gaps = 1/219 (0%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCN  890
             R  ST  + ID  L GGLR GH+ EL GPSSSGKTQVC  +AS+VAR  SG V++ D+ N
Sbjct  24    RILSTGCERIDLLLQGGLRVGHVTELAGPSSSGKTQVCLKVASHVARKYSGTVMYFDSGN  83

Query  889   SFSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSG  710
             SFSPKR+ + ++Q SD + ++  + ++ VMS+IVCYS+FDIFT+ D++H L + ++S+ G
Sbjct  84    SFSPKRIVQFLTQESDPANTEVDEIVQRVMSSIVCYSIFDIFTLLDMLHQLMNNLKSEIG  143

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
             C  RMLIIDS+SSLI P+LGG GAHG ALM +AGF+LK+LA+EHNL ++VTNHMVAGEAG
Sbjct  144   CNVRMLIIDSLSSLIAPVLGGGGAHGHALMVTAGFLLKELAHEHNLSIVVTNHMVAGEAG  203

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNM  413
               KPALG+SWKSIPH+RLLL R  A + S IS+LKHP +
Sbjct  204   SSKPALGDSWKSIPHVRLLLHRYRATNDSCISILKHPYL  242



>ref|XP_008788055.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Phoenix 
dactylifera]
Length=311

 Score =   252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 169/224 (75%), Gaps = 5/224 (2%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAE  863
             ID  L GGL +G L E+VG SSSGKTQVC   A++VA +  G V+FLDTCNSFSPKR+A 
Sbjct  86    IDVLLGGGLCEGQLTEIVGSSSSGKTQVCLYSAAHVADKHFGVVMFLDTCNSFSPKRIAC  145

Query  862   VVSQMSDNSTSKAK-KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SG-CRARM  695
             +V Q+S + + +AK + L+ +MSNI C+S+FDIF + DV+H L+  ++ Q  SG  +  +
Sbjct  146   MVDQLSSSFSGEAKERRLKRIMSNIFCHSIFDIFALLDVLHQLEFNLKHQVTSGHTKICL  205

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPA  515
             LIIDSISSL+TP+LGG G+ GR LM SAG ILK+LANEHN+ VLVTNHMV GE G+LKPA
Sbjct  206   LIIDSISSLLTPVLGGKGSEGRLLMVSAGIILKKLANEHNVSVLVTNHMVGGEGGILKPA  265

Query  514   LGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             LGESWKSIPH+RL L+ D   +I ++S+LKH  MA+G   +F I
Sbjct  266   LGESWKSIPHVRLQLTHDQGSNICNVSILKHTFMASGRTTKFVI  309



>ref|XP_010033173.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X3 [Eucalyptus 
grandis]
Length=318

 Score =   225 bits (573),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 172/231 (74%), Gaps = 6/231 (3%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  + +D  L GGLR G + EL GPSSSGKTQ C + AS VA +  G V+++DT NSFS
Sbjct  86    STGCEGMDFLLRGGLRRGQVTELAGPSSSGKTQFCLLTASTVAYKHMGGVIYIDTGNSFS  145

Query  880   PKRVAEVVSQMSDNSTSKAK-KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCR  704
              KR+A  ++Q+S  ++ + + + L+ VM++I+C+SV+DIF+MFDV+H L+S ++ Q  CR
Sbjct  146   AKRIARFLNQISCPASEEMQPRVLQEVMNSILCHSVYDIFSMFDVLHCLESKLKYQVMCR  205

Query  703   A----RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGE  536
                  R++IIDSISSLITPILG SG+ GRALM SA  +LK+LA+E+NL VLVTNH V G+
Sbjct  206   GDNDERLIIIDSISSLITPILGSSGSQGRALMVSAMSLLKKLAHEYNLAVLVTNHTVGGD  265

Query  535   AGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
              G+ KPALGESWK++PH+RLLLSRD   +   +S+LKHP++A+G   +F I
Sbjct  266   GGIPKPALGESWKTLPHVRLLLSRDCGSNTYQVSLLKHPSIASGKAAKFII  316


 Score = 87.0 bits (214),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 4/76 (5%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MA LK LE  +PI+D +FQ FCA  GIF+V+DFL+ D+ +LV  AEQ  +S R      Q
Sbjct  1     MASLKRLETEFPILDPDFQSFCALRGIFTVQDFLIRDLQSLVADAEQQPSSERFM----Q  56

Query  1083  VLASIDALHQPWLNAL  1036
             VL  ID LHQPWLN +
Sbjct  57    VLYVIDGLHQPWLNGV  72



>emb|CDY67670.1| BnaCnng55870D [Brassica napus]
Length=317

 Score =   225 bits (574),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 158/222 (71%), Gaps = 12/222 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAE  863
             ++  L GG  +G L ELVGPSSSGKTQ C   A++VA +  G V ++DT NSFS +R+A+
Sbjct  96    MNSLLQGGYGEGQLTELVGPSSSGKTQFCMRAAASVAEKQEGSVFYIDTGNSFSARRIAQ  155

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-----SGCRAR  698
              +   SD +  + +     V+S I C++V+DI+TMFD +  L+  +RSQ     +  R R
Sbjct  156   FICGGSDAAALRKR-----VLSRISCHTVYDIYTMFDTLQGLEVALRSQVQMNVNEYRLR  210

Query  697   MLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV-AGEAGLLK  521
             +L++DSISS ITPILGGSG+ GRALM + G++LK+LA+EHN+ VLVTNH V AGE+G  K
Sbjct  211   LLVVDSISSTITPILGGSGSQGRALMVALGYMLKKLAHEHNIAVLVTNHTVGAGESGKTK  270

Query  520   PALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRV  395
             PALGE+WKSIPH+RL+LSRD+     +IS+LKH +M +G  V
Sbjct  271   PALGETWKSIPHVRLMLSRDNRNSNCTISILKHTSMPSGQTV  312


 Score = 85.9 bits (211),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK LE    IID  F+ FCASHGI +VEDFLLHD++ L   AE+   + RLK+GI  
Sbjct  1     MAPLKHLEMENSIIDECFRDFCASHGILTVEDFLLHDLYELAAFAEREANADRLKEGITV  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ I+   +PWLN +
Sbjct  61    MLSLIELQCRPWLNGM  76



>ref|XP_009397501.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=321

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 166/229 (72%), Gaps = 5/229 (2%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCNSFSP  878
             T  K ID  L GGLR+G L E+VGPSSSGKTQVC   A  VA    G V+FLDTCNSFSP
Sbjct  91    TGCKGIDILLGGGLREGQLTEIVGPSSSGKTQVCLHSALGVADVHLGVVLFLDTCNSFSP  150

Query  877   KRVAEVVSQMSDNSTSKAKKS-LEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
              R+A +V+  SD    + K+  L+ +MS+I+C+S+FDIF + DV+H L+  ++ Q   SG
Sbjct  151   HRIAHMVNSQSDTLVKEGKEGRLKRIMSSILCHSLFDIFELLDVLHQLECKLKHQVKSSG  210

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
              R R+LI+DSISSLITPILGG  + GR +M + G +LK++ANE+NL VLVTNHMV GE G
Sbjct  211   NRIRLLIVDSISSLITPILGGKNSQGRLMMITTGILLKKIANEYNLSVLVTNHMVGGEGG  270

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
              LKPALGESWK+IPH+RL LSRD   ++ ++S+LKH  +A+G   +F I
Sbjct  271   SLKPALGESWKNIPHVRLSLSRDQGSNVCNVSILKHTIIASGRTAKFVI  319



>ref|XP_010457979.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Camelina 
sativa]
Length=320

 Score =   218 bits (555),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 155/226 (69%), Gaps = 15/226 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  K  D  L GG R+G + ELVGPSSSGKTQ C   A++VA +  G V++LDT NSFS
Sbjct  90    STGDKGTDSLLKGGFREGQVTELVGPSSSGKTQFCMQAAASVAEKHDGGVLYLDTGNSFS  149

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-----  716
              +R+A   S  SD S  +       VMS I C++V+DI+TM + +  L  T+RSQ     
Sbjct  150   ARRIAHFGSS-SDTSLGQK------VMSRISCHAVYDIYTMLETLQGLDITLRSQVQTNV  202

Query  715   SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV--A  542
             +  R R+L++DSISSLITPILGG+G+ GRALM + G++LK+LA+EH++ +LVTNH V   
Sbjct  203   NEHRLRLLVVDSISSLITPILGGNGSQGRALMVAVGYMLKKLAHEHSIAILVTNHTVGAG  262

Query  541   GEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATG  404
             GE G  KPALGE+WKSIPH RL+LSRD      +IS+LKH +M +G
Sbjct  263   GEGGKTKPALGETWKSIPHARLMLSRDHKNSNCTISILKHTSMPSG  308


 Score = 89.7 bits (221),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK LE+  PIID++F+ FCASHGI +VEDFLLHD+  L   A++   S RLK+GI  
Sbjct  1     MAPLKHLEKENPIIDASFRYFCASHGIVTVEDFLLHDLEGLAAFADRQTNSDRLKEGITV  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ ++    PWLN +
Sbjct  61    MLSLVERQCHPWLNGM  76



>ref|XP_010487958.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Camelina 
sativa]
Length=320

 Score =   220 bits (561),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 155/219 (71%), Gaps = 15/219 (7%)
 Frame = -1

Query  1036  DDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEV  860
             D  L GG R+G + ELVGPSSSGKTQ C   A++VA +  GRV++LDT NSFS +R+A+ 
Sbjct  97    DSLLKGGFREGLVTELVGPSSSGKTQFCMQAAASVAEKHDGRVLYLDTGNSFSARRIAQF  156

Query  859   VSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-----SGCRARM  695
                 S + TS  +K     MS I C++V+DI+T+ + +  L  T+RSQ     S  R R+
Sbjct  157   ---GSSSDTSLGQK----FMSRISCHTVYDIYTLLETLQGLDVTLRSQVQTNVSEHRLRL  209

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV--AGEAGLLK  521
             L++DSISSLITPILGGSG+ GRALM + G++LK+LA+EH++ +LVTNH V   GE G  K
Sbjct  210   LVVDSISSLITPILGGSGSQGRALMVAVGYMLKKLAHEHSIAILVTNHTVGAGGEGGKTK  269

Query  520   PALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATG  404
             PALGE+WKSIPH+RL+LSRD      +IS+LKH +M +G
Sbjct  270   PALGETWKSIPHVRLMLSRDHKNSNCTISILKHTSMPSG  308


 Score = 82.8 bits (203),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK LE+  PIID++F+ FCASHGI +VEDFLLHD+  L   +++   S RLK+ I  
Sbjct  1     MAPLKHLEKENPIIDASFRYFCASHGILTVEDFLLHDLEVLAAFSDRQTNSDRLKEAITV  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ ++     WLN +
Sbjct  61    MLSLVERQCHSWLNGM  76



>ref|XP_006417773.1| hypothetical protein EUTSA_v10008243mg [Eutrema salsugineum]
 gb|ESQ36126.1| hypothetical protein EUTSA_v10008243mg [Eutrema salsugineum]
Length=316

 Score =   204 bits (520),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 147/229 (64%), Gaps = 31/229 (14%)
 Frame = -1

Query  1063  TASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNS  887
             T ST    +D  L GG R+G L ELVGPSSSGKTQ+C   A++VA + +GRV ++DT NS
Sbjct  88    TLSTGDNGMDSLLQGGFREGQLTELVGPSSSGKTQICMQAAASVAEKQTGRVFYVDTGNS  147

Query  886   FSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---  716
             FS +R+A+ +   SD +  K       V+S I C++V+DIFTMFD +  L+ T+RSQ   
Sbjct  148   FSARRIAQFICATSDAALGKK------VLSRISCHTVYDIFTMFDTLQGLEVTLRSQVQM  201

Query  715   --SGCRARMLIIDSISSLITPILGGSGAH------------------GRALMASAGFILK  596
               +  R R+L++DSISSLITPILGGSG+                   GRALM + G++LK
Sbjct  202   NVNEYRLRLLVVDSISSLITPILGGSGSQDELVIWKKDSRVTNLVFAGRALMVAVGYMLK  261

Query  595   QLANEHNLPVLVTNHMV-AGEAGLLKPALGESWKSIPHIRLLLSRDSAR  452
             +LA+EHN+ +LVTNH V AGE G  KPALGE+WKSIPH   L  R   R
Sbjct  262   KLAHEHNIAILVTNHTVGAGEGGKTKPALGETWKSIPHPSGLTGRTLTR  310


 Score = 90.9 bits (224),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK LE+  PIID+ F+ FCASHGI +VEDFLLHD++ L   AE+   + RLK+GI  
Sbjct  1     MAPLKHLERDNPIIDACFRDFCASHGILTVEDFLLHDLYELAAFAERQTNADRLKEGITH  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ I+   +PWLN +
Sbjct  61    MLSLIEHQCRPWLNGM  76



>ref|NP_001077479.1| DNA repair protein RAD51 homolog 4 [Arabidopsis thaliana]
 gb|AEE28174.1| DNA repair protein RAD51-like 4 [Arabidopsis thaliana]
Length=304

 Score =   231 bits (590),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 160/227 (70%), Gaps = 12/227 (5%)
 Frame = -1

Query  1063  TASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCNS  887
             T ST  K  D  L GG R+G L ELVGPSSSGKTQ C   A++VA +  GRV++LDT NS
Sbjct  70    TLSTGDKETDSLLQGGFREGQLTELVGPSSSGKTQFCMQAAASVAENHLGRVLYLDTGNS  129

Query  886   FSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---  716
             FS +R+A+ +   SD +        + VMS I+C++V+DI+T+FD +  L+ T+R Q   
Sbjct  130   FSARRIAQFICSSSDATLG------QKVMSRILCHTVYDIYTLFDTLQDLEITLRLQMNV  183

Query  715   SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV--A  542
             +  R R+L++DSISSLITPILGGSG+ GRALM + G++LK+LA+EH++ +LVTNH V   
Sbjct  184   NESRLRLLVVDSISSLITPILGGSGSQGRALMVAIGYLLKKLAHEHSIAILVTNHTVGAG  243

Query  541   GEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGD  401
             GE G  KPALGE+WKSIPH+RL LSRD      +IS+LKH ++ +G 
Sbjct  244   GEGGKTKPALGETWKSIPHVRLSLSRDHKNSNCTISILKHTSLPSGQ  290



>gb|KEH30104.1| DNA repair protein RAD51 [Medicago truncatula]
Length=265

 Score =   177 bits (450),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 121/170 (71%), Gaps = 8/170 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSP  878
             ST  + ID  L GGLR G L ELVGPSSSGKTQVC M +S VA++   V++LDT NSFSP
Sbjct  90    STGCEGIDALLGGGLRVGQLTELVGPSSSGKTQVCLMSSSTVAKNKCSVIYLDTGNSFSP  149

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGC  707
             +R+A  V Q SD  +       ++++  I+CY VFD++ MFD++H LK  +RSQ   S  
Sbjct  150   QRIAYFVGQSSDYVSVN-----QNILDRIICYPVFDVYQMFDLLHQLKINLRSQIVKSDH  204

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVT  557
             + ++LI+DSISSLITPIL G+G  G ALM S+GF+LKQLA+EHN+ VL +
Sbjct  205   QVQVLIVDSISSLITPILRGNGPQGHALMISSGFLLKQLAHEHNIAVLAS  254


 Score =   108 bits (269),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL SL + YP+IDSNFQ FCASH I+SVEDFLLHD+ AL  SA  H+ S RLKQGI+Q
Sbjct  1     MAPLNSLSKEYPLIDSNFQTFCASHAIYSVEDFLLHDLDALFASAANHSNSERLKQGIHQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L  +DALH P LN L
Sbjct  61    LLLIVDALHPPVLNGL  76



>gb|EPS64672.1| hypothetical protein M569_10104 [Genlisea aurea]
Length=752

 Score =   216 bits (549),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 155/216 (72%), Gaps = 8/216 (4%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             ID  L GGLR GH+ E+VGPSSSGKTQ C   AS+VAR+  G V++ DT NS S +R+++
Sbjct  94    IDVLLQGGLRLGHVTEIVGPSSSGKTQFCLRTASHVARNFDGEVLYFDTGNSCSARRISQ  153

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHL---KSTMRSQSGCRARML  692
              ++Q +  + ++ KK+++  M +IV +SVFDIF + D++H L   KS  ++QS    +ML
Sbjct  154   FLNQFTVPANNEVKKTVKQAMCSIVRHSVFDIFKLLDMLHQLLMNKSNTQAQSPF-VKML  212

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             IIDS+SSLI+PILGG    G ++M   GF+LK+LA E N+ V+VTNHMV G+ G  KPAL
Sbjct  213   IIDSVSSLISPILGGGNPQGHSVMIRMGFMLKKLAYERNISVVVTNHMVGGQGGASKPAL  272

Query  511   GESWKSIPHIRLLLSRDSARHISSISVLKHPNMATG  404
             GESWKS+PH+RLLL   SA   SSI++LKHP +A G
Sbjct  273   GESWKSVPHVRLLL---SATPGSSITILKHPFLAAG  305


 Score = 69.3 bits (168),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             M  L+ LE  +P++D +F+ FC+S GI +VEDFLLHD  +L +  E  +   +LKQG+ Q
Sbjct  1     MVTLEELEGDFPLLDFDFRRFCSSLGIITVEDFLLHD--SLALELELKHAPEKLKQGVEQ  58

Query  1083  VLASIDALHQPWLNAL  1036
             + + +D  H P+L  L
Sbjct  59    LFSIVDDYHHPFLTGL  74



>gb|AAF75078.1|AC007583_14 Contains similarity to DNA repair protein RAD51 homolog 4 (TRAD) 
from Homo sapiens gi|6174940 [Arabidopsis thaliana]
Length=285

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 158/223 (71%), Gaps = 12/223 (5%)
 Frame = -1

Query  1063  TASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCNS  887
             T ST  K  D  L GG R+G L ELVGPSSSGKTQ C   A++VA +  GRV++LDT NS
Sbjct  66    TLSTGDKETDSLLQGGFREGQLTELVGPSSSGKTQFCMQAAASVAENHLGRVLYLDTGNS  125

Query  886   FSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---  716
             FS +R+A+ +   SD +        + VMS I+C++V+DI+T+FD +  L+ T+R Q   
Sbjct  126   FSARRIAQFICSSSDATLG------QKVMSRILCHTVYDIYTLFDTLQDLEITLRLQMNV  179

Query  715   SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV--A  542
             +  R R+L++DSISSLITPILGGSG+ GRALM + G++LK+LA+EH++ +LVTNH V   
Sbjct  180   NESRLRLLVVDSISSLITPILGGSGSQGRALMVAIGYLLKKLAHEHSIAILVTNHTVGAG  239

Query  541   GEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNM  413
             GE G  KPALGE+WKSIPH+RL LSRD      +IS+LKH ++
Sbjct  240   GEGGKTKPALGETWKSIPHVRLSLSRDHKNSNCTISILKHTSL  282



>ref|XP_010475545.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Camelina 
sativa]
Length=260

 Score =   227 bits (578),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 159/227 (70%), Gaps = 15/227 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  +  D  L GG R+G + ELVGPSSSGKTQ C   A++VA + +GRV++LDT NSFS
Sbjct  30    STGDRGTDSLLKGGFREGQVTELVGPSSSGKTQFCMQAAASVAEKHAGRVLYLDTGNSFS  89

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC--  707
              +R+A+  S  SD S        + VMS I C++V+DI+TM + +  L  T+RSQ     
Sbjct  90    ARRIAQFGSS-SDTSLE------QKVMSRISCHTVYDIYTMLETLQGLDVTLRSQVQTNV  142

Query  706   ---RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA--  542
                R R+L++DSISSLITPILGGSG+ GRALM + G++LK+LA+EH++ +LVTNH V+  
Sbjct  143   NEHRLRLLVVDSISSLITPILGGSGSQGRALMVAVGYMLKKLAHEHSIAILVTNHTVSAG  202

Query  541   GEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGD  401
             GE G  KPALGE+WKSIPH+RL+LS D     S+IS+LKH +M +G 
Sbjct  203   GEGGKTKPALGETWKSIPHVRLMLSHDHKNSNSTISILKHTSMPSGQ  249



>ref|XP_006305443.1| hypothetical protein CARUB_v10009852mg, partial [Capsella rubella]
 gb|EOA38341.1| hypothetical protein CARUB_v10009852mg, partial [Capsella rubella]
Length=304

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 165/236 (70%), Gaps = 15/236 (6%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCN  890
             +T S+  K +D  L GG R+G L ELVGPSSSGKTQ C   A++VA + +GRV++LDT N
Sbjct  68    QTLSSGDKGVDSLLKGGFREGQLTELVGPSSSGKTQFCMQAAASVAEKHAGRVLYLDTGN  127

Query  889   SFSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--  716
             SFS +R+A+     S + TS  +K    V+S I C++V+DI+TM +++  L  T+RSQ  
Sbjct  128   SFSARRIAQF---GSSSETSLGQK----VISRISCHTVYDIYTMLEILQGLDVTLRSQVQ  180

Query  715   ---SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV  545
                +  R R+L++DSISSLITPILGGSG+ GRALM + G++LK+LA+EH++ +LVTNH V
Sbjct  181   TNVNEQRLRLLVVDSISSLITPILGGSGSQGRALMVAVGYMLKKLAHEHSIAILVTNHTV  240

Query  544   --AGEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
                GE    KPALGE+WKSIPH+RL+LSRD      +IS+LKH +M +G  V   I
Sbjct  241   GAGGEGVKTKPALGETWKSIPHVRLMLSRDHKNSNCTISILKHTSMPSGQTVRTTI  296



>ref|XP_008366341.1| PREDICTED: DNA repair protein RAD51 homolog 4-like isoform X4 
[Malus domestica]
Length=219

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 150/200 (75%), Gaps = 4/200 (2%)
 Frame = -1

Query  970  GKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEVVSQMSDNSTSKA-KKSLEHVMS  797
            G  QVC + A+NVA +  G VV+LDT NSFSP+R+   V  +S+++  +A ++  + VM+
Sbjct  20   GNVQVCLLSAANVATKHMGTVVYLDTGNSFSPERIVHFVGDISNHAFDQAGQRVFQKVMN  79

Query  796  NIVCYSVFDIFTMFDVVHHLKSTMRSQ--SGCRARMLIIDSISSLITPILGGSGAHGRAL  623
            NI+C+ VFDIFTMF+++H L+ ++ SQ   G + R+LI+DSISSLITPILG SG+ GRAL
Sbjct  80   NILCHHVFDIFTMFNLLHQLEFSLPSQMQKGEQVRLLIVDSISSLITPILGNSGSQGRAL  139

Query  622  MASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGESWKSIPHIRLLLSRDSARHIS  443
            M SAG++LK+LA+EHNL VLVTNH V GE G+ KPALG++WKSIPH+RLLLS D      
Sbjct  140  MISAGYLLKKLAHEHNLAVLVTNHTVGGEKGIPKPALGQTWKSIPHVRLLLSGDQGNSTR  199

Query  442  SISVLKHPNMATGDRVEFQI  383
            +ISVL+H +MA+G    F I
Sbjct  200  TISVLRHSSMASGKSTRFTI  219



>ref|XP_008366340.1| PREDICTED: DNA repair protein RAD51 homolog 4-like isoform X3 
[Malus domestica]
Length=221

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 149/202 (74%), Gaps = 6/202 (3%)
 Frame = -1

Query  970  GKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEVVSQMSDNSTSKA-KKSLEHVMS  797
            G  QVC + A+NVA +  G VV+LDT NSFSP+R+   V  +S+++  +A ++  + VM+
Sbjct  20   GNVQVCLLSAANVATKHMGTVVYLDTGNSFSPERIVHFVGDISNHAFDQAGQRVFQKVMN  79

Query  796  NIVCYSVFDIFTMFDVVHHLK----STMRSQSGCRARMLIIDSISSLITPILGGSGAHGR  629
            NI+C+ VFDIFTMF+++H L+    S  + Q G + R+LI+DSISSLITPILG SG+ GR
Sbjct  80   NILCHHVFDIFTMFNLLHQLEFSLPSQFQMQKGEQVRLLIVDSISSLITPILGNSGSQGR  139

Query  628  ALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGESWKSIPHIRLLLSRDSARH  449
            ALM SAG++LK+LA+EHNL VLVTNH V GE G+ KPALG++WKSIPH+RLLLS D    
Sbjct  140  ALMISAGYLLKKLAHEHNLAVLVTNHTVGGEKGIPKPALGQTWKSIPHVRLLLSGDQGNS  199

Query  448  ISSISVLKHPNMATGDRVEFQI  383
              +ISVL+H +MA+G    F I
Sbjct  200  TRTISVLRHSSMASGKSTRFTI  221



>ref|XP_008448362.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X3 [Cucumis 
melo]
Length=311

 Score =   188 bits (478),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 134/218 (61%), Gaps = 35/218 (16%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L GGLR+G L E+VGPSSSGKTQVC   ASNVA++ +  V ++DT NSFSP+R++ 
Sbjct  124   VDVLLGGGLREGQLTEIVGPSSSGKTQVCLRAASNVAKNYNAEVFYVDTGNSFSPQRISG  183

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRARMLIID  683
              V+     +                                L  T +     R + LIID
Sbjct  184   FVNWKPGTA--------------------------------LDWTCKGDR--RVQFLIID  209

Query  682   SISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGES  503
             SISSLITPILGGS + G ALM SAG +LK++A+EHN+ VLVTNH V G+ G  KPALGES
Sbjct  210   SISSLITPILGGSSSQGHALMISAGTLLKKIAHEHNIAVLVTNHTVGGDRGTSKPALGES  269

Query  502   WKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEF  389
             WKS+PH+RL LSRD+  ++   S+LKH +MA+G    F
Sbjct  270   WKSVPHVRLQLSRDAGSNVYQASILKHSSMASGTAARF  307


 Score = 89.4 bits (220),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 57/104 (55%), Gaps = 28/104 (27%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLK-----  1099
             MAPLK LE+ YP IDSNF  FCASHGIF+VEDFL+HD++ L   AEQ   S +LK     
Sbjct  1     MAPLKFLEELYPFIDSNFLTFCASHGIFTVEDFLIHDLYVLAAFAEQQPASEKLKQVKPS  60

Query  1098  ----------------------QGINQVLASIDAL-HQPWLNAL  1036
                                   QGI Q+L+ ID    QPWLN L
Sbjct  61    LHFPFSCLSFTVLNFSISCMCTQGITQILSIIDVTERQPWLNGL  104



>gb|ACR37601.1| unknown [Zea mays]
 tpg|DAA63892.1| TPA: DNA repair protein RAD51 [Zea mays]
Length=298

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 161/232 (69%), Gaps = 10/232 (4%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNV-ARSSGRVVFLDTCNSFSP  878
             T ++ ID  L GGLR G L E+ GPSSSGKTQVC   AS+   + +G V++LDT NSFSP
Sbjct  64    TGLEGIDRLLGGGLRQGQLTEVTGPSSSGKTQVCLHSASHAPVKHTGVVMYLDTSNSFSP  123

Query  877   KRVAEVVSQMSDNSTSK-----AKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS  713
              R+A ++   +D S  K     +K+ L+ VM +I+C SVFDIF MF+V+H L+ ++ ++ 
Sbjct  124   SRIATIIDGTNDLSDQKGFDLLSKERLKTVMQSIICESVFDIFGMFEVLHQLEVSLLNEK  183

Query  712   ----GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV  545
                 G R  +LIIDSISSL+ PI+GG    GR++M S   ILK+LA EHNL VLVTNHMV
Sbjct  184   VIGDGRRICLLIIDSISSLLAPIIGGKYPQGRSMMISLAMILKKLAYEHNLAVLVTNHMV  243

Query  544   AGEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEF  389
             +   G +KPALGESWKS+PH+RL++SR+ + +I + +VLKH  +A+G   +F
Sbjct  244   SAGNGAVKPALGESWKSVPHVRLMISREHSSNICTGTVLKHTLLASGRTAKF  295



>ref|NP_001149161.1| LOC100282783 [Zea mays]
 gb|ACG34419.1| DNA repair protein RAD51 [Zea mays]
Length=298

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/235 (50%), Positives = 162/235 (69%), Gaps = 10/235 (4%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNV-ARSSGRVVFLDTCNSFSP  878
             T ++ ID  L GGLR G L E+ GPSSSGKTQVC   AS+   +  G V++LDT NSFSP
Sbjct  64    TGLEGIDRLLGGGLRQGQLTEVTGPSSSGKTQVCLHSASHAPVKHMGVVMYLDTTNSFSP  123

Query  877   KRVAEVVSQMSDNSTSK-----AKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS  713
              R+A ++   +D S  K     +K+ L+ VM +I+C SVFDIF MF+V+H L+ ++ ++ 
Sbjct  124   SRIATIIDGTNDLSDRKGFDLLSKERLKTVMQSIICESVFDIFGMFEVLHQLEVSLLNEK  183

Query  712   ----GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV  545
                 G R  +LIIDSISSL+ PI+GG    GR++M S   ILK+LA EHNL VLVTNHMV
Sbjct  184   VIGDGRRICLLIIDSISSLLAPIIGGKYPQGRSMMISLAMILKKLAYEHNLAVLVTNHMV  243

Query  544   AGEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQIL  380
             +   G +KPALGESWKS+PH+RL++SR+ + +I + +VLKH  +A+G   +F +L
Sbjct  244   SAGNGAVKPALGESWKSVPHVRLMISREHSSNICTGTVLKHTLLASGRTAKFVLL  298



>ref|XP_008448363.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X4 [Cucumis 
melo]
Length=304

 Score =   185 bits (470),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 133/221 (60%), Gaps = 48/221 (22%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSPKRVAEV  860
             +D  L GGLR+G L E+VGPS                 SSG+                  
Sbjct  124   VDVLLGGGLREGQLTEIVGPS-----------------SSGK------------------  148

Query  859   VSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC----RARML  692
                     T   +  L+ VMS+I C+SVFDIF +FDV+H L+  +RSQ+ C    R + L
Sbjct  149   --------TQSEQSMLQQVMSSISCHSVFDIFALFDVLHRLEFNLRSQT-CKGDRRVQFL  199

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             IIDSISSLITPILGGS + G ALM SAG +LK++A+EHN+ VLVTNH V G+ G  KPAL
Sbjct  200   IIDSISSLITPILGGSSSQGHALMISAGTLLKKIAHEHNIAVLVTNHTVGGDRGTSKPAL  259

Query  511   GESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEF  389
             GESWKS+PH+RL LSRD+  ++   S+LKH +MA+G    F
Sbjct  260   GESWKSVPHVRLQLSRDAGSNVYQASILKHSSMASGTAARF  300


 Score = 89.4 bits (220),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 57/104 (55%), Gaps = 28/104 (27%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLK-----  1099
             MAPLK LE+ YP IDSNF  FCASHGIF+VEDFL+HD++ L   AEQ   S +LK     
Sbjct  1     MAPLKFLEELYPFIDSNFLTFCASHGIFTVEDFLIHDLYVLAAFAEQQPASEKLKQVKPS  60

Query  1098  ----------------------QGINQVLASIDAL-HQPWLNAL  1036
                                   QGI Q+L+ ID    QPWLN L
Sbjct  61    LHFPFSCLSFTVLNFSISCMCTQGITQILSIIDVTERQPWLNGL  104



>ref|XP_008366339.1| PREDICTED: DNA repair protein RAD51 homolog 4-like isoform X2 
[Malus domestica]
Length=223

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 150/204 (74%), Gaps = 8/204 (4%)
 Frame = -1

Query  970  GKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEVVSQMSDNSTSKA-KKSLEHVMS  797
            G  QVC + A+NVA +  G VV+LDT NSFSP+R+   V  +S+++  +A ++  + VM+
Sbjct  20   GNVQVCLLSAANVATKHMGTVVYLDTGNSFSPERIVHFVGDISNHAFDQAGQRVFQKVMN  79

Query  796  NIVCYSVFDIFTMFDVVHHLKSTMRSQ--SGCRARMLIIDSISSLITPILGGSGAHG---  632
            NI+C+ VFDIFTMF+++H L+ ++ SQ   G + R+LI+DSISSLITPILG SG+ G   
Sbjct  80   NILCHHVFDIFTMFNLLHQLEFSLPSQMQKGEQVRLLIVDSISSLITPILGNSGSQGIYH  139

Query  631  -RALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGESWKSIPHIRLLLSRDSA  455
             RALM SAG++LK+LA+EHNL VLVTNH V GE G+ KPALG++WKSIPH+RLLLS D  
Sbjct  140  WRALMISAGYLLKKLAHEHNLAVLVTNHTVGGEKGIPKPALGQTWKSIPHVRLLLSGDQG  199

Query  454  RHISSISVLKHPNMATGDRVEFQI  383
                +ISVL+H +MA+G    F I
Sbjct  200  NSTRTISVLRHSSMASGKSTRFTI  223



>ref|XP_008366338.1| PREDICTED: DNA repair protein RAD51 homolog 4-like isoform X1 
[Malus domestica]
Length=225

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 149/206 (72%), Gaps = 10/206 (5%)
 Frame = -1

Query  970  GKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEVVSQMSDNSTSKA-KKSLEHVMS  797
            G  QVC + A+NVA +  G VV+LDT NSFSP+R+   V  +S+++  +A ++  + VM+
Sbjct  20   GNVQVCLLSAANVATKHMGTVVYLDTGNSFSPERIVHFVGDISNHAFDQAGQRVFQKVMN  79

Query  796  NIVCYSVFDIFTMFDVVHHLK----STMRSQSGCRARMLIIDSISSLITPILGGSGAHG-  632
            NI+C+ VFDIFTMF+++H L+    S  + Q G + R+LI+DSISSLITPILG SG+ G 
Sbjct  80   NILCHHVFDIFTMFNLLHQLEFSLPSQFQMQKGEQVRLLIVDSISSLITPILGNSGSQGI  139

Query  631  ---RALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGESWKSIPHIRLLLSRD  461
               RALM SAG++LK+LA+EHNL VLVTNH V GE G+ KPALG++WKSIPH+RLLLS D
Sbjct  140  YHWRALMISAGYLLKKLAHEHNLAVLVTNHTVGGEKGIPKPALGQTWKSIPHVRLLLSGD  199

Query  460  SARHISSISVLKHPNMATGDRVEFQI  383
                  +ISVL+H +MA+G    F I
Sbjct  200  QGNSTRTISVLRHSSMASGKSTRFTI  225



>ref|XP_010033174.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X4 [Eucalyptus 
grandis]
Length=277

 Score =   172 bits (437),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 140/229 (61%), Gaps = 47/229 (21%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSP  878
             ST  + +D  L GGLR G + EL GPSSSGK                             
Sbjct  90    STGCEGMDFLLRGGLRRGQVTELAGPSSSGK-----------------------------  120

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA-  701
                           T    + L+ VM++I+C+SV+DIF+MFDV+H L+S ++ Q  CR  
Sbjct  121   --------------TQMQPRVLQEVMNSILCHSVYDIFSMFDVLHCLESKLKYQVMCRGD  166

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                R++IIDSISSLITPILG SG+ GRALM SA  +LK+LA+E+NL VLVTNH V G+ G
Sbjct  167   NDERLIIIDSISSLITPILGSSGSQGRALMVSAMSLLKKLAHEYNLAVLVTNHTVGGDGG  226

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             + KPALGESWK++PH+RLLLSRD   +   +S+LKHP++A+G   +F I
Sbjct  227   IPKPALGESWKTLPHVRLLLSRDCGSNTYQVSLLKHPSIASGKAAKFII  275


 Score = 99.0 bits (245),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MA LK LE  +PI+D +FQ FCA  GIF+V+DFL+ D+ +LV  AEQ  +S R  Q INQ
Sbjct  1     MASLKRLETEFPILDPDFQSFCALRGIFTVQDFLIRDLQSLVADAEQQPSSERFMQAINQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL  ID LHQPWLN +
Sbjct  61    VLYVIDGLHQPWLNGV  76



>ref|XP_003563123.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010238412.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Brachypodium 
distachyon]
Length=262

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 161/229 (70%), Gaps = 6/229 (3%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSP  878
             T ++ ID  L GGLR GHL E+ G SSSGKTQVC   AS+VA R  G V++LDT NSFSP
Sbjct  34    TGLEGIDMLLGGGLRKGHLTEITGQSSSGKTQVCLYSASHVAARHMGVVLYLDTSNSFSP  93

Query  877   KRVAEVVSQMSDNSTSKAKK-SLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
              R+A +V ++  +   + K   L+ VMS+IVC SVFD+F +F+V+  L+++M  +    G
Sbjct  94    SRIAHIVDELPISLIKEPKDMRLKRVMSSIVCESVFDVFALFEVLDQLEASMNDKVNSGG  153

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
              +  +LIIDS+SSL+ PI+GG  + GR++M S   ILK+LA++HNL VLVTNH V G  G
Sbjct  154   NKICLLIIDSVSSLLAPIIGGKNSQGRSMMISVAMILKKLADKHNLSVLVTNHTVGGN-G  212

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
               KPALGESWK++PH+RL++SRD   ++ + +VLKH  +A+G  ++F +
Sbjct  213   APKPALGESWKAVPHVRLMISRDHGSNMYTATVLKHTLLASGRHMKFVV  261



>gb|AHN60060.1| RAD51D variant 1 [Oryza sativa Japonica Group]
Length=283

 Score =   218 bits (555),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 159/233 (68%), Gaps = 6/233 (3%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCN  890
             R   T ++ +D  L GGLR G L E+ G SSSGKTQVC   AS+VA R  G V++LDT N
Sbjct  50    RFLPTGLQGVDALLGGGLRQGQLTEITGQSSSGKTQVCLCSASHVAARQLGVVMYLDTSN  109

Query  889   SFSPKRVAEVVSQMSDNSTSKAKK-SLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-  716
             SFSP R+A +V     +   + K   LE VMS+I+C SVFDIF +F+V+H L+ +++S+ 
Sbjct  110   SFSPSRIARIVDGFPISLVREPKNVRLERVMSSIICKSVFDIFDLFEVLHQLELSLKSKV  169

Query  715   --SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA  542
                G +  +LIIDSISS++ PI GG    GR++M S   ILK+LA EHNL VLVTNHMVA
Sbjct  170   NNGGNKICLLIIDSISSILAPINGGKYPRGRSMMISVAMILKKLAYEHNLSVLVTNHMVA  229

Query  541   GEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             G  G  KPALGESWK++PH+RL++SR+    I + +VLKH  +A+G  ++F +
Sbjct  230   GN-GAPKPALGESWKTVPHVRLVISRERGSKICAATVLKHTLLASGRVMKFAV  281



>gb|AHN60062.1| RAD51D variant 3 [Oryza sativa Japonica Group]
Length=256

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 155/224 (69%), Gaps = 6/224 (3%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAE  863
             +D  L GGLR G L E+ G SSSGKTQVC   AS+VA R  G V++LDT NSFSP R+A 
Sbjct  32    VDALLGGGLRQGQLTEITGQSSSGKTQVCLCSASHVAARQLGVVMYLDTSNSFSPSRIAR  91

Query  862   VVSQMSDNSTSKAKK-SLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARM  695
             +V     +   + K   LE VMS+I+C SVFDIF +F+V+H L+ +++S+    G +  +
Sbjct  92    IVDGFPISLVREPKNVRLERVMSSIICKSVFDIFDLFEVLHQLELSLKSKVNNGGNKICL  151

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPA  515
             LIIDSISS++ PI GG    GR++M S   ILK+LA EHNL VLVTNHMVAG  G  KPA
Sbjct  152   LIIDSISSILAPINGGKYPRGRSMMISVAMILKKLAYEHNLSVLVTNHMVAGN-GAPKPA  210

Query  514   LGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             LGESWK++PH+RL++SR+    I + +VLKH  +A+G  ++F +
Sbjct  211   LGESWKTVPHVRLVISRERGSKICAATVLKHTLLASGRVMKFAV  254



>ref|XP_010238415.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Brachypodium 
distachyon]
Length=222

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 156/221 (71%), Gaps = 6/221 (3%)
 Frame = -1

Query  1030  FLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEVVS  854
              L GGLR GHL E+ G SSSGKTQVC   AS+VA R  G V++LDT NSFSP R+A +V 
Sbjct  2     LLGGGLRKGHLTEITGQSSSGKTQVCLYSASHVAARHMGVVLYLDTSNSFSPSRIAHIVD  61

Query  853   QMSDNSTSKAKK-SLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARMLII  686
             ++  +   + K   L+ VMS+IVC SVFD+F +F+V+  L+++M  +    G +  +LII
Sbjct  62    ELPISLIKEPKDMRLKRVMSSIVCESVFDVFALFEVLDQLEASMNDKVNSGGNKICLLII  121

Query  685   DSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGE  506
             DS+SSL+ PI+GG  + GR++M S   ILK+LA++HNL VLVTNH V G  G  KPALGE
Sbjct  122   DSVSSLLAPIIGGKNSQGRSMMISVAMILKKLADKHNLSVLVTNHTVGGN-GAPKPALGE  180

Query  505   SWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             SWK++PH+RL++SRD   ++ + +VLKH  +A+G  ++F +
Sbjct  181   SWKAVPHVRLMISRDHGSNMYTATVLKHTLLASGRHMKFVV  221



>ref|XP_010686176.1| PREDICTED: uncharacterized protein LOC104900458 [Beta vulgaris 
subsp. vulgaris]
Length=996

 Score =   228 bits (582),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 161/220 (73%), Gaps = 3/220 (1%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCN  890
             +T S   + ID FL+G LR+G + ELVGPSSSGKTQVC   A++VA R + RV ++D+ N
Sbjct  87    QTLSLAYEGIDPFLHGALREGFVTELVGPSSSGKTQVCLQAAASVAKRYADRVAYIDSGN  146

Query  889   SFSPKRVAEVVSQMSDNSTSKAKKSLEHV-MSNIVCYSVFDIFTMFDVVHHLKSTMRSQS  713
             SFS  R+A +V + S ++  +      H+ M NI CY VFDIF++FDV+H L+  ++SQ 
Sbjct  147   SFSAPRIAHLVKRASYSAPKQDNNEALHIIMKNIWCYPVFDIFSLFDVLHQLELKLKSQI  206

Query  712   GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA  533
                AR+LI+DS SSLI P+LGG+G +G ALM SAG +LK++A+E+N+ VLVTNHMVAGE 
Sbjct  207   -FSARLLIVDSFSSLIIPLLGGNGPYGHALMISAGNLLKKIAHEYNICVLVTNHMVAGEG  265

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNM  413
             G  KPALGESWK+  H+RLLLSRD   +I + +V++HP++
Sbjct  266   GSPKPALGESWKNAVHVRLLLSRDQETNICTSTVVRHPSV  305


 Score =   105 bits (261),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             M  LKS+E +YP++DS FQ FC S GI++VEDFL+HD++AL++SAE+  TS RLKQGI+Q
Sbjct  1     MGFLKSMEDKYPLLDSIFQEFCGSRGIYTVEDFLIHDLNALILSAEKKPTSERLKQGIDQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ ++ +H+PWLN +
Sbjct  61    LLSIVNGIHKPWLNGV  76



>gb|ACH42255.1| RAD51D protein [Triticum aestivum]
Length=246

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 158/230 (69%), Gaps = 6/230 (3%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSP  878
             T ++ ID  L GGLR G L E+ G SSSGKTQVC   A++VA R  G V++LDT NSFSP
Sbjct  16    TGLEGIDTLLGGGLRKGQLTEITGQSSSGKTQVCLYSAAHVAARHMGAVLYLDTSNSFSP  75

Query  877   KRVAEVVSQMSDNSTSKAKK-SLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMR---SQSG  710
              R+A ++ ++  +   + K   L+ VMS+I+C SVFDIF +F+V+  L+ ++    +   
Sbjct  76    SRIAHILDELPISLIKEPKDMRLKRVMSSIICESVFDIFALFEVLDRLEVSLNCKVTNGS  135

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
              +  +LIIDS+SSL+ PI+GG  + GR++M S   ILK+LA++HNL VLVTNHMVAG  G
Sbjct  136   NKICLLIIDSVSSLLAPIIGGKNSQGRSMMISVAMILKKLAHKHNLSVLVTNHMVAGN-G  194

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQIL  380
               KPALGESWK+ PHIRL++SRD   +I + + LKH  +A G  ++FQ L
Sbjct  195   APKPALGESWKAAPHIRLMISRDRGSNICTATTLKHTLLACGRHMKFQFL  244



>ref|XP_006661024.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Oryza brachyantha]
Length=245

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 158/233 (68%), Gaps = 6/233 (3%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCN  890
             R   T ++ ID  L GGLR G L E+ G SSSGKTQVC   AS+VA    G V++LDT N
Sbjct  12    RFLPTGLQGIDALLGGGLRQGQLTEITGQSSSGKTQVCLCSASHVAAMQLGAVIYLDTSN  71

Query  889   SFSPKRVAEVVSQMSDNSTSKAKK-SLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-  716
             SFSP R+A +V     +  ++ K   LE V+S+I+C SVFDIF +F+V+  L+ +++++ 
Sbjct  72    SFSPSRIARIVDGFRISLVTEPKNVKLERVLSSIICKSVFDIFDLFEVLRQLELSLKNKV  131

Query  715   --SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA  542
                  +  +LIIDS+SSL+ PI GG    GR++M S   ILK+LA+E+NL VLVTNHMVA
Sbjct  132   NNGSSKICLLIIDSLSSLLAPINGGKYPQGRSMMISVAMILKKLADEYNLSVLVTNHMVA  191

Query  541   GEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             G  G  KPALGESWK++PH+RL+LSR+   +I + +VLKH  +A+G  + F +
Sbjct  192   GN-GAPKPALGESWKTVPHVRLVLSRERGSNICAATVLKHTLLASGHVMRFAV  243



>dbj|BAD34152.1| Trad-like protein [Oryza sativa Japonica Group]
 dbj|BAD33684.1| Trad-like protein [Oryza sativa Japonica Group]
 gb|EAZ43722.1| hypothetical protein OsJ_28349 [Oryza sativa Japonica Group]
Length=272

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 151/220 (69%), Gaps = 6/220 (3%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCN  890
             R   T ++ +D  L GGLR G L E+ G SSSGKTQVC   AS+VA R  G V++LDT N
Sbjct  48    RFLPTGLQGVDALLGGGLRQGQLTEITGQSSSGKTQVCLCSASHVAARQLGVVMYLDTSN  107

Query  889   SFSPKRVAEVVSQMSDNSTSKAKK-SLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-  716
             SFSP R+A +V     +   + K   LE VMS+I+C SVFDIF +F+V+H L+ +++S+ 
Sbjct  108   SFSPSRIARIVDGFPISLVREPKNVRLERVMSSIICKSVFDIFDLFEVLHQLELSLKSKV  167

Query  715   --SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA  542
                G +  +LIIDSISS++ PI GG    GR++M S   ILK+LA EHNL VLVTNHMVA
Sbjct  168   NNGGNKICLLIIDSISSILAPINGGKYPRGRSMMISVAMILKKLAYEHNLSVLVTNHMVA  227

Query  541   GEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKH  422
             G  G  KPALGESWK++PH+RL++SR+    I + +VLKH
Sbjct  228   GN-GAPKPALGESWKTVPHVRLVISRERGSKICAATVLKH  266



>gb|ADE77590.1| unknown [Picea sitchensis]
Length=320

 Score =   197 bits (501),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 146/208 (70%), Gaps = 6/208 (3%)
 Frame = -1

Query  988  VGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEVVSQMSDNS--TSKAKK  818
            VGPS+SGKTQ+C   AS++A  S   V++LDTCNSFS KR+A+ ++ ++ +S  +   + 
Sbjct  111  VGPSASGKTQICLRAASHIAYHSQAAVMYLDTCNSFSSKRIAQFLNVLAKSSIKSKDQQG  170

Query  817  SLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARMLIIDSISSLITPILGG  647
            ++E  M  I  Y+VFD+++M D+++ ++S+M++Q      R R+LI+DS+SS+ITPIL G
Sbjct  171  NIERAMKGIFHYNVFDVYSMLDLLYQIESSMQTQGKNESSRVRLLIVDSVSSVITPILSG  230

Query  646  SGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPALGESWKSIPHIRLLLS  467
            S   G +LM S G +LK+LA E+++ VL+TNH+V  + G  KPALGESWKS+PH+RLLLS
Sbjct  231  SNLQGHSLMISLGVVLKKLALEYSIAVLITNHIVVDKTGTSKPALGESWKSMPHVRLLLS  290

Query  466  RDSARHISSISVLKHPNMATGDRVEFQI  383
            RD   +I  +S+LKH +M    +    +
Sbjct  291  RDPVSNICDMSLLKHTSMVCDQQASLSL  318


 Score = 66.2 bits (160),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL++L    PI+      F A++GI SVEDFL+HD++ L    E    S  LKQ I +
Sbjct  1     MAPLRALN--LPILTRQVLQFLAANGILSVEDFLVHDIYTLAARTEHQTNSEVLKQAIAE  58

Query  1083  VLASIDALHQPWLNA  1039
             +L+ ID+ H  WLN 
Sbjct  59    ILSFIDSQHSRWLNG  73



>gb|EAZ08086.1| hypothetical protein OsI_30353 [Oryza sativa Indica Group]
Length=280

 Score =   212 bits (539),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 151/220 (69%), Gaps = 6/220 (3%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCN  890
             R   T ++ +D  L GGLR G L E+ G SSSGKTQVC   AS+VA R  G V++LDT N
Sbjct  56    RFLPTGLQGVDALLGGGLRQGQLTEITGQSSSGKTQVCLCSASHVAARQLGVVMYLDTSN  115

Query  889   SFSPKRVAEVVSQMSDNSTSKAKK-SLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-  716
             SFSP R+A +V     +   + K   LE VMS+I+C SVFDIF +F+V+H L+ +++S+ 
Sbjct  116   SFSPSRIARIVDGFPISLVREPKNVRLERVMSSIICKSVFDIFDLFEVLHQLELSLKSKV  175

Query  715   --SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA  542
                G +  +LIIDSISS++ PI GG    GR++M S   ILK+LA EHNL VLVTNHMVA
Sbjct  176   NNGGNKICLLIIDSISSILAPINGGKYPRGRSMMISVAMILKKLAYEHNLSVLVTNHMVA  235

Query  541   GEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKH  422
             G  G  KPALGESWK++PH+RL++SR+    I + +VLKH
Sbjct  236   GN-GAPKPALGESWKTVPHVRLVISRERGSKICAATVLKH  274



>ref|XP_010253342.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X3 [Nelumbo 
nucifera]
Length=243

 Score =   153 bits (386),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 103/141 (73%), Gaps = 5/141 (4%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAE  863
             ID  L GGLR GH+ ELVGPS SGKTQVC   ASNVA +  G V+FLDTCNSFSP+R+A 
Sbjct  96    IDMLLQGGLRVGHVTELVGPSPSGKTQVCLQAASNVAVKFMGVVMFLDTCNSFSPRRMAC  155

Query  862   VVSQMSDNSTSK-AKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARM  695
              ++Q  +    +  +K L+ VMS+I+C SVFDIF++ DV+  L+  ++ Q     C+ R+
Sbjct  156   FINQHFNTPVEEVTQKGLKRVMSSILCQSVFDIFSLLDVLRQLELKLQFQVNTGDCKLRL  215

Query  694   LIIDSISSLITPILGGSGAHG  632
             LIIDSISSLITPILGG+GAHG
Sbjct  216   LIIDSISSLITPILGGNGAHG  236


 Score =   109 bits (272),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSL++ +PIID NFQ FCASHGI+SVEDFL+HD+++LV SAEQ ++S  L++GI+Q
Sbjct  1     MAPLKSLQREFPIIDCNFQQFCASHGIYSVEDFLVHDLYSLVASAEQQSSSEELREGISQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             V++ I + HQPW N +
Sbjct  61    VISIIGSQHQPWSNGV  76



>gb|ABE02576.1| RAD51D splice variant g [Arabidopsis thaliana]
 gb|ABE02664.1| RAD51D splice variant g [Arabidopsis thaliana]
Length=266

 Score =   171 bits (433),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 123/178 (69%), Gaps = 10/178 (6%)
 Frame = -1

Query  1063  TASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCNS  887
             T ST  K  D  L GG R+G L ELVGPSSSGKTQ C   A++VA +  GRV++LDT NS
Sbjct  88    TLSTGDKETDSLLQGGFREGQLTELVGPSSSGKTQFCMQAAASVAENHLGRVLYLDTGNS  147

Query  886   FSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---  716
             FS +R+A+ +   SD +        + VMS I+C++V+DI+T+FD +  L+ T+R Q   
Sbjct  148   FSARRIAQFICSSSDATLG------QKVMSRILCHTVYDIYTLFDTLQDLEITLRLQMNV  201

Query  715   SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA  542
             +  R R+L++DSISSLITPILGGSG+ GRALM + G++LK+LA+EH++ +LV     A
Sbjct  202   NESRLRLLVVDSISSLITPILGGSGSQGRALMVAIGYLLKKLAHEHSIAILVLKKFQA  259


 Score = 86.3 bits (212),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK LE+  PIID+ FQ FCASHGI ++EDFLLHD++ L   +++   + RLK+GI  
Sbjct  1     MAPLKHLEKENPIIDACFQDFCASHGILTIEDFLLHDLYELTAFSQRQTNADRLKEGITL  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ I+   +P +N L
Sbjct  61    ILSLIERQCRPLVNGL  76



>gb|KEH30105.1| DNA repair protein RAD51 [Medicago truncatula]
Length=264

 Score =   148 bits (374),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSP  878
             ST  + ID  L GGLR G L ELVGPSSSGKTQVC M +S VA++   V++LDT NSFSP
Sbjct  90    STGCEGIDALLGGGLRVGQLTELVGPSSSGKTQVCLMSSSTVAKNKCSVIYLDTGNSFSP  149

Query  877   KRVAEVVSQMSDN-STSKAK-KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---S  713
             +R+A  V Q SD  S ++A  + L++++  I+CY VFD++ MFD++H LK  +RSQ   S
Sbjct  150   QRIAYFVGQSSDYVSVNQADHRLLQNILDRIICYPVFDVYQMFDLLHQLKINLRSQIVKS  209

Query  712   GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFIL  599
               + ++LI+DSISSLITPIL G+G  G   +    F++
Sbjct  210   DHQVQVLIVDSISSLITPILRGNGPQGIVHICMQNFLV  247


 Score =   107 bits (268),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL SL + YP+IDSNFQ FCASH I+SVEDFLLHD+ AL  SA  H+ S RLKQGI+Q
Sbjct  1     MAPLNSLSKEYPLIDSNFQTFCASHAIYSVEDFLLHDLDALFASAANHSNSERLKQGIHQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L  +DALH P LN L
Sbjct  61    LLLIVDALHPPVLNGL  76



>gb|KEH30100.1| DNA repair protein RAD51 [Medicago truncatula]
Length=242

 Score =   145 bits (365),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 103/155 (66%), Gaps = 8/155 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSP  878
             ST  + ID  L GGLR G L ELVGPSSSGKTQVC M +S VA++   V++LDT NSFSP
Sbjct  90    STGCEGIDALLGGGLRVGQLTELVGPSSSGKTQVCLMSSSTVAKNKCSVIYLDTGNSFSP  149

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGC  707
             +R+A  V Q SD  +       ++++  I+CY VFD++ MFD++H LK  +RSQ   S  
Sbjct  150   QRIAYFVGQSSDYVSVN-----QNILDRIICYPVFDVYQMFDLLHQLKINLRSQIVKSDH  204

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFI  602
             + ++LI+DSISSLITPIL G+G  G   +    F+
Sbjct  205   QVQVLIVDSISSLITPILRGNGPQGIVHICMQNFL  239


 Score =   108 bits (269),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL SL + YP+IDSNFQ FCASH I+SVEDFLLHD+ AL  SA  H+ S RLKQGI+Q
Sbjct  1     MAPLNSLSKEYPLIDSNFQTFCASHAIYSVEDFLLHDLDALFASAANHSNSERLKQGIHQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L  +DALH P LN L
Sbjct  61    LLLIVDALHPPVLNGL  76



>gb|KEH30101.1| DNA repair protein RAD51 [Medicago truncatula]
Length=257

 Score =   145 bits (365),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 104/156 (67%), Gaps = 8/156 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSP  878
             ST  + ID  L GGLR G L ELVGPSSSGKTQVC M +S VA++   V++LDT NSFSP
Sbjct  90    STGCEGIDALLGGGLRVGQLTELVGPSSSGKTQVCLMSSSTVAKNKCSVIYLDTGNSFSP  149

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGC  707
             +R+A  V Q SD  +       ++++  I+CY VFD++ MFD++H LK  +RSQ   S  
Sbjct  150   QRIAYFVGQSSDYVSVN-----QNILDRIICYPVFDVYQMFDLLHQLKINLRSQIVKSDH  204

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFIL  599
             + ++LI+DSISSLITPIL G+G  G   +    F++
Sbjct  205   QVQVLIVDSISSLITPILRGNGPQGIVHICMQNFLV  240


 Score =   107 bits (268),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL SL + YP+IDSNFQ FCASH I+SVEDFLLHD+ AL  SA  H+ S RLKQGI+Q
Sbjct  1     MAPLNSLSKEYPLIDSNFQTFCASHAIYSVEDFLLHDLDALFASAANHSNSERLKQGIHQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L  +DALH P LN L
Sbjct  61    LLLIVDALHPPVLNGL  76



>ref|XP_008788056.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Phoenix 
dactylifera]
Length=273

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 142/225 (63%), Gaps = 35/225 (16%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSP  878
             T  + ID  L GGL +G L E+VG SSSGKTQVC   A++VA +  G V+FLDTCNSFSP
Sbjct  81    TGYEGIDVLLGGGLCEGQLTEIVGSSSSGKTQVCLYSAAHVADKHFGVVMFLDTCNSFSP  140

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRAR  698
             KR+A +V Q+S + + +            +C                             
Sbjct  141   KRIACMVDQLSSSFSGEVTSG-----HTKIC-----------------------------  166

Query  697   MLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKP  518
             +LIIDSISSL+TP+LGG G+ GR LM SAG ILK+LANEHN+ VLVTNHMV GE G+LKP
Sbjct  167   LLIIDSISSLLTPVLGGKGSEGRLLMVSAGIILKKLANEHNVSVLVTNHMVGGEGGILKP  226

Query  517   ALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
             ALGESWKSIPH+RL L+ D   +I ++S+LKH  MA+G   +F I
Sbjct  227   ALGESWKSIPHVRLQLTHDQGSNICNVSILKHTFMASGRTTKFVI  271



>gb|EMS53753.1| DNA repair protein RAD51-like protein 4 [Triticum urartu]
Length=295

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 153/235 (65%), Gaps = 25/235 (11%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSP  878
             T ++ ID  L GGLR G L E+ G SSSGKTQVC   A++VA R  G V++LDT NSFSP
Sbjct  34    TGLEGIDTLLGGGLRKGQLTEITGQSSSGKTQVCLYSAAHVAARHMGLVLYLDTSNSFSP  93

Query  877   KRVA------------EVVSQMSDNSTSKAKKS--------LEHVMSNIVCYSVFDIFTM  758
              R+A            E+  ++ D+  SK   S        L+ VMS+I+C SVFDIF +
Sbjct  94    SRIAHILDELPISLIKEITLKLFDHVISKHPISNMQPKDVRLKRVMSSIICESVFDIFAL  153

Query  757   FDVVHHLKSTMR---SQSGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLA  587
             F+V+  L+ ++    +    R  +LIIDS+SSL+ PI+GG  + GR++M S   ILK+LA
Sbjct  154   FEVLDRLEVSLNGKVTNGSNRICLLIIDSVSSLLAPIIGGKNSQGRSMMISVAMILKKLA  213

Query  586   NEHNLPVLVTNHMVAGEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKH  422
             ++HNL VLVTNHMVAG  G  KPALGESWK++PHIRL++SRD   +I + + LKH
Sbjct  214   HKHNLSVLVTNHMVAGN-GAPKPALGESWKAVPHIRLMISRDRGSNICTATALKH  267



>ref|XP_011089834.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X6 [Sesamum 
indicum]
Length=218

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 143/221 (65%), Gaps = 38/221 (17%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCN  890
             R  ST  + ID  L GGLR GH+ EL GPSSSGKTQVC  +AS+VAR  SG V++ D+ N
Sbjct  24    RILSTGCERIDLLLQGGLRVGHVTELAGPSSSGKTQVCLKVASHVARKYSGTVMYFDSGN  83

Query  889   SFSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSG  710
             SFSPKR+ + ++Q SD + ++                                      G
Sbjct  84    SFSPKRIVQFLTQESDPANTEI-------------------------------------G  106

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
             C  RMLIIDS+SSLI P+LGG GAHG ALM +AGF+LK+LA+EHNL ++VTNHMVAGEAG
Sbjct  107   CNVRMLIIDSLSSLIAPVLGGGGAHGHALMVTAGFLLKELAHEHNLSIVVTNHMVAGEAG  166

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMAT  407
               KPALG+SWKSIPH+RLLL R  A + S IS+LKHP + +
Sbjct  167   SSKPALGDSWKSIPHVRLLLHRYRATNDSCISILKHPYLVS  207



>ref|XP_008448364.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X5 [Cucumis 
melo]
Length=274

 Score =   144 bits (364),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 107/149 (72%), Gaps = 7/149 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L GGLR+G L E+VGPSSSGKTQVC   ASNVA++ +  V ++DT NSFSP+R++ 
Sbjct  124   VDVLLGGGLREGQLTEIVGPSSSGKTQVCLRAASNVAKNYNAEVFYVDTGNSFSPQRISG  183

Query  862   VVSQMSDNSTSKAKKS-LEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC----RAR  698
              V+     +   +++S L+ VMS+I C+SVFDIF +FDV+H L+  +RSQ+ C    R +
Sbjct  184   FVNWKPGTALDWSEQSMLQQVMSSISCHSVFDIFALFDVLHRLEFNLRSQT-CKGDRRVQ  242

Query  697   MLIIDSISSLITPILGGSGAHGRALMASA  611
              LIIDSISSLITPILGGS + G + + ++
Sbjct  243   FLIIDSISSLITPILGGSSSQGTSYVKTS  271


 Score = 89.7 bits (221),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 57/104 (55%), Gaps = 28/104 (27%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLK-----  1099
             MAPLK LE+ YP IDSNF  FCASHGIF+VEDFL+HD++ L   AEQ   S +LK     
Sbjct  1     MAPLKFLEELYPFIDSNFLTFCASHGIFTVEDFLIHDLYVLAAFAEQQPASEKLKQVKPS  60

Query  1098  ----------------------QGINQVLASIDAL-HQPWLNAL  1036
                                   QGI Q+L+ ID    QPWLN L
Sbjct  61    LHFPFSCLSFTVLNFSISCMCTQGITQILSIIDVTERQPWLNGL  104



>gb|ABE02571.1| RAD51D splice variant b [Arabidopsis thaliana]
 gb|ABE02659.1| RAD51D splice variant b [Arabidopsis thaliana]
Length=232

 Score =   141 bits (356),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 101/148 (68%), Gaps = 10/148 (7%)
 Frame = -1

Query  1063  TASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCNS  887
             T ST  K  D  L GG R+G L ELVGPSSSGKTQ C   A++VA +  GRV++LDT NS
Sbjct  88    TLSTGDKETDSLLQGGFREGQLTELVGPSSSGKTQFCMQAAASVAENHLGRVLYLDTGNS  147

Query  886   FSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---  716
             FS +R+A+ +   SD +  +       VMS I+C++V+DI+T+FD +  L+ T+R Q   
Sbjct  148   FSARRIAQFICSSSDATLGQK------VMSRILCHTVYDIYTLFDTLQDLEITLRLQMNV  201

Query  715   SGCRARMLIIDSISSLITPILGGSGAHG  632
             +  R R+L++DSISSLITPILGGSG+ G
Sbjct  202   NESRLRLLVVDSISSLITPILGGSGSQG  229


 Score = 86.3 bits (212),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK LE+  PIID+ FQ FCASHGI ++EDFLLHD++ L   +++   + RLK+GI  
Sbjct  1     MAPLKHLEKENPIIDACFQDFCASHGILTIEDFLLHDLYELTAFSQRQTNADRLKEGITL  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ I+   +P +N L
Sbjct  61    ILSLIERQCRPLVNGL  76



>gb|KEH30107.1| DNA repair protein RAD51 [Medicago truncatula]
Length=207

 Score =   119 bits (297),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 78/114 (68%), Gaps = 5/114 (4%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSP  878
             ST  + ID  L GGLR G L ELVGPSSSGKTQVC M +S VA++   V++LDT NSFSP
Sbjct  90    STGCEGIDALLGGGLRVGQLTELVGPSSSGKTQVCLMSSSTVAKNKCSVIYLDTGNSFSP  149

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ  716
             +R+A  V Q SD  +       ++++  I+CY VFD++ MFD++H LK  +RSQ
Sbjct  150   QRIAYFVGQSSDYVSVN-----QNILDRIICYPVFDVYQMFDLLHQLKINLRSQ  198


 Score =   108 bits (269),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL SL + YP+IDSNFQ FCASH I+SVEDFLLHD+ AL  SA  H+ S RLKQGI+Q
Sbjct  1     MAPLNSLSKEYPLIDSNFQTFCASHAIYSVEDFLLHDLDALFASAANHSNSERLKQGIHQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L  +DALH P LN L
Sbjct  61    LLLIVDALHPPVLNGL  76



>gb|KCW52730.1| hypothetical protein EUGRSUZ_J02088 [Eucalyptus grandis]
Length=318

 Score =   117 bits (292),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 106/147 (72%), Gaps = 7/147 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  + +D  L GGLR G + EL GPSSSGKTQ C + AS VA +  G V+++DT NSFS
Sbjct  135   STGCEGMDFLLRGGLRRGQVTELAGPSSSGKTQFCLLTASTVAYKHMGGVIYIDTGNSFS  194

Query  880   PKRVAEVVSQMSDNSTSKAK-KSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCR  704
              KR+A  ++Q+S  ++ + + + L+ VM++I+C+SV+DIF+MFDV+H L+S ++ Q  CR
Sbjct  195   AKRIARFLNQISCPASEEMQPRVLQEVMNSILCHSVYDIFSMFDVLHCLESKLKYQM-CR  253

Query  703   A----RMLIIDSISSLITPILGGSGAH  635
                  R++IIDSISSLITPILG SG+ 
Sbjct  254   GDNDERLIIIDSISSLITPILGSSGSQ  280


 Score = 99.8 bits (247),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -2

Query  1269  RAMAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGI  1090
             + MA LK LE  +PI+D +FQ FCA  GIF+V+DFL+ D+ +LV  AEQ  +S R  Q I
Sbjct  44    QGMASLKRLETEFPILDPDFQSFCALRGIFTVQDFLIRDLQSLVADAEQQPSSERFMQAI  103

Query  1089  NQVLASIDALHQPWLNAL  1036
             NQVL  ID LHQPWLN +
Sbjct  104   NQVLYVIDGLHQPWLNGV  121



>ref|XP_001771392.1| predicted protein [Physcomitrella patens]
 gb|EDQ63782.1| predicted protein [Physcomitrella patens]
Length=200

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 135/213 (63%), Gaps = 21/213 (10%)
 Frame = -1

Query  1036  DDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEV  860
             D  L GGLR+G + ELVG SSSGKTQVC  +A++VA R    V F+DTC+SFS  R++ +
Sbjct  1     DKLLEGGLREGTVTELVGGSSSGKTQVCMQVAASVAYRCRAMVGFVDTCHSFSATRLSHM  60

Query  859   VSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA----RML  692
             +  +       A KS+ H       YS+FDIF M   ++ L +T+  Q         R+L
Sbjct  61    LGGLVGGD---AMKSIMH-------YSIFDIFPMLSFLNQLHTTLSVQVQSMEEKVMRLL  110

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             I+D  SS+I+PILG       ALM S G ILK+LA E++L VL+TNH V GE G  KPAL
Sbjct  111   IVDCASSVISPILG------HALMVSMGIILKKLALENHLAVLITNHTVGGEGGHPKPAL  164

Query  511   GESWKSIPHIRLLLSRDSARHISSISVLKHPNM  413
             GE+WK++P +RLLL+RD + ++   +V+KH +M
Sbjct  165   GETWKAMPSVRLLLARDFSSNLCHATVMKHTSM  197



>gb|KEH30106.1| DNA repair protein RAD51 [Medicago truncatula]
Length=194

 Score =   108 bits (269),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPL SL + YP+IDSNFQ FCASH I+SVEDFLLHD+ AL  SA  H+ S RLKQGI+Q
Sbjct  1     MAPLNSLSKEYPLIDSNFQTFCASHAIYSVEDFLLHDLDALFASAANHSNSERLKQGIHQ  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L  +DALH P LN L
Sbjct  61    LLLIVDALHPPVLNGL  76


 Score = 87.0 bits (214),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSP  878
             ST  + ID  L GGLR G L ELVGPSSSGKTQVC M +S VA++   V++LDT NSFSP
Sbjct  90    STGCEGIDALLGGGLRVGQLTELVGPSSSGKTQVCLMSSSTVAKNKCSVIYLDTGNSFSP  149

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVV  746
             +R+A  V Q SD   S  + SL+  + +IV    F + T   +V
Sbjct  150   QRIAYFVGQSSD-YVSVNQVSLDSDLLSIVWSLFFCLLTGHKIV  192



>ref|XP_009397502.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=268

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 102/146 (70%), Gaps = 5/146 (3%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCNSFSP  878
             T  K ID  L GGLR+G L E+VGPSSSGKTQVC   A  VA    G V+FLDTCNSFSP
Sbjct  91    TGCKGIDILLGGGLREGQLTEIVGPSSSGKTQVCLHSALGVADVHLGVVLFLDTCNSFSP  150

Query  877   KRVAEVVSQMSDNSTSKAKKS-LEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
              R+A +V+  SD    + K+  L+ +MS+I+C+S+FDIF + DV+H L+  ++ Q   SG
Sbjct  151   HRIAHMVNSQSDTLVKEGKEGRLKRIMSSILCHSLFDIFELLDVLHQLECKLKHQVKSSG  210

Query  709   CRARMLIIDSISSLITPILGGSGAHG  632
              R R+LI+DSISSLITPILGG  + G
Sbjct  211   NRIRLLIVDSISSLITPILGGKNSQG  236



>ref|XP_002963606.1| hypothetical protein SELMODRAFT_80718, partial [Selaginella moellendorffii]
 gb|EFJ35477.1| hypothetical protein SELMODRAFT_80718, partial [Selaginella moellendorffii]
Length=235

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 133/240 (55%), Gaps = 38/240 (16%)
 Frame = -1

Query  1036  DDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEV  860
             D  L GGL+DG + ELVGPSSSGKTQ+C   A+ VA      V ++D  +SFS +RV ++
Sbjct  1     DSLLKGGLKDGTITELVGPSSSGKTQLCMRSAACVAYHHKFSVAYVDASSSFSAERVLQM  60

Query  859   VSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMR----SQSG-CRARM  695
             +     +S +         M  I C+ V+D+  + +V+H L    R    S  G    R+
Sbjct  61    MCGRRCSSIAI------EAMRRIFCFKVYDVHGLLEVLHSLYDPARFVPISFPGPVHLRL  114

Query  694   LIIDSISSLITPILGGSGAHG--------------------------RALMASAGFILKQ  593
             +I+D ++S+++PILGG+ A G                            LM S G ILK 
Sbjct  115   VIVDCLASVLSPILGGNNAQGVNNCFKLDDAKQNLIFPFIFFCCNAGHTLMMSVGQILKT  174

Query  592   LANEHNLPVLVTNHMVAGEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNM  413
             +A   N+ VL+TN+ VA E   LKPALGESWKS+PH+RL+L++D   +  ++++LKH ++
Sbjct  175   IAINRNICVLITNNTVAAEDEELKPALGESWKSVPHVRLMLAKDHDNNSCTVTLLKHTSL  234



>ref|XP_010501364.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Camelina 
sativa]
Length=198

 Score = 94.7 bits (234),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 71/108 (66%), Gaps = 8/108 (7%)
 Frame = -1

Query  1036  DDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEV  860
             D  L GG R+G + ELVGPSSSGKTQ C   A++VA +  GRV++LDT NSFS +R+A+ 
Sbjct  97    DSLLKGGFREGLVTELVGPSSSGKTQFCMQAAASVAEKHDGRVLYLDTGNSFSARRIAQF  156

Query  859   VSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ  716
              S    + TS  +K     MS I C++V+DI+T+ + +  L  T+RSQ
Sbjct  157   GSS---SDTSLGQK----FMSRISCHTVYDIYTLLETLQGLDVTLRSQ  197


 Score = 82.8 bits (203),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK LE+  PIID++F+ FCASHGI +VEDFLLHD+  L   +++   S RLK+ I  
Sbjct  1     MAPLKHLEKENPIIDASFRYFCASHGILTVEDFLLHDLEVLAAFSDRQTNSDRLKEAITV  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ ++     WLN +
Sbjct  61    MLSLVERQCHSWLNGM  76



>ref|XP_002463279.1| hypothetical protein SORBIDRAFT_02g041080 [Sorghum bicolor]
 gb|EER99800.1| hypothetical protein SORBIDRAFT_02g041080 [Sorghum bicolor]
Length=237

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/219 (38%), Positives = 117/219 (53%), Gaps = 55/219 (25%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSP  878
             T ++ ID  L GGLR G L E+ GPSSSGKTQVC   AS+ A +  G V++LDT NSFSP
Sbjct  68    TGLEGIDTLLGGGLRQGQLTEVTGPSSSGKTQVCLHSASHAAVKHMGVVMYLDTSNSFSP  127

Query  877   KRVAEVV--SQMSDNS--TSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSG  710
              R+A ++  + +SD        K+ L+ +M +I+C SVFDIF MFD++H L+ ++ S   
Sbjct  128   SRIATIIDGTNLSDQRGFDLPPKERLKTLMKSIICESVFDIFGMFDILHQLEVSLLSDK-  186

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                                                              VTNHMV+   G
Sbjct  187   -------------------------------------------------VTNHMVSAGNG  197

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNM  413
              +KPALGESWK++PH+RL++SR+   +I + +VLKH  +
Sbjct  198   AVKPALGESWKAVPHVRLVISREHDSNICTATVLKHTQL  236



>ref|XP_006305442.1| hypothetical protein CARUB_v10009852mg, partial [Capsella rubella]
 gb|EOA38340.1| hypothetical protein CARUB_v10009852mg, partial [Capsella rubella]
Length=214

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 104/151 (69%), Gaps = 13/151 (9%)
 Frame = -1

Query  1066  RTASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCN  890
             +T S+  K +D  L GG R+G L ELVGPSSSGKTQ C   A++VA + +GRV++LDT N
Sbjct  68    QTLSSGDKGVDSLLKGGFREGQLTELVGPSSSGKTQFCMQAAASVAEKHAGRVLYLDTGN  127

Query  889   SFSPKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--  716
             SFS +R+A+     S + TS  +K    V+S I C++V+DI+TM +++  L  T+RSQ  
Sbjct  128   SFSARRIAQF---GSSSETSLGQK----VISRISCHTVYDIYTMLEILQGLDVTLRSQVQ  180

Query  715   ---SGCRARMLIIDSISSLITPILGGSGAHG  632
                +  R R+L++DSISSLITPILGGSG+ G
Sbjct  181   TNVNEQRLRLLVVDSISSLITPILGGSGSQG  211



>ref|XP_002974702.1| hypothetical protein SELMODRAFT_101803, partial [Selaginella 
moellendorffii]
 gb|EFJ24222.1| hypothetical protein SELMODRAFT_101803, partial [Selaginella 
moellendorffii]
Length=202

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 126/215 (59%), Gaps = 21/215 (10%)
 Frame = -1

Query  1036  DDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFSPKRVAEV  860
             D  L GGL+DG + ELVGPSSSGKTQ+C   A+ VA      V ++D  +SFS +RV ++
Sbjct  1     DSLLKGGLKDGTITELVGPSSSGKTQLCMHSAACVAYHHKFSVAYVDASSSFSAERVLQM  60

Query  859   VSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMR----SQSG-CRARM  695
             +     +S +         M  I C+ V+D+  + +V+H L    R    S  G    R+
Sbjct  61    MCGRRCSSIAI------EAMRRIFCFKVYDVHGLLEVLHSLYDPARFVPISFPGPVHLRL  114

Query  694   LIIDSISSLITPILGGSGAHGR-ALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKP  518
             +I+D ++S+++PILGG+ A G  + + S  ++L            +TN+ VA E   LKP
Sbjct  115   VIVDCLASVLSPILGGNNAQGLCSQVDSISYVLFYCK--------ITNNTVAAEDEELKP  166

Query  517   ALGESWKSIPHIRLLLSRDSARHISSISVLKHPNM  413
             ALGESWKS+PH+RL+L++D   +  ++++LKH ++
Sbjct  167   ALGESWKSVPHVRLMLAKDHDNNSCTVTLLKHTSL  201



>ref|XP_007436222.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Python 
bivittatus]
Length=339

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 118/202 (58%), Gaps = 9/202 (4%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFS  881
             ST ++ +D  L+ GL  G L ELVG  S+GKTQVC  +A+NV+ S  + V+++D+   F+
Sbjct  82    STGIESLDKLLDSGLYTGELTELVGAPSAGKTQVCLTVAANVSHSLKQTVLYIDSTGGFT  141

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ E+++ ++++   +A+      +  I  +  FD + M DV+  ++S M  Q   + 
Sbjct  142   GIRLLELLNCLTEDEEEQAE-----ALRRIQVFHAFDAYKMLDVLQEVRSYMAQQIFSTS  196

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                ++LI+DS+S++I P LG     G ALM      +K LA E  + +L+TNH+    +G
Sbjct  197   GPVKLLIVDSVSAVICPFLGLRQPDGMALMMHLAREMKTLAKEFGIAILLTNHVTRDTSG  256

Query  529   LLKPALGESWKSIPHIRLLLSR  464
               KPALG SW  IP+ RLLL +
Sbjct  257   GFKPALGRSWSFIPNTRLLLEK  278



>ref|XP_005327816.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Ictidomys 
tridecemlineatus]
Length=329

 Score =   134 bits (338),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 77/228 (34%), Positives = 124/228 (54%), Gaps = 15/228 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHGLQQNVLYIDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+ +++   + +   +A+      +  I     FDIF M DV+  L+ T+  Q  C +
Sbjct  143   ASRLLQLLQPRTQDEEEQAR-----ALQRIQVVRAFDIFQMLDVLQDLRGTVTQQVRCSS  197

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS++++++P+LGG    G ALM      LK LA E ++ V+VTNHM    ++
Sbjct  198   GTVKVVIVDSVTAVVSPLLGGQQRDGLALMMQLARELKTLARELSMAVVVTNHMTRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATG  404
             G  KPALG SW  +P  R+LL     +  S     ++S+ K P   TG
Sbjct  258   GKFKPALGRSWSFVPSTRILLDIIEGTGASGSSQRTVSLTKSPRQPTG  305



>ref|XP_006025805.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Alligator sinensis]
Length=329

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 126/237 (53%), Gaps = 19/237 (8%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST  K +D  L+ GL  G ++EL+G   SGKTQVC  IA++V+ S    V+F+D+   F+
Sbjct  83    STGNKSLDTLLDSGLYTGEVMELMGAPGSGKTQVCLSIAASVSHSLKQNVLFIDSTGGFT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+ ++V   ++    + +      +  I    VFDI+ M   +  L+  M  Q  C  
Sbjct  143   ASRLLQLVQSRTEEEEEQVE-----ALQRIQVAHVFDIYKMLAALQELQHCMSQQVVCSV  197

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA-GEA  533
                ++L++DS+S+++ P+ GG  + G ALM      LK LA E  L  +VTNH+     +
Sbjct  198   GPVKLLVVDSVSAVVCPLFGGRQSEGLALMMQLARELKTLAREFGLATVVTNHVTRDSSS  257

Query  532   GLLKPALGESWKSIPHIRLLLSRD-------SARHISSISVLKHPNMATGDRVEFQI  383
             G LKPALG SW  +P  R+LL R        S + I+S++  K P   TG +VE  I
Sbjct  258   GHLKPALGRSWSFVPSTRVLLERSQGALGKASTQRIASLT--KSPRQPTGIKVELDI  312



>gb|EMT02415.1| DNA repair RAD51-4-like protein [Aegilops tauschii]
Length=195

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/227 (38%), Positives = 113/227 (50%), Gaps = 73/227 (32%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNV-ARSSGRVVFLDTCNSFSPKRVAE  863
             ID  L GGLR G L E+ G SSSGKTQVC   A++V AR  G V++LDT NSFSP R+A 
Sbjct  12    IDTLLGGGLRKGQLTEITGQSSSGKTQVCLYSAAHVAARHMGAVLYLDTSNSFSPSRIAH  71

Query  862   VVSQMS------------DNSTSKAKKS--------LEHVMSNIVCYSVFDIFTMFDVVH  743
             ++ ++             D+  SK   S        L+ VMS+I+C SVFDIF +F+V+ 
Sbjct  72    ILDELPISLIKEITLKLLDHVISKHPISNMQPKDMRLKRVMSSIICESVFDIFALFEVLD  131

Query  742   HLKSTMRSQSGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVL  563
              L+ ++     C+                                               
Sbjct  132   RLEVSL----NCK-----------------------------------------------  140

Query  562   VTNHMVAGEAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKH  422
             VTNHMVAG  G  KPALGESWK+ PHIRL++SRD   +I + + LKH
Sbjct  141   VTNHMVAGN-GAPKPALGESWKAAPHIRLMISRDRGSNICTATTLKH  186



>gb|ABE02575.1| RAD51D splice variant f [Arabidopsis thaliana]
 gb|ABE02663.1| RAD51D splice variant f [Arabidopsis thaliana]
Length=174

 Score = 85.5 bits (210),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLK LE+  PIID+ FQ FCASHGI ++EDFLLHD++ L   +++   + RLK+GI  
Sbjct  1     MAPLKHLEKENPIIDACFQDFCASHGILTIEDFLLHDLYELTAFSQRQTNADRLKEGITL  60

Query  1083  VLASIDALHQPWLNAL  1036
             +L+ I+   +P +N L
Sbjct  61    ILSLIERQCRPLVNGL  76


 Score = 79.3 bits (194),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = -1

Query  1063  TASTVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSS-GRVVFLDTCNS  887
             T ST  K  D  L GG R+G L ELVGPSSSGKTQ C   A++VA +  GRV++LDT NS
Sbjct  88    TLSTGDKETDSLLQGGFREGQLTELVGPSSSGKTQFCMQAAASVAENHLGRVLYLDTGNS  147

Query  886   FSPKRVAEVVSQMSD  842
             FS +R+A+ +   SD
Sbjct  148   FSARRIAQFICSSSD  162



>ref|XP_009558453.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Cuculus canorus]
Length=329

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 128/231 (55%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G ++EL+G   SGKTQVC  IA++++ S  + V+FLD+   F+  R+  
Sbjct  89    LDQLLDSGLYTGEVMELMGAPGSGKTQVCLGIAASISLSLKQHVLFLDSTGGFTASRL--  146

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
               SQM    T   ++ LE  +  I    VFDI+ +   +  L+  +  Q   S    +++
Sbjct  147   --SQMLQAQTEDEEEQLE-ALQRIQVVRVFDIYEVLSALQELRDRLSQQVVSSMGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+++++ P+LGG  + G A+M      LK LA E +L V+VTN ++   + GLLKPA
Sbjct  204   VIDSVAAVVYPLLGGKQSEGLAIMMQLAGELKTLAREFSLAVVVTNQVIRDSSTGLLKPA  263

Query  514   LGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL    A       + I+S++  K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKEATWEKATTQRIASLA--KSPRQPTGIQVELDI  312



>gb|KFQ52520.1| DNA repair protein RAD51 4, partial [Pelecanus crispus]
Length=321

 Score =   132 bits (332),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 122/228 (54%), Gaps = 11/228 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+ S   RV+FLD+   F+  R+ +
Sbjct  78    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLSLKQRVLFLDSTAGFTASRLYQ  137

Query  862   VV-SQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARM  695
             ++ +Q  D     +   L   +  I    VFDI+ M   +  L+  +  Q   S    ++
Sbjct  138   MLRAQTGDEEEQASSPGLLEALQRIQVVRVFDIYEMLSALQELRDRLSQQVVSSVGPLKI  197

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKP  518
             ++IDS+S++I P+LGG  + G A+M      LK LA E +L ++VTN +    + G LKP
Sbjct  198   VVIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAREFSLAIVVTNQVTRDSSTGPLKP  257

Query  517   ALGESWKSIPHIRLLLSR-----DSARHISSISVLKHPNMATGDRVEF  389
             ALG SW  +P  R+LL       + A      S++K P   TG +VE 
Sbjct  258   ALGRSWSFVPSTRVLLESKEAIWEKATTQRVASLVKSPRQPTGIQVEL  305



>ref|XP_007067196.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Chelonia mydas]
Length=329

 Score =   132 bits (332),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/237 (37%), Positives = 131/237 (55%), Gaps = 19/237 (8%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST  + +D  L+ GL  G + EL G   SGKTQVC  IA + +      V+++D+   F+
Sbjct  83    STGSESLDKLLDSGLYTGEVTELTGAPGSGKTQVCLSIAVSSSHDLKQNVLYVDSTGGFT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+     Q++   T   ++ +E  +  I    VFD++ M DV+  L+ ++  Q    +
Sbjct  143   ASRLL----QLAQTRTGDEEEQVE-ALQRIQVARVFDVYKMLDVLQELRCSVSQQVLSSS  197

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA-GEA  533
                ++L++DS+S++I P+LGG  A G ALM      LK LA E N+ V+VTNH+   G +
Sbjct  198   GPVKVLVVDSVSAVICPLLGGRQAEGLALMMQLARELKTLARELNVAVVVTNHVTRDGSS  257

Query  532   GLLKPALGESWKSIPHIRLLL-SRD------SARHISSISVLKHPNMATGDRVEFQI  383
             G LKPALG SW  +P  R+LL SR+      SAR ++S++  K P   TG  VE  I
Sbjct  258   GHLKPALGRSWSFVPSTRVLLESREGTWGKASARRLASLT--KSPRQPTGIEVELDI  312



>gb|KFV11722.1| DNA repair protein RAD51 4, partial [Tauraco erythrolophus]
Length=299

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 126/236 (53%), Gaps = 19/236 (8%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSP  878
             T +  +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+ 
Sbjct  57    TGIPSLDQLLDSGLYTGEVTELMGSPGSGKTQVCLGIAASVSLGLKQHVLFLDSTAGFTA  116

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGC  707
              R+ +++   +++   +AK      +  I    VFDI+ M   +  L+  +  Q   S  
Sbjct  117   SRLYQMLQSQAEDEKEQAK-----ALQRIQVVRVFDIYEMLSALQELQDRLSQQVVSSTG  171

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-G  530
               ++++IDS+S++I P+LG   + G A+M      LK LA E +L V+VTN +    + G
Sbjct  172   PVKVVVIDSVSAVIYPLLGSKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTG  231

Query  529   LLKPALGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQI  383
             LLKPALG +W  +P  R+LL    A       + ++S++  K P   TG  VE  I
Sbjct  232   LLKPALGRTWSFVPSTRVLLESKEATWEKATTKRVASLA--KSPRQPTGIEVELDI  285



>ref|XP_008846371.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Nannospalax galili]
Length=330

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 121/229 (53%), Gaps = 16/229 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G L E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIASLDKLLDAGLYTGELTEIVGAPGSGKTQVCLCVAANVAHSLQQNVLYIDSNGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A+      +  I     FDIF M DV+  L+ T+  Q   S 
Sbjct  143   ASRLLQLLQARTQDEEKQAE-----ALQRIQVVHAFDIFQMLDVLQDLRGTVVQQVTGSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGE-A  533
                +++I+DS+++++ P+LGG    G ALM      LK LA +  + V+VTNH+     +
Sbjct  198   GTVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKTLARDLGVAVVVTNHLTRDRSS  257

Query  532   GLLKPALGESWKSIPHIRLLLS-RDSARHISSIS-----VLKHPNMATG  404
             G LKPALG SW  +P  R+ L   D AR   S S     + K P   TG
Sbjct  258   GRLKPALGRSWSFVPSTRIFLDVTDGARASGSGSQRTACLTKSPRQPTG  306



>ref|XP_005309892.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Chrysemys picta 
bellii]
Length=329

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 130/237 (55%), Gaps = 19/237 (8%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST  K +D  L+ GL  G + EL G  SSGKTQVC  IA + +      V+++D+   F+
Sbjct  83    STGSKSLDKLLDSGLYTGEVTELTGAPSSGKTQVCLSIAVSTSHDLKQNVLYVDSTGGFT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+     Q++   T   ++ +E  +  I    VFD++ M DV+  L+ ++  Q    +
Sbjct  143   ASRLL----QLAQTRTGDEEEQVE-ALQRIQVARVFDVYKMLDVLQELRCSVSQQVLSSS  197

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA-GEA  533
                ++L++DS+S++I P+LGG  A G A+M      LK LA E ++ V+VTNH+   G +
Sbjct  198   GPVKVLVVDSVSAVICPLLGGRQAEGLAIMMQLARELKTLARELSMAVVVTNHVTRDGSS  257

Query  532   GLLKPALGESWKSIPHIRLLL-SRD------SARHISSISVLKHPNMATGDRVEFQI  383
             G LKPALG SW  +P  R+LL SR+      S   I+S++  K P   TG  VE  I
Sbjct  258   GHLKPALGRSWSFVPSTRVLLESREGTWGQASTHRIASLT--KSPRQPTGIEVELDI  312



>ref|XP_548263.2| PREDICTED: DNA repair protein RAD51 homolog 4 isoformX2 [Canis 
lupus familiaris]
Length=328

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 120/228 (53%), Gaps = 16/228 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      VV++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAYGLQQNVVYIDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ----S  713
               R+ +++   + +   +A       +  I     FDIF M DV+   + T+  Q    S
Sbjct  143   ASRILQLLQARTPDEEVQA-----GALQRIQVVRAFDIFQMLDVLQDCRGTLSQQVSSAS  197

Query  712   GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-E  536
             G   +++I+DS++++++P+LGG    G ALM      LK LA +  + V+VTNHM    +
Sbjct  198   GT-VKVVIVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHMTRDRD  256

Query  535   AGLLKPALGESWKSIPHIRLLLSRDSARHISS----ISVLKHPNMATG  404
             +G LKPALG SW  +P  R+LL  D     S       + K P + TG
Sbjct  257   SGELKPALGRSWSFVPSTRILLDIDEGARASGSWRRACLTKSPRLPTG  304



>ref|XP_010132247.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Buceros 
rhinoceros silvestris]
Length=301

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 126/231 (55%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+ S  + V+FLD+   F+  R+ +
Sbjct  61    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLSLKQHVLFLDSTGGFTASRLYQ  120

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++     K+     +  I    VFDI+     +  L+  +  Q   S    +++
Sbjct  121   MLQAQAED-----KEEQLETLQRIQVVRVFDIYETLSALQELRDRLSQQVESSMGPLKIV  175

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA-GEAGLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +     +G LKPA
Sbjct  176   VIDSVSAVIYPLLGGRQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSSGPLKPA  235

Query  514   LGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL        + +A+ I+S++  K P   TG RVE  I
Sbjct  236   LGRSWSFVPSTRVLLETKEAAWEKATAQRIASLA--KSPRQPTGIRVELVI  284



>gb|AHN60061.1| RAD51D variant 2 [Oryza sativa Japonica Group]
Length=184

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 95/145 (66%), Gaps = 5/145 (3%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNV-ARSSGRVVFLDTCNSFSPKRVAE  863
             +D  L GGLR G L E+ G SSSGKTQVC   AS+V AR  G V++LDT NSFSP R+A 
Sbjct  32    VDALLGGGLRQGQLTEITGQSSSGKTQVCLCSASHVAARQLGVVMYLDTSNSFSPSRIAR  91

Query  862   VVSQMSDNSTSKAKK-SLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARM  695
             +V     +   + K   LE VMS+I+C SVFDIF +F+V+H L+ +++S+    G +  +
Sbjct  92    IVDGFPISLVREPKNVRLERVMSSIICKSVFDIFDLFEVLHQLELSLKSKVNNGGNKICL  151

Query  694   LIIDSISSLITPILGGSGAHGRALM  620
             LIIDSISS++ PI GG    G  ++
Sbjct  152   LIIDSISSILAPINGGKYPRGTCIV  176



>ref|XP_008928651.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Manacus vitellinus]
Length=329

 Score =   129 bits (324),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 83/231 (36%), Positives = 128/231 (55%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+ S   +V+FLD+   F    +A 
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLSLKQQVLFLDSTGGF----IAS  144

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
              + QM    T   ++ LE  +  I    VFD++ M   +  L+  +  Q   S    +++
Sbjct  145   RLYQMLQAQTEDEEEQLE-ALQRIQVARVFDVYEMLSALQELRDRLSQQVMSSTGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGRQSEGLAIMMQLSRELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLL-SRDSA------RHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL SR+++      R +++++  K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESREASWDKGTTRRVAALA--KSPRQPTGLQVELDI  312



>ref|XP_009483052.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Pelecanus 
crispus]
Length=331

 Score =   129 bits (323),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 121/227 (53%), Gaps = 15/227 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+ S   RV+FLD+   F+  R+  
Sbjct  91    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLSLKQRVLFLDSTAGFTASRLY-  149

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM    T   ++ LE  +  I    VFDI+ M   +  L+  +  Q   S    +++
Sbjct  150   ---QMLRAQTGDEEEQLEA-LQRIQVVRVFDIYEMLSALQELRDRLSQQVVSSVGPLKIV  205

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L ++VTN +    + G LKPA
Sbjct  206   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAREFSLAIVVTNQVTRDSSTGPLKPA  265

Query  514   LGESWKSIPHIRLLLSR-----DSARHISSISVLKHPNMATGDRVEF  389
             LG SW  +P  R+LL       + A      S++K P   TG +VE 
Sbjct  266   LGRSWSFVPSTRVLLESKEAIWEKATTQRVASLVKSPRQPTGIQVEL  312



>ref|XP_009978659.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Tauraco 
erythrolophus]
Length=315

 Score =   128 bits (321),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 82/236 (35%), Positives = 124/236 (53%), Gaps = 19/236 (8%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSP  878
             T +  +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+ 
Sbjct  70    TGIPSLDQLLDSGLYTGEVTELMGSPGSGKTQVCLGIAASVSLGLKQHVLFLDSTAGFTA  129

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGC  707
              R+     QM  +     K+ LE  +  I    VFDI+ M   +  L+  +  Q   S  
Sbjct  130   SRLY----QMLQSQAEDEKEQLE-ALQRIQVVRVFDIYEMLSALQELQDRLSQQVVSSTG  184

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-G  530
               ++++IDS+S++I P+LG   + G A+M      LK LA E +L V+VTN +    + G
Sbjct  185   PVKVVVIDSVSAVIYPLLGSKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTG  244

Query  529   LLKPALGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQI  383
             LLKPALG +W  +P  R+LL    A       + ++S++  K P   TG  VE  I
Sbjct  245   LLKPALGRTWSFVPSTRVLLESKEATWEKATTKRVASLA--KSPRQPTGIEVELDI  298



>gb|KFM62106.1| DNA repair protein RAD51-like protein, partial [Stegodyphus mimosarum]
Length=313

 Score =   128 bits (321),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/230 (33%), Positives = 126/230 (55%), Gaps = 11/230 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASN-VARSSGRVVFLDTCNSFS  881
             ST  K ID FL GG+  G + E+ GP+ SGKTQ CF I  N + ++   V++LD+ + F+
Sbjct  83    STGSKRIDKFLLGGIYTGEVTEVHGPAGSGKTQFCFSILCNLICKTKNTVLYLDSGSHFN  142

Query  880   PKRVAEVV-SQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSG--  710
              KR+ ++V S+++D  T   K      + N+   +V+DI+ +FD +  +K  +  +    
Sbjct  143   AKRIEQIVMSKLNDAQTVPDK------LKNVKIVNVYDIYNLFDCLDDIKCKLHEKEDRF  196

Query  709   -CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA  533
                 ++LIIDSI+ L+ P  GG    G  LM++     + L  EH L ++V+N+ V  + 
Sbjct  197   YKYLKVLIIDSITPLLAPCFGGKILDGPGLMSNVAQQFRTLCCEHMLSIIVSNNTVRDQN  256

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVEFQI  383
               +KPALG +WK +P + L L + +A  +  ++ +K       + V F I
Sbjct  257   CGIKPALGPNWKYVPSVSLCLHKVNATSLRRMTAIKSCRRDLSEEVMFNI  306



>ref|XP_006219509.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Vicugna pacos]
Length=328

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 123/230 (53%), Gaps = 20/230 (9%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  ++++VA      V+++D+   F+
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVSAHVAHGLQQNVLYIDSNGGFT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M D++  L+ T+  Q   S 
Sbjct  143   ASRILQLLQARTPDEEEQA-----GALQRIQVVRAFDIFQMLDMIQDLRGTVAQQVSSSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS++++++P+LGG    G ALM      LK LA +  + V+VTNHM    + 
Sbjct  198   GTLKVVIVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGVAVVVTNHMTRDRDT  257

Query  532   GLLKPALGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATG  404
             G LKPALG SW  +P  R LL       + DS R    + ++K P + TG
Sbjct  258   GKLKPALGRSWSFVPSTRFLLDVTKGTGASDSQRM---VCLMKSPRLPTG  304



>gb|KFW86401.1| DNA repair protein RAD51 4, partial [Manacus vitellinus]
Length=335

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/236 (35%), Positives = 132/236 (56%), Gaps = 20/236 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+ S   +V+FLD+   F   R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLSLKQQVLFLDSTGGFIASRLYQ  148

Query  862   VVSQMSDN-----STSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGC  707
             ++   +++     S+  A  SLE  +  I    VFD++ M   +  L+  +  Q   S  
Sbjct  149   MLQAQTEDEEEQASSPGAGPSLE-ALQRIQVARVFDVYEMLSALQELRDRLSQQVMSSTG  207

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-G  530
               ++++IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G
Sbjct  208   PLKIVVIDSVSAVIYPLLGGRQSEGLAIMMQLSRELKTLAREFSLAVVVTNQVTRDSSTG  267

Query  529   LLKPALGESWKSIPHIRLLL-SRDSA------RHISSISVLKHPNMATGDRVEFQI  383
              LKPALG SW  +P  R+LL SR+++      R +++++  K P   TG +VE  I
Sbjct  268   PLKPALGRSWSFVPSTRVLLESREASWDKGTTRRVAALA--KSPRQPTGLQVELDI  321



>ref|XP_010170093.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Caprimulgus carolinensis]
Length=329

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 125/229 (55%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+ S  + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLSLKQHVLFLDSTAGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++     ++ LE  +  I    VFDI+ M   +  L+  +  Q   S    +++
Sbjct  149   MLQARAEDE----EEQLE-ALQRIQVIRVFDIYEMLSALQELRDRLSQQVVSSVGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAKEFSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLLSRDSARHISSI-----SVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL    A    +      S++K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKEATWEKATTQRVASLVKSPRQPTGIQVELDI  312



>ref|XP_005327817.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Ictidomys 
tridecemlineatus]
Length=324

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 123/228 (54%), Gaps = 20/228 (9%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHGLQQNVLYIDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+ +++   + +   +A+      +  I     FDIF M DV+  L+ T+  Q  C +
Sbjct  143   ASRLLQLLQPRTQDEEEQAR-----ALQRIQVVRAFDIFQMLDVLQDLRGTVTQQVRCSS  197

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS++++++P+LG     G ALM      LK LA E ++ V+VTNHM    ++
Sbjct  198   GTVKVVIVDSVTAVVSPLLG-----GLALMMQLARELKTLARELSMAVVVTNHMTRDRDS  252

Query  532   GLLKPALGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATG  404
             G  KPALG SW  +P  R+LL     +  S     ++S+ K P   TG
Sbjct  253   GKFKPALGRSWSFVPSTRILLDIIEGTGASGSSQRTVSLTKSPRQPTG  300



>gb|KGL83685.1| DNA repair protein RAD51 4, partial [Tinamus guttatus]
Length=303

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 125/237 (53%), Gaps = 18/237 (8%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFS  881
             ST +  +D  L+ GL  G ++E++G   SGKTQVC  IA++      + V+FLD+   F+
Sbjct  59    STGIPSLDKLLDSGLYTGEVMEIMGAPGSGKTQVCLSIAASACLGLKQHVLFLDSTGGFT  118

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-SGCR  704
               R+     QM    T   ++    + S +    VF+I+ M   +  L+ ++  Q   C 
Sbjct  119   ASRL----HQMLQAETEDEEEQASSLRSRVQVARVFNIYEMLGALQELRDSLSQQVMSCT  174

Query  703   A--RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGE-A  533
                ++++IDS+S++I P+LGG  + G ALM      LK LA E +L V+VTN +     A
Sbjct  175   GPLKVVLIDSVSAVIYPLLGGKQSEGLALMMQLARELKMLAREFSLAVVVTNQVTRDSGA  234

Query  532   GLLKPALGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             G LKPALG SW  +P  RLLL        +   + ++S++  K P   TG +VE  I
Sbjct  235   GPLKPALGRSWSFVPSTRLLLESKEVAWEKGGTQRVASLA--KSPRQPTGIQVELDI  289



>ref|XP_005010701.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Anas platyrhynchos]
Length=329

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 125/229 (55%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLSIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS-GCRA--RML  692
             ++   +++     ++ LE  +  I    VFD++ M   +  ++  +  Q+  C    + +
Sbjct  149   MLQAQAEDE----EEQLE-ALQRIQVARVFDVYEMLSALQEVRDRLSQQAVSCTGPLKTV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + GLLKPA
Sbjct  204   LIDSVSAVIHPLLGGRQSEGLAIMMQLARELKMLAKEFSLAVVVTNQVTRDSSTGLLKPA  263

Query  514   LGESWKSIPHIRLLLSR-----DSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL       + A    S S+ K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKGAPWEEATTRRSASLAKSPRQPTGMQVELDI  312



>ref|XP_009705022.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Cariama 
cristata]
Length=309

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 127/229 (55%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   FS  R+ +
Sbjct  69    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFSASRLYQ  128

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++     ++ LE  +  I    VFD++ M   +  L+  +  Q   S    ++ 
Sbjct  129   MLRSRAEDE----EEQLE-ALQRIQVVRVFDVYEMLSALQELRDRLSQQVVSSVGPLKIT  183

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + GLLKPA
Sbjct  184   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTGLLKPA  243

Query  514   LGESWKSIPHIRLLL-SRDSARHISSI----SVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL S+++A   ++     S+ K P    G +VE  I
Sbjct  244   LGRSWSFVPSTRVLLESKEAAWEKTTTQRIASLAKSPRQPVGIQVELDI  292



>emb|CDQ64183.1| unnamed protein product [Oncorhynchus mykiss]
Length=334

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 118/218 (54%), Gaps = 10/218 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G L EL G   SGKTQVCF +A N++    + V+++D+    S  R+ +
Sbjct  89    LDKLLDSGLYTGELTELAGGPGSGKTQVCFGVAVNISYQLKQSVIYVDSTGGLSASRLLQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS---GCRARML  692
             ++   S N   + +      +  I  + VFDIF++   +HH +     Q+   G   + +
Sbjct  149   MLQAKSCNIEEQME-----ALQRIQVFPVFDIFSLLGCLHHFRCVGLQQASAGGGSVKAV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             I+DS+S++I+PILGG    G ++M     +LK +A + N+ VLVTN +     G LK  L
Sbjct  204   IVDSVSAVISPILGGKQNEGMSMMTQVAGLLKTIAKDFNVAVLVTNTVTRDGNGQLKAGL  263

Query  511   GESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDR  398
             G++W  +P IR+LL R   R  S+ S ++   +A   R
Sbjct  264   GQTWSHVPRIRILLQR-LERPGSTCSSVRTATLAKSSR  300



>gb|KFO98486.1| DNA repair protein RAD51 4, partial [Calypte anna]
Length=325

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/236 (34%), Positives = 125/236 (53%), Gaps = 20/236 (8%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSP  878
             T +  +D  L+ GL  G + EL+G   SGKTQVC  IA+ ++ S   RV+FLD+    + 
Sbjct  84    TGIPSLDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAATMSLSLKHRVLFLDSTGGLTA  143

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGC  707
              R+ +++    ++   +A       +  I    VFDI+ M   +  L+  +  Q   S  
Sbjct  144   SRLYQMLQARVEDEEEQA------TLQRIQVVRVFDIYEMLSALQELRDCLSQQVLSSVG  197

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-G  530
               +++IIDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G
Sbjct  198   PLKIVIIDSVSAVIYPLLGGKQSEGLAIMMQLARELKSLAREFSLTVVVTNQVTRDSSTG  257

Query  529   LLKPALGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
              LKPALG SW  +P  R+LL        + S + ++S++  K P   TG +VE  I
Sbjct  258   PLKPALGRSWSFVPSTRVLLESKEATWEKASTQRVASLA--KSPRQPTGIQVELNI  311



>ref|XP_005502029.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Columba livia]
Length=329

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 123/231 (53%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+  
Sbjct  89    LDKLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRL--  146

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM    T   ++ LE  +  I     FDI+ M   +  L+  +  Q   S    +++
Sbjct  147   --YQMLQARTEDEEEQLE-ALQRIQVVRAFDIYEMLSALQDLRDRLSQQVVSSMGPLKVV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + GLLKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLAKELKTLAREFSLAVVVTNQVTRDSSTGLLKPA  263

Query  514   LGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL    A       + ++S++  K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKEATWEKVTTQRVASLA--KSPRQPTGIQVELDI  312



>ref|XP_010950147.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Camelus bactrianus]
Length=328

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 122/230 (53%), Gaps = 20/230 (9%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  ++++VA      V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVSAHVAHGLQQNVLYIDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M DV+  L+ T+  Q   S 
Sbjct  143   ASRILQLLQARTPDEEEQA-----GALQRIQVVRAFDIFQMLDVIQDLRGTVAQQVSSSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS++++++P+LGG    G ALM      LK LA +  + V+VTNHM    + 
Sbjct  198   GTLKVVIVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGVAVVVTNHMTRDRDT  257

Query  532   GLLKPALGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATG  404
             G LKPALG SW  +P  R LL       + DS R    + ++K P + TG
Sbjct  258   GKLKPALGRSWSFVPSTRFLLDVTKGTGASDSQRM---VCLMKSPRLPTG  304



>ref|XP_010293844.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Phaethon lepturus]
Length=329

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 125/231 (54%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G ++EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+  
Sbjct  89    LDQLLDSGLYTGEVMELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLY-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM  + T   ++ LE  +  I    VF+I+ M   +  L+  +  Q   S    +++
Sbjct  148   ---QMLGSQTEDEEEQLE-ALQRIQVVRVFNIYEMLSALQELRDRLSQQVVSSMGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL    A       + ++S++  K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKEATWEKATTKRVASLA--KSPRQPTGIQVELDI  312



>ref|XP_006181449.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Camelus 
ferus]
Length=246

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 119/224 (53%), Gaps = 20/224 (9%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + E+VG   SGKTQVC  ++++VA      V+++D+    +  R+ +
Sbjct  7     LDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVSAHVAHGLQQNVLYIDSNGGLTASRILQ  66

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   + +   +A       +  I     FDIF M DV+  L+ T+  Q   S    +++
Sbjct  67    LLQARTPDEEEQAG-----ALQRIQVVRAFDIFQMLDVIQDLRGTVAQQVSSSSGTLKVV  121

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EAGLLKPA  515
             I+DS++++++P+LGG    G ALM      LK LA +  + V+VTNHM    + G LKPA
Sbjct  122   IVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGVAVVVTNHMTRDRDTGKLKPA  181

Query  514   LGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATG  404
             LG SW  +P  R LL       + DS R    + ++K P + TG
Sbjct  182   LGRSWSFVPSTRFLLDVTKGTGASDSQRM---VCLMKSPRLPTG  222



>ref|XP_008488934.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Calypte anna]
Length=329

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 83/236 (35%), Positives = 124/236 (53%), Gaps = 19/236 (8%)
 Frame = -1

Query  1054  TVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSP  878
             T +  +D  L+ GL  G + EL+G   SGKTQVC  IA+ ++ S   RV+FLD+    + 
Sbjct  84    TGIPSLDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAATMSLSLKHRVLFLDSTGGLTA  143

Query  877   KRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGC  707
              R+     QM        ++ LE  +  I    VFDI+ M   +  L+  +  Q   S  
Sbjct  144   SRLY----QMLQARVEDEEEQLE-ALQRIQVVRVFDIYEMLSALQELRDCLSQQVLSSVG  198

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-G  530
               +++IIDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G
Sbjct  199   PLKIVIIDSVSAVIYPLLGGKQSEGLAIMMQLARELKSLAREFSLTVVVTNQVTRDSSTG  258

Query  529   LLKPALGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
              LKPALG SW  +P  R+LL        + S + ++S++  K P   TG +VE  I
Sbjct  259   PLKPALGRSWSFVPSTRVLLESKEATWEKASTQRVASLA--KSPRQPTGIQVELNI  312



>ref|XP_006101991.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Myotis 
lucifugus]
Length=328

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 125/231 (54%), Gaps = 18/231 (8%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGVPGSGKTQVCLCVAANVAHGLQQNVLYVDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M DV+  L+ ++  Q   S 
Sbjct  143   ASRILQLLQARTPDEEEQA-----GALQRIQVVRAFDIFQMLDVLQGLRGSVAQQVSHSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS++++++P+LGG    G ALM      LK LA +  + V+VTNHM    ++
Sbjct  198   GTVKVVIVDSVTAVVSPLLGGQQREGLALMMQLALELKTLARDLGVAVVVTNHMTRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLLS------RDSARHISSISVLKHPNMATGDR  398
             G LKPALG SW  +P  R++L+         ++H + ++  K P + TG +
Sbjct  258   GKLKPALGRSWSFVPSTRVILAIGEGAGAPGSQHTACLT--KSPRLPTGSQ  306



>ref|XP_010297991.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Balearica regulorum 
gibbericeps]
Length=329

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 128/229 (56%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++     ++ LE  +  I    VFD++ M   +  L+  +  Q   S    +++
Sbjct  149   MLRARAEDE----EEQLE-ALQRIQVVRVFDVYEMLSALQELRDRLSQQVVSSAGPFKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLL-SRDSARHISSI----SVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL S+++A   ++     S+ K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKEAAWEKATTQRVASLAKSPRQPTGIQVELDI  312



>ref|XP_010121918.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Chlamydotis macqueenii]
Length=329

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 127/229 (55%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G L EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGELTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++     ++ LE  +  I    VFDI+ M   +  L+  +  Q   S    +++
Sbjct  149   MLRAQAEDE----EEQLE-ALQRIQVVRVFDIYEMLSALQELRDRLSQQVLSSVGPLKVV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAREFSLTVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLL-SRDSARHISSI----SVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL S+++     +     S++K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKETTWEKGTTQRVASLVKSPRQPTGIQVELDI  312



>ref|XP_006154463.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Tupaia chinensis]
 gb|ELW61717.1| DNA repair protein RAD51 like protein 4 [Tupaia chinensis]
Length=328

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 113/201 (56%), Gaps = 10/201 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             +T +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+     
Sbjct  83    ATGIGSLDKLLDAGLYTGEVTEIVGGPRSGKTQVCLCVAANVAHSLQQNVLYIDSSGGLM  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M DV+  L+ T+  Q   S 
Sbjct  143   ASRLLQLLQARTQDEEEQA-----GALQRIQVVHAFDIFQMLDVLQDLRGTVAQQVTSSL  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++++DS++++++PILGG    G ALM      LK LA + ++ VLVTNH +   ++
Sbjct  198   GTVKVIVVDSVTAVVSPILGGQQREGLALMMQLARELKTLARDLSVAVLVTNHTIRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLL  470
             G LKPALG SW  +P  R+LL
Sbjct  258   GRLKPALGRSWSFVPSTRILL  278



>ref|XP_009643313.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Egretta garzetta]
Length=329

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 123/229 (54%), Gaps = 19/229 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  RV  
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRVY-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM    T   ++ LE  +  I    VFDI+ M   +  L+  +  Q   S    +++
Sbjct  148   ---QMLRAQTEDEEEQLE-ALQRIQVVRVFDIYEMLSALQELRDRLSQQVVNSMGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLARELSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLLS-------RDSARHISSISVLKHPNMATGDRVEF  389
             LG SW  +P  R+LL        + + + ++S++  K P   TG +VE 
Sbjct  264   LGRSWSFVPSTRVLLESKETTLGKGTTQRVASLA--KSPRQPTGIQVEL  310



>ref|XP_003495849.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Cricetulus griseus]
 ref|XP_007608658.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Cricetulus griseus]
 gb|EGV94391.1| DNA repair protein RAD51-like 4 [Cricetulus griseus]
Length=329

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 119/228 (52%), Gaps = 15/228 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSSGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+ +++   + +   +A       +  I    VFDIF M D++  L+ +M  QS   +
Sbjct  143   ASRLLQLLQARTQDEEKQA-----GALQRIQVVHVFDIFQMLDMLQDLRGSMAQQSTSSS  197

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                +++I+DS++++I P+LGG    G ALM      LK LA +  + V+VTNH+     G
Sbjct  198   GTVKVVIVDSVTAVIAPLLGGQQREGLALMMQLARELKILARDLAVAVVVTNHLTRDRDG  257

Query  529   -LLKPALGESWKSIPHIRLLLSRDS-----ARHISSISVLKHPNMATG  404
                KPALG SW  +P  R+LL          R   ++ + K P   TG
Sbjct  258   RRFKPALGRSWSFVPSTRILLDVTKGAGTLGRGQRTVCLTKSPRQPTG  305



>ref|NP_996959.1| DNA repair protein RAD51 homolog 4 [Danio rerio]
 gb|AAH66407.1| Zgc:77165 [Danio rerio]
Length=327

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 111/205 (54%), Gaps = 9/205 (4%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL G   SGKTQVCF +A N++    + VV++DT       R+  
Sbjct  89    LDKLLDSGLYTGEITELTGSPGSGKTQVCFSVAVNISHQLKQTVVYIDTKGGMCANRLL-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKST---MRSQSGCRARML  692
                QM    T   ++ +E  +  I  + VFD+F++   + +L+ST     S  G   + L
Sbjct  148   ---QMLQTKTPNEQEQME-ALQKIKVFRVFDVFSLLACLQNLRSTGLQKMSVGGGSVKAL  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             ++DS+S++++PILGG    G +L+      LK +A + N+ VLVTNH+     G +K  L
Sbjct  204   MVDSVSAVLSPILGGKQNEGMSLLMQVAGELKMIAKDFNIAVLVTNHVTKDGNGQVKAGL  263

Query  511   GESWKSIPHIRLLLSRDSARHISSI  437
             G SW  +P  R+LL R     ISS+
Sbjct  264   GLSWSHVPRTRVLLQRVENEEISSL  288



>gb|KFP70732.1| DNA repair protein RAD51 4, partial [Acanthisitta chloris]
Length=326

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 124/229 (54%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++   +        +  I    VFDI+ M   +  L+  +  Q   S    +++
Sbjct  149   MLRAQTEDEEEQV-----EALQRIQVVRVFDIYEMLRALQELRDRLSQQVVSSMGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKSLAREFSLAVVVTNQVTRDSSTGALKPA  263

Query  514   LGESWKSIPHIRLLL-SRDSARHISSI----SVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL S+++    ++     S+ K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKETTLEKATTERVASLAKSPRQPTGIQVELNI  312



>ref|XP_010400787.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Corvus cornix 
cornix]
Length=329

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 123/231 (53%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G S SGKTQVC  IA++V+    + V+FLD+   F+  R+  
Sbjct  89    LDQLLDSGLYTGEVTELMGASGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLY-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM    T   ++ LE  +  I    VF I+ +   +  L+  +  Q   S    +M+
Sbjct  148   ---QMLRAQTEDEEEQLE-ALQRIQVVRVFSIYELLSALQELRDRLSQQVVSSMGPLKMM  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             ++DS+S++I P+LGG  + G ALM      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VLDSVSAVIYPLLGGRQSEGLALMMQLSRELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL    A       + ++S++  K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKEATWEKATTQRVASLA--KSPRQPTGIQVELDI  312



>ref|XP_006274258.1| PREDICTED: DNA repair protein RAD51 homolog 4-like, partial [Alligator 
mississippiensis]
Length=302

 Score =   125 bits (314),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 112/203 (55%), Gaps = 10/203 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST  K +D  L+ GL  G ++EL+G   SGKTQVC  IA++V+ S    V+F+D+   F+
Sbjct  83    STGNKSLDTLLDSGLYTGEVMELMGAPGSGKTQVCLSIAASVSHSLKQNVLFIDSTGGFT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ ++V   ++    + +      +  I    VFDI+ M   +  L+  M  Q   SG
Sbjct  143   ASRLLQLVQFRTEEEEEQVE-----ALQRIQVAHVFDIYKMLAALQELRHCMSQQVVCSG  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA-GEA  533
                ++L++DS+S+++ P+ GG  + G ALM      LK LA E  L  +VTNH+     +
Sbjct  198   GPVKLLVVDSVSAVVCPLFGGRQSEGLALMMQLARELKTLAREFGLATVVTNHVTRDSSS  257

Query  532   GLLKPALGESWKSIPHIRLLLSR  464
             G LKPALG SW  +P  R+LL R
Sbjct  258   GHLKPALGRSWSFVPSTRVLLER  280



>ref|XP_009573114.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Fulmarus glacialis]
Length=329

 Score =   125 bits (315),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 124/230 (54%), Gaps = 21/230 (9%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + VVFLD+   F+  RV  
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVVFLDSTGGFTASRV--  146

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM    T   ++ LE  +  I    VFD++ M   +  L+  +  Q   S    +++
Sbjct  147   --YQMLRARTEDEEEQLE-ALQRIQVVRVFDVYEMLSALQELRDRLSQQVVSSVGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLLSRDSA-------RHISSISV-LKHPNMATGDRVEF  389
             LG SW  +P  R+LL R  A       + ++S++  L+ P   TG +VE 
Sbjct  264   LGRSWSFVPSTRVLLERKEAAWEKATMQRVASLAKSLRQP---TGIQVEL  310



>ref|XP_009076072.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Acanthisitta chloris]
Length=329

 Score =   125 bits (315),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 124/229 (54%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++   +        +  I    VFDI+ M   +  L+  +  Q   S    +++
Sbjct  149   MLRAQTEDEEEQV-----EALQRIQVVRVFDIYEMLRALQELRDRLSQQVVSSMGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKSLAREFSLAVVVTNQVTRDSSTGALKPA  263

Query  514   LGESWKSIPHIRLLL-SRDSARHISSI----SVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL S+++    ++     S+ K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKETTLEKATTERVASLAKSPRQPTGIQVELNI  312



>ref|XP_010201104.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Colius 
striatus]
Length=323

 Score =   125 bits (314),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/228 (34%), Positives = 122/228 (54%), Gaps = 15/228 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQ+C  IA++V+    + VVFLD+   F+  R+ +
Sbjct  83    LDQLLDSGLYTGEVTELMGAPGSGKTQLCLGIAASVSLGLKQHVVFLDSTGGFTASRLYQ  142

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++     ++ LE  +  +    VFD++ M   +  L+  +  Q   S    +++
Sbjct  143   MLRAQAEDE----EEQLE-ALQRVQVIRVFDVYEMLRALQELRDRLSQQVMSSVAPLKVV  197

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV-AGEAGLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +      G LKPA
Sbjct  198   VIDSVSAVIYPVLGGRQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRESSTGPLKPA  257

Query  514   LGESWKSIPHIRLLLSRDSARHISSI-----SVLKHPNMATGDRVEFQ  386
             LG SW  +P  RLLL    A    +      S+ K P   TG +VE +
Sbjct  258   LGRSWSFVPSTRLLLETKEATWQKTTKQRVASLAKSPRQPTGIQVELE  305



>gb|EPQ03939.1| DNA repair protein RAD51 like protein 4 [Myotis brandtii]
Length=315

 Score =   125 bits (313),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 112/202 (55%), Gaps = 10/202 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      V+++D+    +
Sbjct  70    STGIGSLDKLLDAGLYTGEVTEIVGVPGSGKTQVCLCVAANVAHGLQQNVLYVDSNGGLT  129

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M DV+  L+  +  Q   S 
Sbjct  130   ASRILQLLQARTPDEEEQA-----GALQRIQVVRAFDIFQMLDVLQGLRGAVAQQVSRSS  184

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS++++++P+LGG    G ALM      LK LA +  + V+VTNHM    ++
Sbjct  185   GTVKVVIVDSVTAVVSPLLGGQQREGLALMMQLALELKTLARDLGVAVVVTNHMTRDRDS  244

Query  532   GLLKPALGESWKSIPHIRLLLS  467
             G LKPALG SW  +P  R++L+
Sbjct  245   GKLKPALGRSWSFVPSTRIVLA  266



>ref|NP_001086359.1| RAD51 paralog D [Xenopus laevis]
 gb|AAH75158.1| MGC82048 protein [Xenopus laevis]
Length=324

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 124/224 (55%), Gaps = 10/224 (4%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + E+ G + SGKTQ+C  IA NVA S  + V+++DT    +  R+ +
Sbjct  89    LDILLDSGLYTGEVTEIAGAAGSGKTQMCQSIAVNVAYSLKQTVLYVDTTGGLTASRLLQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             +V   ++N   +        +  I    VFDI+ + D    L+  +  Q   SG   R++
Sbjct  149   LVQSRTENEDEQVAS-----LQRIEVIRVFDIYKLLDAFQDLRHKISQQLLRSGEPLRLV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             IIDS+ ++I P+LGG    G A+M      L+ +A++++L +L++N +    A  ++PAL
Sbjct  204   IIDSVCAVIYPMLGGKHTEGMAIMMQLARELQTMAHDYHLAILISNSITKDGAASIRPAL  263

Query  511   GESWKSIPHIRLLLSRDSAR-HISSISVLKHPNMATGDRVEFQI  383
             G SW  +P  R+LL+++     + ++S++K P   T  +V+ +I
Sbjct  264   GRSWSFVPSTRILLTQNELNCGLCTVSLVKSPRQPTNLKVDVEI  307



>ref|XP_008152065.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Eptesicus fuscus]
Length=330

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 112/202 (55%), Gaps = 10/202 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGVPGSGKTQVCLCVAANVAHGLQQNVLYVDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M DV+  L+  +  Q   S 
Sbjct  143   ASRILQLLQARTPDEEEQA-----GALQRIQVVRAFDIFQMLDVLQDLRGAVAQQVSDSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS++++++P+LGG    G ALM      LK LA +  + V+VTNHM    ++
Sbjct  198   GTVKVVIVDSVTAVVSPLLGGQQREGLALMMQLALELKTLARDLGVAVVVTNHMTRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLLS  467
             G LKPALG SW  +P  R++L+
Sbjct  258   GKLKPALGRSWSFVPSTRIVLA  279



>ref|XP_010869139.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Esox 
lucius]
Length=328

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 119/218 (55%), Gaps = 11/218 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G L EL G   SGKTQVCF +  N++    + V+++D+    S  R+ +
Sbjct  82    LDKLLDSGLYTGELTELAGGPGSGKTQVCFGVTVNISYQLKQSVIYIDSTGGLSASRLLQ  141

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKST---MRSQSGCRARML  692
             ++ ++      K ++ +E  +  I  Y VFDIF++ D +  L+ T     S  G   + +
Sbjct  142   ILQKIC-----KLEEQME-ALQRIQVYRVFDIFSLIDCLQSLQCTGLQRASAGGGSVKAV  195

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             I+DS+S++I+PILGG    G ++M     +LK +A + N+ VLVTN +     G LK  L
Sbjct  196   IVDSVSAVISPILGGKQNEGMSMMMQVAGVLKTIAKDFNVAVLVTNTVTRDCNGNLKAGL  255

Query  511   GESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDR  398
             G+SW  +P  R++L R  +   S+ S L+   +A   R
Sbjct  256   GQSWSHVPRTRIILQRFESPG-STCSSLRTATLAKSSR  292



>ref|XP_009807082.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Gavia 
stellata]
Length=314

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 125/231 (54%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+ S  + V+FLD+   F+  R+ +
Sbjct  74    LDQLLDSGLYTGEVTELMGVPGSGKTQVCLGIAASVSLSLKQHVLFLDSTGGFTASRLYQ  133

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   ++N     K+     +  I    VFDI+ M   +  L+  +  Q   S    +++
Sbjct  134   MLRARAEN-----KEEQLEALQRIQVVRVFDIYEMLSALQELRDRLSQQVVSSMGSLKIV  188

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK +A E +L V+VTN +    +   LKPA
Sbjct  189   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTVAREFSLAVVVTNQVTRDSSTAPLKPA  248

Query  514   LGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL        + + + ++S++  K P   TG +VE  I
Sbjct  249   LGRSWSFVPSTRVLLESKETTWEKATTQRVASLA--KSPRQPTGIQVELDI  297



>ref|XP_009324339.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Pygoscelis adeliae]
Length=329

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 126/229 (55%), Gaps = 19/229 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLAIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++     ++ LE  +  I    VFDI+ M   +  L+  +  Q   S    +++
Sbjct  149   MLRARAEDE----EEQLE-ALQRIQVVRVFDIYEMLRALQELRDRLSQQVVSSMGPLKIM  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEF  389
             LG SW  +P  R+LL        + + + ++S++  K P   TG +VE 
Sbjct  264   LGRSWSFVPSTRVLLESKEATWEKTTTQRVASLA--KSPRQPTGIQVEL  310



>ref|NP_001100499.1| DNA repair protein RAD51 homolog 4 [Rattus norvegicus]
 gb|EDM05454.1| RAD51-like 3 (S. cerevisiae) (predicted), isoform CRA_b [Rattus 
norvegicus]
 gb|AAI69062.1| RAD51-like 3 (S. cerevisiae) [Rattus norvegicus]
Length=329

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/228 (33%), Positives = 120/228 (53%), Gaps = 15/228 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G L E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGELTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M D++  L+ TM  Q   S 
Sbjct  143   ASRLLQLLQARTQDEEKQA-----SALQRIQVVHSFDIFQMLDMLQDLRGTMAQQATASS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS+++++ P+LGG    G ALM      LK LA +  + V+VTNH+    ++
Sbjct  198   GTVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATG  404
                KPALG SW  +P  R+LL     +    R   ++ ++K P   TG
Sbjct  258   RRFKPALGRSWSFVPSTRILLEVFEGAGTLGRSQRTVRLIKSPRQPTG  305



>ref|XP_010735544.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Larimichthys crocea]
Length=332

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 111/196 (57%), Gaps = 9/196 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL G   SGK+QVCF +A +++    + V+F+DT    + +R+  
Sbjct  89    LDKVLDSGLYTGEITELSGGPGSGKSQVCFGVAVHISYQLKQSVIFIDTTGGLTARRLL-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS---GCRARML  692
                QM    TS  ++ +E  +  I  + +FD++++ D +H L+S    Q+   G   + +
Sbjct  148   ---QMLQTETSNTEEQME-ALQRIHIFRLFDVYSLLDCLHSLRSGRLQQASVGGGSVKAV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             I+DS+S++I P+LGG    G +LM      LK +A + N+  LVTNH+    +G ++P L
Sbjct  204   IVDSVSAVIAPLLGGKQNEGMSLMIQVAGTLKTMAKDFNVAALVTNHVTRSGSGEVQPGL  263

Query  511   GESWKSIPHIRLLLSR  464
             G SW  IP  R+LL +
Sbjct  264   GVSWSHIPRTRVLLEQ  279



>ref|XP_009932816.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Opisthocomus hoazin]
Length=340

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 120/229 (52%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+ S  + V+FLD+   F+  R+ +
Sbjct  100   LDQLLDSGLYTGEVTELMGGPGSGKTQVCLGIAASVSLSLKQHVLFLDSTGGFTASRLYQ  159

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++   +        +  I     FDI+ M   +  L+  +  Q   S    R++
Sbjct  160   MLRAQAEDEEEQ-----REALQRIQVVRAFDIYEMLGALQELRDRLSQQDVSSVGPLRIV  214

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             ++DS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  215   VVDSVSAVIYPLLGGRQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  274

Query  514   LGESWKSIPHIRLLLSRDSARHISSI-----SVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL    A    +      S+ K P   TG +VE  I
Sbjct  275   LGRSWSFVPSTRVLLETKEATWEKATTQRVASLAKSPRQPTGIQVELDI  323



>ref|XP_004076854.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Oryzias latipes]
Length=332

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 113/201 (56%), Gaps = 8/201 (4%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST    +D  L+ GL  G + EL G   SGK+QVCF +A +V+     RV+++DT    +
Sbjct  83    STGNPSLDKLLDSGLYTGEVTELSGGPGSGKSQVCFGVAVHVSHQLKQRVIYIDTTGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKS--TMRSQSGC  707
               R+ E    M  + TS   + +E  +  I  + +FD +++ D +  L+S   +++  G 
Sbjct  143   ASRLLE----MLQSETSDRDEQME-ALQRIHVFRLFDAYSLRDRLSTLRSGGLLQASGGG  197

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGL  527
               + +I+DS+S++I+P+LGG    G +LM  A   LK +A +  + VLVTNH+  G  G 
Sbjct  198   SVKAVIVDSVSAVISPLLGGKQNEGMSLMIQAALALKTMAKDFGVAVLVTNHVTRGGRGE  257

Query  526   LKPALGESWKSIPHIRLLLSR  464
             ++P LG SW  IP  R+LL R
Sbjct  258   VQPGLGASWSHIPRSRILLER  278



>ref|XP_007245347.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Astyanax 
mexicanus]
 ref|XP_007245348.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Astyanax 
mexicanus]
Length=332

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 113/202 (56%), Gaps = 9/202 (4%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + EL G   +GKTQ+CF +A N A      V+++DT     
Sbjct  83    STGIPSVDKLLDSGLYSGEITELAGGPGTGKTQMCFSVAVNTAHELKQNVLYIDTSGGVC  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKST---MRSQSG  710
               R+ +++ Q   +ST++  K+L+     I  + VFD+FT+   + +L+S      S  G
Sbjct  143   AGRLLQML-QAKTSSTAEQMKALQR----IRVFRVFDVFTLLCCLQNLRSNDLQKGSVGG  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                + +I+DS+S++I+ +LGG    G +LM    F LK +A + N+ VLVTN++     G
Sbjct  198   GSVKAVIVDSVSAVISCVLGGKQTEGMSLMMQVAFKLKMIAKDFNIAVLVTNYVTRDGNG  257

Query  529   LLKPALGESWKSIPHIRLLLSR  464
              LK  LG+SW  +P  R+LL R
Sbjct  258   KLKSGLGQSWSHVPRTRILLQR  279



>ref|XP_006779455.1| PREDICTED: LOW QUALITY PROTEIN: RAD51 paralog D, partial [Myotis 
davidii]
Length=337

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 112/202 (55%), Gaps = 10/202 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      V+++D+    +
Sbjct  92    STGIGSLDKLLDAGLYTGEVTEIVGVPGSGKTQVCLCVAANVAHGLQQNVLYVDSNGGLT  151

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M DV+  L+  +  Q   S 
Sbjct  152   ASRILQLLQARTSDEEEQA-----GALQRIQVVRAFDIFQMLDVLQGLRGAVAQQVSHSS  206

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS++++++P+LGG    G ALM      LK LA +  + V+VTNHM    ++
Sbjct  207   GTVKVVIVDSVTAVVSPLLGGQQREGLALMMQLALELKTLARDLGVAVVVTNHMTRDRDS  266

Query  532   GLLKPALGESWKSIPHIRLLLS  467
             G LKPALG SW  +P  R++L+
Sbjct  267   GKLKPALGRSWSFVPSTRIVLA  288



>ref|XP_006045430.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X4 [Bubalus 
bubalis]
Length=338

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 123/229 (54%), Gaps = 18/229 (8%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A++VA      V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGAPGSGKTQVCLCVAAHVAHGLQQNVLYIDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+ +++   + +   +A       +  I     FDIF M DV+  L+ T+  Q    +
Sbjct  143   ASRILQLLQARTPDEEEQAG-----ALQRIQVVRAFDIFQMLDVLQDLRGTVSQQVSSSS  197

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS+++++ P+LGG    G ALM      LK LA + ++ VLVTNHM    ++
Sbjct  198   GTLKVVIVDSVAAVVAPLLGGQQREGLALMMQLARELKTLARDLSVAVLVTNHMTRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLLSRDS------ARHISSISVLKHPNMATG  404
             G LKPALG SW  +P  RLLL          +R ++ ++  K P + TG
Sbjct  258   GQLKPALGRSWSFVPSTRLLLDNTQGSGSLGSRRVACLT--KSPRLPTG  304



>gb|KFO64220.1| DNA repair protein RAD51 4, partial [Corvus brachyrhynchos]
Length=341

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 127/241 (53%), Gaps = 24/241 (10%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHV----------MSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-  716
             ++   +++   +A++ L  +          +  I    VF I+ +   +  L+  +  Q 
Sbjct  149   MLRAQTEDEEEQARQVLGRLRLCFVPQLEALQRIQVVRVFSIYELLSALQELRDRLSQQV  208

Query  715   --SGCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA  542
               S    +M+++DS+S++I P+LGG  + G ALM      LK LA E +L V+VTN +  
Sbjct  209   VSSMGPLKMMVLDSVSAVIYPLLGGRQSEGLALMMQLSRELKTLAREFSLAVVVTNQVTR  268

Query  541   GEA-GLLKPALGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQ  386
               + G LKPALG SW  +P  R+LL    A       + ++S++  K P   TG +VE  
Sbjct  269   DSSTGPLKPALGRSWSFVPSTRVLLESKEATWEKATTQRVASLA--KSPRQPTGIQVELD  326

Query  385   I  383
             I
Sbjct  327   I  327



>ref|XP_005860284.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Myotis brandtii]
Length=351

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 112/202 (55%), Gaps = 10/202 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      V+++D+    +
Sbjct  106   STGIGSLDKLLDAGLYTGEVTEIVGVPGSGKTQVCLCVAANVAHGLQQNVLYVDSNGGLT  165

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M DV+  L+  +  Q   S 
Sbjct  166   ASRILQLLQARTPDEEEQA-----GALQRIQVVRAFDIFQMLDVLQGLRGAVAQQVSRSS  220

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS++++++P+LGG    G ALM      LK LA +  + V+VTNHM    ++
Sbjct  221   GTVKVVIVDSVTAVVSPLLGGQQREGLALMMQLALELKTLARDLGVAVVVTNHMTRDRDS  280

Query  532   GLLKPALGESWKSIPHIRLLLS  467
             G LKPALG SW  +P  R++L+
Sbjct  281   GKLKPALGRSWSFVPSTRIVLA  302



>ref|XP_009285288.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Aptenodytes forsteri]
Length=329

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 126/229 (55%), Gaps = 19/229 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLAIAASVSLGLRQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++     ++ LE  +  I    VFDI+ M   +  L+  +  Q   S    +++
Sbjct  149   MLRARAEDE----EEQLE-ALQRIQVVRVFDIYEMLRALQELRDRLSQQVVSSMGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEF  389
             LG SW  +P  R+LL        + + + ++S++  K P   TG +VE 
Sbjct  264   LGRSWSFVPSTRVLLESKEATWEKTTTQRVASLA--KSPRQPTGIQVEL  310



>ref|XP_008638583.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Corvus brachyrhynchos]
Length=329

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 122/231 (53%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+  
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLY-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM    T   ++ LE  +  I    VF I+ +   +  L+  +  Q   S    +M+
Sbjct  148   ---QMLRAQTEDEEEQLE-ALQRIQVVRVFSIYELLSALQELRDRLSQQVVSSMGPLKMM  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             ++DS+S++I P+LGG  + G ALM      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VLDSVSAVIYPLLGGRQSEGLALMMQLSRELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL    A       + ++S++  K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKEATWEKATTQRVASLA--KSPRQPTGIQVELDI  312



>ref|XP_005077004.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Mesocricetus 
auratus]
Length=328

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 117/227 (52%), Gaps = 14/227 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAYSLQQNVLYVDSSGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SGC  707
               R+ +++   + +   +A       +  I     FDIF M D++  L+  M  Q  S  
Sbjct  143   ASRLLQLLQARTQDEEKQA-----GALQRIQVARAFDIFQMLDMLQDLRGAMAQQVTSSG  197

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG-  530
               +++I+DS+++++ P+LGG    G ALM      LK LA +  + V+VTNH+     G 
Sbjct  198   TVKVVIVDSVTAVVAPLLGGQQRDGLALMMQLARELKTLARDLAVAVVVTNHLTWDRDGR  257

Query  529   LLKPALGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATG  404
               KPALG SW  +P  R+LL     +    R   ++ + K P   TG
Sbjct  258   RFKPALGRSWSFVPSTRILLDVIEGAGTLGRGQRTVCLTKSPRQPTG  304



>ref|XP_009954008.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Leptosomus 
discolor]
Length=301

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 122/231 (53%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++ +    + V+FLD+   F+  R+ +
Sbjct  61    LDRLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASASLGLKQHVLFLDSTGGFTASRLYQ  120

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++     K+     +  +    VFDI+ M   +  L+  +  Q   S    +++
Sbjct  121   MLQAQAED-----KEEQLEALQRVQVVRVFDIYEMLSALQELRDRLSQQVVSSMGPLKVV  175

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S+ I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  176   VIDSVSAAIHPLLGGKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  235

Query  514   LGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL    A       R ++S++  K P   TG +VE  I
Sbjct  236   LGRSWSFVPSTRVLLESKEATWEKATVRRVASLA--KSPRQPTGIQVELDI  284



>gb|EOB07843.1| DNA repair protein RAD51-like protein 4, partial [Anas platyrhynchos]
Length=305

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 114/200 (57%), Gaps = 7/200 (4%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLSIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS-GCRA--RML  692
             ++   +++   +A  SLE  +  I    VFD++ M   +  ++  +  Q+  C    + +
Sbjct  149   MLQAQAEDEEEQAS-SLE-ALQRIQVARVFDVYEMLSALQEVRDRLSQQAVSCTGPLKTV  206

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + GLLKPA
Sbjct  207   LIDSVSAVIHPLLGGRQSEGLAIMMQLARELKMLAKEFSLAVVVTNQVTRDSSTGLLKPA  266

Query  514   LGESWKSIPHIRLLLSRDSA  455
             LG SW  +P  R+LL    A
Sbjct  267   LGRSWSFVPSTRVLLESKGA  286



>ref|XP_005916078.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Haplochromis 
burtoni]
Length=333

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 111/196 (57%), Gaps = 9/196 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL G   SGK+QVCF +A +++    + V+++DT    +  R+  
Sbjct  89    LDKLLDSGLYTGEITELSGGPGSGKSQVCFGVAVHISYQLKQSVIYIDTTGGLAASRLL-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS---GCRARML  692
                QM    TS  ++ +E  +  I  + +FD++T+ D ++ L+S    Q+   G   + +
Sbjct  148   ---QMLQAETSNTEEQME-ALQRIHVFRLFDVYTLLDCLYSLRSGGLQQASVGGGSVKAV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             I+DS+S++I+P+LGG    G +LM      LK +A + N+  LVTNH+    +G ++P L
Sbjct  204   IVDSVSAVISPLLGGKQNEGMSLMIQVAGALKTMAKDFNVAALVTNHVTRSGSGEVQPGL  263

Query  511   GESWKSIPHIRLLLSR  464
             G SW  IP  R+LL R
Sbjct  264   GVSWSHIPRTRILLER  279



>ref|XP_005077005.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Mesocricetus 
auratus]
Length=329

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 117/228 (51%), Gaps = 15/228 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAYSLQQNVLYVDSSGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M D++  L+  M  Q   S 
Sbjct  143   ASRLLQLLQARTQDEEKQA-----GALQRIQVARAFDIFQMLDMLQDLRGAMAQQEVTSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                +++I+DS+++++ P+LGG    G ALM      LK LA +  + V+VTNH+     G
Sbjct  198   GTVKVVIVDSVTAVVAPLLGGQQRDGLALMMQLARELKTLARDLAVAVVVTNHLTWDRDG  257

Query  529   -LLKPALGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATG  404
                KPALG SW  +P  R+LL     +    R   ++ + K P   TG
Sbjct  258   RRFKPALGRSWSFVPSTRILLDVIEGAGTLGRGQRTVCLTKSPRQPTG  305



>ref|NP_001290859.1| RAD51 paralog D [Esox lucius]
 gb|ACO14034.1| DNA repair protein RAD51 homolog 4 [Esox lucius]
Length=335

 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 118/218 (54%), Gaps = 11/218 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G L EL G   SGKTQVCF +  N++    + V+++D+    S  R+ +
Sbjct  89    LDKLLDSGLYTGELTELAGGPGSGKTQVCFGVTVNISYQLKQSVIYIDSTGGLSASRLLQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKST---MRSQSGCRARML  692
             ++ ++      K ++ +E  +  I  Y VFDIF++ D +  L+ T     S  G   + +
Sbjct  149   ILQKIC-----KLEEQME-ALQRIQVYRVFDIFSLIDCLQSLQCTGLQRASAGGGSVKAV  202

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             I+DS+S++I+PILGG    G ++M     +LK +  + N+ VLVTN +     G LK  L
Sbjct  203   IVDSVSAVISPILGGKQNEGMSMMMQVAGVLKTIVKDFNVAVLVTNTVTRDCNGNLKAGL  262

Query  511   GESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDR  398
             G+SW  +P  R++L R  +   S+ S L+   +A   R
Sbjct  263   GQSWSHVPRTRIILQRFESPG-STCSSLRTATLAKSSR  299



>ref|XP_005525888.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Pseudopodoces 
humilis]
Length=329

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 124/229 (54%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G L EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGELTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA---RML  692
             ++   +++     ++ LE  +  +    VF+I+ +   +  L+  +  Q+       +++
Sbjct  149   ILQAQTEDE----EEQLE-ALQRVQVVRVFNIYELLGALQELRDRLSQQAVSSVGPLKVV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             ++DS+S++I P+LGG  + G ALM      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   LLDSVSAVIYPLLGGRQSEGLALMMQLSRELKTLAREFSLAVVVTNQVTRDSSTGQLKPA  263

Query  514   LGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL     S + A    + S+ K P    G +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKEASWERASTQRAASLAKSPRQPAGIQVELDI  312



>gb|KFQ09385.1| DNA repair protein RAD51 4, partial [Haliaeetus albicilla]
Length=326

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 124/231 (54%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGVPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   S++   +AK      +  I    VF+I+ M   +  L+  +  Q   S    +++
Sbjct  149   ILRARSEDGEEQAK-----ALQRIQVVRVFNIYEMLSALQELRDHLSQQVVSSMGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV-AGEAGLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +      G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKHSEGLAIMMQLARELKTLAKEFSLAVVVTNQVTRESSTGPLKPA  263

Query  514   LGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL        + + + ++S++  K     TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKETTWEKATTQRVASLA--KSSRQPTGIQVELDI  312



>ref|XP_005425456.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Geospiza fortis]
Length=329

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 125/229 (55%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G ++EL+G   +GKTQVC  IA++V+    + V+FLD+   F+  R+  
Sbjct  89    LDQLLDSGLYTGEVMELMGAPGTGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLY-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM    T   ++ LE  +  +    VF+I+ +   +  L+  +  Q   S    +++
Sbjct  148   ---QMLQAQTEDEEEQLE-ALQRVQVQRVFNIYEVLRALQELRDRLSQQVLSSMGPLKVV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA-GEAGLLKPA  515
             ++DS+S++I P+LGG  + G ALM      LK LA E +L V+VTN +     +G LKPA
Sbjct  204   VLDSVSAVIYPLLGGRQSEGLALMMQLSRELKTLAREFSLAVVVTNQVTRDSSSGPLKPA  263

Query  514   LGESWKSIPHIRLLL-SRDSARHISSI----SVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL S++ +   SS     S+ K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKEGSWERSSTQRAASLAKSPRQPTGIQVELDI  312



>ref|XP_006641024.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Lepisosteus 
oculatus]
Length=338

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 118/210 (56%), Gaps = 12/210 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFS  881
             ST  + +D  L+ GL  G + EL G   SGKTQVC  +A N++    R V+++DT    S
Sbjct  83    STGNESLDVLLDAGLYTGEVTELAGGPGSGKTQVCLGVAVNISCVLKRTVLYIDTNGGLS  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCR-  704
               R+     QM  + TS  ++ +E +   +VC  VFD+F++ + +H L+S    Q+  R 
Sbjct  143   ASRLL----QMVQSKTSNMEEQVEALNRILVC-RVFDVFSLLETLHSLRSGGLEQASVRN  197

Query  703   --ARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                R +++DS++++++ +LGG    G +LM      L+ +A + N+ VLVTNH+     G
Sbjct  198   GPIRAVLVDSVTAVLSHMLGGRQTEGMSLMMQVAGALRLIAKDLNVAVLVTNHVTRDGNG  257

Query  529   LLKPALGESWKSIPHIRLLLSR---DSARH  449
             +LK  LG+SW  +P  R+LL R     ARH
Sbjct  258   VLKAGLGQSWSHVPRTRVLLQRVDGPQARH  287



>ref|XP_005495079.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Zonotrichia albicollis]
Length=329

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 124/231 (54%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G ++EL+G   +GKTQVC  IA++V+    + V+FLD+   F+  R+  
Sbjct  89    LDQLLDSGLYTGEVMELMGAPGTGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLY-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM    T   ++ LE  +  +    VF+I+ +   +  L+  +  Q   S    +++
Sbjct  148   ---QMLQAQTEDEEEQLE-ALQRVQVQRVFNIYEVLRALQELRDRLSQQVLSSVGPLKVV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA-GEAGLLKPA  515
             ++DS+S++I P+LGG  + G ALM      LK LA E +L V+VTN +     +G LKPA
Sbjct  204   VLDSVSAVIYPLLGGRQSEGLALMMQLSRELKTLAREFSLAVVVTNQVTRDSSSGSLKPA  263

Query  514   LGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL        R S +  +S++  K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKEGPWERSSTQRAASLA--KSPRQPTGIQVELDI  312



>ref|XP_010156501.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Eurypyga helias]
Length=329

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/231 (33%), Positives = 124/231 (54%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  I+++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGISASVSLVLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++   K        +  I    VF+I+ M   +  L+     Q   S    +++
Sbjct  149   MLQSRAEDEEEKL-----EALQRIQVVRVFNIYEMLSALQELRDRFSQQVVSSVGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLL-------LSRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+L       L + +++ I+S++  K P   TG +VE  I
Sbjct  264   LGRSWSFMPSTRVLLESKETTLEKATSQRIASLA--KSPRQPTGIQVELDI  312



>ref|XP_009906136.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Picoides pubescens]
Length=330

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/230 (33%), Positives = 122/230 (53%), Gaps = 16/230 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + ++FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHLLFLDSTGGFTASRLCQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++     K+     +  +    VFDI+ M   +  L+  +  Q   S    R++
Sbjct  149   MLQARAED-----KEEQLEALQRVQVVRVFDIYEMLRALQELRDRLSQQVVSSVGALRLV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV--AGEAGLLKP  518
             +IDS+S++I P+LGG  + G A+M      LK LA E +L ++VTN +   +   G LKP
Sbjct  204   VIDSVSAVIYPLLGGRHSEGLAIMMQLARELKTLAREFSLAIVVTNQVTRDSSSNGPLKP  263

Query  517   ALGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATGDRVEFQI  383
             ALG SW  +P  R+LL     +   A  +   ++ K P   TG +VE  I
Sbjct  264   ALGRSWSFVPSARVLLESKEGTGQGATALRIAALAKSPRQPTGIQVELDI  313



>ref|XP_004551221.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Maylandia 
zebra]
Length=333

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 110/196 (56%), Gaps = 9/196 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL G   SGK+QVCF +A +++    + V+++DT    +  R+  
Sbjct  89    LDKLLDSGLYTGEITELSGGPGSGKSQVCFGVAVHISYQLKQSVIYIDTTGGLAASRLL-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS---GCRARML  692
                QM    TS  ++ +E  +  I  + +FD++ + D ++ L+S    Q+   G   + +
Sbjct  148   ---QMLQAETSNTEEQME-ALQRIHVFRLFDVYALLDCLYSLRSGGLQQASVGGGSVKAV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             I+DS+S++I+P+LGG    G +LM      LK +A + N+  LVTNH+    +G ++P L
Sbjct  204   IVDSVSAVISPLLGGKQNEGMSLMIQVAGALKTMAKDFNVAALVTNHVTRSGSGEVQPGL  263

Query  511   GESWKSIPHIRLLLSR  464
             G SW  IP  R+LL R
Sbjct  264   GVSWSHIPRTRILLER  279



>ref|XP_008766246.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Rattus 
norvegicus]
Length=342

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 110/202 (54%), Gaps = 10/202 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G L E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGELTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M D++  L+ TM  Q   S 
Sbjct  143   ASRLLQLLQARTQDEEKQAS-----ALQRIQVVHSFDIFQMLDMLQDLRGTMAQQATASS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS+++++ P+LGG    G ALM      LK LA +  + V+VTNH+    ++
Sbjct  198   GTVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLLS  467
                KPALG SW  +P  R+LL 
Sbjct  258   RRFKPALGRSWSFVPSTRILLE  279



>ref|XP_005725471.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Pundamilia 
nyererei]
Length=333

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 110/196 (56%), Gaps = 9/196 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL G   SGK+QVCF +A +++    + V+++DT    +  R+  
Sbjct  89    LDKLLDSGLYTGEITELSGGPGSGKSQVCFGVAVHISYQLKQSVIYIDTTGGLAASRLL-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS---GCRARML  692
                QM    TS  ++ +E  +  I  + +FD++ + D ++ L+S    Q+   G   + +
Sbjct  148   ---QMLQAETSNTEEQME-ALQRIHVFRLFDVYALLDCLYSLRSGGLQQASVGGGSVKAV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             I+DS+S++I+P+LGG    G +LM      LK +A + N+  LVTNH+    +G ++P L
Sbjct  204   IVDSVSAVISPLLGGKQNEGMSLMIQVAGALKTMAKDFNVAALVTNHVTRSGSGEVQPGL  263

Query  511   GESWKSIPHIRLLLSR  464
             G SW  IP  R+LL R
Sbjct  264   GVSWSHIPRTRILLER  279



>ref|XP_005056584.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Ficedula 
albicollis]
Length=267

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 123/229 (54%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  27    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  86

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++     ++ LE  +  I    VF I+ +   +  L+  +  Q   S    +M+
Sbjct  87    ILQAQTEDE----EEQLE-ALQRIQVVRVFHIYEVLSALQELRDRLSQQVLSSTGPLKMV  141

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             ++DS+S++I P+LGG  + G ALM      LK LA E +L V+VTN +    + G LKPA
Sbjct  142   LLDSVSAVIYPLLGGRQSEGLALMMQLSRELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  201

Query  514   LGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL     S +      + S+ K P   TG +V+  I
Sbjct  202   LGRSWSFVPSTRVLLESKEGSWEKGTSHRAASLAKSPRQPTGIQVQLDI  250



>ref|XP_006990137.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Peromyscus 
maniculatus bairdii]
Length=329

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 111/201 (55%), Gaps = 10/201 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M +++  L+ TM  Q   S 
Sbjct  143   ASRLLQLLQARTQDEEKQA-----GALQRIQVVHAFDIFQMLNMLQDLRGTMAQQATASS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS+++++ P+LGG    G ALM      LK LA E  + V+VTNH+    ++
Sbjct  198   GTVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKILARELGVAVMVTNHLTRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLL  470
               +KPALG SW  +P  R+LL
Sbjct  258   RRVKPALGRSWSFVPSTRILL  278



>ref|XP_009092943.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Serinus canaria]
Length=329

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/231 (34%), Positives = 123/231 (53%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   +GKTQVC  IA++V+    + ++FLDT   F+  R+  
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGAGKTQVCLGIAASVSLGLKQHILFLDTTGGFTAARLY-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM    T   ++ LE  +  +    VF+I+ +   +  L+  +  Q   S    +++
Sbjct  148   ---QMLQAQTEDEEEQLE-ALQRVQVERVFNIYEVLRALQELRDRLSQQVVSSMGPLKVV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA-GEAGLLKPA  515
             ++DS+S++I P+LGG  + G ALM      LK LA E +L V+VTN +     +G L+PA
Sbjct  204   VLDSVSAVIYPLLGGRQSEGLALMMQLSRELKTLAREFSLAVVVTNQVTRDSSSGPLRPA  263

Query  514   LGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL        R S +  +S++  K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKEGPWERSSTQRAASLA--KSPRQPTGIQVELDI  312



>gb|ADF97633.1| DNA repair protein RAD51 4-like protein [Hypophthalmichthys molitrix]
Length=320

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 111/205 (54%), Gaps = 9/205 (4%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVF-LDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVCF +A N++    + VF +DT       R+  
Sbjct  79    LDKLLDSGLYTGEITELIGSPGSGKTQVCFSVAVNMSHQLKQTVFYIDTKGGMCANRLL-  137

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKST---MRSQSGCRARML  692
                QM  N T   ++ +E  +  I  + VFD+F++   + +L+S      S  G   + L
Sbjct  138   ---QMLQNKTPNMEEQME-ALQKIKVFRVFDVFSLLACLQNLRSNGLQKASVGGGSVKAL  193

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             ++DS+S++++ +LGG    G +L+      +K +A + N+ VLVTNH++    G LK  L
Sbjct  194   MVDSVSAVLSSMLGGKQNEGMSLLMQVAGEMKMIAKDFNIAVLVTNHVIKDGNGHLKAGL  253

Query  511   GESWKSIPHIRLLLSRDSARHISSI  437
             G+SW  +P  R+LL R      SS+
Sbjct  254   GQSWSHVPRTRVLLQRVENAETSSL  278



>ref|XP_010222291.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Tinamus guttatus]
Length=336

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 80/237 (34%), Positives = 127/237 (54%), Gaps = 19/237 (8%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFS  881
             ST +  +D  L+ GL  G ++E++G   SGKTQVC  IA++      + V+FLD+   F+
Sbjct  93    STGIPSLDKLLDSGLYTGEVMEIMGAPGSGKTQVCLSIAASACLGLKQHVLFLDSTGGFT  152

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-SGCR  704
               R+ +++ Q       +  ++L+ V        VF+I+ M   +  L+ ++  Q   C 
Sbjct  153   ASRLHQML-QAETEDEEEQLEALQRVQ----VARVFNIYEMLGALQELRDSLSQQVMSCT  207

Query  703   A--RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGE-A  533
                ++++IDS+S++I P+LGG  + G ALM      LK LA E +L V+VTN +     A
Sbjct  208   GPLKVVLIDSVSAVIYPLLGGKQSEGLALMMQLARELKMLAREFSLAVVVTNQVTRDSGA  267

Query  532   GLLKPALGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             G LKPALG SW  +P  RLLL        +   + ++S++  K P   TG +VE  I
Sbjct  268   GPLKPALGRSWSFVPSTRLLLESKEVAWEKGGTQRVASLA--KSPRQPTGIQVELDI  322



>ref|XP_006785181.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Neolamprologus 
brichardi]
Length=333

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 109/196 (56%), Gaps = 9/196 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL G   SGK+QVCF +A +++    + V+++DT    +  R+  
Sbjct  89    LDKLLDSGLYTGEITELSGGPGSGKSQVCFGVAVHISYQLKQSVIYIDTTGGLAAGRLL-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM    TS  ++ +E  +  I  + +FD++ + D ++ L+S    Q    G   + +
Sbjct  148   ---QMLQAETSNTEEQME-ALQRIHVFRLFDVYALLDCLYSLRSGGLQQVSVGGGSVKAV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             I+DS+S++I+P+LGG    G +LM      LK +A + N+  LVTNH+    +G ++P L
Sbjct  204   IVDSVSAVISPLLGGKQNEGMSLMIQVAGALKTMAKDFNVAALVTNHVTRSGSGEVQPGL  263

Query  511   GESWKSIPHIRLLLSR  464
             G SW  IP  R+LL R
Sbjct  264   GVSWSHIPRTRILLER  279



>ref|XP_008349730.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Malus domestica]
Length=132

 Score =   114 bits (286),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  1263  MAPLKSLEQRYPIIDSNFQGFCASHGIFSVEDFLLHDMHALVVSAEQHNTSARLKQGINQ  1084
             MAPLKSLE  +P+IDSNFQ FCASHGIFSVE+FL+HD+  L  +A+QH T  +LKQGI +
Sbjct  1     MAPLKSLEAEHPVIDSNFQXFCASHGIFSVEEFLIHDLDELAGAAQQHPTCEKLKQGITE  60

Query  1083  VLASIDALHQPWLNAL  1036
             VL++ID+ HQPWLN +
Sbjct  61    VLSTIDSQHQPWLNGM  76


 Score = 36.2 bits (82),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 3/39 (8%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQV---CF  950
             ST  + ID  L GGLR+G + ELVGPS+SGKTQV   CF
Sbjct  90    STGCEGIDLLLGGGLREGQVTELVGPSTSGKTQVSKSCF  128



>ref|NP_035365.1| DNA repair protein RAD51 homolog 4 isoform 1 [Mus musculus]
 sp|O55230.1|RA51D_MOUSE RecName: Full=DNA repair protein RAD51 homolog 4; AltName: Full=R51H3; 
AltName: Full=RAD51 homolog D; AltName: Full=RAD51-like 
protein 3 [Mus musculus]
 dbj|BAA24010.1| Trad [Mus musculus]
 gb|AAC40093.1| RAD51D [Mus musculus]
 emb|CAA75679.1| R51H3 [Mus musculus]
 dbj|BAB30965.1| unnamed protein product [Mus musculus]
 gb|AAH49136.1| Rad51l3 protein [Mus musculus]
 dbj|BAE28119.1| unnamed protein product [Mus musculus]
 dbj|BAE23698.1| unnamed protein product [Mus musculus]
Length=329

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 119/228 (52%), Gaps = 15/228 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+ +++   + +   +A       +  I     FDIF M D++  L+ T+  Q    +
Sbjct  143   ASRLLQLLQARTQDEEKQA-----SALQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSS  197

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                +++I+DS+++++ P+LGG    G ALM      LK LA +  + V+VTNH+     G
Sbjct  198   GAVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDWDG  257

Query  529   -LLKPALGESWKSIPHIRLLLS-RDSARHISS----ISVLKHPNMATG  404
                KPALG SW  +P  R+LL   + A  + S    + + K P   TG
Sbjct  258   RRFKPALGRSWSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSPRQPTG  305



>gb|KFV86858.1| DNA repair protein RAD51 4, partial [Struthio camelus australis]
Length=299

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/237 (33%), Positives = 126/237 (53%), Gaps = 19/237 (8%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFS  881
             ST +  +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+
Sbjct  56    STGIASLDKLLDSGLYTGEVTELMGAPGSGKTQVCLSIAASVSLGLKQHVLFLDSTGGFT  115

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   ++    +        +  +    VFD++ M   +  L+ ++  Q   S 
Sbjct  116   ASRLYQMLRARAEEEEEQL-----EALQRVQVARVFDVYEMLGALQELRDSLSQQVMSSM  170

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-  533
                ++++IDSIS++I P+LGG  + G ALM      LK LA E +L +++TN +    + 
Sbjct  171   GPLKVVLIDSISAVIYPLLGGKQSEGLALMMQLARELKTLAREFSLTIVMTNQVTRDSST  230

Query  532   GLLKPALGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQI  383
             G LKPALG SW  +P  R+LL    A       + I+S++  K P   TG +VE  I
Sbjct  231   GPLKPALGRSWSFVPSTRVLLESKEATWEKANTQRIASLA--KSPRQPTGIQVELDI  285



>ref|XP_009967903.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Tyto 
alba]
Length=314

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 123/231 (53%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+ +  + V+FLD+   F+  R+  
Sbjct  74    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLALKQHVLFLDSTAGFTASRL--  131

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA---RML  692
                QM        ++ LE  +  I    VF+I+ M   +  L+  +  Q        +++
Sbjct  132   --YQMLQAQAGDKEEQLE-ALQRIQVVRVFNIYEMLSALQELRDRLSQQVVSNVGPFKIV  188

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    +   LKPA
Sbjct  189   VIDSVSAVIYPLLGGKQSEGLAIMMQLAKELKTLAREFSLAVVVTNQVTRDSSTSSLKPA  248

Query  514   LGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL        + +A+ ++S++  K P   TG +VE  +
Sbjct  249   LGRSWSFVPSTRVLLESKEATWEKATAQRVASLA--KSPRQPTGIQVELDL  297



>ref|XP_009467190.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Nipponia nippon]
Length=329

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 119/227 (52%), Gaps = 15/227 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA +V+    + V+FLD+   F+  R+  
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAVSVSLGLKQHVLFLDSTAGFTASRL--  146

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM    T   ++ L+  +  I    VF+I+ M   +  L+  +  Q   S    +++
Sbjct  147   --YQMLQARTGDEEEQLD-ALQRIQVVRVFNIYEMLSALQELREHLSQQVMSSMGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLAKELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATGDRVEF  389
             LG SW  +P  R+LL     + D A      S+ K P   TG +VE 
Sbjct  264   LGRSWSFVPSTRVLLESKEATWDKATTQRVASLAKSPRQPTGIQVEL  310



>ref|NP_001264868.1| DNA repair protein RAD51 homolog 4 isoform 3 [Mus musculus]
 gb|ACF40976.1| RAD51D transcript variant delta 10 [Mus musculus]
Length=307

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 109/201 (54%), Gaps = 10/201 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+ +++   + +   +A       +  I     FDIF M D++  L+ T+  Q    +
Sbjct  143   ASRLLQLLQARTQDEEKQA-----SALQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSS  197

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                +++I+DS+++++ P+LGG    G ALM      LK LA +  + V+VTNH+     G
Sbjct  198   GAVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDWDG  257

Query  529   -LLKPALGESWKSIPHIRLLL  470
                KPALG SW  +P  R+LL
Sbjct  258   RRFKPALGRSWSFVPSTRILL  278



>ref|XP_005056583.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Ficedula 
albicollis]
Length=329

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 123/229 (54%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   +++     ++ LE  +  I    VF I+ +   +  L+  +  Q   S    +M+
Sbjct  149   ILQAQTEDE----EEQLE-ALQRIQVVRVFHIYEVLSALQELRDRLSQQVLSSTGPLKMV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             ++DS+S++I P+LGG  + G ALM      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   LLDSVSAVIYPLLGGRQSEGLALMMQLSRELKTLAREFSLAVVVTNQVTRDSSTGPLKPA  263

Query  514   LGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL     S +      + S+ K P   TG +V+  I
Sbjct  264   LGRSWSFVPSTRVLLESKEGSWEKGTSHRAASLAKSPRQPTGIQVQLDI  312



>ref|XP_009684175.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Struthio camelus 
australis]
Length=317

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 78/237 (33%), Positives = 126/237 (53%), Gaps = 19/237 (8%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFS  881
             ST +  +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+
Sbjct  71    STGIASLDKLLDSGLYTGEVTELMGAPGSGKTQVCLSIAASVSLGLKQHVLFLDSTGGFT  130

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   ++    +        +  +    VFD++ M   +  L+ ++  Q   S 
Sbjct  131   ASRLYQMLRARAEEEEEQL-----EALQRVQVARVFDVYEMLGALQELRDSLSQQVMSSM  185

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-  533
                ++++IDSIS++I P+LGG  + G ALM      LK LA E +L +++TN +    + 
Sbjct  186   GPLKVVLIDSISAVIYPLLGGKQSEGLALMMQLARELKTLAREFSLTIVMTNQVTRDSST  245

Query  532   GLLKPALGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQI  383
             G LKPALG SW  +P  R+LL    A       + I+S++  K P   TG +VE  I
Sbjct  246   GPLKPALGRSWSFVPSTRVLLESKEATWEKANTQRIASLA--KSPRQPTGIQVELDI  300



>ref|XP_006532650.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Mus 
musculus]
Length=341

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 119/228 (52%), Gaps = 15/228 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  95    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMT  154

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+ +++   + +   +A       +  I     FDIF M D++  L+ T+  Q    +
Sbjct  155   ASRLLQLLQARTQDEEKQA-----SALQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSS  209

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                +++I+DS+++++ P+LGG    G ALM      LK LA +  + V+VTNH+     G
Sbjct  210   GAVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDWDG  269

Query  529   -LLKPALGESWKSIPHIRLLLS-RDSARHISS----ISVLKHPNMATG  404
                KPALG SW  +P  R+LL   + A  + S    + + K P   TG
Sbjct  270   RRFKPALGRSWSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSPRQPTG  317



>ref|XP_003453486.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Oreochromis 
niloticus]
Length=333

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 110/196 (56%), Gaps = 9/196 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL G   SGK+QVCF +A +++    + V+++DT    +  R+  
Sbjct  89    LDKLLDSGLYTGEITELSGGPGSGKSQVCFGVAVHISYQLKQSVIYIDTTGGLAASRLL-  147

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS---GCRARML  692
                QM    TS  ++ +E  +  I  + +FD++ +   ++ L+S    Q+   G   + +
Sbjct  148   ---QMLQAETSNTEEQME-ALQRIHVFRLFDVYALLGCLYSLRSGGLQQASVGGGSVKAV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             I+DS+S++I+P+LGG    G +LM     +LK +A + N+  LVTNH+    +G ++P L
Sbjct  204   IVDSVSAVISPLLGGKQNEGMSLMIQVAGVLKTMAKDFNVAALVTNHVTRSGSGEVQPGL  263

Query  511   GESWKSIPHIRLLLSR  464
             G SW  IP  R+LL R
Sbjct  264   GVSWSHIPRTRILLER  279



>ref|XP_003469653.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Cavia 
porcellus]
Length=329

 Score =   120 bits (300),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 112/201 (56%), Gaps = 10/201 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A++VA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAAHVAHSLHQNVLYIDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M D +H L+  +  Q   S 
Sbjct  143   ASRLLQLLQCRTRDEEEQAG-----ALRRIQVAHAFDIFQMLDRLHDLRGAVAQQVSGSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS++++++P+LGG    G ALM      LK LA +  + V+VTNH+    ++
Sbjct  198   GTVKVVIVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGIAVMVTNHITRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLL  470
             G LKPALG SW  +P  R+LL
Sbjct  258   GRLKPALGRSWSFVPSTRVLL  278



>ref|XP_007894858.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Callorhinchus 
milii]
Length=290

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 124/234 (53%), Gaps = 14/234 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVA-RSSGRVVFLDTCNSFS  881
             ST  K +D  L+ GL  G L E VG   SGKTQVC  +A N++     +VV++D+    S
Sbjct  44    STGNKNLDKLLDSGLYTGELTEFVGAPGSGKTQVCLSLAVNISCELKQKVVYVDSTGGLS  103

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ-SGCR  704
               R+ E++    D++  +        +  I    VFD++ M DV+  L+++   Q +G R
Sbjct  104   ASRLLELIQSQVDSAEQQT-----DALQRIEVVRVFDVYGMLDVLQDLRTSFTQQVTGAR  158

Query  703   A--RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
             A  + ++IDS+ ++++ +L GS A G A+M      LK +A E  + V+VTN +V    G
Sbjct  159   ASVKAVVIDSVCAVLSTVLSGSLAEGMAIMMQLARALKTMARELGVAVVVTNGVVQDMGG  218

Query  529   LLKPALGESWKSIPHIRLLLSRDSA-----RHISSISVLKHPNMATGDRVEFQI  383
              +KPALG SW  +P+ R+LL R++          S +VLK     TG   E  I
Sbjct  219   GVKPALGRSWSYVPNARVLLQREAEMGSLQETKRSATVLKSSRQPTGLTAELHI  272



>ref|XP_010085771.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Pterocles 
gutturalis]
Length=330

 Score =   119 bits (299),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 125/232 (54%), Gaps = 21/232 (9%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + ++FLD+   F+  R+ +
Sbjct  90    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHILFLDSTGGFTASRLFQ  149

Query  862   VV-SQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARM  695
             ++ SQ  D      ++ LE +    V  + FDIF M   +  L+  +  Q   S    ++
Sbjct  150   MLRSQAEDE-----EEQLEALQRTQVVRA-FDIFAMLRALQELRDRLSQQDVSSVGPLKV  203

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKP  518
             ++IDS+S+++ P+LGG  + G A+M      LK LA E +L V+VTN +    +   LKP
Sbjct  204   VVIDSVSAVVYPLLGGRQSEGLAIMMQLARELKALAREFSLAVVVTNQVTRDSSTSPLKP  263

Query  517   ALGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQI  383
             ALG SW  +P  R+LL    A       + I+S++  K P   TG +VE  I
Sbjct  264   ALGRSWSFVPSTRVLLENKEATWEKATTQRIASLA--KSPRQPTGIQVELDI  313



>ref|XP_010571858.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Haliaeetus leucocephalus]
 ref|XP_010571860.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Haliaeetus leucocephalus]
Length=329

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 125/231 (54%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGVPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   S++     ++ LE  +  I    VF+I+ M   +  L+  +  Q   S    +++
Sbjct  149   ILRARSED----GEEQLE-ALQRIQVVRVFNIYEMLRALQELRDRLSQQVVSSMGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV-AGEAGLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +      G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKHSEGLAIMMQLARELKTLAKEFSLAVVVTNQVTRESSTGPLKPA  263

Query  514   LGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL        + + + ++S++  K     TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKETTWEKATTQRVASLA--KSSRQPTGIQVELDI  312



>ref|XP_003970950.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Takifugu 
rubripes]
Length=328

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 111/201 (55%), Gaps = 11/201 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ G   G L EL G   SGK+QVCF  + +++    + VVF+DT    +  R+  
Sbjct  73    LDKLLDSGFYTGELTELSGGPGSGKSQVCFAASVHISHHLKQSVVFVDTTGGLTAGRLL-  131

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA-----R  698
                QM +  T   ++ +E  +  I  + +FD+F++ D ++ L++ +  Q+         +
Sbjct  132   ---QMLEAETGSREEQME-ALQRIHVFRLFDVFSLLDCLYGLRAGILQQASVGGGGGSVK  187

Query  697   MLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKP  518
              +I+DS+S++I P+LGG    G +LM   G +LK +A + N+  LVTNH+    +G ++P
Sbjct  188   AVIVDSVSAVIAPVLGGKQNEGMSLMTQVGGVLKTIAKDFNIAALVTNHVTRSLSGEVQP  247

Query  517   ALGESWKSIPHIRLLLSRDSA  455
              LG SW  +P  R+LL R  A
Sbjct  248   GLGMSWSHVPRTRILLERVEA  268



>ref|XP_004608899.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Sorex araneus]
Length=324

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 112/201 (56%), Gaps = 10/201 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    ++++D+    +
Sbjct  83    STGLGSLDRLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNILYVDSSGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+  ++   + +   +A       +  I     FDIF +F V+  L+  +  Q   S 
Sbjct  143   ACRLLRLLQARTPDEEEQAA-----ALRRIQVARAFDIFHLFGVLQDLRGALGQQVSGSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS++++++P+LGG    G ALM      LK LA +  L V+VTNH+    ++
Sbjct  198   GMVKVVIVDSVAAVVSPLLGGQQREGLALMMQLARELKTLARDLGLAVVVTNHLTRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLL  470
             G LKPALG +W  +P+ R+LL
Sbjct  258   GRLKPALGRAWSFVPNTRILL  278



>ref|XP_007517000.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Erinaceus 
europaeus]
Length=323

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 123/235 (52%), Gaps = 16/235 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E VG   SGKTQVC  +A+NVA      V+++D+    +
Sbjct  83    STGLGSLDKLLDAGLYTGEMTEFVGGPGSGKTQVCLCVAANVACGLQQNVLYVDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +  ++A+      +  I     FDIF M   +   ++T+  Q   S 
Sbjct  143   ASRLLQLLQARTPDEETQAR-----ALQRIQVVHAFDIFQMLAALQDFRATVAQQVSSSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS++++++P+LGG    G ALM      LK LA +  + V+VTNH+    ++
Sbjct  198   GTVKVVIVDSVTAVVSPLLGGQQREGLALMMQLALELKTLARDLGVAVVVTNHVTRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHIS----SISVLKHPNMATGDR--VEFQ  386
             G LKPALG SW  +P  R+LL        S    S  + K P +  G +  V+F+
Sbjct  258   GKLKPALGLSWSFVPSTRILLDLGEGTGASGSWRSACLTKSPRLPIGSQEMVDFE  312



>ref|XP_009923891.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Haliaeetus albicilla]
Length=329

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 125/231 (54%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGVPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++   S++     ++ LE  +  I    VF+I+ M   +  L+  +  Q   S    +++
Sbjct  149   ILRARSED----GEEQLE-ALQRIQVVRVFNIYEMLSALQELRDHLSQQVVSSMGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV-AGEAGLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +      G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKHSEGLAIMMQLARELKTLAKEFSLAVVVTNQVTRESSTGPLKPA  263

Query  514   LGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL        + + + ++S++  K     TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLESKETTWEKATTQRVASLA--KSSRQPTGIQVELDI  312



>ref|XP_001373739.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Monodelphis 
domestica]
Length=328

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 130/230 (57%), Gaps = 20/230 (9%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+ G  +SGKTQVC   A+NVA S G+ V+++D+    +
Sbjct  83    STGMARLDKLLDSGLYTGEVTEITGAPASGKTQVCLCTAANVAHSLGQNVLYIDSTGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   +++   +A+      + +I    VFDIF M D++  L+ ++  Q   + 
Sbjct  143   ASRLLQLLQAKTEDEEEQAR-----ALQSIHVVRVFDIFQMLDMLQDLRGSISQQVTSAS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV-AGEA  533
                +++++DS+S++++P+LGG  + G ALM      LK LA E  + VLVTNH+    ++
Sbjct  198   GPVKIVVVDSVSAVVSPLLGGQYSEGLALMMQLARELKTLARELGIAVLVTNHVTRERDS  257

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISSI-------SVLKHPNMATG  404
             G+LKPALG SW  +P  R+LL    AR  S +       S+ K P   TG
Sbjct  258   GVLKPALGRSWSFVPSTRVLL---EAREGSQVPHGCRVASLTKSPRQPTG  304



>dbj|BAB19970.1| Trad [Mus musculus]
 gb|EDL15681.1| RAD51-like 3 (S. cerevisiae), isoform CRA_h [Mus musculus]
Length=329

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 118/228 (52%), Gaps = 15/228 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+ +++   + +   +A       +  I     FDIF M D++  L+ T+  Q    +
Sbjct  143   ASRLLQLLQARTQDEEKQA-----SALQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSS  197

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                +++I+DS++++  P+LGG    G ALM      LK LA +  + V+VTNH+     G
Sbjct  198   GAVKVVIVDSVTAVAAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDWDG  257

Query  529   -LLKPALGESWKSIPHIRLLLS-RDSARHISS----ISVLKHPNMATG  404
                KPALG SW  +P  R+LL   + A  + S    + + K P   TG
Sbjct  258   RRFKPALGRSWSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSPRQPTG  305



>ref|XP_004664545.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Jaculus jaculus]
Length=292

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 107/199 (54%), Gaps = 10/199 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      V+++D+   F+
Sbjct  53    STGIGSLDKLLDAGLYTGEMTEIVGGPGSGKTQVCLCVAANVAHGLQQNVLYVDSNGGFT  112

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M DV+  L+  +  Q   S 
Sbjct  113   ASRLLQLLQARTQDEEEQA-----GALQRIQVARAFDIFQMLDVLQDLRGAVAQQVTGSS  167

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++++DS+++++ P+LGG    G ALM      LK LA +  + V+VTNH+    + 
Sbjct  168   GTVKVVMVDSVTAVVAPLLGGQQREGLALMMQLARELKTLAWDLGVAVVVTNHLTRDRDN  227

Query  532   GLLKPALGESWKSIPHIRL  476
             G  KPALG SW  +P  R+
Sbjct  228   GKFKPALGRSWSFVPSTRI  246



>ref|XP_010720057.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Meleagris gallopavo]
 ref|XP_010720058.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Meleagris gallopavo]
Length=326

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/230 (33%), Positives = 118/230 (51%), Gaps = 18/230 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL G   SGKTQVC  IA+NV+    + VVFLD+   F+  R+  
Sbjct  89    LDQLLDAGLYTGEVTELAGAPGSGKTQVCLSIAANVSLGLRQHVVFLDSTGGFTASRL--  146

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRARML---  692
                QM        ++ +E  +  +    VFDI+ M   +H ++  +  Q    A +L   
Sbjct  147   --YQMLQARVEDREEQME-ALQRVQVVRVFDIYEMLRALHEVRDCLSQQVESSAGLLKAV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++++P+LGG  + G A+M      LK LA E ++ VLVTN +    +   LK A
Sbjct  204   LIDSVSAVLSPLLGGRQSEGLAIMMQLARELKTLAKEFSVAVLVTNQVTRDNSTSALKSA  263

Query  514   LGESWKSIPHIRLLLS------RDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL        +   H + ++  K P   TG +V+  I
Sbjct  264   LGRSWSFVPSTRVLLQGRAAPWEEGTAHTACLA--KSPRQPTGMQVQLDI  311



>ref|XP_005349431.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Microtus 
ochrogaster]
Length=329

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 107/201 (53%), Gaps = 10/201 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+ G   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIAGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M D++  L+  M  Q   S 
Sbjct  143   ASRLLQLLQARTQDEEKQA-----GALRRIQVAHAFDIFRMLDMLQDLRGAMAQQATASS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                +++I+DS+++++ P+LGG    G ALM      LK LA +  + V+VTNH+     G
Sbjct  198   GAVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDRDG  257

Query  529   -LLKPALGESWKSIPHIRLLL  470
                KPALG SW  +P  R+LL
Sbjct  258   RRFKPALGRSWSFVPSTRILL  278



>gb|EDL15676.1| RAD51-like 3 (S. cerevisiae), isoform CRA_c [Mus musculus]
Length=250

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 115/222 (52%), Gaps = 15/222 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +  R+ +
Sbjct  10    LDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMTASRLLQ  69

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA---RML  692
             ++   + +   +A       +  I     FDIF M D++  L+ T+  Q    +   +++
Sbjct  70    LLQARTQDEEKQA-----SALQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSSGAVKVV  124

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG-LLKPA  515
             I+DS++++  P+LGG    G ALM      LK LA +  + V+VTNH+     G   KPA
Sbjct  125   IVDSVTAVAAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDWDGRRFKPA  184

Query  514   LGESWKSIPHIRLLLS-RDSARHISS----ISVLKHPNMATG  404
             LG SW  +P  R+LL   + A  + S    + + K P   TG
Sbjct  185   LGRSWSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSPRQPTG  226



>ref|XP_009510043.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Phalacrocorax 
carbo]
Length=301

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 118/231 (51%), Gaps = 19/231 (8%)
 Frame = -1

Query  1045  KCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRV  869
             + +D  L+ GL  G + EL+G   SGKTQVC  IA++V+ S  + V+FLD+   F+  R 
Sbjct  59    RSLDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLSLQQHVLFLDSTGGFTASR-  117

Query  868   AEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRAR  698
                V QM        ++ LE  +  I    VFDI+ M   +  L+  +  Q   S    +
Sbjct  118   ---VYQMLQGQAEDKEEQLE-ALQRIQVVRVFDIYEMLRALQELRDRLSQQVVSSMGPLK  173

Query  697   MLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLK  521
             +++IDS+S++I P        G A+M      LK LA E +L V+VTN +    + G LK
Sbjct  174   IVVIDSVSAVIYPXXXXXPPSGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTGPLK  233

Query  520   PALGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEF  389
             PALG SW  +P  R+LL    A       + ++S++  K P   TG +VE 
Sbjct  234   PALGRSWSFVPSTRVLLESKEATWEKATTQRVASLA--KSPRQPTGIQVEL  282



>ref|XP_005349430.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Microtus 
ochrogaster]
Length=330

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 107/202 (53%), Gaps = 11/202 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+ G   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIAGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+ +++   + +   +A       +  I     FDIF M D++  L+  M  Q    +
Sbjct  143   ASRLLQLLQARTQDEEKQA-----GALRRIQVAHAFDIFRMLDMLQDLRGAMAQQQATAS  197

Query  700   ----RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA  533
                 +++I+DS+++++ P+LGG    G ALM      LK LA +  + V+VTNH+     
Sbjct  198   SGAVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDRD  257

Query  532   G-LLKPALGESWKSIPHIRLLL  470
             G   KPALG SW  +P  R+LL
Sbjct  258   GRRFKPALGRSWSFVPSTRILL  279



>ref|XP_006832385.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Chrysochloris 
asiatica]
Length=327

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/228 (32%), Positives = 116/228 (51%), Gaps = 13/228 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + ELVG   SGKTQ+C  +A+NVA S    ++++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTELVGSPGSGKTQICLCMAANVALSLQQNILYIDSSGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SGC  707
               R+ +++   + +   +A       +  I     FDIF M  V+  L+ T   Q  S  
Sbjct  143   ASRLLQLLQARTQDEEEQAA-----ALQRIQVVRAFDIFQMLHVLQDLRGTGSQQVISSG  197

Query  706   RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EAG  530
               +M+++DS++++++P+LG     G A M      LK +A +  + V+VTNH+    ++G
Sbjct  198   TLKMVLVDSVTAVVSPLLGVQQGEGLAFMMQLARELKTVARDLGVAVVVTNHVTRDRDSG  257

Query  529   LLKPALGESWKSIPHIRLLLSRDSARHISS----ISVLKHPNMATGDR  398
              LKPALG SW  +P  R+LL        S       + K P   TG R
Sbjct  258   KLKPALGRSWSFVPSTRILLDMQEGAGTSGSQRVACLTKSPRRPTGIR  305



>gb|EDL15678.1| RAD51-like 3 (S. cerevisiae), isoform CRA_e [Mus musculus]
Length=264

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 115/222 (52%), Gaps = 15/222 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +  R+ +
Sbjct  24    LDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMTASRLLQ  83

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA---RML  692
             ++   + +   +A       +  I     FDIF M D++  L+ T+  Q    +   +++
Sbjct  84    LLQARTQDEEKQAS-----ALQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSSGAVKVV  138

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG-LLKPA  515
             I+DS++++  P+LGG    G ALM      LK LA +  + V+VTNH+     G   KPA
Sbjct  139   IVDSVTAVAAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDWDGRRFKPA  198

Query  514   LGESWKSIPHIRLLLS-RDSARHISS----ISVLKHPNMATG  404
             LG SW  +P  R+LL   + A  + S    + + K P   TG
Sbjct  199   LGRSWSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSPRQPTG  240



>ref|XP_002503137.1| Rad51 DNA recombinase 4 [Micromonas sp. RCC299]
 gb|ACO64395.1| Rad51 DNA recombinase 4 [Micromonas sp. RCC299]
Length=292

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/244 (32%), Positives = 115/244 (47%), Gaps = 24/244 (10%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGRVVFLDTCNSFSPKRVAEV  860
             IDD L GGLR G + EL G + SGKTQ+C   A++ A    RVV+LDT   FS KR+ E 
Sbjct  42    IDDLLEGGLRQGQVTELTGEAGSGKTQLCLSAAASAAALGHRVVYLDTGGGFSAKRIKEF  101

Query  859   VSQM--SDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQS---------  713
                   +D  +++ ++ L   +  I   +V DI T+F V+  L   +             
Sbjct  102   HRGFVTADADSAEVEQHLSLTLDLITVLNVHDILTLFKVLEELALGLSGDPGVPGDGGLE  161

Query  712   --------GCRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVT  557
                     G    +L++DS+SSL++P++      G  +MAS   +L+ LA  HN  VL T
Sbjct  162   GNQDVVDIGRDMGLLVVDSLSSLLSPVITRLHHQGYTMMASTASLLRSLAPAHNCAVLYT  221

Query  556   NHMVAG-----EAGLLKPALGESWKSIPHIRLLLSRDSARHISSISVLKHPNMATGDRVE  392
             NH V+          +KPALG  W S PH R+ L +         +        TG    
Sbjct  222   NHTVSAGGNDRGGASIKPALGTRWTSTPHRRVCLGKGHGNDAQGCTAEVIYGPGTGSSCA  281

Query  391   FQIL  380
             F+++
Sbjct  282   FKVV  285



>ref|XP_010998674.1| PREDICTED: DNA repair protein RAD51 homolog 4-like, partial [Camelus 
dromedarius]
Length=230

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 113/213 (53%), Gaps = 20/213 (9%)
 Frame = -1

Query  1006  GHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFSPKRVAEVVSQMSDNSTS  830
             G + E+VG   SGKTQVC  ++++V+      V+++D+    +  R+ +++   + +   
Sbjct  2     GEVTEIVGGPGSGKTQVCLCVSAHVSHGLQQNVLYIDSNGGLTASRILQLLQARTPDEEE  61

Query  829   KAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARMLIIDSISSLITP  659
             +A       +  I     FDIF M DV+  L+ T+  Q   S    +++I+DS++++++P
Sbjct  62    QA-----GALQRIQVVRAFDIFQMLDVIQDLRGTVAQQVSSSSGTLKVVIVDSVTAVVSP  116

Query  658   ILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EAGLLKPALGESWKSIPHI  482
             +LGG    G ALM      LK LA +  + V+VTNHM    + G LKPALG SW  +P  
Sbjct  117   LLGGQQREGLALMMQLARELKTLARDLGVAVVVTNHMTRDRDTGKLKPALGRSWSFVPST  176

Query  481   RLLL-------SRDSARHISSISVLKHPNMATG  404
             R LL       + DS R    + ++K P + TG
Sbjct  177   RFLLDVTKGTGASDSQRM---VCLMKSPRLPTG  206



>ref|XP_009800889.1| PREDICTED: DNA repair protein RAD51 homolog 4-like isoform X2 
[Nicotiana sylvestris]
Length=135

 Score =   107 bits (266),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -1

Query  802  MSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRARMLIIDSISSLITPILGGSGAHGRAL  623
            M+NIVC SVFDIFT+F+V+H LK+ + SQ     RM+IIDSIS+LITPILGG GA G AL
Sbjct  1    MNNIVCLSVFDIFTLFEVLHQLKNNLISQVDQHIRMIIIDSISTLITPILGGGGAQGHAL  60

Query  622  MASAGFILKQLANEHNLPVLV  560
            M S GF+LK LA+EH++ +LV
Sbjct  61   MVSVGFLLKLLAHEHDICILV  81


 Score = 39.3 bits (90),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 27/52 (52%), Gaps = 0/52 (0%)
 Frame = -2

Query  531  VF*SLHLARVGRAFHTLDCCFPVTLQDTLVAFQC*NIQIWLLEIEWSSRYYD  376
            V  S HL RV  AF  LD  +P T   T  A Q  +   WL EIE SSRY D
Sbjct  81   VLPSQHLERVRGAFRMLDFYYPETELGTSAACQYLDTHTWLQEIELSSRYND  132



>ref|XP_007485578.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Monodelphis 
domestica]
Length=302

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 120/202 (59%), Gaps = 10/202 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+ G  +SGKTQVC   A+NVA S G+ V+++D+    +
Sbjct  83    STGMARLDKLLDSGLYTGEVTEITGAPASGKTQVCLCTAANVAHSLGQNVLYIDSTGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   +++   +A+      + +I    VFDIF M D++  L+ ++  Q   + 
Sbjct  143   ASRLLQLLQAKTEDEEEQAR-----ALQSIHVVRVFDIFQMLDMLQDLRGSISQQVTSAS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMV-AGEA  533
                +++++DS+S++++P+LGG  + G ALM      LK LA E  + VLVTNH+    ++
Sbjct  198   GPVKIVVVDSVSAVVSPLLGGQYSEGLALMMQLARELKTLARELGIAVLVTNHVTRERDS  257

Query  532   GLLKPALGESWKSIPHIRLLLS  467
             G+LKPALG SW  +P  R+LL 
Sbjct  258   GVLKPALGRSWSFVPSTRVLLE  279



>ref|XP_009883436.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Charadrius vociferus]
Length=329

 Score =   117 bits (292),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 78/231 (34%), Positives = 126/231 (55%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G ++EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDHLLDSGLYTGEVMELMGVPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++      + ++A++     +  I    VF+I+ M   +  L+  +  Q   S    +++
Sbjct  149   ML-----RAKAEAEEEQLEALQRIQVVRVFNIYEMLSALQDLRDRLSQQVVSSVGPLKIV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +    + G LKPA
Sbjct  204   VIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSTGALKPA  263

Query  514   LGESWKSIPHIRLLLSRDSA-------RHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL    A       + I+S++  K P   TG +VE  I
Sbjct  264   LGRSWSFVPSTRVLLETKEATWEKATTQRIASLA--KSPRQPTGIQVELDI  312



>ref|NP_001005687.1| RAD51 paralog D [Xenopus (Silurana) tropicalis]
 gb|AAH75110.1| RAD51-like 3 (S. cerevisiae) [Xenopus (Silurana) tropicalis]
 emb|CAJ83738.1| RAD51-like 3 [Xenopus (Silurana) tropicalis]
Length=320

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 121/226 (54%), Gaps = 14/226 (6%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + E+ G + SGKTQ C  IA NVA +  + V+++DT    +  R+ +
Sbjct  89    LDILLDSGLYTGEVTEIAGAAGSGKTQTCQSIAVNVAYNLKQTVLYVDTTGGLTASRLLQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMS--NIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRAR  698
             +V        S+ K   E V S   I    VFDI+ +FD    L+  +  Q   SG   R
Sbjct  149   LVQ-------SRTKSEDEQVASLQRIEVIRVFDIYKLFDAFQDLRHQISQQLLRSGEPLR  201

Query  697   MLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKP  518
             ++I+DS+ ++I P+LGG    G A+M      L+ LA++++L +L++N +    A   +P
Sbjct  202   LVIVDSVCAVIYPMLGGKHTEGMAIMMQLARELQTLAHDYHLAILISNSITKDGATGNRP  261

Query  517   ALGESWKSIPHIRLLLSRDSARHISSI-SVLKHPNMATGDRVEFQI  383
             ALG SW  +P  R+LL+        SI S++K P   T  +++ +I
Sbjct  262   ALGRSWSFVPSTRILLTPTELNCGHSIVSLVKSPRQPTNLQLDMEI  307



>gb|KFQ37373.1| DNA repair protein RAD51 4, partial [Mesitornis unicolor]
Length=335

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 124/244 (51%), Gaps = 36/244 (15%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++VA S  + V+FLD+   FS  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVALSLKQHVLFLDSTAGFSASRLYQ  148

Query  862   VVSQMSDN-----STSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRAR  698
             ++   +++     S+  A  +LE  +  +    VFD++ M   +  L+  +  Q      
Sbjct  149   ILQCQAEDEEEQASSPGAGPALE-ALQRVQVVRVFDVYEMLSAMQKLRDRLSQQ------  201

Query  697   MLIIDSISSL-----------ITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNH  551
               ++ S+  L           + P+LGG  + G A+M      LK LA E +L V+VTN 
Sbjct  202   --VVSSVGPLKIVVVDSVSAVVYPLLGGRQSEGLAIMMQLARELKTLAREFSLAVVVTNQ  259

Query  550   MVAGEA-GLLKPALGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRV  395
             +    + G LKPALG SW  +P  R+LL        R +AR I+S++  K P   TG +V
Sbjct  260   VTRDSSTGPLKPALGRSWSFVPSTRVLLESKETNWERATARRIASLA--KSPRQPTGIQV  317

Query  394   EFQI  383
             E  I
Sbjct  318   ELDI  321



>ref|XP_005077006.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X3 [Mesocricetus 
auratus]
Length=324

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 116/228 (51%), Gaps = 20/228 (9%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAYSLQQNVLYVDSSGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M D++  L+  M  Q   S 
Sbjct  143   ASRLLQLLQARTQDEEKQA-----GALQRIQVARAFDIFQMLDMLQDLRGAMAQQEVTSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                +++I+DS+++++ P+LG     G ALM      LK LA +  + V+VTNH+     G
Sbjct  198   GTVKVVIVDSVTAVVAPLLG-----GLALMMQLARELKTLARDLAVAVVVTNHLTWDRDG  252

Query  529   -LLKPALGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATG  404
                KPALG SW  +P  R+LL     +    R   ++ + K P   TG
Sbjct  253   RRFKPALGRSWSFVPSTRILLDVIEGAGTLGRGQRTVCLTKSPRQPTG  300



>ref|XP_010184455.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Mesitornis unicolor]
Length=329

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 122/239 (51%), Gaps = 35/239 (15%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++VA S  + V+FLD+   FS  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVALSLKQHVLFLDSTAGFSASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRARMLIID  683
             ++   +++     ++ LE  +  +    VFD++ M   +  L+  +  Q        ++ 
Sbjct  149   ILQCQAEDE----EEQLE-ALQRVQVVRVFDVYEMLSAMQKLRDRLSQQ--------VVS  195

Query  682   SISSL-----------ITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGE  536
             S+  L           + P+LGG  + G A+M      LK LA E +L V+VTN +    
Sbjct  196   SVGPLKIVVVDSVSAVVYPLLGGRQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDS  255

Query  535   A-GLLKPALGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             + G LKPALG SW  +P  R+LL        R +AR I+S++  K P   TG +VE  I
Sbjct  256   STGPLKPALGRSWSFVPSTRVLLESKETNWERATARRIASLA--KSPRQPTGIQVELDI  312



>ref|XP_008570833.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Galeopterus variegatus]
Length=328

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 120/227 (53%), Gaps = 14/227 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      ++++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAYGLQQNILYIDSKGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M DV+  L+ TM  Q   S 
Sbjct  143   ASRLLQLLQARTQDEEEQA-----GALQRIQVVHAFDIFQMLDVLQDLRGTMAQQVTSSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++++DS++++++P+LGG    G ALM      LK LA +  L V+VTNHM    ++
Sbjct  198   GTMKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGLAVVVTNHMTCDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHIS----SISVLKHPNMATG  404
             G  KPALG SW  +P  R+LLS       S    ++ + K P   TG
Sbjct  258   GKFKPALGRSWSFVPSTRILLSITDGAGASGCQRTMCLTKSPRQPTG  304



>gb|AAG42287.1| RAD5113 [Mus musculus]
Length=329

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 117/228 (51%), Gaps = 15/228 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+ +++   + +   +A       +  I      DIF M D++  L+ T+  Q    +
Sbjct  143   ASRLLQLLQARTQDEEKQA-----SALQRIQVVRSXDIFRMLDMLQDLRGTIAQQEATSS  197

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                +++I+DS++++  P+LGG    G ALM      LK LA +  + V+VTNH+     G
Sbjct  198   GAVKVVIVDSVTAVAAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDWDG  257

Query  529   -LLKPALGESWKSIPHIRLLLS-RDSARHISS----ISVLKHPNMATG  404
                KPALG SW  +P  R+LL   + A  + S    + + K P   TG
Sbjct  258   RRFKPALGRSWSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSPRQPTG  305



>ref|XP_002195631.2| PREDICTED: DNA repair protein RAD51 homolog 4 [Taeniopygia guttata]
Length=524

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 120/229 (52%), Gaps = 15/229 (7%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   +GKTQ+C  IA++V+    + V+FLD+   F+  R+  
Sbjct  284   LDQLLDSGLYTGEVTELMGAPGTGKTQLCLGIAASVSLGLKQHVLFLDSTGGFTASRLY-  342

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
                QM    T   ++ LE  +  +    VF+I+ +   +  L+  +  Q   S    +++
Sbjct  343   ---QMLQAQTEDEEEQLE-ALQRVRVERVFNIYEVLRALQELRDRLSQQVVSSMGPLKVV  398

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             ++DS+S++I P+LGG  + G ALM      LK LA E +L V+VTN +    + G LKPA
Sbjct  399   VLDSVSAVIYPLLGGRQSEGLALMMQLSRELKTLAREFSLAVVVTNQVTRDSSTGTLKPA  458

Query  514   LGESWKSIPHIRLLLSRDSARHIS-----SISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL    A         + S+ K P   TG +VE  I
Sbjct  459   LGRSWSFVPSTRVLLESKEATWEKCSTQRAASLAKSPRQPTGIQVELDI  507



>ref|XP_010021074.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Nestor 
notabilis]
Length=314

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 124/232 (53%), Gaps = 21/232 (9%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + V+FLD+   F+  R+ +
Sbjct  89    LDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVLFLDSTGGFTASRLYQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ----SGCRARM  695
             ++      + S+ ++     +  I    VFDI+ M   +  L+  +  Q    +G   ++
Sbjct  149   ML-----RAQSEEEEEQLEALQRIQVVRVFDIYEMLSALQELRERLSQQVLSFTGP-LKI  202

Query  694   LIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA-GEAGLLKP  518
             +++DS+S+LI P+LGG  + G A+M      LK LA E +L V+VTN +     +G  KP
Sbjct  203   VVVDSVSALIYPLLGGKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSSSGPPKP  262

Query  517   ALGESWKSIPHIRLL-------LSRDSARHISSISVLKHPNMATGDRVEFQI  383
             ALG SW  +P  R+L       L + + + I+S++  K P    G +VE  I
Sbjct  263   ALGRSWSFVPSTRVLLENKEVTLEKATTQRIASLA--KSPRQPVGRQVELDI  312



>ref|NP_001185575.1| DNA repair protein RAD51 homolog 4 [Gallus gallus]
Length=327

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 119/231 (52%), Gaps = 19/231 (8%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL G   SGKTQVC  IA++V+    + V FLD+   F+  R+  
Sbjct  89    LDQLLDAGLYTGEVTELAGAPGSGKTQVCLSIAASVSLGLRQHVFFLDSTGGFTASRL--  146

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA---RML  692
                QM        ++ LE  +  +    +FDI+ M   +H ++  +  Q    A   + +
Sbjct  147   --YQMLQARVEDKEEQLE-ALQRVQVVRMFDIYEMLRALHEVRDCLSQQVESSAGPLKAV  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-GLLKPA  515
             +IDS+S++++P+LGG  + G A+M      LK LA E ++ V+VTN +    + G LK A
Sbjct  204   LIDSVSAVLSPLLGGRQSEGLAIMMQLARELKTLAKEFSVAVVVTNQVTRDSSTGALKSA  263

Query  514   LGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             LG SW  +P  R+LL          +A H + ++  K P   TG +V+  I
Sbjct  264   LGRSWSFVPSTRVLLQGRAVPWEEGAAPHTACLA--KSPRQPTGMQVQLDI  312



>ref|XP_003726418.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Strongylocentrotus 
purpuratus]
Length=323

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 120/203 (59%), Gaps = 9/203 (4%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFS  881
             ST    ID  L+GG+    L E+VG ++ GKTQ C  +AS VA SS + V+F+DT   F 
Sbjct  83    STGCDSIDKLLDGGVYTSELTEIVGQAAVGKTQFCLTLASCVAVSSEQNVLFIDTNGGFH  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGC--  707
               R+ ++++       S ++K     +  + C + FD++ + D++  +K+++ S S    
Sbjct  143   ASRLHDIIAH-----KSTSEKITSAALHKVHCATTFDLYDLLDLLESIKASIDSASEAFY  197

Query  706   -RARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                +++++DS+++++ P+LGG  + G+ +M      LK LA ++++ V++ N+MV GE G
Sbjct  198   SSLKLVVVDSVTAVLAPLLGGKHSEGQGMMVHLARSLKSLAADYSIAVVMCNNMVRGERG  257

Query  529   LLKPALGESWKSIPHIRLLLSRD  461
               KPALG +W ++PH R+ L  D
Sbjct  258   EPKPALGRTWLTVPHTRIQLRAD  280



>ref|XP_003996621.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Felis catus]
Length=328

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 120/227 (53%), Gaps = 14/227 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      VV++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAYGLQQNVVYIDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M DV+  L+  M  Q   + 
Sbjct  143   ASRLLQLLQARTPDEEEQA-----GALQRIQVVRAFDIFQMLDVLQDLRGAMSQQVSSAS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++++DS++++++P+LGG    G ALM      LK LA +  + V+VTNHM    ++
Sbjct  198   ATVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDVGVAVMVTNHMTRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISS----ISVLKHPNMATG  404
             G LKPALG SW  +P  R+LL  +    +S       + K P + TG
Sbjct  258   GKLKPALGRSWSFVPSTRILLDIEEGAGMSGSWRRAYLTKSPRLPTG  304



>ref|XP_007096120.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Panthera tigris 
altaica]
Length=328

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 120/227 (53%), Gaps = 14/227 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      VV++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAYGLQQNVVYVDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M DV+  L+  M  Q   + 
Sbjct  143   ASRLLQLLQARTPDEEEQA-----GALQRIQVVRAFDIFQMLDVLQDLRGAMSQQVSSAS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++++DS++++++P+LGG    G ALM      LK LA +  + V+VTNHM+   ++
Sbjct  198   ATVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDVGVAVMVTNHMIRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISS----ISVLKHPNMATG  404
             G LKPALG SW  +P  R+LL  +     S       + K P + TG
Sbjct  258   GKLKPALGRSWSFVPSTRILLDIEEGAGTSGSWRRACLTKSPRLPTG  304



>ref|XP_002923663.1| PREDICTED: DNA repair protein RAD51 homolog 4-like [Ailuropoda 
melanoleuca]
Length=302

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 121/227 (53%), Gaps = 14/227 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      VV++D+    +
Sbjct  57    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAYGLQQNVVYIDSNGGLT  116

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SGC  707
               R+ +++      + + A++     +  I     FDIF M DV+   + T+  Q  SG 
Sbjct  117   ASRILQLL-----QAKTPAEEEQAGALQRIQVVRAFDIFQMLDVLQDFRGTVSQQVSSGS  171

Query  706   RA-RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
              A + +++DS++++++P+LGG    G ALM      LK LA +  + V+VTNH+    ++
Sbjct  172   AATKAVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGVAVVVTNHVTRDRDS  231

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISS----ISVLKHPNMATG  404
             G LKPALG SW  +P  R+LL  D     S       + K P + TG
Sbjct  232   GDLKPALGRSWSFVPSTRILLDVDKGAGASGSRRRACLTKSPRLPTG  278



>gb|EFB17511.1| hypothetical protein PANDA_012831 [Ailuropoda melanoleuca]
Length=300

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 121/227 (53%), Gaps = 14/227 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      VV++D+    +
Sbjct  56    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAYGLQQNVVYIDSNGGLT  115

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SGC  707
               R+ +++      + + A++     +  I     FDIF M DV+   + T+  Q  SG 
Sbjct  116   ASRILQLL-----QAKTPAEEEQAGALQRIQVVRAFDIFQMLDVLQDFRGTVSQQVSSGS  170

Query  706   RA-RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
              A + +++DS++++++P+LGG    G ALM      LK LA +  + V+VTNH+    ++
Sbjct  171   AATKAVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGVAVVVTNHVTRDRDS  230

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISS----ISVLKHPNMATG  404
             G LKPALG SW  +P  R+LL  D     S       + K P + TG
Sbjct  231   GDLKPALGRSWSFVPSTRILLDVDKGAGASGSRRRACLTKSPRLPTG  277



>ref|XP_010639671.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Fukomys damarensis]
 gb|KFO25943.1| DNA repair protein RAD51 like protein 4 [Fukomys damarensis]
Length=329

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 119/228 (52%), Gaps = 15/228 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A++VA S    V+++D     +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAAHVAHSLQQNVLYIDCNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FD+F   D +  L+  +  Q   S 
Sbjct  143   ALRLLQLLQARTQDEEEQA-----GALQRIQVAHAFDVFQTLDQLQDLRGAVAQQVTGSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++++DSI+++++P+LGG    G ALM      LK LA + ++ V+VTNHM    ++
Sbjct  198   GTVKVVVVDSIAAVVSPLLGGQQREGLALMMQLARELKTLARDLSVAVVVTNHMTRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATG  404
             G LKPALG SW  +P  R+LL     +  S R +    + K P   TG
Sbjct  258   GRLKPALGRSWSFVPSTRVLLDSIDGTGASGRSLRMACLTKSPRQPTG  305



>ref|XP_010002132.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Chaetura pelagica]
Length=358

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 125/237 (53%), Gaps = 19/237 (8%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFS  881
             ST    +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + VVFLD+   F+
Sbjct  109   STGSPSLDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVVFLDSTGGFT  168

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   +++   + +      +  +    VF ++     +  L+  +  Q   S 
Sbjct  169   ASRLHQMLRARAEDEGEQLE-----ALQRVQVVRVFHVYETLRALQELRDRLSFQVVSST  223

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA-GEA  533
                +++++DS+S++++P+LGG  + G A+M      LK LA E +L V+VTN +     +
Sbjct  224   APLKIVVVDSVSAVLSPLLGGKQSEGLAIMMHLARELKTLAREFSLAVVVTNQVTRDSSS  283

Query  532   GLLKPALGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             G LKPALG SW  +P  R+LL        + +   I+S++  K P   TG +VE  I
Sbjct  284   GSLKPALGRSWSFVPSTRVLLESKEGTWEKGTTHRIASLA--KSPRQPTGIQVEMDI  338



>ref|XP_008693804.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Ursus maritimus]
Length=318

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 121/227 (53%), Gaps = 14/227 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+ G   SGKTQVC  +A+NVA      VV++D+    +
Sbjct  73    STGIGSLDKLLDAGLYTGEVTEIAGGPGSGKTQVCLCVAANVAYGLQQNVVYIDSNGGLT  132

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ--SG-  710
               R+ +++      + + A++     +  I     FDIF M DV+   + T+  Q  SG 
Sbjct  133   ASRILQLL-----QARTPAEEEQAGALQRIQVVRAFDIFQMLDVLQDFRGTVSQQVSSGS  187

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
               A+ +++DS++++++P+LGG    G ALM      LK LA +  + V+VTNH++   ++
Sbjct  188   AAAKAVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGVAVVVTNHVIRDRDS  247

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISS----ISVLKHPNMATG  404
             G LKPALG SW  +P  R+LL  D     S       + K P + TG
Sbjct  248   GDLKPALGRSWSFVPSTRILLDVDEGAGASGSRRRACLTKSPRLPTG  294



>ref|XP_006990138.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Peromyscus 
maniculatus bairdii]
Length=324

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 110/201 (55%), Gaps = 15/201 (7%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M +++  L+ TM  Q   S 
Sbjct  143   ASRLLQLLQARTQDEEKQA-----GALQRIQVVHAFDIFQMLNMLQDLRGTMAQQATASS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++I+DS+++++ P+LG     G ALM      LK LA E  + V+VTNH+    ++
Sbjct  198   GTVKVVIVDSVTAVVAPLLG-----GLALMMQLARELKILARELGVAVMVTNHLTRDRDS  252

Query  532   GLLKPALGESWKSIPHIRLLL  470
               +KPALG SW  +P  R+LL
Sbjct  253   RRVKPALGRSWSFVPSTRILL  273



>gb|KFU94305.1| DNA repair protein RAD51 4, partial [Chaetura pelagica]
Length=315

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 124/237 (52%), Gaps = 19/237 (8%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFS  881
             ST    +D  L+ GL  G + EL+G   SGKTQVC  IA++V+    + VVFLD+   F+
Sbjct  72    STGSPSLDQLLDSGLYTGEVTELMGAPGSGKTQVCLGIAASVSLGLKQHVVFLDSTGGFT  131

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   +++   + +      +  +    VF ++     +  L+     Q   S 
Sbjct  132   ASRLHQMLRARAEDEGEQLE-----ALQRVQVVRVFHVYETLRALQELRDPSSFQVVSST  186

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVA-GEA  533
                +++++DS+S++++P+LGG  + G A+M      LK LA E +L V+VTN +     +
Sbjct  187   APLKIVVVDSVSAVLSPLLGGKQSEGLAIMMHLARELKTLAREFSLAVVVTNQVTRDSSS  246

Query  532   GLLKPALGESWKSIPHIRLLL-------SRDSARHISSISVLKHPNMATGDRVEFQI  383
             G LKPALG SW  +P  R+LL        + +   I+S++  K P   TG +VE  I
Sbjct  247   GSLKPALGRSWSFVPSTRVLLESKEGTWEKGTTHRIASLA--KSPRQPTGIQVEMDI  301



>ref|XP_007563937.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Poecilia formosa]
Length=333

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 111/196 (57%), Gaps = 9/196 (5%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARSSGR-VVFLDTCNSFSPKRVAE  863
             +D  L+ GL  G + EL G   SGK+QVCF +A ++A    + V+++DT    +  R+ +
Sbjct  89    LDKLLDSGLYTGEITELTGGPGSGKSQVCFGVAVHIAYQLKQSVIYIDTTGGLTASRLLQ  148

Query  862   VVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SGCRARML  692
             ++ Q   N+T +  ++L+ + +    + +FD+  + D ++ L      +    G   + L
Sbjct  149   ML-QTETNNTDEQMEALQRIHT----FRLFDVGALLDCLYGLGGGGLHKVCVGGGSVKAL  203

Query  691   IIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAGLLKPAL  512
             I+DS+S++ITP+LGG    G +LM      LK +A + N+ VLVTNH+    +G ++P L
Sbjct  204   IVDSVSAVITPLLGGKQNEGMSLMIQVAAALKTMAKDFNVAVLVTNHVTRSSSGEVQPGL  263

Query  511   GESWKSIPHIRLLLSR  464
             G SW  +P  R+LL R
Sbjct  264   GVSWSHVPRTRILLER  279



>ref|XP_010341997.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Saimiri boliviensis 
boliviensis]
Length=328

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 119/201 (59%), Gaps = 10/201 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSSGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A ++L+ +    V Y+ FDIF M DV+  L+ T+  Q   S 
Sbjct  143   ASRLLQLLQAKTQDEEEQA-EALQRIQ---VVYA-FDIFQMLDVLQELRGTVVQQVTGSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++++DS++++++P+LGG    G ALM      LK LA +  + V+VTNH+    ++
Sbjct  198   GTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLL  470
             G LKPALG SW  +P  R+LL
Sbjct  258   GRLKPALGRSWSFVPSTRILL  278



>ref|NP_001264867.1| DNA repair protein RAD51 homolog 4 isoform 2 [Mus musculus]
Length=324

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 118/228 (52%), Gaps = 20/228 (9%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA S    V+++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQSGCRA  701
               R+ +++   + +   +A       +  I     FDIF M D++  L+ T+  Q    +
Sbjct  143   ASRLLQLLQARTQDEEKQA-----SALQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSS  197

Query  700   ---RMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEAG  530
                +++I+DS+++++ P+LG     G ALM      LK LA +  + V+VTNH+     G
Sbjct  198   GAVKVVIVDSVTAVVAPLLG-----GLALMMQLARELKILARDLGVAVVVTNHLTRDWDG  252

Query  529   -LLKPALGESWKSIPHIRLLLS-RDSARHISS----ISVLKHPNMATG  404
                KPALG SW  +P  R+LL   + A  + S    + + K P   TG
Sbjct  253   RRFKPALGRSWSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSPRQPTG  300



>ref|XP_009874974.1| PREDICTED: DNA repair protein RAD51 homolog 4, partial [Apaloderma 
vittatum]
Length=325

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 118/235 (50%), Gaps = 21/235 (9%)
 Frame = -1

Query  1039  IDDFLNGGLRDGHLIELVGPSSSGKTQ------VCFMIASNVARSSGR-VVFLDTCNSFS  881
             +D  L+ GL  G + EL+G   SGKTQ       C  I ++V+    + V+FLD+   F+
Sbjct  79    LDQLLDSGLYTGEVTELMGAPGSGKTQGWLTPSPCLGIVASVSLGLKQHVLFLDSTGGFT  138

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   +++     K      +  +    VF I+ M   +  L+  +  Q   S 
Sbjct  139   ASRLYQMLQARAED-----KDEQLEALQRVQVVRVFHIYEMLSALQELRDRLSQQVVSSM  193

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAGEA-  533
                ++++IDS+S++I P+LGG  + G A+M      LK LA E +L V+VTN +      
Sbjct  194   APLKVVVIDSVSAVIYPLLGGKQSEGLAIMMQLARELKTLAREFSLAVVVTNQVTRDSGT  253

Query  532   GLLKPALGESWKSIPHIRLLL-----SRDSARHISSISVLKHPNMATGDRVEFQI  383
             GLLKPALG SW  +P  R+LL     S + A      S+ K P   TG +VE  I
Sbjct  254   GLLKPALGRSWSFVPSTRVLLESKEASWEKATTQRLASLAKSPRQPTGIQVELDI  308



>ref|XP_004416858.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform 1 [Odobenus 
rosmarus divergens]
Length=328

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 118/227 (52%), Gaps = 14/227 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQVC  +A+NVA      VV++D+    +
Sbjct  83    STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHGLQQNVVYIDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF M DV+   +  M  Q   + 
Sbjct  143   ASRILQLLQARTPDEEEQA-----GALQRIQVVRAFDIFQMLDVLQDFRGAMSQQVSSAS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++++DS++++++P+LGG    G ALM      LK LA +  + V+VTNHM    ++
Sbjct  198   MTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHMTRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISS----ISVLKHPNMATG  404
             G L+PALG SW  +P  R+LL  D     S       + K P + TG
Sbjct  258   GELRPALGRSWSFVPSTRILLDIDEGAGASGSQRRACLTKSPRLPTG  304



>ref|XP_008072483.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X2 [Tarsius 
syrichta]
Length=328

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 122/229 (53%), Gaps = 14/229 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQ+C  +A+N+A S    V+++D+    +
Sbjct  83    STGLGSLDKLLDAGLYTGEVTEIVGGPGSGKTQICLCVAANMAHSLQQNVLYVDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I    VFDIF M  V+  L+ T+  Q   S 
Sbjct  143   ASRLLQLLQARTQDEEEQA-----GALQRIQVVHVFDIFQMLGVLQDLRGTVAQQVTGSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                RM+++DS++++++P+LGG    G ALM      LK LA +  + V+VTNH+    ++
Sbjct  198   GTLRMVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISS----ISVLKHPNMATGDR  398
             G LKPALG SW  +P  R+LL+       S     + + K P   TG R
Sbjct  258   GRLKPALGRSWSFVPSTRILLNVIEETGTSGSQRMVCLTKSPRQPTGVR  306



>ref|XP_008072482.1| PREDICTED: DNA repair protein RAD51 homolog 4 isoform X1 [Tarsius 
syrichta]
Length=328

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 122/229 (53%), Gaps = 14/229 (6%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQ+C  +A+N+A S    V+++D+    +
Sbjct  83    STGLGSLDKLLDAGLYTGEVTEIVGGPGSGKTQICLCVAANMAHSLQQNVLYVDSNGGLT  142

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I    VFDIF M  V+  L+ T+  Q   S 
Sbjct  143   ASRLLQLLQARTQDEEEQA-----GALQRIQVVHVFDIFQMLGVLQDLRGTVAQQVSSSS  197

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                RM+++DS++++++P+LGG    G ALM      LK LA +  + V+VTNH+    ++
Sbjct  198   GTLRMVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDRDS  257

Query  532   GLLKPALGESWKSIPHIRLLLSRDSARHISS----ISVLKHPNMATGDR  398
             G LKPALG SW  +P  R+LL+       S     + + K P   TG R
Sbjct  258   GRLKPALGRSWSFVPSTRILLNVIEETGTSGSQRMVCLTKSPRQPTGVR  306



>ref|XP_004685091.1| PREDICTED: DNA repair protein RAD51 homolog 4 [Condylura cristata]
Length=355

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 114/201 (57%), Gaps = 10/201 (5%)
 Frame = -1

Query  1057  STVVKCIDDFLNGGLRDGHLIELVGPSSSGKTQVCFMIASNVARS-SGRVVFLDTCNSFS  881
             ST +  +D  L+ GL  G + E+VG   SGKTQ C  +A+NVA S    V+++D+    +
Sbjct  115   STGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQACLCVAANVAYSLQQNVLYVDSNGGLT  174

Query  880   PKRVAEVVSQMSDNSTSKAKKSLEHVMSNIVCYSVFDIFTMFDVVHHLKSTMRSQ---SG  710
               R+ +++   + +   +A       +  I     FDIF MFDV+H  ++ +  Q   S 
Sbjct  175   ACRLLQLLQARTPDEEEQAA-----ALQRIQVVRAFDIFQMFDVLHDFRTAVAQQISGSS  229

Query  709   CRARMLIIDSISSLITPILGGSGAHGRALMASAGFILKQLANEHNLPVLVTNHMVAG-EA  533
                +++++DS++++++P+LGG    G ALM      LK LA + N+ V+VTNH+    ++
Sbjct  230   ATVKVVVVDSVTAVVSPLLGGQQTEGLALMMQLARELKMLARDLNVAVVVTNHLTRDRDS  289

Query  532   GLLKPALGESWKSIPHIRLLL  470
             G LKPALG SW  +P  R+LL
Sbjct  290   GKLKPALGRSWSFVPSTRILL  310



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3958969345722