BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17206_g1_i1 len=1109 path=[704:0-701 1406:702-740 3204:741-1108]

Length=1109
                                                                      Score     E

ref|XP_008372641.1|  PREDICTED: cysteine-rich repeat secretory pr...    303   5e-98   
ref|XP_008244704.1|  PREDICTED: cysteine-rich repeat secretory pr...    302   2e-97   
ref|XP_009359012.1|  PREDICTED: cysteine-rich repeat secretory pr...    301   8e-97   
ref|XP_009372187.1|  PREDICTED: cysteine-rich repeat secretory pr...    298   9e-96   
ref|XP_007049618.1|  Receptor-like protein kinase-related family ...    297   2e-95   
ref|XP_009334264.1|  PREDICTED: cysteine-rich repeat secretory pr...    297   3e-95   
ref|XP_008382567.1|  PREDICTED: cysteine-rich repeat secretory pr...    296   4e-95   
ref|XP_010036760.1|  PREDICTED: cysteine-rich repeat secretory pr...    294   4e-94   
ref|XP_004492208.1|  PREDICTED: cysteine-rich repeat secretory pr...    290   6e-93   
gb|KDO60896.1|  hypothetical protein CISIN_1g036866mg                   290   7e-93   
ref|XP_006484824.1|  PREDICTED: cysteine-rich repeat secretory pr...    290   7e-93   
ref|XP_006437221.1|  hypothetical protein CICLE_v10032523mg             289   2e-92   
ref|XP_002264674.2|  PREDICTED: cysteine-rich repeat secretory pr...    288   7e-92   Vitis vinifera
ref|XP_010908261.1|  PREDICTED: cysteine-rich repeat secretory pr...    287   2e-91   
ref|XP_003622768.1|  Cysteine-rich repeat secretory protein             286   4e-91   
ref|XP_003551283.1|  PREDICTED: cysteine-rich repeat secretory pr...    285   7e-91   
emb|CDP14580.1|  unnamed protein product                                284   3e-90   
emb|CDP03947.1|  unnamed protein product                                283   4e-90   
ref|XP_009769622.1|  PREDICTED: cysteine-rich repeat secretory pr...    283   6e-90   
ref|XP_009611212.1|  PREDICTED: cysteine-rich repeat secretory pr...    283   6e-90   
ref|XP_004247276.1|  PREDICTED: cysteine-rich repeat secretory pr...    282   1e-89   
emb|CAN64566.1|  hypothetical protein VITISV_020515                     287   1e-89   Vitis vinifera
gb|AFK33693.1|  unknown                                                 281   5e-89   
ref|XP_010241766.1|  PREDICTED: cysteine-rich repeat secretory pr...    280   8e-89   
ref|XP_006365261.1|  PREDICTED: cysteine-rich repeat secretory pr...    278   4e-88   
ref|XP_008788477.1|  PREDICTED: cysteine-rich repeat secretory pr...    276   3e-87   
ref|XP_007140710.1|  hypothetical protein PHAVU_008G135300g             275   7e-87   
ref|XP_002526797.1|  DUF26 domain-containing protein 2 precursor,...    275   8e-87   Ricinus communis
gb|KDP45259.1|  hypothetical protein JCGZ_15124                         271   2e-85   
ref|XP_011089218.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    271   2e-85   
ref|XP_002533056.1|  DUF26 domain-containing protein 1 precursor,...    271   4e-85   Ricinus communis
ref|XP_010100808.1|  hypothetical protein L484_015838                   269   2e-84   
gb|EYU40654.1|  hypothetical protein MIMGU_mgv1a012036mg                262   9e-82   
ref|XP_007200165.1|  hypothetical protein PRUPE_ppa016689mg             257   2e-80   
ref|XP_006828418.1|  hypothetical protein AMTR_s00060p00084230          257   6e-80   
ref|XP_002269937.2|  PREDICTED: cysteine-rich repeat secretory pr...    255   4e-79   Vitis vinifera
ref|XP_004290148.1|  PREDICTED: cysteine-rich repeat secretory pr...    254   9e-79   
ref|NP_199665.1|  receptor-like protein kinase-related family pro...    254   1e-78   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31328.1|  hypothetical protein AALP_AA6G098000                    250   3e-77   
emb|CBI18745.3|  unnamed protein product                                254   4e-77   
ref|XP_002865649.1|  hypothetical protein ARALYDRAFT_494916             249   5e-77   
emb|CDX85345.1|  BnaC07g26560D                                          248   2e-76   
ref|XP_011024571.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    247   3e-76   
ref|XP_010482102.1|  PREDICTED: cysteine-rich repeat secretory pr...    247   5e-76   
ref|XP_010442278.1|  PREDICTED: cysteine-rich repeat secretory pr...    246   1e-75   
ref|XP_009151651.1|  PREDICTED: cysteine-rich repeat secretory pr...    245   4e-75   
ref|XP_006828415.1|  hypothetical protein AMTR_s00060p00079250          244   5e-75   
ref|XP_010036761.1|  PREDICTED: cysteine-rich repeat secretory pr...    244   6e-75   
ref|XP_006386887.1|  hypothetical protein POPTR_0002s25110g             240   1e-73   
ref|XP_006395170.1|  hypothetical protein EUTSA_v10005717mg             240   2e-73   
gb|EYU40655.1|  hypothetical protein MIMGU_mgv1a025334mg                238   9e-73   
gb|EYU39171.1|  hypothetical protein MIMGU_mgv1a027159mg                238   1e-72   
ref|XP_006280966.1|  hypothetical protein CARUB_v10026967mg             238   1e-72   
gb|EPS71622.1|  hypothetical protein M569_03138                         235   7e-72   
ref|XP_010524650.1|  PREDICTED: cysteine-rich repeat secretory pr...    236   1e-71   
ref|XP_010666948.1|  PREDICTED: cysteine-rich repeat secretory pr...    234   7e-71   
ref|XP_010666949.1|  PREDICTED: cysteine-rich repeat secretory pr...    233   1e-70   
ref|XP_009419751.1|  PREDICTED: cysteine-rich repeat secretory pr...    228   1e-68   
ref|XP_008784514.1|  PREDICTED: cysteine-rich repeat secretory pr...    226   8e-68   
ref|XP_010920640.1|  PREDICTED: cysteine-rich repeat secretory pr...    223   8e-67   
ref|XP_010920641.1|  PREDICTED: cysteine-rich repeat secretory pr...    222   2e-66   
ref|XP_010493678.1|  PREDICTED: cysteine-rich repeat secretory pr...    218   2e-65   
ref|XP_010493679.1|  PREDICTED: cysteine-rich repeat secretory pr...    217   3e-65   
ref|XP_009421435.1|  PREDICTED: cysteine-rich repeat secretory pr...    218   6e-65   
ref|XP_009421340.1|  PREDICTED: cysteine-rich repeat secretory pr...    217   2e-64   
ref|XP_010910873.1|  PREDICTED: cysteine-rich repeat secretory pr...    216   2e-64   
ref|XP_008784711.1|  PREDICTED: cysteine-rich repeat secretory pr...    213   8e-63   
gb|KDP45260.1|  hypothetical protein JCGZ_15125                         205   3e-60   
gb|EEE58797.1|  hypothetical protein OsJ_10340                          202   1e-58   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049722.1|  Os03g0277700                                       202   2e-58   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89462.1|  hypothetical protein OsI_10995                          201   3e-58   Oryza sativa Indica Group [Indian rice]
emb|CDP03948.1|  unnamed protein product                                201   8e-58   
ref|XP_006828414.1|  hypothetical protein AMTR_s00060p00077910          196   1e-57   
gb|EMT26211.1|  hypothetical protein F775_06000                         198   5e-57   
ref|NP_001049721.1|  Os03g0277600                                       197   2e-56   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK01760.1|  predicted protein                                      191   2e-54   
gb|ACG28478.1|  serine/threonine kinase-like protein                    191   2e-54   Zea mays [maize]
gb|ACF85855.1|  unknown                                                 191   3e-54   Zea mays [maize]
gb|EMS54365.1|  hypothetical protein TRIUR3_10430                       182   1e-50   
ref|XP_008784712.1|  PREDICTED: cysteine-rich repeat secretory pr...    179   2e-50   
ref|NP_001060951.1|  Os08g0136700                                       180   7e-50   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ05518.1|  hypothetical protein OsI_27735                          179   8e-50   Oryza sativa Indica Group [Indian rice]
gb|EEC75106.1|  hypothetical protein OsI_11281                          176   1e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_006649855.1|  PREDICTED: cysteine-rich repeat secretory pr...    176   2e-48   
ref|XP_004960510.1|  PREDICTED: cysteine-rich repeat secretory pr...    176   2e-48   
ref|XP_003561775.1|  PREDICTED: cysteine-rich repeat secretory pr...    175   4e-48   
gb|EAZ05517.1|  hypothetical protein OsI_27734                          175   4e-48   Oryza sativa Indica Group [Indian rice]
gb|EEE68008.1|  hypothetical protein OsJ_25967                          174   5e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060949.1|  Os08g0136500                                       175   6e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060948.1|  Os08g0136300                                       174   6e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465466.1|  hypothetical protein SORBIDRAFT_01g039360          174   8e-48   Sorghum bicolor [broomcorn]
dbj|BAK03405.1|  predicted protein                                      174   1e-47   
dbj|BAJ88159.1|  predicted protein                                      173   2e-47   
dbj|BAJ99535.1|  predicted protein                                      174   3e-47   
gb|EMT06514.1|  hypothetical protein F775_26971                         172   4e-47   
ref|XP_010645253.1|  PREDICTED: uncharacterized protein LOC100260018    174   6e-47   
ref|XP_004984745.1|  PREDICTED: cysteine-rich repeat secretory pr...    171   1e-46   
emb|CAN83911.1|  hypothetical protein VITISV_000581                     172   3e-46   Vitis vinifera
ref|NP_001054451.1|  Os05g0112800                                       169   5e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010241767.1|  PREDICTED: cysteine-rich repeat secretory pr...    166   6e-46   
gb|EAY96288.1|  hypothetical protein OsI_18186                          169   8e-46   Oryza sativa Indica Group [Indian rice]
gb|EAY96282.1|  hypothetical protein OsI_18180                          169   8e-46   Oryza sativa Indica Group [Indian rice]
ref|NP_001060952.1|  Os08g0136800                                       168   1e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EMT06513.1|  hypothetical protein F775_12194                         167   5e-45   
ref|XP_008391617.1|  PREDICTED: cysteine-rich repeat secretory pr...    165   9e-45   
ref|XP_002440468.1|  hypothetical protein SORBIDRAFT_09g001430          166   2e-44   Sorghum bicolor [broomcorn]
ref|XP_008342465.1|  PREDICTED: cysteine-rich repeat secretory pr...    164   3e-44   
emb|CDP12548.1|  unnamed protein product                                161   5e-43   
ref|XP_002533057.1|  conserved hypothetical protein                     156   3e-42   Ricinus communis
ref|XP_002274668.1|  PREDICTED: cysteine-rich repeat secretory pr...    157   7e-42   Vitis vinifera
ref|XP_010051179.1|  PREDICTED: cysteine-rich repeat secretory pr...    157   7e-42   
ref|XP_010051171.1|  PREDICTED: cysteine-rich repeat secretory pr...    157   1e-41   
ref|XP_002274604.1|  PREDICTED: cysteine-rich repeat secretory pr...    156   3e-41   Vitis vinifera
gb|KHN36561.1|  Cysteine-rich repeat secretory protein 38               155   6e-41   
ref|XP_008237024.1|  PREDICTED: cysteine-rich repeat secretory pr...    155   7e-41   
ref|XP_008237025.1|  PREDICTED: cysteine-rich repeat secretory pr...    155   8e-41   
ref|XP_007149948.1|  hypothetical protein PHAVU_005G112800g             155   1e-40   
ref|XP_010069655.1|  PREDICTED: cysteine-rich repeat secretory pr...    154   2e-40   
gb|AFW74942.1|  putative DUF26 domain family protein                    155   2e-40   
ref|XP_006469729.1|  PREDICTED: cysteine-rich repeat secretory pr...    154   2e-40   
ref|NP_001147502.1|  protein kinase precursor                           154   2e-40   Zea mays [maize]
ref|XP_003543377.1|  PREDICTED: cysteine-rich repeat secretory pr...    154   2e-40   
ref|XP_002274745.2|  PREDICTED: cysteine-rich repeat secretory pr...    153   3e-40   Vitis vinifera
ref|XP_007024474.1|  Receptor-like protein kinase-related family ...    153   3e-40   
ref|XP_010684085.1|  PREDICTED: cysteine-rich repeat secretory pr...    153   5e-40   
ref|XP_008236988.1|  PREDICTED: cysteine-rich repeat secretory pr...    153   5e-40   
emb|CBI28973.3|  unnamed protein product                                153   6e-40   
gb|KDP25874.1|  hypothetical protein JCGZ_22904                         152   9e-40   
ref|XP_010247023.1|  PREDICTED: cysteine-rich repeat secretory pr...    151   1e-39   
gb|ACU16205.1|  unknown                                                 150   3e-39   Glycine max [soybeans]
ref|XP_003566611.1|  PREDICTED: cysteine-rich repeat secretory pr...    151   3e-39   
ref|XP_011079182.1|  PREDICTED: cysteine-rich repeat secretory pr...    150   6e-39   
gb|AES67291.2|  cysteine-rich RLK (receptor-like kinase) protein        149   8e-39   
ref|XP_003633310.1|  PREDICTED: cysteine-rich repeat secretory pr...    149   1e-38   
gb|AFK43074.1|  unknown                                                 148   2e-38   
ref|XP_010247032.1|  PREDICTED: uncharacterized protein LOC104590182    157   2e-38   
ref|XP_003597040.1|  Cysteine-rich repeat secretory protein             150   3e-38   
ref|XP_006380319.1|  hypothetical protein POPTR_0007s02730g             147   5e-38   
ref|XP_006387991.1|  receptor-like protein kinase                       147   5e-38   
emb|CAN73040.1|  hypothetical protein VITISV_044350                     145   5e-38   Vitis vinifera
ref|XP_007216907.1|  hypothetical protein PRUPE_ppa019252mg             146   8e-38   
ref|XP_011003220.1|  PREDICTED: cysteine-rich repeat secretory pr...    147   9e-38   
ref|XP_007216947.1|  hypothetical protein PRUPE_ppa016345mg             145   9e-38   
ref|XP_006447470.1|  hypothetical protein CICLE_v10017568mg             147   9e-38   
ref|XP_008228882.1|  PREDICTED: cysteine-rich repeat secretory pr...    146   1e-37   
ref|XP_002533571.1|  DUF26 domain-containing protein 2 precursor,...    146   1e-37   Ricinus communis
ref|XP_010051188.1|  PREDICTED: cysteine-rich repeat secretory pr...    146   2e-37   
ref|XP_002515716.1|  DUF26 domain-containing protein 2 precursor,...    145   2e-37   Ricinus communis
ref|XP_007149947.1|  hypothetical protein PHAVU_005G112700g             145   3e-37   
ref|XP_004144581.1|  PREDICTED: cysteine-rich repeat secretory pr...    145   4e-37   
ref|XP_002309843.2|  hypothetical protein POPTR_0007s02720g             145   4e-37   Populus trichocarpa [western balsam poplar]
ref|XP_006380320.1|  hypothetical protein POPTR_0007s02740g             145   4e-37   
ref|XP_010051161.1|  PREDICTED: cysteine-rich repeat secretory pr...    145   4e-37   
ref|XP_010532487.1|  PREDICTED: cysteine-rich repeat secretory pr...    145   4e-37   
ref|XP_003635324.2|  PREDICTED: cysteine-rich repeat secretory pr...    147   4e-37   
ref|XP_011003221.1|  PREDICTED: cysteine-rich repeat secretory pr...    144   6e-37   
ref|XP_006372981.1|  hypothetical protein POPTR_0017s06750g             144   7e-37   
gb|AGT15891.1|  hypothetical protein SHCRBa_258_I03_F_10                150   8e-37   
ref|XP_004251507.1|  PREDICTED: cysteine-rich repeat secretory pr...    144   8e-37   
ref|XP_006372983.1|  hypothetical protein POPTR_0017s06770g             144   9e-37   
ref|XP_010247616.1|  PREDICTED: cysteine-rich receptor-like prote...    150   1e-36   
ref|XP_006592824.1|  PREDICTED: cysteine-rich repeat secretory pr...    141   1e-36   
ref|XP_006372978.1|  hypothetical protein POPTR_0017s06720g             144   1e-36   
ref|XP_006351953.1|  PREDICTED: cysteine-rich repeat secretory pr...    143   1e-36   
ref|XP_009605992.1|  PREDICTED: cysteine-rich repeat secretory pr...    143   2e-36   
ref|XP_009591406.1|  PREDICTED: cysteine-rich repeat secretory pr...    143   2e-36   
ref|XP_010931363.1|  PREDICTED: cysteine-rich receptor-like prote...    149   3e-36   
ref|XP_006372982.1|  hypothetical protein POPTR_0017s06760g             142   4e-36   
ref|XP_008455543.1|  PREDICTED: cysteine-rich repeat secretory pr...    143   4e-36   
ref|XP_006372985.1|  hypothetical protein POPTR_0017s06790g             142   4e-36   
ref|XP_006387992.1|  hypothetical protein POPTR_0421s00210g             142   4e-36   
ref|XP_008455405.1|  PREDICTED: cysteine-rich repeat secretory pr...    142   1e-35   
ref|NP_566697.1|  Receptor-like protein kinase-related family pro...    141   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006372979.1|  hypothetical protein POPTR_0017s06730g             141   1e-35   
ref|XP_010051151.1|  PREDICTED: cysteine-rich repeat secretory pr...    141   1e-35   
ref|XP_009793791.1|  PREDICTED: cysteine-rich repeat secretory pr...    141   1e-35   
ref|XP_010087722.1|  Cysteine-rich receptor-like protein kinase 25      147   1e-35   
ref|XP_008342466.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   2e-35   
ref|XP_009787631.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   2e-35   
ref|XP_004144485.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   2e-35   
ref|XP_003597035.1|  Cysteine-rich repeat secretory protein             140   3e-35   
dbj|BAG87054.1|  unnamed protein product                                137   4e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007043326.1|  Cysteine-rich RLK 10, putative                     145   4e-35   
ref|XP_009418903.1|  PREDICTED: cysteine-rich repeat secretory pr...    139   6e-35   
emb|CDP04889.1|  unnamed protein product                                144   7e-35   
ref|XP_010647173.1|  PREDICTED: putative receptor-like protein ki...    145   8e-35   
emb|CDP22123.1|  unnamed protein product                                144   8e-35   
ref|XP_010247024.1|  PREDICTED: cysteine-rich repeat secretory pr...    138   1e-34   
ref|XP_004961654.1|  PREDICTED: cysteine-rich receptor-like prote...    144   1e-34   
ref|XP_010056929.1|  PREDICTED: cysteine-rich receptor-like prote...    143   2e-34   
emb|CAN73036.1|  hypothetical protein VITISV_044346                     137   2e-34   Vitis vinifera
ref|XP_004292427.1|  PREDICTED: cysteine-rich repeat secretory pr...    137   2e-34   
ref|XP_010679273.1|  PREDICTED: cysteine-rich repeat secretory pr...    137   2e-34   
ref|XP_011037144.1|  PREDICTED: cysteine-rich repeat secretory pr...    137   2e-34   
ref|XP_006351952.1|  PREDICTED: cysteine-rich repeat secretory pr...    137   3e-34   
gb|KHN24392.1|  Cysteine-rich receptor-like protein kinase 5            142   3e-34   
gb|EYU43106.1|  hypothetical protein MIMGU_mgv1a021349mg                137   3e-34   
gb|KDO37425.1|  hypothetical protein CISIN_1g005846mg                   141   3e-34   
ref|XP_006352035.1|  PREDICTED: cysteine-rich repeat secretory pr...    137   3e-34   
ref|XP_006850460.1|  hypothetical protein AMTR_s00035p00082360          137   4e-34   
ref|XP_003632027.1|  PREDICTED: cysteine-rich receptor-like prote...    143   4e-34   
ref|XP_008224859.1|  PREDICTED: cysteine-rich receptor-like prote...    143   4e-34   
gb|KDO37424.1|  hypothetical protein CISIN_1g005846mg                   140   5e-34   
gb|KHN24396.1|  Cysteine-rich receptor-like protein kinase 25           141   5e-34   
ref|XP_010267891.1|  PREDICTED: cysteine-rich receptor-like prote...    142   5e-34   
ref|XP_003541936.1|  PREDICTED: cysteine-rich repeat secretory pr...    137   5e-34   
ref|XP_007214583.1|  hypothetical protein PRUPE_ppa026781mg             142   5e-34   
gb|KDO37426.1|  hypothetical protein CISIN_1g005846mg                   140   6e-34   
ref|XP_010646958.1|  PREDICTED: uncharacterized protein LOC100265431    144   9e-34   
gb|KDO37427.1|  hypothetical protein CISIN_1g005846mg                   140   1e-33   
ref|XP_006406217.1|  hypothetical protein EUTSA_v10021371mg             136   1e-33   
ref|XP_008224765.1|  PREDICTED: cysteine-rich receptor-like prote...    141   1e-33   
ref|XP_009357384.1|  PREDICTED: cysteine-rich receptor-like prote...    141   2e-33   
ref|XP_003559575.2|  PREDICTED: putative receptor-like protein ki...    141   2e-33   
gb|KCW76447.1|  hypothetical protein EUGRSUZ_D00839                     135   2e-33   
emb|CAN65425.1|  hypothetical protein VITISV_005300                     142   2e-33   Vitis vinifera
ref|XP_009340926.1|  PREDICTED: cysteine-rich receptor-like prote...    141   2e-33   
ref|XP_010644348.1|  PREDICTED: cysteine-rich receptor-like prote...    139   2e-33   
ref|XP_006383959.1|  hypothetical protein POPTR_0004s02450g             136   2e-33   
ref|XP_010644341.1|  PREDICTED: cysteine-rich receptor-like prote...    140   3e-33   
gb|KDP32106.1|  hypothetical protein JCGZ_12567                         134   3e-33   
gb|KFK39506.1|  hypothetical protein AALP_AA3G252600                    135   3e-33   
gb|KDO37423.1|  hypothetical protein CISIN_1g005846mg                   139   3e-33   
ref|XP_009340923.1|  PREDICTED: cysteine-rich receptor-like prote...    140   3e-33   
ref|XP_010054433.1|  PREDICTED: cysteine-rich receptor-like prote...    140   3e-33   
ref|XP_011037143.1|  PREDICTED: cysteine-rich repeat secretory pr...    134   4e-33   
ref|XP_009340924.1|  PREDICTED: cysteine-rich receptor-like prote...    140   4e-33   
ref|XP_006467962.1|  PREDICTED: cysteine-rich receptor-like prote...    140   5e-33   
gb|KDO37422.1|  hypothetical protein CISIN_1g005846mg                   139   5e-33   
ref|XP_008232237.1|  PREDICTED: cysteine-rich receptor-like prote...    139   7e-33   
gb|KDO39525.1|  hypothetical protein CISIN_1g007490mg                   139   7e-33   
ref|XP_002441306.1|  hypothetical protein SORBIDRAFT_09g024150          137   8e-33   Sorghum bicolor [broomcorn]
gb|EYU43107.1|  hypothetical protein MIMGU_mgv1a022379mg                133   8e-33   
ref|XP_002304943.2|  hypothetical protein POPTR_0004s02390g             134   1e-32   Populus trichocarpa [western balsam poplar]
gb|KEH26423.1|  cysteine-rich receptor-kinase-like protein              140   1e-32   
ref|XP_006850463.1|  hypothetical protein AMTR_s00035p00086030          133   1e-32   
ref|XP_003549139.1|  PREDICTED: cysteine-rich receptor-like prote...    140   1e-32   
ref|XP_009360784.1|  PREDICTED: cysteine-rich receptor-like prote...    140   1e-32   
ref|NP_001146710.1|  uncharacterized protein LOC100280312 precursor     138   1e-32   Zea mays [maize]
gb|AFW78495.1|  putative DUF26-domain receptor-like protein kinas...    138   1e-32   
ref|XP_009340920.1|  PREDICTED: cysteine-rich receptor-like prote...    138   2e-32   
gb|KDO75587.1|  hypothetical protein CISIN_1g040542mg                   132   2e-32   
ref|XP_006468227.1|  PREDICTED: cysteine-rich repeat secretory pr...    132   2e-32   
ref|XP_008340068.1|  PREDICTED: cysteine-rich receptor-like prote...    138   2e-32   
ref|XP_006449123.1|  hypothetical protein CICLE_v10018168mg             132   2e-32   
gb|EYU43108.1|  hypothetical protein MIMGU_mgv1a018557mg                132   2e-32   
ref|XP_010247622.1|  PREDICTED: cysteine-rich receptor-like prote...    138   2e-32   
gb|KDO37599.1|  hypothetical protein CISIN_1g008238mg                   136   2e-32   
emb|CAN73038.1|  hypothetical protein VITISV_044348                     132   2e-32   Vitis vinifera
ref|XP_006469774.1|  PREDICTED: cysteine-rich repeat secretory pr...    132   2e-32   
ref|XP_004168058.1|  PREDICTED: cysteine-rich repeat secretory pr...    131   2e-32   
ref|XP_004144580.1|  PREDICTED: cysteine-rich repeat secretory pr...    131   2e-32   
gb|KDO59869.1|  hypothetical protein CISIN_1g041051mg                   130   3e-32   
emb|CDP04898.1|  unnamed protein product                                134   3e-32   
ref|XP_010052402.1|  PREDICTED: putative receptor-like protein ki...    137   4e-32   
gb|KGN43546.1|  hypothetical protein Csa_7G044860                       132   4e-32   
ref|XP_009398186.1|  PREDICTED: cysteine-rich repeat secretory pr...    131   4e-32   
ref|XP_008455404.1|  PREDICTED: cysteine-rich repeat secretory pr...    131   5e-32   
ref|XP_010103954.1|  Cysteine-rich receptor-like protein kinase 25      136   5e-32   
ref|XP_007010459.1|  Receptor-like protein kinase-related family ...    130   6e-32   
ref|XP_007157184.1|  hypothetical protein PHAVU_002G049500g             137   6e-32   
ref|XP_006856952.1|  hypothetical protein AMTR_s01216p00000700          135   6e-32   
ref|XP_007211369.1|  hypothetical protein PRUPE_ppa002516mg             136   7e-32   
gb|KDO37598.1|  hypothetical protein CISIN_1g008238mg                   135   7e-32   
ref|XP_006838101.1|  hypothetical protein AMTR_s00106p00037610          132   9e-32   
emb|CAN73039.1|  hypothetical protein VITISV_044349                     130   1e-31   Vitis vinifera
gb|AGT15894.1|  hypothetical protein SHCRBa_258_I03_R_140               136   1e-31   
gb|AGT17379.1|  hypothetical protein SHCRBa_240_C21_F_200               135   1e-31   
ref|XP_003559574.1|  PREDICTED: putative receptor-like protein ki...    136   1e-31   
ref|XP_006838099.1|  hypothetical protein AMTR_s00106p00036910          131   1e-31   
emb|CDY68211.1|  BnaCnng58060D                                          130   1e-31   
ref|XP_008365097.1|  PREDICTED: cysteine-rich receptor-like prote...    131   1e-31   
ref|XP_006838094.1|  hypothetical protein AMTR_s00106p00032870          130   1e-31   
gb|AGT17169.1|  ATP binding protein                                     135   1e-31   
ref|XP_008349926.1|  PREDICTED: cysteine-rich receptor-like prote...    130   1e-31   
ref|XP_008371192.1|  PREDICTED: cysteine-rich receptor-like prote...    130   2e-31   
gb|AFW78497.1|  putative DUF26-domain receptor-like protein kinas...    135   2e-31   
ref|XP_008356777.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-31   
ref|XP_008649810.1|  PREDICTED: putative receptor-like protein ki...    135   2e-31   
gb|KDO59870.1|  hypothetical protein CISIN_1g046481mg                   130   2e-31   
gb|KCW76445.1|  hypothetical protein EUGRSUZ_D00835                     130   2e-31   
ref|XP_004295243.1|  PREDICTED: cysteine-rich receptor-like prote...    132   2e-31   
ref|XP_006599641.1|  PREDICTED: cysteine-rich receptor-like prote...    136   2e-31   
ref|XP_009145437.1|  PREDICTED: cysteine-rich repeat secretory pr...    130   2e-31   
ref|XP_010109547.1|  hypothetical protein L484_018282                   129   3e-31   
ref|XP_004496789.1|  PREDICTED: cysteine-rich receptor-like prote...    135   3e-31   
ref|XP_010247618.1|  PREDICTED: putative receptor-like protein ki...    135   3e-31   
ref|XP_004496788.1|  PREDICTED: cysteine-rich receptor-like prote...    135   3e-31   
gb|KEH43898.1|  cysteine-rich receptor-kinase-like protein              131   3e-31   
ref|XP_007152376.1|  hypothetical protein PHAVU_004G124900g             135   3e-31   
emb|CDY57408.1|  BnaA05g36230D                                          129   3e-31   
ref|XP_010247620.1|  PREDICTED: cysteine-rich receptor-like prote...    134   3e-31   
gb|EYU23767.1|  hypothetical protein MIMGU_mgv1a019684mg                129   4e-31   
gb|EMT14278.1|  Cysteine-rich receptor-like protein kinase 10           134   4e-31   
ref|XP_006449119.1|  hypothetical protein CICLE_v10014496mg             134   5e-31   
ref|XP_010057978.1|  PREDICTED: cysteine-rich receptor-like prote...    134   6e-31   
ref|XP_006449118.1|  hypothetical protein CICLE_v10017818mg             133   6e-31   
ref|XP_002518555.1|  ATP binding protein, putative                      134   6e-31   
ref|XP_011002059.1|  PREDICTED: cysteine-rich receptor-like prote...    134   6e-31   
gb|AFK48353.1|  unknown                                                 128   7e-31   
ref|XP_010095198.1|  Dehydration-responsive element-binding prote...    131   7e-31   
ref|XP_002518553.1|  ATP binding protein, putative                      134   7e-31   
ref|XP_007025962.1|  Cysteine-rich RLK 10, putative                     134   8e-31   
ref|XP_006449120.1|  hypothetical protein CICLE_v10014504mg             133   9e-31   
emb|CDP04899.1|  unnamed protein product                                133   9e-31   
emb|CDP19431.1|  unnamed protein product                                132   1e-30   
ref|XP_008371187.1|  PREDICTED: cysteine-rich receptor-like prote...    130   1e-30   
ref|XP_006469728.1|  PREDICTED: cysteine-rich receptor-like prote...    133   1e-30   
ref|XP_006573897.1|  PREDICTED: cysteine-rich receptor-like prote...    132   1e-30   
gb|KDO75584.1|  hypothetical protein CISIN_1g010329mg                   130   1e-30   
ref|XP_007143186.1|  hypothetical protein PHAVU_007G050800g             129   1e-30   
ref|XP_009340953.1|  PREDICTED: cysteine-rich receptor-like prote...    130   2e-30   
gb|KDO75581.1|  hypothetical protein CISIN_1g005893mg                   132   2e-30   
emb|CDY00053.1|  BnaC09g02480D                                          122   2e-30   
gb|AGT15895.1|  hypothetical protein SHCRBa_258_I03_R_340               131   2e-30   
gb|AES62685.2|  cysteine-rich receptor-kinase-like protein              130   2e-30   
ref|XP_010908140.1|  PREDICTED: cysteine-rich repeat secretory pr...    129   2e-30   
ref|XP_007025937.1|  Cysteine-rich RLK 29, putative                     132   2e-30   
ref|XP_006447473.1|  hypothetical protein CICLE_v10014576mg             132   2e-30   
ref|XP_009787632.1|  PREDICTED: cysteine-rich repeat secretory pr...    124   2e-30   
ref|XP_008363779.1|  PREDICTED: cysteine-rich receptor-like prote...    132   3e-30   
gb|KDO75583.1|  hypothetical protein CISIN_1g010329mg                   130   3e-30   
ref|XP_006383962.1|  hypothetical protein POPTR_0004s02500g             132   3e-30   
ref|XP_008349286.1|  PREDICTED: cysteine-rich receptor-like prote...    131   3e-30   
ref|XP_006468229.1|  PREDICTED: uncharacterized protein LOC102629341    133   3e-30   
ref|XP_002439997.1|  hypothetical protein SORBIDRAFT_09g024140          132   4e-30   
gb|KHG16271.1|  Cysteine-rich receptor-like protein kinase 25           131   4e-30   
gb|EMT32495.1|  hypothetical protein F775_20396                         127   4e-30   
ref|XP_008358736.1|  PREDICTED: cysteine-rich receptor-like prote...    131   4e-30   
ref|XP_009418900.1|  PREDICTED: putative receptor-like protein ki...    131   4e-30   
ref|NP_001238492.1|  cysteine-rich protein precursor                    131   4e-30   
ref|XP_010059676.1|  PREDICTED: cysteine-rich receptor-like prote...    127   5e-30   
gb|KHN30448.1|  Cysteine-rich receptor-like protein kinase 10           131   5e-30   
ref|XP_006387993.1|  hypothetical protein POPTR_0421s00220g             125   5e-30   
ref|XP_010910400.1|  PREDICTED: cysteine-rich repeat secretory pr...    127   6e-30   
gb|EYU23765.1|  hypothetical protein MIMGU_mgv1a011805mg                126   6e-30   
emb|CDP11363.1|  unnamed protein product                                131   7e-30   
ref|NP_192429.1|  cysteine-rich receptor-like protein kinase 25         130   7e-30   
ref|XP_007148797.1|  hypothetical protein PHAVU_005G015100g             129   8e-30   
ref|XP_003592435.1|  Cysteine-rich receptor-like protein kinase         129   8e-30   
emb|CBI23450.3|  unnamed protein product                                128   8e-30   
gb|KDO48492.1|  hypothetical protein CISIN_1g0460102mg                  126   8e-30   
ref|XP_004290149.1|  PREDICTED: cysteine-rich repeat secretory pr...    123   8e-30   
ref|XP_010910239.1|  PREDICTED: putative receptor-like protein ki...    130   9e-30   
ref|XP_006655441.1|  PREDICTED: cysteine-rich receptor-like prote...    129   1e-29   
ref|XP_002874837.1|  hypothetical protein ARALYDRAFT_911789             127   1e-29   
gb|KHN35203.1|  Cysteine-rich receptor-like protein kinase 10           130   1e-29   
ref|XP_006591515.1|  PREDICTED: cysteine-rich receptor-like prote...    130   1e-29   
ref|XP_006383961.1|  hypothetical protein POPTR_0004s02480g             124   1e-29   
ref|XP_008370580.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    130   1e-29   
gb|KHN07228.1|  Cysteine-rich receptor-like protein kinase 14           125   1e-29   
emb|CDP20318.1|  unnamed protein product                                129   2e-29   
ref|XP_010109373.1|  Cysteine-rich receptor-like protein kinase 25      127   2e-29   
ref|XP_003592436.1|  Cysteine-rich receptor-like protein kinase         129   2e-29   
ref|XP_009777401.1|  PREDICTED: cysteine-rich receptor-like prote...    125   2e-29   
ref|XP_007148796.1|  hypothetical protein PHAVU_005G015100g             129   3e-29   
ref|XP_008776432.1|  PREDICTED: cysteine-rich repeat secretory pr...    124   3e-29   
ref|XP_006590220.1|  PREDICTED: cysteine-rich receptor-like prote...    129   3e-29   
emb|CBI38478.3|  unnamed protein product                                127   3e-29   
ref|XP_010646644.1|  PREDICTED: cysteine-rich repeat secretory pr...    126   3e-29   
gb|KDP25619.1|  hypothetical protein JCGZ_20775                         123   3e-29   
ref|XP_009598807.1|  PREDICTED: cysteine-rich receptor-like prote...    129   3e-29   
ref|XP_003592434.1|  Cysteine-rich receptor-like protein kinase         129   3e-29   
ref|XP_006468228.1|  PREDICTED: uncharacterized protein LOC102629057    130   4e-29   
ref|XP_010057984.1|  PREDICTED: cysteine-rich receptor-like prote...    127   4e-29   
emb|CDY39159.1|  BnaC09g21850D                                          128   4e-29   
ref|XP_010069666.1|  PREDICTED: cysteine-rich repeat secretory pr...    123   4e-29   
ref|XP_010240976.1|  PREDICTED: cysteine-rich receptor-like prote...    130   4e-29   
ref|XP_009114496.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    128   4e-29   
gb|KHN02664.1|  Cysteine-rich receptor-like protein kinase 29           124   4e-29   
ref|XP_008804396.1|  PREDICTED: putative receptor-like protein ki...    129   4e-29   
ref|XP_010644356.1|  PREDICTED: cysteine-rich receptor-like prote...    124   4e-29   
gb|KDO39535.1|  hypothetical protein CISIN_1g041746mg                   127   4e-29   
gb|EMT14692.1|  Cysteine-rich receptor-like protein kinase 25           128   4e-29   
gb|KDO59868.1|  hypothetical protein CISIN_1g037548mg                   128   4e-29   
ref|XP_010646639.1|  PREDICTED: putative receptor-like protein ki...    128   5e-29   
gb|KCW75004.1|  hypothetical protein EUGRSUZ_E03766                     128   5e-29   
ref|XP_002518554.1|  ATP binding protein, putative                      127   5e-29   
ref|XP_011004251.1|  PREDICTED: putative cysteine-rich receptor-l...    124   5e-29   
gb|ABR16490.1|  unknown                                                 125   6e-29   
ref|XP_003637461.1|  Cysteine-rich receptor-like protein kinase         127   6e-29   
emb|CAN65760.1|  hypothetical protein VITISV_001837                     124   6e-29   
ref|XP_010247617.1|  PREDICTED: cysteine-rich receptor-like prote...    128   7e-29   
ref|XP_002518549.1|  ATP binding protein, putative                      127   8e-29   
gb|EEC79451.1|  hypothetical protein OsI_20442                          127   8e-29   
ref|XP_011007912.1|  PREDICTED: cysteine-rich receptor-like prote...    122   9e-29   
ref|XP_004144484.1|  PREDICTED: cysteine-rich repeat secretory pr...    122   9e-29   
gb|KDP20813.1|  hypothetical protein JCGZ_21284                         124   9e-29   
ref|XP_008455406.1|  PREDICTED: cysteine-rich repeat secretory pr...    122   9e-29   
ref|XP_008228908.1|  PREDICTED: cysteine-rich repeat secretory pr...    122   1e-28   
ref|XP_010931353.1|  PREDICTED: putative receptor-like protein ki...    127   1e-28   
ref|XP_003638035.1|  Cysteine-rich receptor-like protein kinase         127   1e-28   
ref|XP_003637976.1|  Cysteine-rich receptor-like protein kinase         127   1e-28   
gb|KEH26524.1|  cysteine-rich receptor-kinase-like protein              128   1e-28   
ref|XP_006373153.1|  hypothetical protein POPTR_0017s09190g             122   1e-28   
gb|KGN64558.1|  hypothetical protein Csa_1G064800                       125   1e-28   
ref|XP_010089691.1|  hypothetical protein L484_006313                   124   1e-28   
ref|XP_008776433.1|  PREDICTED: cysteine-rich receptor-like prote...    127   1e-28   
ref|XP_003610650.1|  Cysteine-rich receptor-like protein kinase         127   1e-28   
gb|KHN26412.1|  Cysteine-rich receptor-like protein kinase 10           127   1e-28   
ref|XP_006606027.1|  PREDICTED: cysteine-rich receptor-like prote...    124   1e-28   
ref|XP_010057983.1|  PREDICTED: cysteine-rich receptor-like prote...    127   1e-28   
gb|KHN02663.1|  Cysteine-rich receptor-like protein kinase 29           127   1e-28   
ref|XP_004168056.1|  PREDICTED: cysteine-rich repeat secretory pr...    122   2e-28   
emb|CAN74851.1|  hypothetical protein VITISV_019620                     127   2e-28   
ref|XP_010267898.1|  PREDICTED: uncharacterized protein LOC104605002    128   2e-28   
gb|KDO37169.1|  hypothetical protein CISIN_1g041433mg                   125   2e-28   
ref|XP_003635466.1|  PREDICTED: putative receptor-like protein ki...    127   2e-28   
ref|XP_010932101.1|  PREDICTED: cysteine-rich repeat secretory pr...    123   2e-28   
ref|XP_007143169.1|  hypothetical protein PHAVU_007G0495001g            125   2e-28   
ref|XP_008345332.1|  PREDICTED: cysteine-rich receptor-like prote...    126   2e-28   
ref|XP_009398950.1|  PREDICTED: uncharacterized protein LOC103983462    128   2e-28   
ref|XP_007143162.1|  hypothetical protein PHAVU_007G049100g             126   2e-28   
ref|XP_009357379.1|  PREDICTED: cysteine-rich receptor-like prote...    126   2e-28   
ref|XP_008779475.1|  PREDICTED: cysteine-rich receptor-like prote...    124   2e-28   
gb|KHG01974.1|  Cysteine-rich receptor-like protein kinase 26           125   2e-28   
ref|XP_010646646.1|  PREDICTED: cysteine-rich repeat secretory pr...    122   2e-28   
ref|XP_010931341.1|  PREDICTED: cysteine-rich receptor-like prote...    126   3e-28   
ref|XP_007025939.1|  Cysteine-rich RLK 29                               127   3e-28   
ref|XP_009418899.1|  PREDICTED: cysteine-rich receptor-like prote...    124   3e-28   
gb|EYU27837.1|  hypothetical protein MIMGU_mgv1a002310mg                126   3e-28   
emb|CDY46371.1|  BnaA09g19850D                                          125   3e-28   
ref|XP_010088082.1|  Cysteine-rich receptor-like protein kinase 25      124   3e-28   
gb|KHN27827.1|  Cysteine-rich receptor-like protein kinase 8            127   3e-28   
ref|XP_003635322.2|  PREDICTED: cysteine-rich receptor-like prote...    127   3e-28   
gb|KHG11982.1|  Cysteine-rich receptor-like protein kinase 26           125   3e-28   
ref|XP_003517662.1|  PREDICTED: cysteine-rich receptor-like prote...    126   3e-28   
ref|XP_009357380.1|  PREDICTED: cysteine-rich receptor-like prote...    126   3e-28   
ref|XP_003533249.1|  PREDICTED: cysteine-rich receptor-like prote...    127   4e-28   
ref|XP_004511332.1|  PREDICTED: cysteine-rich receptor-like prote...    125   4e-28   
ref|XP_002515717.1|  ATP binding protein, putative                      125   4e-28   
ref|XP_004511333.1|  PREDICTED: cysteine-rich receptor-like prote...    125   4e-28   
ref|XP_006587375.1|  PREDICTED: cysteine-rich receptor-like prote...    127   4e-28   
gb|KCW76450.1|  hypothetical protein EUGRSUZ_D00842                     125   4e-28   
ref|XP_006287210.1|  hypothetical protein CARUB_v10000385mg             125   4e-28   
ref|XP_007152378.1|  hypothetical protein PHAVU_004G125100g             126   4e-28   
ref|XP_006602740.1|  PREDICTED: putative cysteine-rich receptor-l...    125   4e-28   
ref|XP_002271125.3|  PREDICTED: cysteine-rich receptor-like prote...    125   4e-28   
ref|XP_003637378.1|  Cysteine-rich receptor-like protein kinase         124   4e-28   
ref|XP_006603573.1|  PREDICTED: cysteine-rich receptor-like prote...    125   5e-28   
ref|XP_010267806.1|  PREDICTED: putative receptor-like protein ki...    125   5e-28   
ref|XP_010931306.1|  PREDICTED: putative receptor-like protein ki...    125   5e-28   
ref|XP_007025935.1|  Cysteine-rich RLK 29, putative isoform 1           125   5e-28   
emb|CBI29181.3|  unnamed protein product                                124   5e-28   
gb|KEH26510.1|  salt stress response/antifungal domain protein          124   5e-28   
ref|XP_006351555.1|  PREDICTED: cysteine-rich receptor-like prote...    126   6e-28   
ref|XP_010042180.1|  PREDICTED: cysteine-rich receptor-like prote...    125   6e-28   
ref|XP_010496825.1|  PREDICTED: cysteine-rich repeat secretory pr...    120   6e-28   
ref|XP_010267805.1|  PREDICTED: putative receptor-like protein ki...    125   6e-28   
ref|XP_007025957.1|  Cysteine-rich RLK 10, putative                     125   6e-28   
ref|XP_011007635.1|  PREDICTED: cysteine-rich receptor-like prote...    125   7e-28   
ref|XP_006373144.1|  hypothetical protein POPTR_0017s09120g             123   7e-28   
gb|KEH43962.1|  cysteine-rich receptor-kinase-like protein              125   7e-28   
gb|AAN46205.1|  unknown protein                                         119   7e-28   
gb|KHN30450.1|  Cysteine-rich receptor-like protein kinase 10           124   7e-28   
ref|XP_007025943.1|  Cysteine-rich protein, putative isoform 1          125   8e-28   
ref|XP_003637462.1|  Cysteine-rich receptor-like protein kinase         120   9e-28   
ref|XP_007025963.1|  Cysteine-rich RLK 10, putative                     124   9e-28   
ref|XP_009349610.1|  PREDICTED: cysteine-rich receptor-like prote...    125   9e-28   
ref|XP_004153962.1|  PREDICTED: cysteine-rich receptor-like prote...    124   1e-27   
ref|XP_003638011.1|  Cysteine-rich receptor-like protein kinase         123   1e-27   
ref|XP_007143160.1|  hypothetical protein PHAVU_007G048900g             124   1e-27   
ref|XP_009150860.1|  PREDICTED: putative cysteine-rich repeat sec...    119   1e-27   
ref|XP_007025950.1|  ATP binding protein, putative                      120   1e-27   
ref|XP_008345851.1|  PREDICTED: cysteine-rich receptor-like prote...    120   1e-27   
ref|XP_010054432.1|  PREDICTED: uncharacterized protein LOC104442733    125   1e-27   
ref|XP_002883339.1|  hypothetical protein ARALYDRAFT_479720             119   1e-27   
gb|KHN27832.1|  Cysteine-rich receptor-like protein kinase 25           124   1e-27   
ref|XP_004491668.1|  PREDICTED: putative cysteine-rich receptor-l...    122   1e-27   
gb|KDP20811.1|  hypothetical protein JCGZ_21282                         125   1e-27   
gb|KDP20812.1|  hypothetical protein JCGZ_21283                         124   1e-27   
ref|XP_010059648.1|  PREDICTED: putative cysteine-rich receptor-l...    122   1e-27   
gb|KDP20809.1|  hypothetical protein JCGZ_21280                         122   2e-27   
ref|XP_010109546.1|  hypothetical protein L484_018281                   121   2e-27   
ref|XP_010911153.1|  PREDICTED: cysteine-rich repeat secretory pr...    120   2e-27   
ref|XP_004236550.1|  PREDICTED: putative receptor-like protein ki...    124   2e-27   
ref|XP_010059126.1|  PREDICTED: cysteine-rich receptor-like prote...    120   2e-27   
emb|CDX88009.1|  BnaA06g26000D                                          119   2e-27   
emb|CDO99704.1|  unnamed protein product                                125   2e-27   
ref|XP_006602739.1|  PREDICTED: putative cysteine-rich receptor-l...    124   2e-27   
gb|AGT15892.1|  hypothetical protein SHCRBa_258_I03_R_20                124   2e-27   
emb|CDY07878.1|  BnaC03g47440D                                          119   2e-27   
ref|XP_004487372.1|  PREDICTED: cysteine-rich repeat secretory pr...    119   2e-27   
ref|XP_002518548.1|  ATP binding protein, putative                      124   2e-27   
ref|XP_003637963.1|  Cysteine-rich receptor-like protein kinase         124   2e-27   
gb|KHN40584.1|  Cysteine-rich receptor-like protein kinase 25           124   2e-27   
ref|XP_010059504.1|  PREDICTED: cysteine-rich receptor-like prote...    119   2e-27   
gb|KEH43963.1|  cysteine-rich receptor-kinase-like protein              124   2e-27   
ref|XP_007025947.1|  Cysteine-rich protein, putative isoform 1          123   2e-27   
ref|XP_010510855.1|  PREDICTED: cysteine-rich repeat secretory pr...    119   2e-27   
ref|XP_009802722.1|  PREDICTED: cysteine-rich receptor-like prote...    122   2e-27   
ref|XP_007025946.1|  Cysteine-rich protein, putative                    123   2e-27   
ref|XP_010910126.1|  PREDICTED: putative receptor-like protein ki...    123   2e-27   
ref|XP_007214635.1|  hypothetical protein PRUPE_ppa001541mg             124   2e-27   
ref|XP_004506295.1|  PREDICTED: putative cysteine-rich receptor-l...    124   3e-27   
ref|XP_007025959.1|  Cysteine-rich RLK 10                               124   3e-27   
ref|XP_009802721.1|  PREDICTED: cysteine-rich receptor-like prote...    123   3e-27   
ref|XP_010027127.1|  PREDICTED: cysteine-rich receptor-like prote...    119   3e-27   
ref|XP_010529370.1|  PREDICTED: cysteine-rich receptor-like prote...    123   3e-27   
ref|XP_006433223.1|  hypothetical protein CICLE_v10003836mg             118   3e-27   



>ref|XP_008372641.1| PREDICTED: cysteine-rich repeat secretory protein 55 [Malus domestica]
Length=263

 Score =   303 bits (777),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/228 (67%), Positives = 182/228 (80%), Gaps = 4/228 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNLN--SQTSTNILKLLTNLVPaasragyataayggsgNKVYGL  250
            +A+S DP G FCN  S  ++  +Q S NI  LL  LVP  +  G+    YG   ++VYGL
Sbjct  18   SAESQDPLGDFCNKDSTKISNGTQISQNIDSLLAELVPKTASTGFLATTYGEKQDQVYGL  77

Query  251  AQCRGDV-SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            AQCRGDV  +KDCSSCIQ+AAK+IR+RCP++ DARIWY+YCFLRY+D  F GEVDT YGI
Sbjct  78   AQCRGDVVGTKDCSSCIQDAAKQIRQRCPNQADARIWYDYCFLRYSDKSFIGEVDTSYGI  137

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
             Y NV NVTDPE+FNE+LG L D I K+AVVPE+ GLGKG+TKLS F+TLYALVQCTRDL
Sbjct  138  FYYNVYNVTDPEKFNEELGALTDKIRKQAVVPESGGLGKGETKLSPFVTLYALVQCTRDL  197

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            S + C+QCLAIAVG NFP FCN++KGCRVLYSSCYVRYELYPF++PLD
Sbjct  198  SKLGCSQCLAIAVG-NFPTFCNNRKGCRVLYSSCYVRYELYPFFYPLD  244



>ref|XP_008244704.1| PREDICTED: cysteine-rich repeat secretory protein 55 [Prunus 
mume]
Length=268

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 187/241 (78%), Gaps = 7/241 (3%)
 Frame = +2

Query  62   CCTIFTAQSTDPSGLFCNTASKNLN--SQTSTNILKLLTNLVPaasragyataayggsgN  235
            CC+   A+S DP G FCN  S  ++  SQ S NI  LL  LVP  +  G+   +YG   +
Sbjct  21   CCS---AESQDPLGDFCNEDSTKISNASQISANIDTLLAQLVPKTASLGFFATSYGKGQD  77

Query  236  KVYGLAQCRGDV-SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            +V+GLAQCRGDV  SKDCSSCIQ+AAK+IRKRCPD+ DARIWY+YCFLRY +  F G+VD
Sbjct  78   RVFGLAQCRGDVVGSKDCSSCIQDAAKQIRKRCPDQADARIWYDYCFLRYNNKSFIGKVD  137

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T YGILY NV NVTDPE FN++LG+LVD I  +AVVP+N GLGKG+TKLS FLTLYALVQ
Sbjct  138  TSYGILYGNVDNVTDPESFNKELGDLVDKIEAQAVVPKNGGLGKGETKLSPFLTLYALVQ  197

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTV  772
            CTRDLS ++C+QCLAIAVG NF  FC+++KGCRVLYSSCYVRYELYPF+FPLD      V
Sbjct  198  CTRDLSQLDCSQCLAIAVG-NFGTFCDNRKGCRVLYSSCYVRYELYPFFFPLDSNNTLPV  256

Query  773  A  775
            A
Sbjct  257  A  257



>ref|XP_009359012.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Pyrus 
x bretschneideri]
Length=263

 Score =   301 bits (770),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 181/228 (79%), Gaps = 4/228 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNLN--SQTSTNILKLLTNLVPaasragyataayggsgNKVYGL  250
            +A+S DP G FCN  S  ++  +Q S NI  LL  LVP  +  G+    YG + ++VYGL
Sbjct  18   SAESQDPLGDFCNKDSTKISNGTQISQNIDSLLAELVPKTASTGFLATTYGENQDQVYGL  77

Query  251  AQCRGDV-SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            AQCRGDV  +KDCSSCIQ+AAK+IR+RCP++ DARIWY+YCFLRY+D  F GEVDT YGI
Sbjct  78   AQCRGDVVGTKDCSSCIQDAAKQIRQRCPNQADARIWYDYCFLRYSDKSFIGEVDTSYGI  137

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
             Y NV NVTDPE+FNE+LG L D I  +AV+PE+ GLGKG+TKLS F+TLYAL QCTRDL
Sbjct  138  FYYNVDNVTDPEKFNEELGALTDNIRAQAVLPESGGLGKGETKLSPFVTLYALAQCTRDL  197

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            S + C+QCLAIAVG NFP FCN++KGCRVLYSSCYVRYELYPF+FPLD
Sbjct  198  SKLGCSQCLAIAVG-NFPTFCNNRKGCRVLYSSCYVRYELYPFFFPLD  244



>ref|XP_009372187.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Pyrus 
x bretschneideri]
Length=266

 Score =   298 bits (763),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 189/249 (76%), Gaps = 6/249 (2%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLN--SQTSTNILKLLTNLVPaasragyataayggsgNKVY  244
            I  A+S DP G FCN  S  ++  +Q S NI  LL  LVP  +  G+   +YG + ++VY
Sbjct  19   ICIAESQDPLGDFCNKDSTKISNGTQISQNIDSLLAELVPKTASTGFLATSYGMNEDQVY  78

Query  245  GLAQCRGDV-SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGY  421
            GLAQCRGDV  +KDCS+CIQ+AAK+IR+RCP++ DARIWY+YCFLRY+D  F GEVDT Y
Sbjct  79   GLAQCRGDVVGTKDCSTCIQDAAKQIRQRCPNQADARIWYDYCFLRYSDKSFIGEVDTSY  138

Query  422  GILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTR  601
            GI Y NV NVTDPE FN++LG L D I  +AVVP++ GLGKG+TKLS F+TLYALVQCTR
Sbjct  139  GIFYYNVNNVTDPENFNKELGALADKIRAQAVVPKSGGLGKGQTKLSPFVTLYALVQCTR  198

Query  602  DLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAAS  781
            DL  + CAQCL+IAVG NFP FCN++KGCRVLYSSCYVRYELYPF+FPLD    +T+ A 
Sbjct  199  DLPQLGCAQCLSIAVG-NFPTFCNNRKGCRVLYSSCYVRYELYPFFFPLD--ANNTLQAV  255

Query  782  EARNYRSTV  808
            +  N  + V
Sbjct  256  DENNVMAIV  264



>ref|XP_007049618.1| Receptor-like protein kinase-related family protein, putative 
[Theobroma cacao]
 gb|EOX93775.1| Receptor-like protein kinase-related family protein, putative 
[Theobroma cacao]
Length=254

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 177/221 (80%), Gaps = 2/221 (1%)
 Frame = +2

Query  92   DPSGLFCNTAS-KNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGD  268
            DP G FCN  +  N++S TS NI +LL  +V   S   Y   + G   ++VYGLAQCRGD
Sbjct  19   DPLGNFCNEDTFINISSPTSENIDRLLAEVVSKTSLTAYIATSSGRGPDRVYGLAQCRGD  78

Query  269  VSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVAN  448
            VSSKDCSSCIQ+AA +IR+RCP++ DARIWY+YCFLRY+ + F GEVDT +GI Y NV N
Sbjct  79   VSSKDCSSCIQDAATQIRQRCPNQSDARIWYDYCFLRYSKENFIGEVDTSFGIFYYNVEN  138

Query  449  VTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQ  628
            VTDPE FN++LG L + I  EAV+P+N GLGKGKTKLS F+TLYALVQCTRDLS ++CAQ
Sbjct  139  VTDPESFNQELGALTNKIRSEAVMPKNEGLGKGKTKLSPFVTLYALVQCTRDLSEIDCAQ  198

Query  629  CLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            CLAIAVG NFP FC+++KGCRVLYSSCYVRYELYPF+FP+D
Sbjct  199  CLAIAVG-NFPNFCDNRKGCRVLYSSCYVRYELYPFFFPID  238



>ref|XP_009334264.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Pyrus 
x bretschneideri]
Length=266

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 188/249 (76%), Gaps = 6/249 (2%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLN--SQTSTNILKLLTNLVPaasragyataayggsgNKVY  244
            I  A+S DP G FCN  S  ++  +Q S NI  LL  LVP  +  G+   +YG + ++VY
Sbjct  19   ICIAESQDPLGDFCNKDSTKISNGTQISQNIDSLLAELVPKTASTGFLATSYGMNEDQVY  78

Query  245  GLAQCRGDV-SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGY  421
            GLAQCRGDV  +KDCS+CIQ+AAK+IR+RCP++ D RIWY+YCFLRY+D  F GEVDT Y
Sbjct  79   GLAQCRGDVVGTKDCSTCIQDAAKQIRQRCPNQADVRIWYDYCFLRYSDKSFIGEVDTSY  138

Query  422  GILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTR  601
            GI Y NV NVTDPE FN++LG L D I  +AVVP++ GLGKG+TKLS F+TLYALVQCTR
Sbjct  139  GIFYYNVNNVTDPENFNKELGALADKIRAQAVVPKSGGLGKGQTKLSPFVTLYALVQCTR  198

Query  602  DLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAAS  781
            DL  + CAQCL+IAVG NFP FCN++KGCRVLYSSCYVRYELYPF+FPLD    +T+ A 
Sbjct  199  DLPQLGCAQCLSIAVG-NFPTFCNNRKGCRVLYSSCYVRYELYPFFFPLD--ANNTLQAV  255

Query  782  EARNYRSTV  808
            +  N  + V
Sbjct  256  DENNVMAIV  264



>ref|XP_008382567.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Malus 
domestica]
Length=266

 Score =   296 bits (759),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 179/227 (79%), Gaps = 4/227 (2%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNLN--SQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            A+S DP G FCN  S  ++  +Q S NI  LL  LVP  +  G+   +YG + ++VYGLA
Sbjct  22   AESQDPLGDFCNKDSTKISNGTQISQNIDSLLAELVPKTASTGFLATSYGMNQDQVYGLA  81

Query  254  QCRGDV-SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
            QCRGDV  +KDCS+CIQ+AAK+IR RCP++ DARIWY+YCFLRY+D  F GEVDT YGI 
Sbjct  82   QCRGDVVGTKDCSTCIQDAAKQIRXRCPNQADARIWYDYCFLRYSDKSFIGEVDTSYGIF  141

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
            Y NV NVTDPE FN++LG L D I  +AVVPE+ GLGKG+TKLS F+TLYALVQCTRDL 
Sbjct  142  YYNVNNVTDPENFNKELGALADKIRAQAVVPESGGLGKGETKLSPFVTLYALVQCTRDLP  201

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
             + C+QCL+IAVG NFP FCN++KGCRVLYSSCYVRYELYPF+FPLD
Sbjct  202  QLGCSQCLSIAVG-NFPTFCNNRKGCRVLYSSCYVRYELYPFFFPLD  247



>ref|XP_010036760.1| PREDICTED: cysteine-rich repeat secretory protein 55-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW48396.1| hypothetical protein EUGRSUZ_K02100 [Eucalyptus grandis]
Length=263

 Score =   294 bits (752),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 176/228 (77%), Gaps = 2/228 (1%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYG  247
            +  AQS DP G FCN  +  +  S   +NI  +LT LV  A   G+ T +YG   +KVYG
Sbjct  19   VSNAQSDDPLGQFCNQDTVISKASPIWSNIDHVLTELVSKAPSTGFLTTSYGSGNDKVYG  78

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            LAQCRGDVS  DCSSCIQ+A K+IR+ CPD+ DARIWY+YCFLRY D  F GEVDT  GI
Sbjct  79   LAQCRGDVSQDDCSSCIQDAGKQIRQLCPDQADARIWYDYCFLRYDDKTFIGEVDTYSGI  138

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
             Y NV NVTDPE+FN++LG L+D I  +AVVPENRGLGK KTKL+ F+TLYALVQCTRDL
Sbjct  139  FYINVENVTDPEKFNKELGRLMDRIEADAVVPENRGLGKSKTKLTPFITLYALVQCTRDL  198

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
              ++CAQCLAIAVG NFPG CN +KGCRVLYSSCYVRYELYPF+FPLD
Sbjct  199  PKLSCAQCLAIAVG-NFPGICNSRKGCRVLYSSCYVRYELYPFFFPLD  245



>ref|XP_004492208.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Cicer 
arietinum]
Length=257

 Score =   290 bits (743),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 185/249 (74%), Gaps = 8/249 (3%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYG  247
            I +A+S DP G FCN  +  ++  + STNI KLL  L        +   +YG    KVYG
Sbjct  15   ISSAKSQDPLGEFCNKNTNISIGGKLSTNIDKLLAELALKTPSTSFIATSYGKDQEKVYG  74

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            LAQCRGD++++DCS+CIQ+A ++IR+RCP++ DARIWY+YCFLRY++  F  +VDT +GI
Sbjct  75   LAQCRGDINTQDCSNCIQDATRQIRQRCPNQADARIWYDYCFLRYSNKSFIADVDTSFGI  134

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
             Y NV NVTDPE FN+KLG L+D I  EAV+ + +G+GKGK+ LS F+TLYALVQCTRDL
Sbjct  135  FYFNVENVTDPEDFNKKLGALMDQIRGEAVMHKEKGIGKGKSMLSPFVTLYALVQCTRDL  194

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEA  787
            S +NCAQCLAIAV NNF  FCN++KGCRVLYSSCYVRYELYPF+FPLDP +      ++ 
Sbjct  195  SEINCAQCLAIAV-NNFSTFCNNRKGCRVLYSSCYVRYELYPFFFPLDPTK------TKP  247

Query  788  RNYRSTVVH  814
             N R  +V+
Sbjct  248  SNVRKLIVY  256



>gb|KDO60896.1| hypothetical protein CISIN_1g036866mg [Citrus sinensis]
Length=254

 Score =   290 bits (743),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 182/236 (77%), Gaps = 4/236 (2%)
 Frame = +2

Query  86   STDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCR  262
            + DP G FCN  S  + N   S NI  LL  LV   ++ GY   +YG   +KV+GLAQCR
Sbjct  17   AADPLGEFCNKDSNVSGNGMISANIDNLLAELVAETAKTGYIATSYGKDQDKVFGLAQCR  76

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GDV SKDC+SCIQ+AAK+IR+RC ++ DARIWY+YCFLRY  + F G+VDT +GI Y NV
Sbjct  77   GDVDSKDCASCIQDAAKQIRQRCVNQADARIWYDYCFLRYNTENFVGKVDTSFGIFYYNV  136

Query  443  ANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNC  622
             NVTDP+ FN++LG L+D I  +AVVP+N GLGKG+T LS F+TLYALVQCTRDLS ++C
Sbjct  137  ENVTDPKSFNKELGALMDEIRSQAVVPKNEGLGKGETTLSPFVTLYALVQCTRDLSQIDC  196

Query  623  AQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEAR  790
            AQCLAIAVG NFP FCN+KKGCRVLYSSCYVRYELYPF+FPLD   K+T+A +  +
Sbjct  197  AQCLAIAVG-NFPNFCNNKKGCRVLYSSCYVRYELYPFFFPLD--SKNTLADTSIK  249



>ref|XP_006484824.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Citrus 
sinensis]
Length=254

 Score =   290 bits (742),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 182/236 (77%), Gaps = 4/236 (2%)
 Frame = +2

Query  86   STDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCR  262
            + DP G FCN  S  + N   S NI  LL  LV   ++ GY   +YG   +KV+GLAQCR
Sbjct  17   AADPLGEFCNKDSNVSGNGMISANIDNLLAELVAETAKTGYIATSYGKDQDKVFGLAQCR  76

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GDV SKDC+SCIQ+AAK+IR+RC ++ DARIWY+YCFLRY  + F G+VDT +GI Y NV
Sbjct  77   GDVDSKDCASCIQDAAKQIRQRCVNQADARIWYDYCFLRYNTENFVGKVDTSFGIFYYNV  136

Query  443  ANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNC  622
             NVTDP+ FN++LG L+D I  +AVVP+N GLGKG+T LS F+TLYALVQCTRDLS ++C
Sbjct  137  ENVTDPKSFNKELGALMDEIRSQAVVPKNEGLGKGETTLSPFVTLYALVQCTRDLSQIDC  196

Query  623  AQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEAR  790
            AQCLAIAVG NFP FCN+KKGCRVLYSSCYVRYELYPF+FPLD   K+T+A +  +
Sbjct  197  AQCLAIAVG-NFPNFCNNKKGCRVLYSSCYVRYELYPFFFPLD--SKNTLADTSIK  249



>ref|XP_006437221.1| hypothetical protein CICLE_v10032523mg [Citrus clementina]
 gb|ESR50461.1| hypothetical protein CICLE_v10032523mg [Citrus clementina]
Length=254

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 175/223 (78%), Gaps = 2/223 (1%)
 Frame = +2

Query  86   STDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCR  262
            + DP G FCN  S  + N   S NI  LL  LV   ++ GY   +YG   +KV+GLAQCR
Sbjct  17   AADPLGEFCNKDSNVSGNGMISANIDNLLAELVAETAKTGYIATSYGKDQDKVFGLAQCR  76

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GDV SKDC+SCIQ+AAK+IR+RC ++ DARIWY+YCFLRY  + F G+VDT +GI Y NV
Sbjct  77   GDVDSKDCASCIQDAAKQIRQRCVNQADARIWYDYCFLRYNTENFVGKVDTSFGIFYYNV  136

Query  443  ANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNC  622
             NVTDP+ FN++LG L+D I  +AVVP+N GLGKG+T LS F+TLYALVQCTRDLS ++C
Sbjct  137  ENVTDPKSFNKELGALMDEIRSQAVVPKNEGLGKGETTLSPFVTLYALVQCTRDLSQIDC  196

Query  623  AQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            AQCLAIAVG NFP FCN+KKGCRVLYSSCYVRYELYPF+FPLD
Sbjct  197  AQCLAIAVG-NFPNFCNNKKGCRVLYSSCYVRYELYPFFFPLD  238



>ref|XP_002264674.2| PREDICTED: cysteine-rich repeat secretory protein 55 [Vitis vinifera]
 emb|CBI18746.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   288 bits (737),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 145/243 (60%), Positives = 183/243 (75%), Gaps = 11/243 (5%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQ  256
            +A S DP G+FCN  +K  + + S NI  LL  LV  AS  G+   +YG     VYGLAQ
Sbjct  24   SADSADPLGVFCNKDTKIGSGKESANIDHLLVELVSKASTNGFLATSYGSGQYLVYGLAQ  83

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGDV  +DCS+CIQ+AAK+IR RCP+  DARIW++YCFLRY++ +F GEVDTG+GI Y 
Sbjct  84   CRGDVGKEDCSTCIQDAAKQIRTRCPNEADARIWFDYCFLRYSNKDFIGEVDTGFGIYYY  143

Query  437  NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            NV NVT+ ERFNE+L  L++ I  +AV P+N GLGKG+T+L+ F+TLYALVQCTRDLSP+
Sbjct  144  NVDNVTETERFNEELSKLMEKIRSQAVEPQNAGLGKGQTELTPFITLYALVQCTRDLSPL  203

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNY  796
            +CAQCLAIAVG NFP FC+++KGCRVLYSSCY RYELYPF+FP+          S A+N+
Sbjct  204  SCAQCLAIAVG-NFPNFCDNRKGCRVLYSSCYTRYELYPFFFPI----------SSAKNF  252

Query  797  RST  805
             +T
Sbjct  253  SNT  255



>ref|XP_010908261.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Elaeis 
guineensis]
Length=262

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/247 (60%), Positives = 186/247 (75%), Gaps = 7/247 (3%)
 Frame = +2

Query  74   FTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
             ++  TDP G FCN ++   NSQTS NI K+L  L+  AS +G+ATA+YG   ++V+GLA
Sbjct  22   LSSNCTDPLGNFCNNSNNITNSQTSANINKVLAELLANASGSGFATASYGSKNDQVFGLA  81

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
            QCRGDVS+ DC SC+ +AA+ +   CP + DARIW++YCFLRY   +FFGEVD+G+GI Y
Sbjct  82   QCRGDVSADDCKSCLADAAERLPTLCPKQADARIWFDYCFLRYDTQDFFGEVDSGFGIFY  141

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             NV NVT+PERF+ +LG L+DG+ K+AV P +RGLGKG++K SDF+T+Y LVQCT DLS 
Sbjct  142  WNVENVTEPERFDAELGKLMDGVRKQAVAPGSRGLGKGESKFSDFVTIYGLVQCTEDLSR  201

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARN  793
            ++CAQCLAIAV  NFP FC  +KGCRVLYSSCYVRYELYPF+FPLD   KS V  S    
Sbjct  202  LSCAQCLAIAVA-NFPNFCLHRKGCRVLYSSCYVRYELYPFFFPLD-ASKSMVGTSAM--  257

Query  794  YRSTVVH  814
               TVVH
Sbjct  258  ---TVVH  261



>ref|XP_003622768.1| Cysteine-rich repeat secretory protein [Medicago truncatula]
 gb|AES78986.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=257

 Score =   286 bits (731),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 177/232 (76%), Gaps = 8/232 (3%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNLNSQT----STNILKLLTNLVPaasragyataayggsgNKVY  244
            +A+S DP G FCN   KN N  T    STNI KLL+ L        +    YG S  KVY
Sbjct  17   SAKSEDPLGEFCN---KNTNISTGGKLSTNIDKLLSQLALQTPSTFFVATTYGNSKEKVY  73

Query  245  GLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYG  424
            GLAQCRGD++++DCS+CIQ+A K+IR+RCP++ DARIWY+YCF+RY++  F GEVDT +G
Sbjct  74   GLAQCRGDINTQDCSNCIQDATKQIRQRCPNQADARIWYDYCFIRYSNKSFIGEVDTSFG  133

Query  425  ILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRD  604
            I Y NV NVTD E FN+KLGNL+D I  EAV+ +N+GLGKGKT LS F+TLY LVQCTRD
Sbjct  134  IFYFNVENVTDSEVFNKKLGNLMDQIRGEAVMVKNKGLGKGKTVLSPFVTLYGLVQCTRD  193

Query  605  LSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPE  760
            L  ++CAQCLAIAV NNF  FC+++KGCRVLYSSCYVRYELYPF+FPLD  +
Sbjct  194  LDEISCAQCLAIAV-NNFQTFCSNRKGCRVLYSSCYVRYELYPFFFPLDSTK  244



>ref|XP_003551283.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Glycine 
max]
 gb|KHN31799.1| Cysteine-rich repeat secretory protein 55 [Glycine soja]
Length=257

 Score =   285 bits (730),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 175/227 (77%), Gaps = 2/227 (1%)
 Frame = +2

Query  74   FTAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGL  250
            + A++ DP G FCN  +      + S NI K+LT +       G+    YG   +KVY L
Sbjct  16   WGAKAEDPLGRFCNENTIIGSGGKLSANIDKILTEIALKTPSTGFVATTYGKDQDKVYAL  75

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
            AQCRGDVS++DCS+CIQ+A K+IR+RCP++VD RIWY+YCFLRY++  FFGEVDT +GI 
Sbjct  76   AQCRGDVSTQDCSNCIQDATKQIRQRCPNQVDGRIWYDYCFLRYSNKSFFGEVDTSFGIF  135

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
            Y NV NVTDPE FN++LG L+D I  +AVVP   GLGKGK+ LS F+TLYALVQCTRDLS
Sbjct  136  YFNVENVTDPEDFNKELGALMDHIRAQAVVPREEGLGKGKSVLSPFVTLYALVQCTRDLS  195

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
             ++CAQCL+IAV NNFP FC+++KGCRVLYSSCYVRYELYPF+FPLD
Sbjct  196  EISCAQCLSIAV-NNFPNFCSNRKGCRVLYSSCYVRYELYPFFFPLD  241



>emb|CDP14580.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 188/248 (76%), Gaps = 3/248 (1%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGL  250
            I TA+S +    FCN  S+  ++Q S NI  LL  L+    + G++T +YG + ++V+GL
Sbjct  16   ICTAESAELWSQFCNHNSQINSTQLSANIDSLLAELMSGTVQNGFSTISYGKAEDQVFGL  75

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
            AQCRGDVSS+DCSSC+++A+K+IRK CP + DARIWY+YCF+RY  ++FFG+VDT  GI+
Sbjct  76   AQCRGDVSSEDCSSCVEDASKQIRKLCPSQSDARIWYDYCFVRYGTNKFFGQVDTSVGII  135

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
            + NV NVTDP+ FN++L +L D IS EAV P N+GLG+GK +LS FLTLY + QCTRDL+
Sbjct  136  FYNVENVTDPDSFNKELASLSDKISSEAVKPGNKGLGRGKKQLSPFLTLYEVAQCTRDLT  195

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEAR  790
            P++C QCLAIA+G NFP FCN+KKGCRVL+ SC VRYELYPF+FPLDP  K T+     +
Sbjct  196  PLSCDQCLAIAIG-NFPIFCNNKKGCRVLHGSCIVRYELYPFFFPLDP--KETLVNMPLK  252

Query  791  NYRSTVVH  814
             Y S+ VH
Sbjct  253  YYHSSTVH  260



>emb|CDP03947.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   283 bits (725),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 182/249 (73%), Gaps = 3/249 (1%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGL  250
            I TA+S +    FCN  S   ++Q S NI  LL  LV      G+ T++YG + ++V+GL
Sbjct  16   ICTAESAELWSQFCNDNSPINSTQLSANIDSLLAELVSGTVLNGFTTSSYGKAKDQVFGL  75

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
             QCRGDVS++DCSSCI++A+K+IRK CP + DARIWY+YCFLRY  ++FFG VDT  GI 
Sbjct  76   GQCRGDVSNEDCSSCIKDASKQIRKLCPTQADARIWYDYCFLRYETEKFFGRVDTSIGIF  135

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
            + NV NVTDP+ FN++LG L D IS EAV P N GLG+GK +LS FLTLY LVQCTRDLS
Sbjct  136  FYNVENVTDPDSFNKELGKLSDKISSEAVAPGNNGLGRGKKELSPFLTLYELVQCTRDLS  195

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEAR  790
             ++C QCLAIA+G  FP FCN+KKGCRVLYSSC VRYELYPF+FPLDP  K T+     +
Sbjct  196  QLSCEQCLAIAIG-EFPTFCNNKKGCRVLYSSCIVRYELYPFFFPLDP--KETLVNMPMK  252

Query  791  NYRSTVVHK  817
             Y S+ V K
Sbjct  253  YYHSSTVIK  261



>ref|XP_009769622.1| PREDICTED: cysteine-rich repeat secretory protein 55 [Nicotiana 
sylvestris]
Length=261

 Score =   283 bits (724),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 186/249 (75%), Gaps = 4/249 (2%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGL  250
            I TA S DP G FCN A+K  N++TS NI K+L  L+  +++  ++T +YG + N VYGL
Sbjct  16   ICTAVSVDPLGNFCNDATKFNNAKTSANIGKVLAELLSVSAKDIFSTTSYGDATNLVYGL  75

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
             QCRGD+SS +C SCI++AAKEIRKRCPD+ DARIWY++CFLRY    F G+V+T  GI+
Sbjct  76   YQCRGDISSNECLSCIKDAAKEIRKRCPDQTDARIWYDFCFLRYNTKNFLGQVETSPGII  135

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
            Y NV  V+D   FN+KL  L + I+ EA+VP N+GLGKGK+ LS FLTLYAL+QCTRD+ 
Sbjct  136  YYNVDFVSDTNFFNKKLAQLKNQITAEAIVPMNKGLGKGKSILSPFLTLYALMQCTRDIP  195

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEAR  790
             ++CAQCLA AVG NFP  C ++KGCR+LYSSCYVRYELYPF+FPLDP EK    A+ + 
Sbjct  196  EIDCAQCLATAVG-NFPTICLNRKGCRILYSSCYVRYELYPFFFPLDPKEK---LANVSM  251

Query  791  NYRSTVVHK  817
            NY +  V +
Sbjct  252  NYYTMKVSR  260



>ref|XP_009611212.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Nicotiana 
tomentosiformis]
Length=261

 Score =   283 bits (724),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 182/231 (79%), Gaps = 1/231 (0%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGL  250
            I TA S DP G FC+ A+K  N++TS NI K+L  L+  +++  ++T +YG + N+VYGL
Sbjct  16   ICTAVSVDPLGNFCDDATKFNNAKTSANIGKVLAKLLSVSAKDSFSTTSYGDATNQVYGL  75

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
             QCRGD+SS DC +CI++AAKEIRKRCPD+ DARIWY++CFLRY    F G+V+T  GI 
Sbjct  76   YQCRGDISSNDCLNCIKDAAKEIRKRCPDQTDARIWYDFCFLRYNTKNFLGQVETTPGIF  135

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
            Y NV  V+D + FN+KL  L + I+ EA+VP+N+GLGKGK+KLS FLTLYAL+QCTRD+ 
Sbjct  136  YYNVDFVSDTDFFNKKLVQLNNQITAEAIVPKNKGLGKGKSKLSPFLTLYALMQCTRDIP  195

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEK  763
             ++CAQCLAIAVG NFP  C ++KGCR+LYSSCYVRYELYPF+FPLDP EK
Sbjct  196  EIDCAQCLAIAVG-NFPTTCLNRKGCRILYSSCYVRYELYPFFFPLDPKEK  245



>ref|XP_004247276.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Solanum 
lycopersicum]
Length=261

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/245 (58%), Positives = 186/245 (76%), Gaps = 1/245 (0%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGL  250
            I TA S +P G FC  ASK+ +++TS NI K+L  LV  +++  ++T +YG + N+VYGL
Sbjct  16   ICTAVSVNPLGNFCYDASKSNDAKTSANIGKVLAELVSVSAKDTFSTTSYGDAKNQVYGL  75

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
             QCRGDVSS DCSSCI++AAKEIRK CPD+ DARIWY+YCFLRY    FFG+ +T  GI 
Sbjct  76   YQCRGDVSSNDCSSCIRDAAKEIRKSCPDQTDARIWYDYCFLRYQAKNFFGQAETVPGIF  135

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
            Y N+  V+DP+ FN+KL  L + I ++A+V +N+GLGKGK K+S FLTLYAL+QCTRDL 
Sbjct  136  YWNINFVSDPDFFNKKLAQLKNQIIEQAIVQKNKGLGKGKIKISPFLTLYALMQCTRDLQ  195

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEAR  790
             ++CAQCLA+AVG NFP  C ++KGCRVLYSSCYVRYELYPF+FPL+P EK    + +  
Sbjct  196  KIDCAQCLAVAVG-NFPTTCLNRKGCRVLYSSCYVRYELYPFFFPLEPKEKLANVSMDYH  254

Query  791  NYRST  805
             ++ +
Sbjct  255  TFKMS  259



>emb|CAN64566.1| hypothetical protein VITISV_020515 [Vitis vinifera]
Length=399

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/243 (59%), Positives = 182/243 (75%), Gaps = 11/243 (5%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQ  256
            +A S DP G+FCN  +K  + + S NI  LL  LV  AS  G+   +YG     VYGLAQ
Sbjct  24   SADSADPLGVFCNKDTKIGSGKESANIDHLLVELVSKASTNGFLATSYGSGQYLVYGLAQ  83

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGDV  +DCS+CIQ+AAK+IR RCP+  DARIW++YCFLRY++ +F GE DTG+GI Y 
Sbjct  84   CRGDVGKEDCSTCIQDAAKQIRTRCPNEADARIWFDYCFLRYSNKDFIGEXDTGFGIYYY  143

Query  437  NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            NV NVT+ ERFNE+L  L++ I  +AV P+N GLGKG+T+L+ F+TLYALVQCTRDLSP+
Sbjct  144  NVDNVTETERFNEELSKLMEKIRSQAVEPQNAGLGKGQTELTPFITLYALVQCTRDLSPL  203

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNY  796
            +CAQCLAIAVG NFP FC+++KGCRVLYSSCY RYELYPF+FP+          S A+N+
Sbjct  204  SCAQCLAIAVG-NFPNFCDNRKGCRVLYSSCYTRYELYPFFFPI----------SSAKNF  252

Query  797  RST  805
             +T
Sbjct  253  SNT  255



>gb|AFK33693.1| unknown [Lotus japonicus]
Length=261

 Score =   281 bits (718),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/247 (58%), Positives = 185/247 (75%), Gaps = 3/247 (1%)
 Frame = +2

Query  62   CCTIFTAQS-TDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgN  235
            C +I  +Q  + P G FCN  +K +   + S NI KLL   +      G+   +YG + +
Sbjct  14   CISIAESQDLSGPLGEFCNENTKISSGGKLSANIDKLLAEFILKTPSTGFVATSYGNNQD  73

Query  236  KVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            +VYGLAQCRGDVS++DCS+CIQ+AAK+IR++CP++VDARIWY+YCFLRY +  F G+VDT
Sbjct  74   QVYGLAQCRGDVSTQDCSNCIQDAAKQIRQKCPNQVDARIWYDYCFLRYNNKSFIGDVDT  133

Query  416  GYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQC  595
             +GI Y NV NVTDPE FN++LG+L+  I  +AV P+ +GLGKGKT LS FLTLYALVQC
Sbjct  134  SFGIFYFNVKNVTDPEGFNKELGSLMGKIRGQAVKPKAQGLGKGKTNLSPFLTLYALVQC  193

Query  596  TRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVA  775
            TRDLS ++CAQCLA+AV +NFP FC+++KGCRVLYSSCYVRYELYPF+FPLD  +     
Sbjct  194  TRDLSEISCAQCLAVAV-SNFPTFCDNRKGCRVLYSSCYVRYELYPFFFPLDSSKTGDSN  252

Query  776  ASEARNY  796
             + A  Y
Sbjct  253  VARAIVY  259



>ref|XP_010241766.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Nelumbo 
nucifera]
Length=258

 Score =   280 bits (716),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/240 (61%), Positives = 179/240 (75%), Gaps = 8/240 (3%)
 Frame = +2

Query  101  GLFCNTASKNLNSQT--STNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVS  274
            G FCN   KN++S +  S NI  LL +LV   S  G+   +YG   ++VYGLAQCRGDVS
Sbjct  24   GEFCNK-DKNISSDSPKSANIDHLLADLVSKTSSNGFTATSYGVGEDRVYGLAQCRGDVS  82

Query  275  SKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVT  454
             KDCSSCIQ+AAK+IR+ CP++ DARIW++YCFLRY    F GEVDT +GI Y NV NVT
Sbjct  83   KKDCSSCIQDAAKQIRQLCPNQADARIWFDYCFLRYDIQNFIGEVDTAFGIFYWNVENVT  142

Query  455  DPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCL  634
            DPE F++ LG L+D + ++A+VP+N GLGKGKTKL+ F+TLYALVQCTRDLS + CAQCL
Sbjct  143  DPETFDKDLGALMDQVREQALVPKNGGLGKGKTKLTPFVTLYALVQCTRDLSQLPCAQCL  202

Query  635  AIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNYRSTVVH  814
            AIAVG NFP FC  +KGCRVLYSSCYVRYELYPF+FP D    S+ +   +  Y   V+H
Sbjct  203  AIAVG-NFPVFCEHRKGCRVLYSSCYVRYELYPFFFPQD----SSNSTGSSGKYLRAVMH  257



>ref|XP_006365261.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Solanum 
tuberosum]
Length=265

 Score =   278 bits (712),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 187/245 (76%), Gaps = 1/245 (0%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGL  250
            I TA+S +P G FC+ A+K+ +S+TS  I K+L  LV  +++  ++T +YG + N+VYGL
Sbjct  20   ICTAESVNPLGNFCDDATKSNDSKTSAIIGKVLAELVSVSAKNSFSTTSYGDAKNQVYGL  79

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
             QCRGDVSS DC SCI++AAKEIRK CPD+ DARIWY+YCFLRY    F G+V+T  GI 
Sbjct  80   YQCRGDVSSNDCLSCIRDAAKEIRKSCPDQTDARIWYDYCFLRYQAKNFLGQVETVPGIF  139

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
            Y N+  V+DP+ FN+KL  L + +  +A+VP N+GLGKGK+K+S FLTLYAL+QCTRDL 
Sbjct  140  YWNIDFVSDPDFFNKKLAQLKNQLIADAIVPMNKGLGKGKSKISPFLTLYALMQCTRDLP  199

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEAR  790
             ++CAQCLA+AVG NFP  C ++KGCRVLYSSCYVRYELYPF+FPL+P EK    +++  
Sbjct  200  NIDCAQCLAVAVG-NFPTTCLNRKGCRVLYSSCYVRYELYPFFFPLEPKEKLANVSTDYY  258

Query  791  NYRST  805
             ++ +
Sbjct  259  TFKMS  263



>ref|XP_008788477.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Phoenix 
dactylifera]
Length=262

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 179/231 (77%), Gaps = 2/231 (1%)
 Frame = +2

Query  89   TDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGD  268
            TDP G FCN ++   N QTS NI +++  L+  AS +G+ATA+YG   ++V+GLAQCRGD
Sbjct  27   TDPLGNFCNNSNNITNGQTSANINQVVAELLANASVSGFATASYGSKNDQVFGLAQCRGD  86

Query  269  VSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVAN  448
            VS+  C SC+ +AA+ + K CP + DARIW++YCFLRY   +FFGE+DTG+GI Y NV N
Sbjct  87   VSADGCKSCLADAAERLPKLCPKQADARIWFDYCFLRYDTKDFFGELDTGFGIFYWNVEN  146

Query  449  VTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQ  628
            VT+PERF+ +LG L+DG+ K+AV P +RGLGKG+++ SDF+T+YALVQCT DLS ++CAQ
Sbjct  147  VTEPERFDAELGKLMDGVRKQAVAPGSRGLGKGESQFSDFVTIYALVQCTDDLSRLSCAQ  206

Query  629  CLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAAS  781
            CLAIA   NFP FC  +KGCRVLYSSCYVRYELYPF+FPLD   KS V  S
Sbjct  207  CLAIAEA-NFPNFCLHRKGCRVLYSSCYVRYELYPFFFPLD-SSKSMVGTS  255



>ref|XP_007140710.1| hypothetical protein PHAVU_008G135300g [Phaseolus vulgaris]
 gb|ESW12704.1| hypothetical protein PHAVU_008G135300g [Phaseolus vulgaris]
Length=257

 Score =   275 bits (703),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 174/230 (76%), Gaps = 3/230 (1%)
 Frame = +2

Query  65   CTIFTAQSTDPSGLFCNTASKNLNS-QTSTNILKLLTNLVPaasragyataayggsgNKV  241
            CT + A++ DP G FCN  +   N  + S NI K+L  +       G+    YG   ++V
Sbjct  14   CT-WGAKAVDPLGEFCNRNTNISNGGKLSANIDKVLGEVALKTPSTGFVATTYGKGRDQV  72

Query  242  YGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGY  421
            Y L QCRGDVS++DCSSCIQ+A K+I +RCP++ DARIWY+YCFLR+ +  FFGEVDT +
Sbjct  73   YALGQCRGDVSTEDCSSCIQDATKQILQRCPNQADARIWYDYCFLRFNNKSFFGEVDTSF  132

Query  422  GILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTR  601
            GI Y NV NVTDPE FNE+LG L++ I  +AVVP+  GLGKGK+ LS F+TLYALVQCTR
Sbjct  133  GIFYFNVENVTDPEAFNEELGALMNHIRAQAVVPKEEGLGKGKSVLSPFVTLYALVQCTR  192

Query  602  DLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            DLS ++CAQCLAIAV N+F  FC+++KGCRVLYSSCYVRYELYPF+FPLD
Sbjct  193  DLSQISCAQCLAIAV-NSFSNFCSNRKGCRVLYSSCYVRYELYPFFFPLD  241



>ref|XP_002526797.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF35603.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
Length=260

 Score =   275 bits (703),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 178/235 (76%), Gaps = 4/235 (2%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGL  250
            ++T  + DP G  CN  + + +   S NI  LL++LV  AS +GY+  ++G   +KVYGL
Sbjct  15   LYTCDAADPLGNLCNGGASS-SRAVSVNIDYLLSDLVSEASTSGYSATSFGNGRDKVYGL  73

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
            AQCRGDVSS+DCS C++ AAKE R+RCP +VDARIWY++C LRY  + F G++DT Y I+
Sbjct  74   AQCRGDVSSRDCSDCLENAAKETRRRCPAKVDARIWYDFCLLRYNKENFIGKLDTSYAIV  133

Query  431  YANVANVTD--PERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRD  604
            Y NV NVTD  PE FN KLG L+D I  EAVVP+N+GLGKG+TKLS F TLYAL QCTRD
Sbjct  134  YFNVENVTDPRPEDFNRKLGALIDKIRSEAVVPKNQGLGKGETKLSPFTTLYALAQCTRD  193

Query  605  LSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKST  769
            L+ ++CAQC+AIAVG NFP +C+++KGCR +Y++CYVRYELYPF+FP D    ST
Sbjct  194  LAAIDCAQCVAIAVG-NFPKYCSNRKGCRAIYTNCYVRYELYPFFFPFDSSNPST  247



>gb|KDP45259.1| hypothetical protein JCGZ_15124 [Jatropha curcas]
Length=258

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 171/222 (77%), Gaps = 4/222 (2%)
 Frame = +2

Query  92   DPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDV  271
            DP G  CN    N N  T  NI  L+T LV  AS +GY T   G   +K+YGLAQCRGDV
Sbjct  22   DPLGNLCNDQQTN-NKTTIQNINHLITELVSKASSSGYFTTTSGQGQDKIYGLAQCRGDV  80

Query  272  SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV  451
            S+ DCS C+ +AAKEI +RCP++VDARIWY+YCFLRY++ +F G++DT Y + Y NV NV
Sbjct  81   STDDCSGCLLDAAKEIGQRCPNQVDARIWYDYCFLRYSNKDFIGKLDTSYALFYINVENV  140

Query  452  T--DPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCA  625
            T  DPE FN KLGNL+D I  EAV+ +++G+GKG+TKL+  +TLYAL QCTRDL+ V+CA
Sbjct  141  TVIDPEAFNRKLGNLIDEIRSEAVMEKSKGIGKGETKLTPLVTLYALAQCTRDLAVVDCA  200

Query  626  QCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            QC+AIAVG NFP FCN++KGCR +YS+CYVRYELYPF+FPLD
Sbjct  201  QCIAIAVG-NFPNFCNNRKGCRAIYSNCYVRYELYPFFFPLD  241



>ref|XP_011089218.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich repeat secretory 
protein 55-like [Sesamum indicum]
Length=260

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 167/231 (72%), Gaps = 3/231 (1%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLN-SQTSTNILKLLTNLVPaasragyataayggsgNKVYG  247
            I++A S DP   FCN  SK    SQTS NI  LL  LV    + G+   +    GN++YG
Sbjct  15   IYSADSADPVYYFCNEDSKTYGGSQTSRNIDVLLNKLVSGTVQNGFTATSXXXXGNQIYG  74

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            LAQCRGDVS  DCS CIQ+A + IR  C +R DARIWY+YCFLRY+  +FFG VDT  G+
Sbjct  75   LAQCRGDVSKDDCSVCIQDALENIRDHCANRADARIWYDYCFLRYSTVKFFGHVDTS-GL  133

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
               NV NVTDP+ FN+KLG+L+D IS EAV P ++GLGKGKT +S F+ LYALVQCTRDL
Sbjct  134  YLYNVENVTDPDVFNQKLGDLMDQISSEAVKPGSKGLGKGKTDISSFVRLYALVQCTRDL  193

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPE  760
            S +NCAQC+AIA+   FP  C +KKGCRVLYSSCYVRYELYPF+FPL   E
Sbjct  194  SELNCAQCIAIAI-EKFPTICGNKKGCRVLYSSCYVRYELYPFFFPLGSHE  243



>ref|XP_002533056.1| DUF26 domain-containing protein 1 precursor, putative [Ricinus 
communis]
 gb|EEF29326.1| DUF26 domain-containing protein 1 precursor, putative [Ricinus 
communis]
Length=281

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 174/224 (78%), Gaps = 4/224 (2%)
 Frame = +2

Query  86   STDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRG  265
            + DP G  CN    + NS  S NI  LL+ +V  +S +GY   ++G   +KVYGLAQCRG
Sbjct  41   AADPLGNLCNEGHSS-NSTVSANIDHLLSQVVSKSSSSGYIATSFGKGEDKVYGLAQCRG  99

Query  266  DVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVA  445
            DV++ DCSSC+++A  EIR+RCPD+ DARIWY++CFLRY  +EF G++DT + I Y NV 
Sbjct  100  DVNTTDCSSCLKDAVNEIRQRCPDQADARIWYDFCFLRYNTEEFIGKLDTSFAIFYYNVE  159

Query  446  NVTD--PERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVN  619
            NVTD  PE FN+KLG L+D I  EAVVP+N+GLGK +TKLS F TLYALVQCTRDL+ V+
Sbjct  160  NVTDPRPEDFNKKLGALMDNIRSEAVVPKNQGLGKDETKLSPFSTLYALVQCTRDLAAVD  219

Query  620  CAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            CAQCLAIAVG NFP FC+++KGCR LYS+CYVRYELYPF+FPLD
Sbjct  220  CAQCLAIAVG-NFPNFCSNRKGCRALYSNCYVRYELYPFFFPLD  262



>ref|XP_010100808.1| hypothetical protein L484_015838 [Morus notabilis]
 gb|EXB84506.1| hypothetical protein L484_015838 [Morus notabilis]
Length=260

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/241 (61%), Positives = 182/241 (76%), Gaps = 6/241 (2%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLN-SQTSTNILKLLTNLVPaasragyataayggsgNKVYG  247
            I +A+S DP G FCN  ++  N S+ S+NI  LL  LV      G+ATA  G   ++VYG
Sbjct  15   ICSAESADPLGNFCNKDTEISNGSKISSNIDGLLPELVLKTPSTGFATAFNGNGKDRVYG  74

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTD-DEFFGEVDTGYG  424
            LAQCRGDVS++DCS C+++AA++IRKRCP   DARIWY+YCFLRY +   F G+VDT +G
Sbjct  75   LAQCRGDVSTEDCSRCVRDAAEQIRKRCPGESDARIWYDYCFLRYNNKSRFIGQVDTSFG  134

Query  425  ILYANVANVTDPERFNEKLGNLVDGISKEAVVPEN-RGLGKGKTKLSDFLTLYALVQCTR  601
            I Y NV +V DP+ FNE+LG L+D I KEAV  +N  GLGKG+T+LS F TLYALVQCTR
Sbjct  135  IYYFNVESVNDPDTFNEQLGALMDQIKKEAVEAKNYDGLGKGETRLSPFSTLYALVQCTR  194

Query  602  DLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAAS  781
            DLS ++CAQC+AIAV  NFP FC ++KGCRVLYSSCYVRYELYPF+FPLD    +T+AA 
Sbjct  195  DLSKLDCAQCVAIAV-ENFPNFCENRKGCRVLYSSCYVRYELYPFFFPLD--SNNTLAAD  251

Query  782  E  784
            +
Sbjct  252  Q  252



>gb|EYU40654.1| hypothetical protein MIMGU_mgv1a012036mg [Erythranthe guttata]
Length=263

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 175/235 (74%), Gaps = 4/235 (2%)
 Frame = +2

Query  83   QSTDPSGLFCNTASKNLN-SQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQC  259
            +S DP   FCN  S+  N SQ S NI  LL+ LV    + G+   + G + +++YGL+QC
Sbjct  20   ESADPLANFCNDNSRTDNTSQISRNIDNLLSVLVSGTVQNGFTATSLGEADSQIYGLSQC  79

Query  260  RGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYAN  439
            RGDVS  DCS CI++AA+ IRK CPD+ DARI Y+YCFLRY+   FFG+VDT   + Y N
Sbjct  80   RGDVSKNDCSVCIKDAAESIRKLCPDQSDARITYDYCFLRYSHATFFGQVDTSPAVYYWN  139

Query  440  VANVTDPERFNEKLGNLVDGISKEAVVP-ENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            V NVT  + FN KLG+L+D I  EAV P +N+GLGKG++K+S  +TLYAL QCTRDLS +
Sbjct  140  VENVTGVDDFNGKLGSLMDEIRSEAVGPAQNKGLGKGESKVSPLVTLYALAQCTRDLSDI  199

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAAS  781
            NCAQC+AIAVG NFP FC++K+GCRVLYSSCYVRYELYPF+FPLD  + S V++S
Sbjct  200  NCAQCVAIAVG-NFPRFCDNKRGCRVLYSSCYVRYELYPFFFPLDSKD-SLVSSS  252



>ref|XP_007200165.1| hypothetical protein PRUPE_ppa016689mg, partial [Prunus persica]
 gb|EMJ01364.1| hypothetical protein PRUPE_ppa016689mg, partial [Prunus persica]
Length=225

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 167/235 (71%), Gaps = 24/235 (10%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNLN--SQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            A+S DP G FCN  S  ++  SQ S NI  LL  LVP  +  G+   +YG   ++V+GLA
Sbjct  1    AESQDPLGDFCNEDSTKISNASQISANIDTLLAQLVPKTASLGFFATSYGKGQDRVFGLA  60

Query  254  QCRGDV-SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
            QCRGDV  SKDCSSCIQ+AAK+IRKRCPD+ DARIWY+YCFLRY +  F G         
Sbjct  61   QCRGDVVGSKDCSSCIQDAAKQIRKRCPDQADARIWYDYCFLRYNNKSFIGS--------  112

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
                        FN++LG LVD I ++AVVP+N GLGKG+TKLS FLTLYALVQCTRDLS
Sbjct  113  ------------FNKELGALVDKIEEQAVVPKNGGLGKGETKLSPFLTLYALVQCTRDLS  160

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVA  775
             ++C+QCLAIAVG NF  FC+++KGCRVLYSSCYVRYELYPF+FPLD      VA
Sbjct  161  QLDCSQCLAIAVG-NFGTFCDNRKGCRVLYSSCYVRYELYPFFFPLDSNNTLPVA  214



>ref|XP_006828418.1| hypothetical protein AMTR_s00060p00084230 [Amborella trichopoda]
 gb|ERM95834.1| hypothetical protein AMTR_s00060p00084230 [Amborella trichopoda]
Length=261

 Score =   257 bits (657),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/252 (52%), Positives = 173/252 (69%), Gaps = 7/252 (3%)
 Frame = +2

Query  65   CTIFT------AQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataaygg  226
            CT+FT      +  +D +G FCN+  K  +  T TNI  +L+ L       G+ATA+ G 
Sbjct  7    CTLFTLALLQLSLGSDHTGEFCNSNKKISDKSTMTNIGLVLSELETKGPSNGFATASIGQ  66

Query  227  sgNKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGE  406
               +VYGL QCRGD+S KDCSSC  +A K+IR+ CPD  DARIW++ CFLRY  D+F GE
Sbjct  67   GKERVYGLLQCRGDISPKDCSSCTSDATKQIRQLCPDEADARIWFDNCFLRYDTDDFMGE  126

Query  407  VDTGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYAL  586
            +DTGYGI Y NV NVT+PERF ++LG+L+D I+ +AV P N+G G GKTK + F+T+Y L
Sbjct  127  LDTGYGIFYWNVQNVTEPERFAKELGDLMDKITAKAVEPGNKGFGSGKTKFAPFVTIYGL  186

Query  587  VQCTRDLSPVNCAQCLAIAVGN-NFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEK  763
            VQCT+DL  + CAQCL+IA+ N    G+C+ KKGCRV YSSC VR+E+YPF+ PL    +
Sbjct  187  VQCTQDLPKLQCAQCLSIAISNFGGGGYCDGKKGCRVFYSSCSVRFEIYPFFLPLSFYTR  246

Query  764  STVAASEARNYR  799
              V AS A  ++
Sbjct  247  DEVHASHAVYHK  258



>ref|XP_002269937.2| PREDICTED: cysteine-rich repeat secretory protein 55 [Vitis vinifera]
Length=255

 Score =   255 bits (651),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 164/224 (73%), Gaps = 1/224 (0%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQ  256
            +A S DP G+FCN  +   +   S +   L   LV  AS  G+   ++G     V+GLAQ
Sbjct  19   SADSADPLGVFCNKDTNIGSGNASADFDDLSVQLVSKASTNGFVAISFGSGQYLVHGLAQ  78

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGDV  + CS+CIQ+AAK+IR RCP++ DARI ++YCFLRY+D +F G+VDTG+GI   
Sbjct  79   CRGDVGKEGCSTCIQDAAKQIRTRCPNKADARILFDYCFLRYSDKDFIGKVDTGFGIFLR  138

Query  437  NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            + A VT+ ERFNE+LG L++ I  +AV P+N GLGKG+TKL+ F+TLYALVQCTRDLSP+
Sbjct  139  HGAKVTETERFNEELGKLMEKIRSQAVEPQNAGLGKGQTKLTPFVTLYALVQCTRDLSPL  198

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
            +CAQCLAIAVG NF  FC + KGCRVLYSSCY RYELYP  F L
Sbjct  199  SCAQCLAIAVG-NFSDFCYNMKGCRVLYSSCYARYELYPVSFRL  241



>ref|XP_004290148.1| PREDICTED: cysteine-rich repeat secretory protein 55-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=263

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 134/241 (56%), Positives = 169/241 (70%), Gaps = 3/241 (1%)
 Frame = +2

Query  68   TIFTAQSTDPSGLFCNT-ASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVY  244
            +I + ++ DP   FCN  +  + +S  S NI  LL  LV      G++  +YG    +VY
Sbjct  16   SICSIEAADPMADFCNNDSKISKSSTISANIDALLAQLVSKTPSTGFSATSYGKGQAQVY  75

Query  245  GLAQCRGDV-SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGY  421
            GLAQCRGDV  SKDCSSCIQ+AAKEIR+RCPD+  A IWY++CFL+Y++  F GEVDT Y
Sbjct  76   GLAQCRGDVVGSKDCSSCIQDAAKEIRQRCPDQAAATIWYDFCFLKYSNKSFTGEVDTSY  135

Query  422  GILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTR  601
            GI++ NV NVTDPE+F +KLG LVD I  +AVVP+N G GKG+TKLS   TLYA  QCTR
Sbjct  136  GIIFYNVQNVTDPEKFVKKLGALVDDIKAQAVVPKNLGFGKGETKLSPLSTLYAFGQCTR  195

Query  602  DLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAAS  781
            DL+  +C QCLAIAVG N+   C +++GCRVLY SCYVRYELYP ++P+       V A 
Sbjct  196  DLAKQDCTQCLAIAVG-NYETICGNRRGCRVLYGSCYVRYELYPIFYPVGANSTMNVVAD  254

Query  782  E  784
            E
Sbjct  255  E  255



>ref|NP_199665.1| receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
 sp|Q9LV60.1|CRR55_ARATH RecName: Full=Cysteine-rich repeat secretory protein 55; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAA96974.1| 33 kDa secretory protein-like [Arabidopsis thaliana]
 gb|AAK93601.1| putative 33 kDa secretory protein [Arabidopsis thaliana]
 gb|AAM14364.1| putative 33 kDa secretory protein [Arabidopsis thaliana]
 gb|AED95683.1| receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
Length=263

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 169/231 (73%), Gaps = 6/231 (3%)
 Frame = +2

Query  83   QSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNK--VYGLA  253
            ++ D     CNT S  + +SQ S NI  LL  LV      G+ T       NK  VYGLA
Sbjct  19   RAADSIWQLCNTNSNISASSQVSKNIDSLLATLVSKTPSKGFKTTTSSSYNNKEKVYGLA  78

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
            QCRGD+S+ DCS+CIQ+AAK+IR+ C ++ D+RI Y++CFLRY+ + F G++DTG G++Y
Sbjct  79   QCRGDISNTDCSTCIQDAAKKIREVCQNQSDSRILYDFCFLRYSQENFIGKLDTGAGLIY  138

Query  434  ANVANVT--DPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
             NVANVT  DP++F+ +LG L D I  EAV+P+N+GLGKGKTKL+ F+TL  LVQCTRDL
Sbjct  139  FNVANVTEIDPKKFDNELGALFDKIRSEAVLPKNKGLGKGKTKLTPFVTLNGLVQCTRDL  198

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPE  760
            S ++CAQC A AVG +F   C++KKGCRVLYSSCYVRYE YPFYFPLDP +
Sbjct  199  SELDCAQCFATAVG-SFMTTCHNKKGCRVLYSSCYVRYEFYPFYFPLDPAK  248



>gb|KFK31328.1| hypothetical protein AALP_AA6G098000 [Arabis alpina]
Length=263

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 158/213 (74%), Gaps = 5/213 (2%)
 Frame = +2

Query  134  NSQTSTNILKLLTNLVPaasragyataayggsgNK--VYGLAQCRGDVSSKDCSSCIQEA  307
            +SQ STNI  LL  LV      G+ T       NK  VYGLAQCRGD+S  DCSSCIQ+A
Sbjct  37   SSQISTNIDSLLATLVSKTPSRGFLTTTSSSYNNKDNVYGLAQCRGDISKSDCSSCIQDA  96

Query  308  AKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV--TDPERFNEKL  481
            AK IR+ CP++ D+RI Y++CFLRY+ + FFG++DTG G++Y N ANV  TDP+ F+ +L
Sbjct  97   AKRIREACPNQSDSRILYDFCFLRYSPENFFGKLDTGSGLIYFNTANVTETDPKTFDNEL  156

Query  482  GNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFP  661
            G L D I  EAV+P+++GLGKGK KL+ F+TL  LVQCTRDL+ + CAQC A AVG +F 
Sbjct  157  GALFDRIRSEAVLPKSQGLGKGKAKLTPFVTLNGLVQCTRDLTELECAQCFATAVG-SFM  215

Query  662  GFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPE  760
              C++KKGCRVLYSSCYVRYE YPFYFPLDP +
Sbjct  216  TTCHNKKGCRVLYSSCYVRYEFYPFYFPLDPAQ  248



>emb|CBI18745.3| unnamed protein product [Vitis vinifera]
Length=385

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 164/224 (73%), Gaps = 1/224 (0%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQ  256
            +A S DP G+FCN  +   +   S +   L   LV  AS  G+   ++G     V+GLAQ
Sbjct  19   SADSADPLGVFCNKDTNIGSGNASADFDDLSVQLVSKASTNGFVAISFGSGQYLVHGLAQ  78

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGDV  + CS+CIQ+AAK+IR RCP++ DARI ++YCFLRY+D +F G+VDTG+GI   
Sbjct  79   CRGDVGKEGCSTCIQDAAKQIRTRCPNKADARILFDYCFLRYSDKDFIGKVDTGFGIFLR  138

Query  437  NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            + A VT+ ERFNE+LG L++ I  +AV P+N GLGKG+TKL+ F+TLYALVQCTRDLSP+
Sbjct  139  HGAKVTETERFNEELGKLMEKIRSQAVEPQNAGLGKGQTKLTPFVTLYALVQCTRDLSPL  198

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
            +CAQCLAIAVG NF  FC + KGCRVLYSSCY RYELYP  F L
Sbjct  199  SCAQCLAIAVG-NFSDFCYNMKGCRVLYSSCYARYELYPVSFRL  241


 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 123/191 (64%), Gaps = 17/191 (9%)
 Frame = +2

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRY------------  382
            +Y L QC  D+S   C+ C+  A       C +    R+ Y  C+ RY            
Sbjct  185  LYALVQCTRDLSPLSCAQCLAIAVGNFSDFCYNMKGCRVLYSSCYARYELYPVSFRLGSA  244

Query  383  ---TDDEFFGEVDTGYGILYANVANVT-DPERFNEKLGNLVDGISKEAVVPENRGLGKGK  550
               ++  F G++DT  GILY N  NVT + ERFNE+LG L++ I  +AV P N GLGKG+
Sbjct  245  LMYSNKGFIGKLDTRPGILYRNGDNVTIETERFNEELGKLMEKIGSQAVEPRNEGLGKGQ  304

Query  551  TKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELY  730
            TKLS F+TLYAL QCTRDLS ++CAQCL+IAVG NFP FCN++KGCRVLYSSCY RYELY
Sbjct  305  TKLSPFVTLYALAQCTRDLSALSCAQCLSIAVG-NFPNFCNNRKGCRVLYSSCYTRYELY  363

Query  731  PFYFPLDPPEK  763
            P +FPL   ++
Sbjct  364  PIFFPLGSTQR  374



>ref|XP_002865649.1| hypothetical protein ARALYDRAFT_494916 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41908.1| hypothetical protein ARALYDRAFT_494916 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 165/231 (71%), Gaps = 6/231 (3%)
 Frame = +2

Query  83   QSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasra--gyataayggsgNKVYGLA  253
            ++ D     CNT S  + +SQ S NI  LL  LV           T+       KVYGLA
Sbjct  19   KAADSIWQLCNTNSNISASSQVSKNIDSLLATLVSKTPSQGFVTTTSPSYNKKEKVYGLA  78

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
            QCRGD+S  DCS+CIQ+AAK+IR+ CP++ D+RI Y++CFLRY+ + F G++DTG G++Y
Sbjct  79   QCRGDISKTDCSTCIQDAAKKIREVCPNQSDSRILYDFCFLRYSQENFIGKLDTGAGLIY  138

Query  434  ANVANV--TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
             N+ANV  TDP+ F+ +LG L D I  EAV+P+++GLGKGKTKL+ F+TL  LVQCTRDL
Sbjct  139  FNIANVTETDPKTFDNELGALFDKIRSEAVLPKSKGLGKGKTKLTPFVTLNGLVQCTRDL  198

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPE  760
              ++CAQC A AVG +F   C++KKGCRVLYSSCYVRYE YPFYFPLDP +
Sbjct  199  GALDCAQCFATAVG-SFMTTCHNKKGCRVLYSSCYVRYEFYPFYFPLDPAK  248



>emb|CDX85345.1| BnaC07g26560D [Brassica napus]
Length=261

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 147/181 (81%), Gaps = 3/181 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            + VYGLAQCRGD+S  DC++CIQ+AAK+IR+ CP++ DARI Y++CFLRY+ + F G++D
Sbjct  72   DNVYGLAQCRGDISKTDCTTCIQDAAKKIREVCPNQSDARILYDFCFLRYSQENFIGKLD  131

Query  413  TGYGILYANVANV--TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYAL  586
            TG G++Y NVANV  TDP+ F+ +LG L D I  EAV+PE++GLGKGKTKL+ F+TL  L
Sbjct  132  TGAGLIYYNVANVTETDPKTFDNELGKLFDKIRSEAVLPESQGLGKGKTKLTPFVTLNGL  191

Query  587  VQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKS  766
            VQCTRDLS ++CAQC A AV  +F G C++KKGCRVLYSSCYVRYE YPFYFPLDP +  
Sbjct  192  VQCTRDLSALDCAQCFATAV-QSFMGACHNKKGCRVLYSSCYVRYEFYPFYFPLDPAKTG  250

Query  767  T  769
            T
Sbjct  251  T  251



>ref|XP_011024571.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich repeat secretory 
protein 55 [Populus euphratica]
Length=253

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 158/223 (71%), Gaps = 2/223 (1%)
 Frame = +2

Query  86   STDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCR  262
            S D +G FCN  S+   NSQ   N   LL  LV   +  G+A   YG   +KVYGLAQCR
Sbjct  17   SADRAGEFCNADSEIKGNSQIFANTDWLLPALVFRTALTGFAPVTYGKGQDKVYGLAQCR  76

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GDVSSKDC SCIQ+AAK+IR+ CPD+ DA IW++YC L Y +  F G+VDT + I+Y NV
Sbjct  77   GDVSSKDCFSCIQDAAKQIREVCPDQADAWIWFDYCILFYDNINFIGKVDTDFSIVYFNV  136

Query  443  ANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNC  622
               T+ E F+++L  L D I  EAV P NRGLGKG+ KLS F  LYA VQC RDLS ++C
Sbjct  137  EEATEFEDFHDELAALTDQIRAEAVFPGNRGLGKGEKKLSRFAKLYAQVQCIRDLSRIDC  196

Query  623  AQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
             QCLAIA G NFP FC+D+KGCR+ YSSCYVRYELYPF+FP+D
Sbjct  197  XQCLAIAFG-NFPDFCDDRKGCRIFYSSCYVRYELYPFFFPID  238



>ref|XP_010482102.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Camelina 
sativa]
Length=263

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 163/223 (73%), Gaps = 6/223 (3%)
 Frame = +2

Query  107  FCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNK--VYGLAQCRGDVSS  277
             CN  S  + +S+ S NI  LL  LV      G+ T       +K  VYGLAQCRGD+S 
Sbjct  27   LCNKNSNISASSKVSKNIDSLLATLVSKTPSQGFMTTTSSSYNDKEKVYGLAQCRGDISK  86

Query  278  KDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV--  451
             DCS+CIQ+AAK+IR+ CP++ D+RI Y++CFLRY+ + F G++DTG G++Y NVANV  
Sbjct  87   TDCSTCIQDAAKKIREVCPNQSDSRILYDFCFLRYSQENFIGKLDTGAGLIYYNVANVTE  146

Query  452  TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQC  631
            TDP+ F+ +LG L D I  EAV+P+++GLGKGKTKL+ F TL  LVQCTRDLS ++CAQC
Sbjct  147  TDPKTFDNELGALFDKIRSEAVLPKSQGLGKGKTKLTPFATLNGLVQCTRDLSELDCAQC  206

Query  632  LAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPE  760
             A AVG +F   C++KKGCRVLYSSCYVRYE YPFYFPLDP +
Sbjct  207  FATAVG-SFMTTCHNKKGCRVLYSSCYVRYEFYPFYFPLDPAK  248



>ref|XP_010442278.1| PREDICTED: cysteine-rich repeat secretory protein 55 [Camelina 
sativa]
Length=263

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 162/223 (73%), Gaps = 6/223 (3%)
 Frame = +2

Query  107  FCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNK--VYGLAQCRGDVSS  277
             CN  S  + +S+ S NI  LL  LV      G+ T       +K  VYGLAQCRGD+S 
Sbjct  27   LCNKNSNISASSKVSKNIDSLLATLVSKTPSQGFMTTTSSSYNDKEKVYGLAQCRGDISK  86

Query  278  KDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV--  451
             DCS+CIQ+AAK+IR+ CP++ D+RI Y++CFLRY+ + F G++DTG G++Y NVANV  
Sbjct  87   TDCSTCIQDAAKKIREVCPNQSDSRILYDFCFLRYSQENFIGKLDTGAGLIYYNVANVTE  146

Query  452  TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQC  631
            TDP+ F+ +LG L D I  EAV+P++ GLGKGKTKL+ F TL  LVQCTRDLS ++CAQC
Sbjct  147  TDPKTFDNELGALFDKIRSEAVLPKSEGLGKGKTKLTPFATLNGLVQCTRDLSELDCAQC  206

Query  632  LAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPE  760
             A AVG +F   C++KKGCRVLYSSCYVRYE YPFYFPLDP +
Sbjct  207  FATAVG-SFMTTCHNKKGCRVLYSSCYVRYEFYPFYFPLDPAK  248



>ref|XP_009151651.1| PREDICTED: cysteine-rich repeat secretory protein 55 [Brassica 
rapa]
 emb|CDX86299.1| BnaA06g30160D [Brassica napus]
Length=261

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 146/181 (81%), Gaps = 3/181 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            + VYGLAQCRGD+S  DC++CIQ+AAK+IR+ CP++ DARI Y++CFLRY+ + F G++D
Sbjct  72   DNVYGLAQCRGDISKTDCTTCIQDAAKKIREVCPNQSDARILYDFCFLRYSQENFIGKLD  131

Query  413  TGYGILYANVANV--TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYAL  586
            TG G++Y NVANV  TDP+ F+ +LG L D I  EAV+ E++GLGKGKTKL+ F+TL  L
Sbjct  132  TGAGLIYYNVANVTETDPKTFDNELGKLFDKIRSEAVLRESQGLGKGKTKLTPFVTLNGL  191

Query  587  VQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKS  766
            VQCTRDLS ++CAQC A AV  +F G C++KKGCRVLYSSCYVRYE YPFYFPLDP +  
Sbjct  192  VQCTRDLSALDCAQCFATAV-QSFMGACHNKKGCRVLYSSCYVRYEFYPFYFPLDPAKTG  250

Query  767  T  769
            T
Sbjct  251  T  251



>ref|XP_006828415.1| hypothetical protein AMTR_s00060p00079250 [Amborella trichopoda]
 gb|ERM95831.1| hypothetical protein AMTR_s00060p00079250 [Amborella trichopoda]
Length=262

 Score =   244 bits (624),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 160/234 (68%), Gaps = 1/234 (0%)
 Frame = +2

Query  89   TDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGD  268
            +D  G FCN   K  +  T  NI  +L+ L   A    +ATA+ G    +VYGL QCRGD
Sbjct  22   SDSLGEFCNFKKKISDKPTMINIGLVLSKLETKAPSNRFATASDGQGKERVYGLLQCRGD  81

Query  269  VSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVAN  448
            +S KDCSSC  +AAK +R  CPD  DARIW++ CFLRY  D+F GE+DT YGI Y NV N
Sbjct  82   ISPKDCSSCTSDAAKHVRHLCPDEADARIWFDSCFLRYNTDDFIGELDTRYGIFYWNVEN  141

Query  449  VTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQ  628
            VT+PERF ++LG+L++ +  +AV P N+G G GK K + F+T+Y LVQCT+DL  + CAQ
Sbjct  142  VTEPERFAKELGDLMNNVKAKAVQPGNKGFGSGKIKFTQFVTIYGLVQCTQDLPKLQCAQ  201

Query  629  CLAIAVGN-NFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEA  787
            CL+ A+ N    G+C+ KKGCRVLYSSC+VR+E+YPF+ PL     + V AS+A
Sbjct  202  CLSTAISNFGGGGYCDGKKGCRVLYSSCFVRFEIYPFFLPLSAYTGNEVHASQA  255



>ref|XP_010036761.1| PREDICTED: cysteine-rich repeat secretory protein 55-like isoform 
X2 [Eucalyptus grandis]
Length=238

 Score =   244 bits (622),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 156/228 (68%), Gaps = 27/228 (12%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYG  247
            +  AQS DP G FCN  +  +  S   +NI  +LT LV  A   G+ T +YG   +KVYG
Sbjct  19   VSNAQSDDPLGQFCNQDTVISKASPIWSNIDHVLTELVSKAPSTGFLTTSYGSGNDKVYG  78

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            LAQCRGDVS  DCSSCIQ+A K+IR+ CPD+ DARIWY+YCFLRY D  F          
Sbjct  79   LAQCRGDVSQDDCSSCIQDAGKQIRQLCPDQADARIWYDYCFLRYDDKTFI---------  129

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
                            +LG L+D I  +AVVPENRGLGK KTKL+ F+TLYALVQCTRDL
Sbjct  130  ----------------ELGRLMDRIEADAVVPENRGLGKSKTKLTPFITLYALVQCTRDL  173

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
              ++CAQCLAIAVG NFPG CN +KGCRVLYSSCYVRYELYPF+FPLD
Sbjct  174  PKLSCAQCLAIAVG-NFPGICNSRKGCRVLYSSCYVRYELYPFFFPLD  220



>ref|XP_006386887.1| hypothetical protein POPTR_0002s25110g [Populus trichocarpa]
 gb|ERP64684.1| hypothetical protein POPTR_0002s25110g [Populus trichocarpa]
Length=240

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 160/223 (72%), Gaps = 15/223 (7%)
 Frame = +2

Query  86   STDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCR  262
            S D +G FCN  S+ + NSQ   NI +LL  LV   +  G+AT  YG   +KV+GLAQCR
Sbjct  17   SADRAGEFCNADSEISGNSQIFANIDRLLPVLVFRTALTGFATVTYGKGQDKVHGLAQCR  76

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GDVSSKDC SCIQ+AAK+IR+ CPD+ DARIW+EYCFLRY +  F G+VDT +  +  N+
Sbjct  77   GDVSSKDCFSCIQDAAKQIREVCPDQADARIWFEYCFLRYDNINFIGKVDTDFSTVCFNL  136

Query  443  ANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNC  622
            A +TD              I  EAV P NRGLGKG+ KLS F+ LYALVQC RDLS ++C
Sbjct  137  AALTDQ-------------IRAEAVFPGNRGLGKGEKKLSRFVKLYALVQCIRDLSRIDC  183

Query  623  AQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            AQCLAIA+G +FP FC+D+KGCR+ YS CYVRYELYPF+FP+D
Sbjct  184  AQCLAIAIG-SFPDFCDDRKGCRIFYSICYVRYELYPFFFPID  225



>ref|XP_006395170.1| hypothetical protein EUTSA_v10005717mg [Eutrema salsugineum]
 gb|ESQ32456.1| hypothetical protein EUTSA_v10005717mg [Eutrema salsugineum]
Length=261

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 148/186 (80%), Gaps = 7/186 (4%)
 Frame = +2

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTG  418
            VYGLAQCRGD+S  DCSSCIQ+AA +IR+ CP++ D+RI Y++CFLRY+ + F G++DTG
Sbjct  74   VYGLAQCRGDISKSDCSSCIQDAALKIREVCPNQSDSRILYDFCFLRYSQENFIGKLDTG  133

Query  419  YGILYANVANV--TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
             G++Y NVANV  TDP+ F+ +LG L D I  EAV+P+++GLGKGKTKL+ F+TL  LVQ
Sbjct  134  AGLIYYNVANVTETDPKTFDNELGALFDKIRSEAVLPKSKGLGKGKTKLTPFVTLNGLVQ  193

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDP----PE  760
            CTRDLS ++CAQC A A+G +F   C++KKGCRVLYSSCYVRYE YPFYFPLDP    P 
Sbjct  194  CTRDLSELDCAQCFATAMG-SFMTTCHNKKGCRVLYSSCYVRYEFYPFYFPLDPAMTGPS  252

Query  761  KSTVAA  778
              TV++
Sbjct  253  VGTVSS  258



>gb|EYU40655.1| hypothetical protein MIMGU_mgv1a025334mg [Erythranthe guttata]
Length=243

 Score =   238 bits (608),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 164/225 (73%), Gaps = 4/225 (2%)
 Frame = +2

Query  83   QSTDPSGLFCNTASKNLNS-QTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQC  259
            +S  P    CN  +K  N+ Q S NI  LL+ LV  A R G+ TA+ G +  +VYGL+QC
Sbjct  20   ESASPLVYSCNDDTKTSNTTQISRNIDNLLSKLVAGAVRKGFVTASSGEAEAQVYGLSQC  79

Query  260  RGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD--TGYGILY  433
            RGDVS  +CS CIQEAAK++R++CPD+ DAR+W++YCFL Y   +FFG+VD  +G GI +
Sbjct  80   RGDVSKTNCSICIQEAAKDLREQCPDQSDARVWFDYCFLTYKPSKFFGQVDFSSGDGIYF  139

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
            +NV NV +   F+ KLG L+D I+ EAV P  +G GKGK+ +S  +TLYALVQCT DLS 
Sbjct  140  SNVENVKNKRVFSRKLGELMDKITSEAVRPSQKGFGKGKSVISSLVTLYALVQCTEDLSG  199

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
            +NCA+C+  AVG +F  FCN+K+GCRVLY+ C+VRYELYPF+FPL
Sbjct  200  INCARCVGTAVG-DFTRFCNNKEGCRVLYNGCFVRYELYPFFFPL  243



>gb|EYU39171.1| hypothetical protein MIMGU_mgv1a027159mg [Erythranthe guttata]
Length=259

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 162/249 (65%), Gaps = 10/249 (4%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLNSQTSTNILK-LLTNLVPaasrag-yataayggsgNKVY  244
            I TAQS DP+   CN  SK   + +S N +K LL NLV    + G  +T    G  N++Y
Sbjct  16   ICTAQSADPAAYSCNPNSK---TNSSNNQIKTLLDNLVSGTIQRGFISTVQGAGGKNQIY  72

Query  245  GLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYG  424
            GLAQCRGDVS  DCS+CI +AAK I K CP + DARIWY++CFLRY    FFG+VDT  G
Sbjct  73   GLAQCRGDVSKNDCSTCINDAAKNILKLCPGQSDARIWYDFCFLRYGRSNFFGQVDTS-G  131

Query  425  ILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRD  604
                NV NVTD   FN+KL  L++ +   A  P +RGLGKGK+ +S F  LY LVQCTRD
Sbjct  132  FFLINVQNVTDAAIFNKKLAALMNKVGSRAPKPASRGLGKGKSDVSPFDRLYGLVQCTRD  191

Query  605  LSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASE  784
            LS + CAQC +IA+G N P  C DK+GCRVLY SCYVRYELYPF+FPL+  E        
Sbjct  192  LSELACAQCASIAIG-NLPIVCGDKRGCRVLYGSCYVRYELYPFFFPLEAKES---IQHH  247

Query  785  ARNYRSTVV  811
              NY+S + 
Sbjct  248  TVNYKSVLA  256



>ref|XP_006280966.1| hypothetical protein CARUB_v10026967mg [Capsella rubella]
 gb|EOA13864.1| hypothetical protein CARUB_v10026967mg [Capsella rubella]
Length=263

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 153/207 (74%), Gaps = 5/207 (2%)
 Frame = +2

Query  152  NILKLLTNLVPaasragyataayggsgNK--VYGLAQCRGDVSSKDCSSCIQEAAKEIRK  325
            NI  LL  LV      G+ T       NK  VYGLAQCRGD+S  DCS+CIQ+AAK+IR+
Sbjct  43   NIDSLLATLVSKTPSQGFTTTTSSSYNNKEKVYGLAQCRGDISQTDCSTCIQDAAKKIRE  102

Query  326  RCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV--TDPERFNEKLGNLVDG  499
             CP++ D+RI Y++CFLRY+ + F G++DT  G++Y NVANV  TDP+ F+ +LG L D 
Sbjct  103  ICPNQSDSRILYDFCFLRYSQENFIGKLDTAGGLIYFNVANVTETDPKTFDNELGALFDK  162

Query  500  ISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDK  679
            I  EA +P+++GLGKGKTKL+ F TL  LVQCTRDLS ++CAQC A AVG +F   C++K
Sbjct  163  IRSEAGLPKSQGLGKGKTKLTPFATLNGLVQCTRDLSELDCAQCFATAVG-SFMTACHNK  221

Query  680  KGCRVLYSSCYVRYELYPFYFPLDPPE  760
            +GCRVLYSSCYVRYE YPFYFPLDP +
Sbjct  222  RGCRVLYSSCYVRYEFYPFYFPLDPAQ  248



>gb|EPS71622.1| hypothetical protein M569_03138, partial [Genlisea aurea]
Length=233

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 154/225 (68%), Gaps = 5/225 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQ  256
            T++S DP   FCN    N  +Q S NI  LL ++       G+   + G   +K+YGL Q
Sbjct  13   TSESADPVASFCN--GSNRTAQQSANIDALLGDIAAGTIAGGFTATSRGTGADKIYGLGQ  70

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGDV S  C SCI +A   + + CPD+VD++ WY++CFLRY+   FF  VDT  G+   
Sbjct  71   CRGDVDSSTCWSCINDAISSVSRFCPDKVDSKTWYDFCFLRYSPTNFFDSVDTS-GVYLI  129

Query  437  NVANVT-DPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
            NV NVT DP  FN+KLG+L+  IS +AV P NRGLGK  + +S ++ LY LVQCTRDLSP
Sbjct  130  NVENVTTDPTIFNQKLGSLMREISSQAVKPPNRGLGKKISDISTYVRLYGLVQCTRDLSP  189

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
            +NCAQCL+ AV +NFP  C +++GCRVLYSSCYVRYELYPF+FPL
Sbjct  190  LNCAQCLSTAV-SNFPAVCPNRRGCRVLYSSCYVRYELYPFFFPL  233



>ref|XP_010524650.1| PREDICTED: cysteine-rich repeat secretory protein 55 [Tarenaya 
hassleriana]
Length=262

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 161/227 (71%), Gaps = 5/227 (2%)
 Frame = +2

Query  83   QSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaa-sragyataayggsgNKVYGLAQ  256
            ++ D     CN  S    NS+ S NI  LL  LV    S+  +  ++ G + +KVYGLAQ
Sbjct  19   EAADSIWELCNKDSNFTRNSRVSMNIDSLLVTLVSETPSKGFFTVSSSGQNQDKVYGLAQ  78

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGD+S  DCSSC+Q+AA++IR+ CP++ D+RI Y++CFLRY+ + F G++D G G++Y 
Sbjct  79   CRGDISRTDCSSCVQDAARKIRESCPNQSDSRILYDFCFLRYSKENFVGKLDAGAGLIYY  138

Query  437  NVANV--TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
            NVANV  TDPE F++ L  L D +  EAV   ++GLGK KT L+ F+TLY LVQCTRDLS
Sbjct  139  NVANVTETDPETFDKVLATLFDRVRAEAVSAGSKGLGKDKTDLTPFVTLYGLVQCTRDLS  198

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
             ++CAQC AIAV  NF   C+ KKGCRVLYSSCYVRYE YPFYFPLD
Sbjct  199  ELDCAQCFAIAV-RNFMYACHGKKGCRVLYSSCYVRYEFYPFYFPLD  244



>ref|XP_010666948.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Beta 
vulgaris subsp. vulgaris]
Length=265

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 155/223 (70%), Gaps = 4/223 (2%)
 Frame = +2

Query  92   DPSGLFCNTASKNLNSQ-TSTNILKLLTNLVPa-asragyataayggsgNKVYGLAQCRG  265
            +P   +CN  +   +S   S NI  LL N+V      A Y  AA G   + +YGLAQCRG
Sbjct  25   EPQSEYCNPNTMTSSSSPISANIDHLLANVVTKFQQGATYVKAASGKGDDTIYGLAQCRG  84

Query  266  DVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYG-ILYANV  442
            DV SKDC SCI++ A+ IRK CP + +A + YEYC+L+Y+ D F+G+VDT  G +LY N 
Sbjct  85   DVGSKDCLSCIKDVAQRIRKTCPSQSEAWVRYEYCYLKYSQDNFYGKVDTSTGGLLYKNT  144

Query  443  ANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNC  622
             NV +P+ FN++LG L D I   AV P + GLGK + KLSDF TLY LVQC +DLSP++C
Sbjct  145  QNVPNPDSFNKELGKLFDKIVSRAVKPSSGGLGKDEKKLSDFETLYGLVQCNKDLSPLSC  204

Query  623  AQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
             QCLAIA+  NF GFC D +GCRV+YSSC+VRYELYPFYFPLD
Sbjct  205  GQCLAIAI-QNFEGFCKDSQGCRVVYSSCFVRYELYPFYFPLD  246



>ref|XP_010666949.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Beta 
vulgaris subsp. vulgaris]
Length=265

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 153/223 (69%), Gaps = 4/223 (2%)
 Frame = +2

Query  92   DPSGLFCNTASKNLNSQ-TSTNILKLLTNLVPa-asragyataayggsgNKVYGLAQCRG  265
            +P   +CN  +   +S   S NI  LL N+V      A Y  AA G   + VYGLAQCRG
Sbjct  25   EPQSEYCNPNTMTSSSSPISANIDHLLANVVTKFQQGATYVKAASGKGDDTVYGLAQCRG  84

Query  266  DVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL-YANV  442
            DV SKDC SCI++ A+ IRK CP + +A + YEYC+L+Y+ D F+G+VDT    L Y N 
Sbjct  85   DVGSKDCLSCIKDVAQRIRKTCPSQSEAWVRYEYCYLKYSQDNFYGKVDTSTAALVYYNT  144

Query  443  ANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNC  622
             NV DP+ F+ +LG L D I   AV P + GLGK +TKLSDF TLY LVQC +DLSPV+C
Sbjct  145  QNVIDPKSFSNELGKLFDKIVSRAVKPSSGGLGKDETKLSDFETLYGLVQCNKDLSPVSC  204

Query  623  AQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
             QCLAIA+  NF GFC D +GCRV++SSC+VRYELYPFYFPLD
Sbjct  205  GQCLAIAI-QNFEGFCKDSQGCRVVFSSCFVRYELYPFYFPLD  246



>ref|XP_009419751.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Musa 
acuminata subsp. malaccensis]
Length=256

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 159/225 (71%), Gaps = 3/225 (1%)
 Frame = +2

Query  92   DPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDV  271
            D  G +C+ +    + Q   N   +L++LV  AS  G+AT++YG  G+ +YGLAQCRGDV
Sbjct  21   DSIGYYCDKSFNGGHIQADIN--GVLSDLVAKASVGGFATSSYGKGGSAIYGLAQCRGDV  78

Query  272  SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV  451
            SS+DCS+C+++AAK + + CP + DARIWY+YCFLRY D+ F G+ D+GY I+  NV N 
Sbjct  79   SSEDCSTCLKDAAKALPESCPSQADARIWYDYCFLRYDDENFIGQSDSGYAIILYNVENA  138

Query  452  TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQC  631
            TDP+ F++K+G  +     +AV P + GLG+ KTK S ++T+Y L QCTRD+  + CAQC
Sbjct  139  TDPDAFDKKVGEAMRTARAQAVAPGSGGLGRVKTKFSPYITIYGLAQCTRDIQTLACAQC  198

Query  632  LAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKS  766
            L+ AV  NF  +C  +KGCRVLYSSC VRYE+YPF+FP+DP   S
Sbjct  199  LSSAV-ENFANYCVHRKGCRVLYSSCMVRYEIYPFFFPVDPGSSS  242



>ref|XP_008784514.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Phoenix 
dactylifera]
Length=255

 Score =   226 bits (575),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 157/226 (69%), Gaps = 3/226 (1%)
 Frame = +2

Query  74   FTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            F   +TD  G +C  A+    S+   NI  +L+NLV  AS  G+AT+  G   + +YGLA
Sbjct  16   FCTAATDSIGQYC--ANSFNGSKIQANIDHVLSNLVAKASVGGFATSYSGEGSDIIYGLA  73

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
            QCRGDVSS DCS+C+  AAK++   CP + DARIWY+YCF+RY +  F G+ DTGY I+Y
Sbjct  74   QCRGDVSSDDCSTCLTAAAKKLPTVCPGQADARIWYDYCFMRYDNKNFIGKADTGYAIIY  133

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             NV N TDPE F+++  +L++ +  EAV P ++G   GKT+ + ++T+Y L QCT+DL P
Sbjct  134  INVQNATDPEAFDKEEESLMNKLKAEAVAPGSKGFATGKTEFTPYVTIYGLEQCTKDLQP  193

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            + CAQCL+ A+   FP +C  ++GC+VLYSSC VRYE+YPF+FPLD
Sbjct  194  LMCAQCLSSALA-KFPDYCRFRRGCQVLYSSCIVRYEIYPFFFPLD  238



>ref|XP_010920640.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Elaeis 
guineensis]
Length=254

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 165/247 (67%), Gaps = 9/247 (4%)
 Frame = +2

Query  74   FTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            F   +TD    +C  A+    S+  +NI  +L++LV  AS +G+AT+  G   + +YGLA
Sbjct  16   FCTAATDSIAQYC--ANSFHGSKIQSNIDHVLSDLVAKASVSGFATSYSGEGSDIIYGLA  73

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
            QCRGDVSS DCS+C++ AAK++   CP + DARIWY+YCF+RY ++ F G+ DTGY  + 
Sbjct  74   QCRGDVSSDDCSTCLRAAAKKLPTVCPGQADARIWYDYCFMRYDNENFIGKADTGYATIL  133

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             NV N TDPE F+++   L+  +  EAV P +RG   GKT+ + F+T+Y L QCT+DL P
Sbjct  134  INVQNATDPEAFDKEEERLMGRLETEAVAPGSRGFATGKTEFTPFVTIYGLEQCTKDLQP  193

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARN  793
            + CAQCL+ A+   FP +C  ++GC+VLYSSC VRYE+YPF+FPLD    S++AA     
Sbjct  194  LMCAQCLSSALA-KFPEYCRFRQGCQVLYSSCIVRYEIYPFFFPLD----SSLAA--VGR  246

Query  794  YRSTVVH  814
            Y   ++H
Sbjct  247  YSKAILH  253



>ref|XP_010920641.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Elaeis 
guineensis]
Length=254

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 157/226 (69%), Gaps = 3/226 (1%)
 Frame = +2

Query  74   FTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            F   +TD  G +C  A+     +T +NI  +L++LV  AS  G+ATA  G   + +YGLA
Sbjct  16   FCTAATDSIGQYC--ANSFNGRKTQSNIDHVLSDLVAKASVGGFATAYSGEGSDIIYGLA  73

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
            QCRGDVSS DCS+C++ AAK++   CP + DARIWY+YCF+RY ++ F G+ DTG+ ++Y
Sbjct  74   QCRGDVSSDDCSTCLRAAAKKLPTVCPGQADARIWYDYCFMRYDNENFIGKADTGFAVIY  133

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             NV N TDPE F+E+   L+  +  EAV P ++G   GKT+ +  +T+Y L QCT+DL P
Sbjct  134  YNVQNATDPEAFDEEKERLMSRLKAEAVAPGSQGFATGKTEFTPSVTIYGLEQCTKDLQP  193

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            + CAQCL+ A+   FP +C  ++GC+VLYSSC VRYE+YPF+FPLD
Sbjct  194  LMCAQCLSSALA-KFPDYCRFRQGCQVLYSSCIVRYEIYPFFFPLD  238



>ref|XP_010493678.1| PREDICTED: cysteine-rich repeat secretory protein 55-like isoform 
X1 [Camelina sativa]
Length=204

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 135/173 (78%), Gaps = 3/173 (2%)
 Frame = +2

Query  236  KVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            KVYGLAQCRGD+S  DCS+CIQ+AAK+IR+ CPD+ D+RI Y++CFLRY+ + F G++DT
Sbjct  13   KVYGLAQCRGDISKTDCSTCIQDAAKKIREVCPDQSDSRILYDFCFLRYSQENFIGKLDT  72

Query  416  GYGILYANVANV--TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
            G G++Y NVANV  TDP+ F+ +LG L D I  EAV+P+++GLGKGK KL+ F TL  LV
Sbjct  73   GAGLIYYNVANVTETDPKTFDNELGALFDKIRSEAVLPKSQGLGKGKKKLTPFATLNGLV  132

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
            QCTRDLS ++CAQC A AVG +F   C++KKGCRVLYSSCYVR     F+  L
Sbjct  133  QCTRDLSELDCAQCFATAVG-SFMTTCHNKKGCRVLYSSCYVRRGGVNFWLRL  184



>ref|XP_010493679.1| PREDICTED: cysteine-rich repeat secretory protein 55-like isoform 
X2 [Camelina sativa]
Length=192

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = +2

Query  236  KVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            KVYGLAQCRGD+S  DCS+CIQ+AAK+IR+ CPD+ D+RI Y++CFLRY+ + F G++DT
Sbjct  13   KVYGLAQCRGDISKTDCSTCIQDAAKKIREVCPDQSDSRILYDFCFLRYSQENFIGKLDT  72

Query  416  GYGILYANVANV--TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
            G G++Y NVANV  TDP+ F+ +LG L D I  EAV+P+++GLGKGK KL+ F TL  LV
Sbjct  73   GAGLIYYNVANVTETDPKTFDNELGALFDKIRSEAVLPKSQGLGKGKKKLTPFATLNGLV  132

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYE  724
            QCTRDLS ++CAQC A AVG +F   C++KKGCRVLYSSCYVR +
Sbjct  133  QCTRDLSELDCAQCFATAVG-SFMTTCHNKKGCRVLYSSCYVRTQ  176



>ref|XP_009421435.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Musa 
acuminata subsp. malaccensis]
Length=257

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 156/233 (67%), Gaps = 7/233 (3%)
 Frame = +2

Query  122  SKNLNS-QTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCSSCI  298
            SK+  S QT  NI  +L +LV +AS  G+ATA+ G   + +YGLAQCRGDVS++DCS+C+
Sbjct  29   SKSFKSKQTQANIDHVLADLVASASVGGFATASSGKGASGIYGLAQCRGDVSAEDCSTCL  88

Query  299  QEAAKEI-RKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPERFNE  475
             +AAK++    CP + D RIWY+YCF+RY ++ F G+ DT    +  NV N TDPE+F++
Sbjct  89   ADAAKKLPTTACPSQADGRIWYDYCFMRYDNENFVGQSDTSVATILINVENATDPEKFDK  148

Query  476  KLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNN  655
            K+G ++     +AV P N  LG+ K + + ++T+YAL QCTRDL  + CAQCL+ AV   
Sbjct  149  KVGVVMGRARADAVAPGNNALGRAKLQFTPYITIYALAQCTRDLQQLTCAQCLSSAV-EK  207

Query  656  FPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNYRSTVVH  814
            FP +C  +KGC+VLYSSC VRYE+YPFYFPLD    ST   +    Y    +H
Sbjct  208  FPDYCQYRKGCQVLYSSCMVRYEIYPFYFPLD----STKTTAAVGTYYKATLH  256



>ref|XP_009421340.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Musa 
acuminata subsp. malaccensis]
Length=257

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 155/233 (67%), Gaps = 7/233 (3%)
 Frame = +2

Query  122  SKNLNS-QTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCSSCI  298
            SK+  S QT  NI  +L +LV +AS  G+ATA+ G   + +YGLAQCRGDVS++DCS+C+
Sbjct  29   SKSFKSKQTQANIDHVLADLVASASVGGFATASSGKGASGIYGLAQCRGDVSAEDCSTCL  88

Query  299  QEAAKEI-RKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPERFNE  475
             +AAK++    CP + D RIWY+YCF+RY ++ F G+ DT    +  NV N TDP+ F++
Sbjct  89   ADAAKKLPTTACPSQADGRIWYDYCFMRYDNENFVGQSDTSVATILYNVENATDPQNFDK  148

Query  476  KLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNN  655
            K+G ++     +AV P N  LG+ K + + ++T+YAL QCTRDL  + CAQCL+ AV   
Sbjct  149  KVGVVMRRARADAVAPGNNALGRAKLQFTPYITIYALAQCTRDLQQLTCAQCLSSAV-EM  207

Query  656  FPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNYRSTVVH  814
            FP +C  +KGCRVLYSSC VRYE+YPFYFPLD    ST   +    Y    +H
Sbjct  208  FPDYCQHRKGCRVLYSSCMVRYEIYPFYFPLD----STKTTAAVGTYYKATLH  256



>ref|XP_010910873.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Elaeis 
guineensis]
Length=238

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 153/226 (68%), Gaps = 3/226 (1%)
 Frame = +2

Query  74   FTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            F   +TDP G  C  A+    S+   NI  +L++LV  AS  G+AT   G   + +YGLA
Sbjct  16   FCTAATDPIGQHC--ANSFNGSEIQDNIDHVLSDLVAKASVGGFATTYSGEGSDIIYGLA  73

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
            QCRGDVSS DCS+C++ AAKE+   CPD+ DARIWY+YCF+RY ++ F G+ DT + ++ 
Sbjct  74   QCRGDVSSDDCSTCLRAAAKELPTVCPDQADARIWYDYCFMRYDNENFIGKDDTEFALIL  133

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             NV N TDPE F+++   L+  +  EAV P ++    GKT+ +  +T+Y L QCT+DL P
Sbjct  134  YNVRNATDPEAFDKEKERLMSRLEAEAVAPGSQEFATGKTEFTPNVTIYGLEQCTKDLKP  193

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            + CAQCL+ A+   FP +C  ++GCRVLYSSC VRYE+YPF+FPLD
Sbjct  194  LTCAQCLSSALA-KFPDYCRFRQGCRVLYSSCIVRYEIYPFFFPLD  238



>ref|XP_008784711.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Phoenix 
dactylifera]
Length=255

 Score =   213 bits (542),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 153/226 (68%), Gaps = 3/226 (1%)
 Frame = +2

Query  74   FTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            F   +TD  G +C  A+    S+   NI  +L++LV  AS  G+AT+  G   + +YGLA
Sbjct  16   FCTAATDSIGQYC--ANSFNGSKIQANIDHVLSDLVAKASVGGFATSYSGEGSDVIYGLA  73

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
            QCR DVSS DCS+C+  AAK++   CP + DARIWY+YCF+RY ++ F G+ DTGY I+ 
Sbjct  74   QCRRDVSSDDCSTCLTAAAKKLPTVCPGQADARIWYDYCFMRYDNENFIGKADTGYAIIL  133

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             NV N TDPE F+++  +L+  +  EAV P ++G   GKT+ +  +T+Y L QCT+DL P
Sbjct  134  INVQNATDPEAFDKEEESLMSRLKAEAVAPGSKGFATGKTEFTPDVTIYGLEQCTKDLQP  193

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            + CAQCL+ A+   FP +C  ++GC+VL SSC VRYE+YPF+FPLD
Sbjct  194  LMCAQCLSSALA-KFPDYCRFRRGCQVLSSSCIVRYEIYPFFFPLD  238



>gb|KDP45260.1| hypothetical protein JCGZ_15125 [Jatropha curcas]
Length=222

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 140/220 (64%), Gaps = 44/220 (20%)
 Frame = +2

Query  92   DPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDV  271
            DP G  CN    N N  T  NI  L+T LV  AS +GY T   G   +K+YGLAQCRGDV
Sbjct  30   DPLGNLCNDQQTN-NKTTIQNINHLITELVSKASSSGYFTTTSGQGQDKIYGLAQCRGDV  88

Query  272  SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV  451
            S+ DCS C+++AAKEI +RCP++VDARIWY+YCFLR                        
Sbjct  89   STDDCSGCLRDAAKEIGQRCPNQVDARIWYDYCFLR------------------------  124

Query  452  TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQC  631
                               EAV  +N+G+GKG+TKL+  +TLYAL QCTRDL+ V+CAQC
Sbjct  125  ------------------SEAVKEKNKGIGKGETKLTPLVTLYALAQCTRDLAVVDCAQC  166

Query  632  LAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            +AIAVG NFP FCN++KGCR +YS+CYVRYELYPF+FPLD
Sbjct  167  IAIAVG-NFPNFCNNRKGCRAIYSNCYVRYELYPFFFPLD  205



>gb|EEE58797.1| hypothetical protein OsJ_10340 [Oryza sativa Japonica Group]
Length=242

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/244 (41%), Positives = 150/244 (61%), Gaps = 5/244 (2%)
 Frame = +2

Query  86   STDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKV-YGLAQCR  262
            + DP G +C+  S   +S+   +I  +LT+LV   S       +  G GN V YGL QCR
Sbjct  2    AMDPLGSYCSGNSLAGSSKAVASINSVLTDLVTKGSTGVGFATSTAGKGNNVIYGLVQCR  61

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GDVS+ DC +C+  AA +I   C  + D+RIWY+YCF+R+ ++ FFG+ DT  G++  NV
Sbjct  62   GDVSTSDCQACLASAANQILTSCNYQSDSRIWYDYCFMRFENENFFGQADTDNGVIMENV  121

Query  443  ANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNC  622
              + + + F + +G ++   + +     + GLG+ K + + F+ +Y   QCTRDLSP+ C
Sbjct  122  QAMDNAKAFQKAVGKVMSKATAQVSQAGSGGLGRVKDQYTPFINIYGFAQCTRDLSPLTC  181

Query  623  AQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNYRS  802
            AQCL+ AV + F  +C  ++GCR+LYSSC VRYE+YPFYFPL     S+ A ++   Y  
Sbjct  182  AQCLSTAV-SRFDQYCGAQQGCRILYSSCMVRYEIYPFYFPL---ATSSTATTDMTKYTK  237

Query  803  TVVH  814
            T+VH
Sbjct  238  TIVH  241



>ref|NP_001049722.1| Os03g0277700 [Oryza sativa Japonica Group]
 gb|ABF95271.1| 33 kDa secretory protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11636.1| Os03g0277700 [Oryza sativa Japonica Group]
Length=265

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 151/246 (61%), Gaps = 5/246 (2%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKV-YGLAQ  256
            + + DP G +C+  S   +S+   +I  +LT+LV   S       +  G GN V YGL Q
Sbjct  23   SMAMDPLGSYCSGNSLAGSSKAVASINSVLTDLVTKGSTGVGFATSTAGKGNNVIYGLVQ  82

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGDVS+ DC +C+  AA +I   C  + D+RIWY+YCF+R+ ++ FFG+ DT  G++  
Sbjct  83   CRGDVSTSDCQACLASAANQILTSCNYQSDSRIWYDYCFMRFENENFFGQADTDNGVIME  142

Query  437  NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            NV  + + + F + +G ++   + +     + GLG+ K + + F+ +Y   QCTRDLSP+
Sbjct  143  NVQAMDNAKAFQKAVGKVMSKATAQVSQAGSGGLGRVKDQYTPFINIYGFAQCTRDLSPL  202

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNY  796
             CAQCL+ AV + F  +C  ++GCR+LYSSC VRYE+YPFYFPL     S+ A ++   Y
Sbjct  203  TCAQCLSTAV-SRFDQYCGAQQGCRILYSSCMVRYEIYPFYFPL---ATSSTATTDMTKY  258

Query  797  RSTVVH  814
              T+VH
Sbjct  259  TKTIVH  264



>gb|EAY89462.1| hypothetical protein OsI_10995 [Oryza sativa Indica Group]
Length=265

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 151/246 (61%), Gaps = 5/246 (2%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKV-YGLAQ  256
            + + DP G +C+  S   +S+   +I  +LT+LV   S       +  G GN V YGL Q
Sbjct  23   SMAMDPLGSYCSGNSLAGSSKAVASINSVLTDLVTKGSTGVGFATSTAGKGNNVIYGLVQ  82

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGDVS+ DC +C+  AA +I   C  + D+RIWY+YCF+R+ ++ FFG+ DT  G++  
Sbjct  83   CRGDVSTSDCQACLASAANQILTSCNYQSDSRIWYDYCFMRFENENFFGQADTDNGVIME  142

Query  437  NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            NV  + + + F + +G ++   + +     + GLG+ K + + F+ +Y   QCTRDLSP+
Sbjct  143  NVQAMDNAKAFQKAVGKVMSKATAQVSQAGSGGLGRVKDQYTPFINIYGFAQCTRDLSPL  202

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNY  796
             CAQCL+ AV + F  +C  ++GCR+LYSSC VRYE+YPFYFPL     S+ A ++   Y
Sbjct  203  TCAQCLSTAV-SRFDQYCGAQQGCRILYSSCMVRYEIYPFYFPL---AISSTATTDMTKY  258

Query  797  RSTVVH  814
              T+VH
Sbjct  259  TKTIVH  264



>emb|CDP03948.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 149/219 (68%), Gaps = 7/219 (3%)
 Frame = +2

Query  110  CNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCS  289
            C+  S    +Q S NI  L+  L  + S+  ++ A YG   +KVYGL QCRGDV+S DC+
Sbjct  90   CSDNSTIPTAQMSANIDSLVAELASSTSQNRFSIATYGKGTDKVYGLGQCRGDVNSTDCT  149

Query  290  SCIQEAAKEIRKRCPDRVDARIWY-EYCFLRYTDDEFFGEVD-TGYGILYANVANVTDPE  463
            +CIQ+AAK IR  C ++ DA +W  + C LR+ DD+FFG VD + +  LY N  +   P 
Sbjct  150  TCIQDAAKNIRTNCQNQTDAWLWQNDNCILRFDDDQFFGNVDPSSFANLYNN-DHPQHPS  208

Query  464  RFNEKLGNLVDGISKEAVVPENRGLGKGKT-KLSDFLTLYALVQCTRDLSPVNCAQCLAI  640
             F ++L  L+  +S EAVVP N GLG+GK+  ++   T+YAL QCTRDLS  +C++CL I
Sbjct  209  AFKKQLDALISKVSSEAVVPANEGLGRGKSFSVASNDTIYALTQCTRDLSRHSCSECLNI  268

Query  641  AVGNNFPGFCNDKK--GCRVLYSSCYVRYELYPFYFPLD  751
            A+G NFP FCN++K  GCRVLY SCYVRYE+YPFY+PLD
Sbjct  269  AIG-NFPKFCNNEKTVGCRVLYGSCYVRYEIYPFYYPLD  306



>ref|XP_006828414.1| hypothetical protein AMTR_s00060p00077910 [Amborella trichopoda]
 gb|ERM95830.1| hypothetical protein AMTR_s00060p00077910 [Amborella trichopoda]
Length=169

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 121/169 (72%), Gaps = 0/169 (0%)
 Frame = +2

Query  296  IQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPERFNE  475
            + ++AK+I + CP+  D RIW++ CFLRY  D+F GE+DTGYGI Y NV NVT+PERF +
Sbjct  1    MSDSAKQICQLCPNEADTRIWFDNCFLRYDTDDFIGELDTGYGIFYWNVENVTEPERFAK  60

Query  476  KLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNN  655
            +LG+L+D +  EAV P N G G GKTK S F+T+Y LVQCT+DL  + CAQCL+IA+ N 
Sbjct  61   ELGDLMDQVRAEAVEPGNEGFGSGKTKFSPFVTIYGLVQCTKDLPELRCAQCLSIAISNG  120

Query  656  FPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNYRS  802
               +C+ KKGC VLYSSC VR+E+YPF+ P      + + AS A  +++
Sbjct  121  SGSYCDGKKGCWVLYSSCCVRFEIYPFFLPPSSYTGNEIHASHAMYHKN  169



>gb|EMT26211.1| hypothetical protein F775_06000 [Aegilops tauschii]
Length=262

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 148/235 (63%), Gaps = 4/235 (2%)
 Frame = +2

Query  113  NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKV-YGLAQCRGDVSSKDCS  289
            N A          NI  +L +LV   S  G+A A  G   + V YGLAQCRGDVS+ DCS
Sbjct  30   NCAGTRYAGSGKANIDSVLADLVAKGSSGGFAMAVAGKGNSTVVYGLAQCRGDVSASDCS  89

Query  290  SCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPERF  469
            +C+ +AAK++   C  + DARIWY++CF+RY + +F G+ DTG G++  NV    DP+ F
Sbjct  90   ACLADAAKQLPAACSYQSDARIWYDFCFMRYDNTDFAGQSDTGAGVILVNVQAADDPKPF  149

Query  470  NEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVG  649
             + +G +++  + ++      GLG+ K + + F+T+Y L QCTRDL+P+ CAQC+++A+ 
Sbjct  150  KKAVGKVMNKATAQSSASGRAGLGRSKDQYTPFVTIYGLAQCTRDLAPLACAQCVSVAL-  208

Query  650  NNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNYRSTVVH  814
            + F  +C  ++GC++ YSSC VRYE+YPFYFPLD  +    A ++   Y   VVH
Sbjct  209  SKFGDYCGAQQGCQINYSSCRVRYEIYPFYFPLDGADGR--ATTDMTKYTKIVVH  261



>ref|NP_001049721.1| Os03g0277600 [Oryza sativa Japonica Group]
 gb|ABF95270.1| 33 kDa secretory protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11635.1| Os03g0277600 [Oryza sativa Japonica Group]
 gb|EAY89459.1| hypothetical protein OsI_10992 [Oryza sativa Indica Group]
 gb|EAY89461.1| hypothetical protein OsI_10994 [Oryza sativa Indica Group]
 gb|EAZ26451.1| hypothetical protein OsJ_10339 [Oryza sativa Japonica Group]
 dbj|BAG87917.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 151/247 (61%), Gaps = 4/247 (2%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKV-YGLAQ  256
            + + D  G +C+  S   NS+   +I  +LT+LV   S  G    +  G  N V YGLAQ
Sbjct  22   SMAMDSIGSYCSGNSLAGNSKAVASINSVLTDLVAKGSTGGGFATSSAGKANNVIYGLAQ  81

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGDVS+ DC +C+  AA +I   C  + D+RIWY+YCF+R+ ++ F G+ DT  G++  
Sbjct  82   CRGDVSTSDCQACLASAANQILTSCNYQSDSRIWYDYCFMRFENENFIGQTDTDAGVILV  141

Query  437  NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            NV  + + + F + +G ++   + +A    + GLG+ K + + F+ +Y L QCT+DLSP+
Sbjct  142  NVQAMDNGKAFQKAVGKVMGKATSQASQAGSGGLGRTKDQYTPFINIYGLAQCTQDLSPL  201

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNY  796
             CAQCL+ AV + F  +C  ++GC++ YSSC VRYE+YPFYFPL    +S  A ++   Y
Sbjct  202  ACAQCLSTAV-SRFGQYCGAQQGCQINYSSCRVRYEIYPFYFPLATSARS--ATTDMTKY  258

Query  797  RSTVVHK  817
               VVH+
Sbjct  259  TKIVVHR  265



>dbj|BAK01760.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01958.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ94653.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87136.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=264

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 128/192 (67%), Gaps = 2/192 (1%)
 Frame = +2

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTG  418
            VYGLAQCRGDVS+ DCS+C+ +AAK++   C    DA IWY++CF+RY + +F G  DTG
Sbjct  74   VYGLAQCRGDVSASDCSACLVDAAKQLPAACSYLSDAIIWYDFCFMRYDNTDFVGHSDTG  133

Query  419  YGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCT  598
             G++  NV    DP+ F   +G +++  + ++    + GLG+ K + + F+T+Y L QCT
Sbjct  134  AGVILVNVQAADDPKPFKTAVGKVMNKATAKSSASGSAGLGRSKYQYTPFVTIYGLAQCT  193

Query  599  RDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAA  778
            RDL+P+ CAQC+++A+ + F  +C  ++GC++ YSSC VRYE+YPFYFPLD       A 
Sbjct  194  RDLAPLACAQCVSVAL-SKFGDYCGAQQGCQINYSSCRVRYEIYPFYFPLDGAANGR-AT  251

Query  779  SEARNYRSTVVH  814
            ++   Y   VVH
Sbjct  252  TDMTKYTKIVVH  263



>gb|ACG28478.1| serine/threonine kinase-like protein [Zea mays]
Length=267

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 147/224 (66%), Gaps = 2/224 (1%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKV-YGLAQ  256
              + D  G +C+ +S   +S+   NI  +L +LV +AS  G    +  G GN + YGLAQ
Sbjct  23   GMAADSIGSYCSGSSYAGSSKAVANINSVLADLVASASSTGGYATSTAGKGNSIIYGLAQ  82

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGDVS+ DC+SC+ +AAK++   C    DARIWY+YCF+RY +  FFG+ DT  G++  
Sbjct  83   CRGDVSASDCASCLADAAKQLPSTCSYSSDARIWYDYCFMRYENANFFGQADTDAGVILV  142

Query  437  NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            NV  + +P+ F + +G ++   + +A    + GLG+ K + + F+++Y L QCTRDL+P+
Sbjct  143  NVQAMDNPKAFEKAVGKVMGKATAQASAAGSAGLGRDKEQYTPFVSIYGLAQCTRDLTPL  202

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
             CAQCL+ A+ + F  +C  ++GC++ YSSC VRYE+YPFYFPL
Sbjct  203  TCAQCLSTAL-SRFGDYCGAQQGCQINYSSCRVRYEIYPFYFPL  245



>gb|ACF85855.1| unknown [Zea mays]
 tpg|DAA44688.1| TPA: putative DUF26 domain family protein [Zea mays]
Length=268

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 147/225 (65%), Gaps = 3/225 (1%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNK--VYGLA  253
              + D  G +C+ +S   +S+   NI  +L +LV +AS  G    +  G GN   +YGLA
Sbjct  23   GMAADSIGSYCSGSSYAGSSKAVANINSVLADLVASASSTGGYATSTAGKGNNSIIYGLA  82

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
            QCRGDVS+ DC+SC+ +AAK++   C    DARIWY+YCF+RY +  FFG+ DT  G++ 
Sbjct  83   QCRGDVSASDCASCLADAAKQLPSTCSYSSDARIWYDYCFMRYENANFFGQADTDAGVIL  142

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             NV  + +P+ F + +G ++   + +A    + GLG+ K + + F+++Y L QCTRDL+P
Sbjct  143  VNVQAMDNPKAFEKAVGKVMGKATAQASAAGSAGLGRDKEQYTPFVSIYGLAQCTRDLAP  202

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
            + CAQCL+ A+ + F  +C  ++GC++ YSSC VRYE+YPFYFPL
Sbjct  203  LTCAQCLSTAL-SRFGDYCGAQQGCQINYSSCRVRYEIYPFYFPL  246



>gb|EMS54365.1| hypothetical protein TRIUR3_10430 [Triticum urartu]
Length=295

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/268 (38%), Positives = 147/268 (55%), Gaps = 37/268 (14%)
 Frame = +2

Query  113  NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKV-YGLAQCRGDVSSKDCS  289
            N A          NI  +L +LV   S  G+ATA  G   + V YGLAQCRGDVS+ DCS
Sbjct  30   NCAGTRYAGSGKANIDSVLADLVAKGSSGGFATAVAGKGNSTVVYGLAQCRGDVSASDCS  89

Query  290  SCIQEAAKEIRKRCPDRVDARIWY---------------------------------EYC  370
            SC+ +AAK++   C    DARIWY                                 ++C
Sbjct  90   SCLADAAKQLPTACSYLSDARIWYHFLSSYKFRTIDGYTCLIIWLSLAGLYVRACRYDFC  149

Query  371  FLRYTDDEFFGEVDTGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGK  550
            F+RY D +F G+ DTG G++  NV    DP+ F + +G +++  + +A      GLG+ K
Sbjct  150  FMRYDDTDFAGQSDTGAGVILVNVQAADDPKPFKKAVGKVMNKATAQASASGRAGLGRSK  209

Query  551  TKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELY  730
             + + F+T+Y L QCTRDL+P+ CAQC+++A+ + F  +C  ++GC++ YSSC VRYE+Y
Sbjct  210  DQYTPFVTIYGLAQCTRDLAPLACAQCVSVAL-SKFGDYCGAQQGCQINYSSCRVRYEIY  268

Query  731  PFYFPLDPPEKSTVAASEARNYRSTVVH  814
            PFYFPLD       A ++   Y   VVH
Sbjct  269  PFYFPLDGAGGR--ATTDMTKYTKIVVH  294



>ref|XP_008784712.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Phoenix 
dactylifera]
Length=226

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 140/226 (62%), Gaps = 17/226 (8%)
 Frame = +2

Query  74   FTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            F   +TD    +C  A+    SQ   NI  LL +LV  AS +G+AT+  G   + +YGLA
Sbjct  16   FCTAATDSIDQYC--ANSFNGSQIQANIDHLLPDLVANASVSGFATSYSGEGSDIIYGLA  73

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
            QCRGDVSS +CS+C+  AA ++   CP + DARIWY+YCF+RY ++ F G+ DTG+    
Sbjct  74   QCRGDVSSDNCSTCLTAAAMKLPTVCPGQADARIWYDYCFMRYDNENFTGKADTGHA---  130

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
                       F+++  +L+  +  EAV P + G   GKT+ +  +T+Y L QCT+DL P
Sbjct  131  -----------FDKEEESLMSRLKAEAVAPGSNGFATGKTEFTTDVTIYGLEQCTKDLQP  179

Query  614  VNCAQCLAIAVG-NNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
              CAQCL+ A+    FP  C  ++GC+VLYSSC VRYE+YPF+FPL
Sbjct  180  QMCAQCLSSALALAEFPDNCRFRRGCQVLYSSCVVRYEIYPFFFPL  225



>ref|NP_001060951.1| Os08g0136700 [Oryza sativa Japonica Group]
 gb|AAC36744.1| 33 kDa secretory protein [Oryza sativa Japonica Group]
 gb|AAC72363.1| 33 kDa secretory protein [Oryza sativa Japonica Group]
 gb|AAD13767.1| 33 kDa secretory protein [Oryza sativa Japonica Group]
 dbj|BAD03069.1| 33-kDa secretory protein [Oryza sativa Japonica Group]
 dbj|BAD16317.1| 33-kDa secretory protein [Oryza sativa Japonica Group]
 dbj|BAF22865.1| Os08g0136700 [Oryza sativa Japonica Group]
 gb|EAZ41445.1| hypothetical protein OsJ_25968 [Oryza sativa Japonica Group]
 dbj|BAG93694.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86875.1| 33kDa secretory protein [Oryza sativa Japonica Group]
Length=274

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 151/253 (60%), Gaps = 14/253 (6%)
 Frame = +2

Query  86   STDPSGLFCNTASKN---LNSQTST----NILKLLTNLVPaasragy-ataayggsgNKV  241
            +T P G FC+ +  N   LNS  +     ++  ++++LV  A   G  AT+  G   +  
Sbjct  26   TTYPIGSFCSESGMNYGDLNSSEAVVRRRSVNFVVSDLVAKARTGGGFATSRAGRGYDAF  85

Query  242  YGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT--  415
            YGLAQCRGDVS  DC +C+ +AAK+I   C    D+RIWYEYCF+RY + +F GEVDT  
Sbjct  86   YGLAQCRGDVSGGDCDACLAQAAKQIVSNCNYTSDSRIWYEYCFMRYYNYDFIGEVDTRE  145

Query  416  GYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQC  595
               +   N  N+ +P+ F +  G  +   + +AV     GLG+ K + + F+++YAL QC
Sbjct  146  DASVTMINWQNMDNPKAFQKAAGKAMGKATAQAVAVGRSGLGRAKEQYTPFVSVYALAQC  205

Query  596  TRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVA  775
            TRDL+P  CA+CL+  V + F   CN  +GC++ YSSC+ RYE+YPFYFPL+   ++T+ 
Sbjct  206  TRDLAPPACARCLSEIV-SKFDKTCNSAQGCQIDYSSCWARYEIYPFYFPLEAGSRATID  264

Query  776  ASEARNYRSTVVH  814
             S+   Y    +H
Sbjct  265  MSK---YTKVTMH  274



>gb|EAZ05518.1| hypothetical protein OsI_27735 [Oryza sativa Indica Group]
Length=274

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 102/255 (40%), Positives = 152/255 (60%), Gaps = 14/255 (5%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKN---LNSQTST----NILKLLTNLVPaasragy-ataayggsgN  235
            A +T P G FC+ +  N   LNS  +     ++  ++++LV  A   G  AT+  G   +
Sbjct  24   AATTYPIGSFCSESGMNYGDLNSSEAVVRRRSVNFVVSDLVAKARTGGGFATSRAGRGYD  83

Query  236  KVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
              YGLAQCRGDVS  DC +C+ +AAK++   C    D+RIWYEYCF+RY + +F GEVDT
Sbjct  84   AFYGLAQCRGDVSGGDCDACLAQAAKQMVSNCNYTSDSRIWYEYCFMRYYNYDFIGEVDT  143

Query  416  --GYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
                 +   N  N+ +P+ F +  G  +   + +AV     GLG+ K + + F+++YAL 
Sbjct  144  REDASVTMINWQNMDNPKAFQKAAGKAMGKATAQAVAVGRGGLGRAKEQYTPFVSVYALA  203

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKST  769
            QCTRDL+P  CA+CL+  V + F   CN  +GC++ YSSC+ RYE+YPFYFPL+   ++T
Sbjct  204  QCTRDLAPPACARCLSEIV-SKFDKTCNSAQGCQIDYSSCWARYEIYPFYFPLEAGSRAT  262

Query  770  VAASEARNYRSTVVH  814
            +  S+   Y    +H
Sbjct  263  IDMSK---YTKVTMH  274



>gb|EEC75106.1| hypothetical protein OsI_11281 [Oryza sativa Indica Group]
Length=249

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/253 (40%), Positives = 150/253 (59%), Gaps = 13/253 (5%)
 Frame = +2

Query  83   QSTDPSGLFCN---TASKNLNSQTST-NILKLLTNLVPaasragyataayggsgNKV-YG  247
             +TDP G +C+   T+   +N +T   +I  ++++LV  A+  G    +  G GN V YG
Sbjct  1    MATDPIGGYCSESGTSDAEINGKTRRRSINSVVSDLVAKAASNGGFATSSAGKGNNVFYG  60

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT--GY  421
            LAQCRGDVS+ DC +C+ EAA      C    D+R+WY+YCF+RY +  F G+VDT    
Sbjct  61   LAQCRGDVSASDCKACLVEAANYTLSFCHYASDSRMWYDYCFMRYKNANFIGQVDTRVDA  120

Query  422  GILYANVANVTDPERFNEKLGNLVDGISKEAVVPE--NRGLGKGKTKLSDFLTLYALVQC  595
             +      N+ +P+ F + +   +D    +AVV    +  LG+ K K   F+ +Y L QC
Sbjct  121  SVRIRKEENMDNPKTFQKVVAKTMDKAIAQAVVATAGSAALGRVKEKYMTFVNIYGLSQC  180

Query  596  TRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVA  775
            TRDL+P+ CAQCL+ AV ++F   CN  +GC++ YS+C+VRYE+YPFYFPL    ++T  
Sbjct  181  TRDLAPLACAQCLSTAV-SDFGDICNAAEGCQIEYSTCWVRYEIYPFYFPLKTDGRAT--  237

Query  776  ASEARNYRSTVVH  814
             ++   Y   VVH
Sbjct  238  -TDMTKYTKVVVH  249



>ref|XP_006649855.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Oryza 
brachyantha]
Length=267

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 149/249 (60%), Gaps = 7/249 (3%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNL--NSQTSTNILKLLTNLVPaasragyataayggsg-NKVYGL  250
            + + DP G +C+  S  L  NS+   +I  +LT+LV   S  G    +  G G N +YGL
Sbjct  23   SMAMDPIGSYCSGNSLGLAGNSKAVASINSVLTDLVSQGSAGGGFATSSAGKGPNVIYGL  82

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
            AQCRGDVS+ DC +C+  AA +I   C  + D+RIWY+YCF+RY ++ F G+ D+  G++
Sbjct  83   AQCRGDVSAGDCQACLASAANQILT-CNYQSDSRIWYDYCFMRYENENFIGQTDSDVGVI  141

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
              N   + + + F + +G +V   +  A    + GL + K + + F+T+Y L QCTRDL 
Sbjct  142  LVNTQTMDNGKAFQKAVGKVVGKATAAASAAGSGGLRRAKGQYTPFVTIYGLAQCTRDLL  201

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEAR  790
            P+ CAQCL+ AV + F  +C   +GC+V YSS  VRYE+YPFYFPL    ++  A ++  
Sbjct  202  PLACAQCLSTAV-SRFDDYCGALQGCQVNYSSYRVRYEIYPFYFPLATGVRT--ATTDMT  258

Query  791  NYRSTVVHK  817
             Y   VVH+
Sbjct  259  KYTKIVVHR  267



>ref|XP_004960510.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Setaria 
italica]
Length=288

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 134/222 (60%), Gaps = 5/222 (2%)
 Frame = +2

Query  86   STDPSGLFCNTASKNL-NSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCR  262
            + DP G +C   +KN   +QT  +I ++L  LVP AS A YATA  G   + ++GLAQCR
Sbjct  49   AVDPVGTYC---AKNFTGAQTQASISQVLAALVPRASAAYYATATAGSGSSAIWGLAQCR  105

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GD+ + DC+ CI  AAK+    C  + D R+WY+YCFLRYTD +F G  DTGY ++  N 
Sbjct  106  GDIPASDCALCISAAAKQAASSCRGQADVRLWYDYCFLRYTDADFLGLPDTGYTLILINT  165

Query  443  ANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNC  622
             N +DP  F+     L+  ++ EA    + GL +   +     T+Y L  CTRD++  +C
Sbjct  166  MNASDPAAFDRAERKLMARVAAEAGDAASGGLVRETARFGSATTIYGLGWCTRDITAADC  225

Query  623  AQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
              C+A AV    P +C  ++GCRVLYSSC  RYE YPF+FP+
Sbjct  226  GLCVAQAVA-ELPNYCQFRRGCRVLYSSCMARYETYPFFFPV  266



>ref|XP_003561775.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Brachypodium 
distachyon]
Length=274

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 126/198 (64%), Gaps = 7/198 (4%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++VYGLAQCRGDVS  DCS+C+ +AA+++   C    DARIWY+YCF+RY    F G+ D
Sbjct  79   DEVYGLAQCRGDVSGSDCSACLADAARQLPNLCGYGSDARIWYDYCFVRYLGTNFIGQAD  138

Query  413  TGYGILYANVANVTD-PERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
            TG G++Y NV    D P  F + +G  +   + +A    + GLG+ K   + F+ +Y L 
Sbjct  139  TGSGVVYVNVQAAADNPRAFAKSVGKALRKATAQA--SGSGGLGRAKELHTPFVVVYGLA  196

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCND--KKGCRVLYSSCYVRYELYPFYFPLDPPEK  763
            QCT DL+P+ CA+CL+  + + F  +C    + GC++ YSSC +RYE+YPFYFPLD  ++
Sbjct  197  QCTGDLAPLACARCLSETL-SRFGSYCGGGAQLGCQINYSSCRLRYEIYPFYFPLDDSDR  255

Query  764  STV-AASEARNYRSTVVH  814
            +    A++  NY   +VH
Sbjct  256  AGFRGATDTANYTKIIVH  273



>gb|EAZ05517.1| hypothetical protein OsI_27734 [Oryza sativa Indica Group]
Length=280

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 143/254 (56%), Gaps = 12/254 (5%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNLNSQTST-----NILKLLTNLVPaasragy-ataayggsgNK  238
            T  S  P G FC   S N  S         +I  ++++LV  A   G  AT++ G   + 
Sbjct  31   TTISMSPIGTFCWNPSYNEMSSDEAIARRRSINSVVSDLVAKARAGGGFATSSAGRGIDA  90

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD--  412
             YGLAQCRGDVS  DC +C+ +AAK++   C   +D+RIWYEYCF+RY D  FFGE+D  
Sbjct  91   FYGLAQCRGDVSGGDCDACLAQAAKQMVTNCNYTLDSRIWYEYCFMRYVDFNFFGEMDTR  150

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T   +      ++ +P  F + +G         AV   + GLG+ K + + F+ +YAL Q
Sbjct  151  TDASVTLRQWPDMDNPMAFQKAVGKATGKAVAHAVTMGSGGLGRAKEQCTSFVNVYALAQ  210

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTV  772
            CTRDL+P  CAQCL+  V + F   C   +GC++ YSSC+VRYE+YPFYFPL   E +  
Sbjct  211  CTRDLAPPLCAQCLSTTV-SKFAEACGSGQGCQIDYSSCWVRYEIYPFYFPL---EANRQ  266

Query  773  AASEARNYRSTVVH  814
            A ++   Y    +H
Sbjct  267  APTDLTKYTKVTMH  280



>gb|EEE68008.1| hypothetical protein OsJ_25967 [Oryza sativa Japonica Group]
Length=239

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 119/196 (61%), Gaps = 6/196 (3%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            +  YGLAQCRGDVS  DC +C+ +AAK++   C   +D+RIWYEYCF+RY D  FFGE+D
Sbjct  48   DAFYGLAQCRGDVSGGDCDACLAQAAKQMVTNCNYTLDSRIWYEYCFMRYVDFNFFGEMD  107

Query  413  --TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYAL  586
              T   +      ++ +P  F + +G         AV   + GLG+ K + + F+ +YAL
Sbjct  108  TRTDASVTLRQWPDMDNPMAFQKAVGKATGKAVAHAVTMGSGGLGRAKEQCTSFVNVYAL  167

Query  587  VQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKS  766
             QCTRDL+P  CAQCL+  V + F   C   +GC++ YSSC+VRYE+YPFYFPL   E +
Sbjct  168  AQCTRDLAPPLCAQCLSTTV-SKFAEACGSGQGCQIDYSSCWVRYEIYPFYFPL---EAN  223

Query  767  TVAASEARNYRSTVVH  814
              A ++   Y    +H
Sbjct  224  RQAPTDLTKYTKVTMH  239



>ref|NP_001060949.1| Os08g0136500 [Oryza sativa Japonica Group]
 dbj|BAD03067.1| putative 33-kDa secretory protein [Oryza sativa Japonica Group]
 dbj|BAD16315.1| putative 33-kDa secretory protein [Oryza sativa Japonica Group]
 dbj|BAF22863.1| Os08g0136500 [Oryza sativa Japonica Group]
 dbj|BAG87782.1| unnamed protein product [Oryza sativa Japonica Group]
Length=280

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 119/196 (61%), Gaps = 6/196 (3%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            +  YGLAQCRGDVS  DC +C+ +AAK++   C   +D+RIWYEYCF+RY D  FFGE+D
Sbjct  89   DAFYGLAQCRGDVSGGDCDACLAQAAKQMVTNCNYTLDSRIWYEYCFMRYVDFNFFGEMD  148

Query  413  --TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYAL  586
              T   +      ++ +P  F + +G         AV   + GLG+ K + + F+ +YAL
Sbjct  149  TRTDASVTLRQWPDMDNPMAFQKAVGKATGKAVAHAVTMGSGGLGRAKEQCTSFVNVYAL  208

Query  587  VQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKS  766
             QCTRDL+P  CAQCL+  V + F   C   +GC++ YSSC+VRYE+YPFYFPL   E +
Sbjct  209  AQCTRDLAPPLCAQCLSTTV-SKFAEACGSGQGCQIDYSSCWVRYEIYPFYFPL---EAN  264

Query  767  TVAASEARNYRSTVVH  814
              A ++   Y    +H
Sbjct  265  RQAPTDLTKYTKVTMH  280



>ref|NP_001060948.1| Os08g0136300 [Oryza sativa Japonica Group]
 gb|AAN32615.1|AF311908_1 33-kDa secretory protein [Oryza sativa Japonica Group]
 dbj|BAD03065.1| 33-kDa secretory protein [Oryza sativa Japonica Group]
 dbj|BAD16313.1| 33-kDa secretory protein [Oryza sativa Japonica Group]
 dbj|BAF22862.1| Os08g0136300 [Oryza sativa Japonica Group]
 gb|EAZ05515.1| hypothetical protein OsI_27733 [Oryza sativa Indica Group]
 gb|EAZ41442.1| hypothetical protein OsJ_25966 [Oryza sativa Japonica Group]
Length=275

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 121/196 (62%), Gaps = 6/196 (3%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            +  YGLAQCRGDVS  DC +C+ +AAK++   C    D+R+WYEYCF+RY +  F GEVD
Sbjct  84   DAFYGLAQCRGDVSGGDCDACLAQAAKQMVSYCNYTSDSRLWYEYCFMRYDNYNFLGEVD  143

Query  413  T--GYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYAL  586
            T     +      ++ +P+ F +  G  +   + +AV   + GLG+ K + + F+++YAL
Sbjct  144  TREDASVTMRQWPDMDNPKAFQKAAGKAMGKATAQAVAVGSSGLGRAKEQYTPFVSVYAL  203

Query  587  VQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKS  766
             QCTRDLSP +CAQCL+ AV + F   C    GC++ YSSC+ RYE+YPFYFPL    ++
Sbjct  204  AQCTRDLSPPSCAQCLSAAV-SKFDKACGSGPGCQIDYSSCWARYEIYPFYFPLAAAGRA  262

Query  767  TVAASEARNYRSTVVH  814
            T+   +   Y    VH
Sbjct  263  TI---DMTKYTKVTVH  275



>ref|XP_002465466.1| hypothetical protein SORBIDRAFT_01g039360 [Sorghum bicolor]
 gb|EER92464.1| hypothetical protein SORBIDRAFT_01g039360 [Sorghum bicolor]
Length=276

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 148/224 (66%), Gaps = 2/224 (1%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKV-YGLAQ  256
              + D  G +C+ +    +++  T+I  +L +LV  AS  G    +  G GN + YGLAQ
Sbjct  30   GMAADSIGSYCSGSRYAGSNKAVTSINSVLADLVATASTGGGYATSTAGKGNNIIYGLAQ  89

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGDVS+ DC++C+ +AAK++   C    DARIWY+YCF+RY + +FFG+ DTG G++  
Sbjct  90   CRGDVSASDCAACLADAAKQLPSTCSYSSDARIWYDYCFMRYENADFFGQADTGAGVILV  149

Query  437  NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            NV  + +P+ F + +G ++   + +A    + GLG+ K + + F+++Y L QCTRDL+P+
Sbjct  150  NVQAMDNPKAFEKAVGKVIGKATAQASAAGSAGLGRDKDQYTPFVSIYGLAQCTRDLAPL  209

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
             CAQCL+ AV + F  +C  ++GC++ YSSC VRYE+YPFYFPL
Sbjct  210  TCAQCLSTAV-SRFGDYCGAQQGCQINYSSCRVRYEIYPFYFPL  252



>dbj|BAK03405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=297

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 136/233 (58%), Gaps = 10/233 (4%)
 Frame = +2

Query  92   DPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDV  271
            D  G +C  A    +++T  +I ++L  LVP AS A YATA  G S + V+GLAQCRGDV
Sbjct  55   DAIGTYC--AKNGTSAETQASIDQVLAALVPRASAAYYATATAGRSSSAVWGLAQCRGDV  112

Query  272  SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV  451
              +DCS C+  AAKE+   C    D R++Y+YC LRY+   F G  DTGY ++  N  N 
Sbjct  113  PRQDCSLCLAAAAKEVASSCRGSSDGRVFYDYCLLRYSTANFIGLADTGYTLILLNTQNA  172

Query  452  T--DPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSD-----FLTLYALVQCTRDLS  610
            T  D   F+   G L+  ++ EA    N+GL    T+L         T+Y L  CTRD++
Sbjct  173  TGVDLAAFDRAQGKLMSRVASEAGDAANKGLATDTTRLGSDGGGAKTTIYGLGWCTRDIT  232

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKST  769
              +C  C+A AV    P +C  ++GCRV+YSSC  RYE+YPF+FPLD  +KS 
Sbjct  233  AADCGLCVAQAVA-ELPNYCRYRRGCRVIYSSCMARYEVYPFFFPLDGADKSA  284



>dbj|BAJ88159.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93055.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=276

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 136/233 (58%), Gaps = 10/233 (4%)
 Frame = +2

Query  92   DPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDV  271
            D  G +C  A    +++T  +I ++L  LVP AS A YATA  G S + V+GLAQCRGDV
Sbjct  34   DAIGTYC--AKNGTSAETQASIDQVLAALVPRASAAYYATATAGRSSSAVWGLAQCRGDV  91

Query  272  SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV  451
              +DCS C+  AAKE+   C    D R++Y+YC LRY+   F G  DTGY ++  N  N 
Sbjct  92   PRQDCSLCLAAAAKEVASSCRGSSDGRVFYDYCLLRYSTANFIGLADTGYTLILLNTQNA  151

Query  452  T--DPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSD-----FLTLYALVQCTRDLS  610
            T  D   F+   G L+  ++ EA    N+GL    T+L         T+Y L  CTRD++
Sbjct  152  TGVDLAAFDRAQGKLMSRVASEAGDAANKGLATDTTRLGSDGGGAKTTIYGLGWCTRDIT  211

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKST  769
              +C  C+A AV    P +C  ++GCRV+YSSC  RYE+YPF+FPLD  +KS 
Sbjct  212  AADCGLCVAQAVA-ELPNYCRYRRGCRVIYSSCMARYEVYPFFFPLDGADKSA  263



>dbj|BAJ99535.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=297

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 135/232 (58%), Gaps = 10/232 (4%)
 Frame = +2

Query  92   DPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDV  271
            D  G +C  A    +++T  +I ++L  LVP AS A YATA  G S + V+GLAQCRGDV
Sbjct  55   DAIGTYC--AKNGTSAETQASIDQVLAALVPRASAAYYATATAGRSSSAVWGLAQCRGDV  112

Query  272  SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV  451
              +DCS C+  AAKE+   C    D R++Y+YC LRY+   F G  DTGY ++  N  N 
Sbjct  113  PRQDCSLCLAAAAKEVASSCRGSSDGRVFYDYCLLRYSTANFIGLADTGYTLILLNTQNA  172

Query  452  T--DPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSD-----FLTLYALVQCTRDLS  610
            T  D   F+   G L+  ++ EA    N+GL    T+L         T+Y L  CTRD++
Sbjct  173  TGVDLAAFDRAQGKLMSRVASEAGDAANKGLATDTTRLGSDGGGAKTTIYGLGWCTRDIT  232

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKS  766
              +C  C+A AV    P +C  ++GCRV+YSSC  RYE+YPF+FPLD   KS
Sbjct  233  AADCGLCVAQAVA-ELPNYCRYRRGCRVIYSSCMARYEVYPFFFPLDGANKS  283



>gb|EMT06514.1| hypothetical protein F775_26971 [Aegilops tauschii]
Length=272

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 136/234 (58%), Gaps = 10/234 (4%)
 Frame = +2

Query  86   STDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRG  265
            + D  G +C  A    +++T  +I ++L  LVP AS A YA A  G S + V+GLAQCRG
Sbjct  27   AVDAIGTYC--AKNGTSAETQASIDRVLAALVPRASAAYYAPATAGRSSSAVWGLAQCRG  84

Query  266  DVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVA  445
            DV  +DCS C+  AA+E+   C    D R++Y+YC LRY+   F G  DTGY ++  N  
Sbjct  85   DVPRQDCSLCLAAAAQEVASSCRGSSDGRVFYDYCLLRYSTSNFVGLADTGYTLILLNTQ  144

Query  446  NVT--DPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSD-----FLTLYALVQCTRD  604
            N T  D   F+   G L+  ++ EA    N+GL    T+L         T+Y L  CTRD
Sbjct  145  NATGVDLAAFDRAQGKLMSRVASEAGDAANKGLATDTTRLGSEGGGAKTTIYGLGWCTRD  204

Query  605  LSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKS  766
            ++  +C  C+A AV    P +C  ++GCRV+YSSC  RYE+YPF+FPLD  ++S
Sbjct  205  ITAADCGLCVAQAVA-ELPNYCRYRRGCRVIYSSCMARYEVYPFFFPLDGADES  257



>ref|XP_010645253.1| PREDICTED: uncharacterized protein LOC100260018 [Vitis vinifera]
Length=334

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  377  RYTDDEFFGEVDTGYGILYANVANVT-DPERFNEKLGNLVDGISKEAVVPENRGLGKGKT  553
            RY++  F G++DT  GILY N  NVT + ERFNE+LG L++ I  +AV P N GLGKG+T
Sbjct  12   RYSNKGFIGKLDTRPGILYRNGDNVTIETERFNEELGKLMEKIGSQAVEPRNEGLGKGQT  71

Query  554  KLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYP  733
            KLS F+TLYAL QCTRDLS ++CAQCL+IAVG NFP FCN++KGCRVLYSSCY RYELYP
Sbjct  72   KLSPFVTLYALAQCTRDLSALSCAQCLSIAVG-NFPNFCNNRKGCRVLYSSCYTRYELYP  130

Query  734  FYFPLDPPEK  763
             +FPL   ++
Sbjct  131  IFFPLGSTQR  140



>ref|XP_004984745.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Setaria 
italica]
Length=265

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 144/223 (65%), Gaps = 1/223 (0%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQC  259
              + D  G +C   S   N++   +I  +L +LV  AS  GYAT+  G   N +YGLAQC
Sbjct  23   GMAADSIGSYCAGNSYAGNNKAVASINSVLADLVATASTGGYATSTAGKGNNVIYGLAQC  82

Query  260  RGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYAN  439
            RGDVS+ DC++C+ +AAK++   C    DARIWY+YCF+RY +  F G+ DT  G++  N
Sbjct  83   RGDVSAGDCAACLADAAKQLPATCSYSSDARIWYDYCFMRYENANFIGQADTDAGVILVN  142

Query  440  VANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVN  619
            V  + + + F + +G +V   + +A    + GLG+ K + + F+T+Y L QCTRDL+P+ 
Sbjct  143  VQGMDNAKAFEKAVGKVVGKAAAQASASGSGGLGRDKDQYTAFVTIYGLAQCTRDLAPLA  202

Query  620  CAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
            CAQCL+ AV + F  +C  ++GC++ YSSC VRYE+YPFYFPL
Sbjct  203  CAQCLSTAV-SRFGDYCRAQQGCQINYSSCRVRYEIYPFYFPL  244



>emb|CAN83911.1| hypothetical protein VITISV_000581 [Vitis vinifera]
Length=355

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  377  RYTDDEFFGEVDTGYGILYANVANVT-DPERFNEKLGNLVDGISKEAVVPENRGLGKGKT  553
            RY++  F G++DT  GILY N  NVT + ERFNE+LG L++ I  +AV P N GLGKG+T
Sbjct  12   RYSNKGFIGKLDTRPGILYRNGDNVTIETERFNEELGKLMEKIGSQAVEPRNEGLGKGQT  71

Query  554  KLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYP  733
            KLS F+TLYAL QCTRDLS ++CAQCL+IAVG NFP FCN++KGCRVLYSSCY RYELYP
Sbjct  72   KLSPFVTLYALAQCTRDLSALSCAQCLSIAVG-NFPNFCNNRKGCRVLYSSCYTRYELYP  130

Query  734  FYFPLDPPEK  763
             +FPL   ++
Sbjct  131  IFFPLGSTQR  140



>ref|NP_001054451.1| Os05g0112800 [Oryza sativa Japonica Group]
 gb|AAS75235.1| putative 33 kDa secretory protein [Oryza sativa Japonica Group]
 dbj|BAF16365.1| Os05g0112800 [Oryza sativa Japonica Group]
 dbj|BAG98381.1| unnamed protein product [Oryza sativa Japonica Group]
Length=272

 Score =   169 bits (429),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/246 (40%), Positives = 147/246 (60%), Gaps = 7/246 (3%)
 Frame = +2

Query  86   STDPSGLFCNTASKNLN-SQTSTNILKLLTNLVPaasragyataayggsgN--KVYGLAQ  256
            + DP   +C   ++NL+ +    ++ ++L+ LVP AS   YATA  G  G+   ++GLAQ
Sbjct  30   AVDPVNTYC---ARNLSGAPAQASVAQVLSELVPRASAGYYATATAGRGGDGSAIWGLAQ  86

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGD+ + DC+ C   AA+++   C  R DAR+WY+YCF RY D +F G  DTGY ++  
Sbjct  87   CRGDIPAPDCALCASAAARQLAGACRGRADARVWYDYCFARYDDADFVGLPDTGYALILL  146

Query  437  NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            N  N TDPE F +    ++  ++ +A      GL +   +  D +T+Y L  CTRD++  
Sbjct  147  NTQNATDPEAFEKAQRKVMARVAADAGDAGGGGLARETARFKDGVTIYGLGWCTRDITAA  206

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNY  796
            +C  C+A AV    P +C  ++GCRVLYSSC  RYE YPF+FPLD  + +  +AS A +Y
Sbjct  207  DCGLCVAQAVA-EMPNYCRFRRGCRVLYSSCMARYETYPFFFPLDGGQSADASASAAGDY  265

Query  797  RSTVVH  814
               V++
Sbjct  266  DRVVLN  271



>ref|XP_010241767.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Nelumbo 
nucifera]
Length=166

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 113/167 (68%), Gaps = 6/167 (4%)
 Frame = +2

Query  314  EIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPERFNEKLGNLV  493
            +IR+RCP++ +A  W++YCFLR+    F G+ D  +GI+Y NV N+T+P  F  KLG L+
Sbjct  2    QIRQRCPNQGEAWTWFDYCFLRFGIQSFTGKADVSFGIIYWNVQNITNPANFYLKLGALM  61

Query  494  DGISKEAVVPENRGL--GKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGF  667
            D + K+A+   + GL   KG   L+   TLYALVQCTRDLS + C +CL IA+ + F  F
Sbjct  62   DRVRKQALESSSVGLFGNKGVISLTSSETLYALVQCTRDLSKLQCGKCLDIAI-SQFSVF  120

Query  668  CNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNYRSTV  808
            C ++KGCRVLY SC+ +YELYPF+FPL     ST +AS A+  R+ +
Sbjct  121  CLNRKGCRVLYGSCFAQYELYPFFFPLS---NSTYSASSAKYLRAAI  164



>gb|EAY96288.1| hypothetical protein OsI_18186 [Oryza sativa Indica Group]
Length=272

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 98/246 (40%), Positives = 147/246 (60%), Gaps = 7/246 (3%)
 Frame = +2

Query  86   STDPSGLFCNTASKNLN-SQTSTNILKLLTNLVPaasragyataayggsgN--KVYGLAQ  256
            + DP   +C   ++NL+ +    ++ ++L+ LVP AS   YATA  G  G+   ++GLAQ
Sbjct  30   AVDPVNTYC---ARNLSGAPAQASVAQVLSELVPRASAGYYATATAGRGGDGSAIWGLAQ  86

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGD+ + DC+ C   AA+++   C  R DAR+WY+YCF RY D +F G  DTGY ++  
Sbjct  87   CRGDIPAPDCALCASAAARQLAGPCRGRADARVWYDYCFARYDDADFVGLPDTGYALILL  146

Query  437  NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            N  N TDPE F +    ++  ++ +A      GL +   +  D +T+Y L  CTRD++  
Sbjct  147  NTQNATDPEAFEKAQRKVMARVAADAGDAGGGGLARETARFKDGVTIYGLGWCTRDITAA  206

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNY  796
            +C  C+A AV    P +C  ++GCRVLYSSC  RYE YPF+FPLD  + +  +AS A +Y
Sbjct  207  DCGLCVAQAVA-EMPNYCRFRRGCRVLYSSCMARYETYPFFFPLDGGQSADASASAAGDY  265

Query  797  RSTVVH  814
               V++
Sbjct  266  DRVVLN  271



>gb|EAY96282.1| hypothetical protein OsI_18180 [Oryza sativa Indica Group]
Length=272

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 146/245 (60%), Gaps = 7/245 (3%)
 Frame = +2

Query  89   TDPSGLFCNTASKNLN-SQTSTNILKLLTNLVPaasragyataayggsgN--KVYGLAQC  259
             DP   +C   ++NL+ +    ++ ++L+ LVP AS   YATA  G  G+   ++GLAQC
Sbjct  31   VDPVNTYC---ARNLSGAPAQASVAQVLSELVPRASAGYYATATAGRGGDGSAIWGLAQC  87

Query  260  RGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYAN  439
            RGD+ + DC+ C   AA+++   C  R DAR+WY+YCF RY D +F G  DTGY ++  N
Sbjct  88   RGDIPAPDCALCASAAARQLAGACRGRADARVWYDYCFARYDDADFVGLPDTGYALILLN  147

Query  440  VANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVN  619
              N TDPE F +    ++  ++ +A      GL +   +  D +T+Y L  CTRD++  +
Sbjct  148  TQNATDPEAFEKAQRKVMARVAADAGDAGGGGLARETARFKDGVTIYGLGWCTRDITAAD  207

Query  620  CAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNYR  799
            C  C+A AV    P +C  ++GCRVLYSSC  RYE YPF+FPLD  + +  +AS A +Y 
Sbjct  208  CGLCVAQAVA-EMPNYCRFRRGCRVLYSSCMARYETYPFFFPLDGGQSADASASAAGDYD  266

Query  800  STVVH  814
              V++
Sbjct  267  RVVLN  271



>ref|NP_001060952.1| Os08g0136800 [Oryza sativa Japonica Group]
 dbj|BAD03070.1| putative 33 kDa secretory protein [Oryza sativa Japonica Group]
 dbj|BAF22866.1| Os08g0136800 [Oryza sativa Japonica Group]
 gb|EAZ05519.1| hypothetical protein OsI_27736 [Oryza sativa Indica Group]
 gb|EAZ41446.1| hypothetical protein OsJ_25969 [Oryza sativa Japonica Group]
 dbj|BAG88641.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86877.1| 33kDa secretory protein [Oryza sativa Japonica Group]
Length=276

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 146/258 (57%), Gaps = 15/258 (6%)
 Frame = +2

Query  74   FTAQSTDPSGLFCNTASKNLNSQTSTNILK-------LLTNLVPaasragyataayggsg  232
              A + DP G FC+    N     S+  +        ++++LV  A   G    +  G G
Sbjct  23   MAATTYDPIGSFCSETWMNYGDLNSSEAVTRRRAVNFVVSDLVAKARTGGGFATSKAGRG  82

Query  233  NKV-YGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLR-YTDDEFFGE  406
            ++V YGLAQCRGDVS  DC +C+ +AAK++   C    D+RIWYEYCF+R Y+   F G+
Sbjct  83   SEVFYGLAQCRGDVSGGDCDACLAQAAKQMVSNCNYTSDSRIWYEYCFMRYYSSYNFIGD  142

Query  407  VDT--GYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLY  580
            VDT     +      ++ +P+ F + +G  +   + +AV     GLG+ K + + F+++Y
Sbjct  143  VDTREDASVTLRRWPDMDNPKAFQKVVGKAMVKATTQAVSVGGNGLGRAKEQYTPFVSVY  202

Query  581  ALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPE  760
            AL QCTRDL+P  CAQCL+  V + F   C   +GC++ YSSC+ RYE+YPFYFPL+   
Sbjct  203  ALAQCTRDLAPPACAQCLSSTV-SKFDKACGAAQGCQIDYSSCWARYEIYPFYFPLEANG  261

Query  761  KSTVAASEARNYRSTVVH  814
            ++T+   +   Y    +H
Sbjct  262  RATI---DMNKYTKVTMH  276



>gb|EMT06513.1| hypothetical protein F775_12194 [Aegilops tauschii]
Length=271

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 130/223 (58%), Gaps = 8/223 (4%)
 Frame = +2

Query  119  ASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCSSCI  298
            A    ++QT  +I ++LT LVP AS A YATA  G S + V+GLAQCRGDV  +DCS C+
Sbjct  36   AKNGTSAQTQASIDQVLTALVPRASAAYYATATAGRSSSAVWGLAQCRGDVPRQDCSLCL  95

Query  299  QEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVT--DPERFN  472
              AAKE+   C    D R++Y+YC LRY+   F G  DTGY ++  N  N T  D   F+
Sbjct  96   AAAAKEVASSCRGSSDGRVFYDYCLLRYSSSNFIGLADTGYTLILLNTQNATGVDLAAFD  155

Query  473  EKLGNLVDGISKEAVVPENRGLGKGKTKLSDF-----LTLYALVQCTRDLSPVNCAQCLA  637
               G L+  ++ EA    N+GL    T+L         T+Y L  CTRD++  +   C+A
Sbjct  156  RAQGKLMSRVASEARDTANKGLATDTTRLGGGGGGAKTTIYGLGWCTRDITAADSGLCVA  215

Query  638  IAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKS  766
             AV    P +C  ++GCRV+YSSC  RYE+YPF+FPL    +S
Sbjct  216  QAVA-ELPNYCRYRRGCRVIYSSCMARYEVYPFFFPLGGARES  257



>ref|XP_008391617.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=242

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 110/168 (65%), Gaps = 1/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+V GLA CRGDVSSKDC++C+ +A+K++R+ CP R  A IWY++C L+Y+D  FFG++D
Sbjct  73   NQVNGLALCRGDVSSKDCNTCVVDASKDLRELCPSRKGAIIWYDHCLLKYSDVGFFGQID  132

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T       NV  V +   FNEK+  L+ G+S EA     +    G+ +L  F TLY L Q
Sbjct  133  TNNRFYLYNVQEVENGTVFNEKVKELLSGLSNEASEDNQKFYATGEVQLDTFTTLYGLAQ  192

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CTRDLS V+C +CL  A+G   P  CN K+G RV+  SC VR+ELYP 
Sbjct  193  CTRDLSGVDCKKCLDSAIG-ELPNCCNAKRGGRVVGGSCNVRFELYPI  239



>ref|XP_002440468.1| hypothetical protein SORBIDRAFT_09g001430 [Sorghum bicolor]
 gb|EES18898.1| hypothetical protein SORBIDRAFT_09g001430 [Sorghum bicolor]
Length=302

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 146/249 (59%), Gaps = 9/249 (4%)
 Frame = +2

Query  86   STDPSGLFCNTASKNL-NSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCR  262
            + DP   +C   +KN    QT  +I  +L  LVP AS A YATA  G  G+ ++GLAQCR
Sbjct  58   AVDPVSTYC---AKNFTGGQTQASISSVLATLVPRASTAYYATAMAGTGGSTIWGLAQCR  114

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GD+SS DC+ C+  AA+++   C  + DAR+WY+YCFLRY D +F G  DTG+ ++  N 
Sbjct  115  GDISSSDCARCLAAAARQVASSCRGQADARVWYDYCFLRYDDADFVGLPDTGHTLILINT  174

Query  443  ANVT-DPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKL-SDFLTLYALVQCTRDLSPV  616
             N T D   F+    +L+  +++ A  P + GL +   K  S+  T+Y L  CTRD++  
Sbjct  175  MNATGDLAAFDRAERSLMARVAETAGDPASAGLARKTAKFGSEGTTIYGLGWCTRDIAAA  234

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASEARNY  796
            +C  C+A AV    P +C  ++GCRVLYSSC  RYE YPF+FP+   +    AAS     
Sbjct  235  DCGLCVAQAVA-ELPNYCRFRRGCRVLYSSCMARYETYPFFFPVTGDDDDVAAASSHAGE  293

Query  797  RSTVV--HK  817
              TV+  HK
Sbjct  294  YETVILNHK  302



>ref|XP_008342465.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=242

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 110/168 (65%), Gaps = 1/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+V GLA CRGDVSSKDC++C+ +A+KEIR+RCP R  A IWY++C L+Y+D  FFG++D
Sbjct  73   NQVNGLALCRGDVSSKDCNTCVVDASKEIRERCPYRKGAIIWYDHCLLKYSDVSFFGQID  132

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            +       NV  V +   FNEK+  L+ G+S EA     +    G+ +L  F TLY + Q
Sbjct  133  SRNRFYMWNVQEVENGTLFNEKVKELLSGLSNEASEANQKLYATGEVQLDTFTTLYGIAQ  192

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CTRDLS V+C +CL  A+ +  P  C+ K+G RV+  SC  RYELYP 
Sbjct  193  CTRDLSGVDCKKCLDSAI-SELPNCCDAKRGGRVVGGSCNFRYELYPI  239



>emb|CDP12548.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 133/237 (56%), Gaps = 9/237 (4%)
 Frame = +2

Query  65   CTIFTAQSTDPSGLF----CNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsg  232
            CT   A     SG+     C+  S     Q S NI  L+  L  + S+  ++ A YG   
Sbjct  16   CTAVLADVLIDSGVVSVYSCSENSTIATPQMSANIDSLVAQLTSSTSQNRFSVATYGKGT  75

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWY-EYCFLRYTDDEFFGEV  409
            ++VYGL QCR DV+ KDC+ C++ A   IR  C +R D  +WY + C LR+ D +FFG V
Sbjct  76   DQVYGLGQCRRDVNIKDCARCLRNATLSIRTFCANRADVWMWYNDTCTLRFHDSKFFGTV  135

Query  410  DTGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKT-KLSDFLTLYAL  586
            D      Y    +   P  F ++L  L+  +S EA+VP N  +GKG +  ++   T+YAL
Sbjct  136  DPSSFTNYYLGDHPQHPSAFKKQLDALISKVSSEAIVPANEAVGKGSSFSVASNATIYAL  195

Query  587  VQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKK--GCRVLYSSCYVRYELYPFYFPLD  751
             QCTRDLS  +C +CL I  G N   FCN++K  GCRV  ++CYV YE Y FY+PLD
Sbjct  196  AQCTRDLSQHSCNECLNIVTG-NLLKFCNNEKTVGCRVASTACYVHYETYQFYYPLD  251



>ref|XP_002533057.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29327.1| conserved hypothetical protein [Ricinus communis]
Length=176

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 106/162 (65%), Gaps = 27/162 (17%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            +KVYGLAQCRGDVS  +CS C+ EAAK+IR+ C ++ D+RIWY+YCFLR +         
Sbjct  42   DKVYGLAQCRGDVSKANCSRCLHEAAKDIRQACRNQPDSRIWYDYCFLRLSS--------  93

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
                              FN+K+ +++D I  +A VP+++GLGK +TKLS  +TLY LV 
Sbjct  94   ------------------FNQKVSSVMDKIKSQAAVPKSKGLGKMETKLSPSVTLYTLVH  135

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVR  718
            CT DL+   C +C+  A+  +FP +C ++KGC+VLYS+CYVR
Sbjct  136  CTGDLTAAKCTKCITKALA-HFPKYCTNRKGCKVLYSNCYVR  176



>ref|XP_002274668.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=242

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 137/221 (62%), Gaps = 3/221 (1%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNLNSQT-STNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            T   TDP   FC+++ K +++ T  TN+ KL+  L  AA   G+   + G + ++V GLA
Sbjct  21   TIAGTDPLYHFCSSSQKFIDNGTYETNLNKLMGYLYLAAPPTGFRKGSVGENNDQVNGLA  80

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVS+ DC +CI E++ EIRKRCPD   A IWY+YC L+Y++  FFG+VD       
Sbjct  81   LCRGDVSNTDCKACITESSSEIRKRCPDNKAAIIWYDYCLLKYSNVNFFGQVDHQNMFYM  140

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             N+ NV+DP+ FN+K   L+  ++++A     +    G+ +L +   LY L QCTRDLS 
Sbjct  141  WNLNNVSDPDSFNQKTKELLSNLAQQAFNAM-KMYATGELELEESEKLYGLTQCTRDLSS  199

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             +C +CL  A+ +  P  C+ K+G RV+  SC +RYE+YPF
Sbjct  200  SDCKKCLDDAI-SKLPNCCDGKEGGRVVGGSCNIRYEIYPF  239



>ref|XP_010051179.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89432.1| hypothetical protein EUGRSUZ_A01731 [Eucalyptus grandis]
Length=240

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 124/222 (56%), Gaps = 5/222 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
             A   DP   FC+T       S   +N+ KL + L      +G+   + G   ++VYGLA
Sbjct  19   AALGADPLFHFCSTPENFTAGSPYESNLNKLTSFLYTKTPSSGFGLGSIGQYQDQVYGLA  78

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGD+S  DC + + +A  EIR+RCP    A IWY+ C  +Y D +FFG++D       
Sbjct  79   LCRGDISPSDCKAFVADAGAEIRRRCPHNKGAIIWYDDCMFKYLDTDFFGQIDNANKFYM  138

Query  434  ANVANVTDPERFNEKLGNLVDGISKEA-VVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
             N+ NV+DPE FN K+  L+ G+ +EA  VP  +    G+  L D   LY LVQCTRDLS
Sbjct  139  WNLKNVSDPEPFNGKVRGLLTGLVEEAYTVP--KLYATGEMGLEDKTKLYGLVQCTRDLS  196

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
               C +CL  A+G   P  C+ K+G RV+  SC  RYE+YPF
Sbjct  197  ATECKECLEGAIG-ELPSCCDGKEGGRVVGGSCNFRYEIYPF  237



>ref|XP_010051171.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89430.1| hypothetical protein EUGRSUZ_A01729 [Eucalyptus grandis]
Length=240

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/219 (41%), Positives = 122/219 (56%), Gaps = 5/219 (2%)
 Frame = +2

Query  86   STDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCR  262
              DP   FC+++      S   +N+ KL + L      +G+   + G   ++VYGLA CR
Sbjct  22   GADPLSHFCSSSENFTAGSPYESNLNKLTSFLYTKTPSSGFGLGSIGQYQDQVYGLALCR  81

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GD S  DC +C+ +A  EIR+RCP    A IWY+ C  +Y D EFFG++D        NV
Sbjct  82   GDTSPSDCKACVADAGAEIRRRCPHNKGAIIWYDNCMFKYLDTEFFGQIDNANKFYMWNV  141

Query  443  ANVTDPERFNEKLGNLVDGISKEA-VVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVN  619
             NV+ PE FN ++  L+ G+ +EA  VP  +    G+  L D   LY LVQCTRDLS   
Sbjct  142  NNVSHPEAFNGRVRGLLTGLVEEAYTVP--KLYATGEMGLEDKTKLYGLVQCTRDLSATE  199

Query  620  CAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            C +CL  A+G   P  C+ K+G RV+  SC   YE+YPF
Sbjct  200  CKECLEGAIG-ELPSCCDGKEGGRVVGGSCNFVYEIYPF  237



>ref|XP_002274604.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=242

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 136/221 (62%), Gaps = 3/221 (1%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNLNSQT-STNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            T   TDP   FC+++ K +++ T  TN+ KL+  L  AA   G+   + G   +KV GLA
Sbjct  21   TIVGTDPLFHFCSSSEKFIDNGTYETNLNKLMGYLYLAAPPTGFGKGSVGEKNDKVNGLA  80

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVS+ DC +CI E++ EIRKRCPD   A IWY+YC L+Y++  FFG+V        
Sbjct  81   LCRGDVSNTDCKACITESSGEIRKRCPDNKAAIIWYDYCLLKYSNVNFFGQVAYQNRFYM  140

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             N+ NV+DP  FN+K   L+  ++++A +  ++    G+ +L +   LY L QCTRDLS 
Sbjct  141  WNLNNVSDPASFNQKTKELLSNLAQKAFI-NSKMYATGELELEESEKLYGLTQCTRDLSS  199

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             +C +CL  A+ +  P  C+ K+G RV+  SC +RYE+YPF
Sbjct  200  SDCKKCLDDAI-SELPNCCDGKEGGRVVGGSCNIRYEIYPF  239



>gb|KHN36561.1| Cysteine-rich repeat secretory protein 38 [Glycine soja]
Length=244

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 126/222 (57%), Gaps = 4/222 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgN-KVYGL  250
            T+   DP   FC N+ +   NS   +N+  L+ +L+      G+   + G   N K Y L
Sbjct  22   TSFGADPLFHFCSNSENFTANSPYESNLKTLINSLIYKTPSTGFGVGSVGQYQNQKAYAL  81

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
            A CRGDVS+ +C +C+ EA KEI  RCP    A IWY+YC  +Y D +F G++D      
Sbjct  82   ALCRGDVSASECKTCVSEAPKEILSRCPYNKGAIIWYDYCMFKYLDTDFLGKIDNTNKFY  141

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
              N+ NV+DP  FN K   L+  ++++A V  N+    G+ KL +  TLY L QCTRDLS
Sbjct  142  MWNLKNVSDPATFNYKTRELLSQLAQKAYV-NNKLYATGEAKLENSETLYGLTQCTRDLS  200

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
              +C +CL  A+ N  P  C+ K+G RV+  SC  RYE+YPF
Sbjct  201  SSDCKKCLDDAI-NELPNCCDGKEGGRVVSGSCNFRYEIYPF  241



>ref|XP_008237024.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=243

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 108/169 (64%), Gaps = 2/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+V GLA CRGDV S++CS+C+  A+KE+R+RCP    A IWY++C L+Y+D  FFG++D
Sbjct  73   NQVNGLALCRGDVLSQNCSTCVIGASKELRERCPYSKGAIIWYDHCLLKYSDVNFFGKID  132

Query  413  TGYGILYANVANV-TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
                    NV  V  +P  FNEK+  L+ G+S EA     +    G+ +L  F TLY + 
Sbjct  133  NKNKFSMTNVQAVENNPTLFNEKVKELLSGLSNEASDANQKFYATGEVQLDTFTTLYGIA  192

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            QCTRDLS VNC +CL +A+ +  P  C+ K+G RV+  SC V +ELYP 
Sbjct  193  QCTRDLSNVNCKKCLNVAI-SELPNCCDAKRGGRVVGGSCNVGFELYPI  240



>ref|XP_008237025.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=243

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 109/169 (64%), Gaps = 2/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+V GLA CRGDVSSK+C++C+  A+KE+R+RCP    A IWY++C L+Y+D  FFG++D
Sbjct  73   NQVNGLALCRGDVSSKNCNTCVIGASKELRERCPYSKGAVIWYDHCLLKYSDVNFFGQID  132

Query  413  TGYGILYANVANV-TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
                   ANV  V  +   FNEK+  L+ G+S EA     +    G+ +L  F TLY + 
Sbjct  133  NRNKFSMANVQAVENNTTLFNEKVKELLSGLSNEASDANPKFYATGEVQLDTFTTLYGIA  192

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            QCTRDLS VNC +CL +A+ +  P  C+ K+G RV+  SC V +ELYP 
Sbjct  193  QCTRDLSNVNCKKCLDVAI-SELPNCCDAKRGGRVVGGSCNVGFELYPI  240



>ref|XP_007149948.1| hypothetical protein PHAVU_005G112800g [Phaseolus vulgaris]
 gb|ESW21942.1| hypothetical protein PHAVU_005G112800g [Phaseolus vulgaris]
Length=253

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 133/222 (60%), Gaps = 4/222 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKV-YGL  250
            T+   DP   FC N+ +   NS   +N+  L+ +L+      G+  A+ G + N++ +GL
Sbjct  31   TSFGADPLFHFCSNSQNFTANSPYESNLKTLINSLIYKTPSTGFGVASVGQNQNQMAHGL  90

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
            A CRGDVS+ +C +C+ EA KEI  RCP    A IWY+YC  +Y+D +FFG++D      
Sbjct  91   ALCRGDVSASECKTCVSEAPKEILNRCPYNKGAIIWYDYCMFKYSDTDFFGKIDYSNRFY  150

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
              N+ +V+DP  FN K   L+  ++++A V +N+    G+  L + +TLY L QCTRDLS
Sbjct  151  MWNLKSVSDPSSFNYKTKELLSKLAEKAYV-DNKLYASGEQYLENSVTLYGLTQCTRDLS  209

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
              +C +CL  A+ +  P  C+ K+G RV+  SC  RYE+YPF
Sbjct  210  SNDCKKCLDDAI-DELPSCCDGKEGGRVVSGSCNFRYEIYPF  250



>ref|XP_010069655.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89428.1| hypothetical protein EUGRSUZ_A01727 [Eucalyptus grandis]
Length=240

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 122/217 (56%), Gaps = 5/217 (2%)
 Frame = +2

Query  92   DPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGD  268
            DP   FC+++      S   +N+ KL + L      +G+   +     ++VYGLA CRGD
Sbjct  24   DPLSHFCSSSENFTAGSPYESNLNKLTSFLYTKTPSSGFGLGSIRQYQDQVYGLALCRGD  83

Query  269  VSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVAN  448
             S  DC +C+ +A  EIR+RCP    A IWY+ C ++Y D +FFG++D        NV N
Sbjct  84   TSPSDCKACVADAGAEIRRRCPRNKGAIIWYDNCMIKYLDTDFFGQIDNANKFYMWNVNN  143

Query  449  VTDPERFNEKLGNLVDGISKEA-VVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCA  625
            V+ PE FN ++  L+ G+ +EA  VP  +    G+  L D   LY LVQCTRDLS   C 
Sbjct  144  VSYPEAFNGRVRGLLTGLVEEAYTVP--KLYATGEMGLEDKTKLYGLVQCTRDLSATECK  201

Query  626  QCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            +CL  A+G   P  C+ K+G RV+  SC   YE+YPF
Sbjct  202  ECLEGAIG-ELPSCCDGKEGGRVVGGSCNFGYEIYPF  237



>gb|AFW74942.1| putative DUF26 domain family protein [Zea mays]
Length=302

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 134/230 (58%), Gaps = 17/230 (7%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNLN-SQTSTNILKLLTNLVPaasragyataayggsgNK--VYGL  250
            + + DP G +C   +KN   +QT  +I ++L  LVP AS A YATA   G G    ++GL
Sbjct  55   SSAVDPVGTYC---AKNFTGAQTQASIAQVLAALVPRASAAYYATATAAGGGGSATIWGL  111

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
            AQCRGDV + DC+ C+  AA++    C  + DAR+WY+YCFLRY D +F G  DTGY ++
Sbjct  112  AQCRGDVPASDCALCVAAAARQAAASCRGQADARVWYDYCFLRYDDADFLGLPDTGYALI  171

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVP----ENRGLGKGKTKLSDFLTLYALVQCT  598
              N  N TDP  F+     L+  ++ +A       E    G      SD  T+Y L  CT
Sbjct  172  LINTMNATDPAAFDRAERRLMARVAADAASAGLARETARFG------SDGTTIYGLGWCT  225

Query  599  RDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
            RD++  +C  C+A AV    P +C  ++GCRVLYSSC  RYE YPF+FP+
Sbjct  226  RDITAADCGLCVAQAVA-ELPNYCRFRRGCRVLYSSCMARYETYPFFFPV  274



>ref|XP_006469729.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
 gb|KDO59871.1| hypothetical protein CISIN_1g025954mg [Citrus sinensis]
Length=245

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 129/222 (58%), Gaps = 5/222 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            TA   DP   FC+++     N    TN+ KL+  L   A   G+   A G   NK YGLA
Sbjct  24   TAFGVDPLFHFCSSSENFTANGPYETNLNKLIGYLDYQAPPTGFGKGALGQRPNKAYGLA  83

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVSS DC +CI +A+ EIRKRCP    A IWY+ C L+YT+ EFFG++D       
Sbjct  84   LCRGDVSSSDCKTCIVDASGEIRKRCPYNKAAIIWYDNCLLKYTNTEFFGQIDNKNKFYM  143

Query  434  ANVANVTDPERFNEKLGNLVDGISKEA-VVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
             NV  VT+P  FN++   L+  ++++A V P+   +G+ +   S+   LY L QCTRDLS
Sbjct  144  WNVRVVTEPVSFNQRTKELLTQLAEKAYVTPKLYAVGEMELGKSN--KLYGLTQCTRDLS  201

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             V+C +CL   +    P  C+ K+G RV+  SC  RYE+YPF
Sbjct  202  SVDCKKCLD-GIIRELPSCCDGKEGGRVVSGSCNFRYEIYPF  242



>ref|NP_001147502.1| protein kinase precursor [Zea mays]
 gb|ACG27750.1| protein kinase [Zea mays]
Length=271

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 134/230 (58%), Gaps = 17/230 (7%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNLN-SQTSTNILKLLTNLVP--aasragyataayggsgNKVYGL  250
            + + DP G +C   +KN   +QT  +I ++L  LVP  +A+    ATAA GG    ++GL
Sbjct  24   SSAVDPVGTYC---AKNFTGAQTQASIAQVLAALVPRASAAYYATATAAGGGGSATIWGL  80

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
            AQCRGDV + DC+ C+  AA++    C  + DAR+WY+YCFLRY D +F G  DTGY ++
Sbjct  81   AQCRGDVPASDCALCVAAAARQAAASCRGQADARVWYDYCFLRYDDADFLGLPDTGYALI  140

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVP----ENRGLGKGKTKLSDFLTLYALVQCT  598
              N  N TDP  F+     L+  ++ +A       E    G      SD  T+Y L  CT
Sbjct  141  LINTMNATDPAAFDRAERRLMARVAADAASAGLARETARFG------SDGTTIYGLGWCT  194

Query  599  RDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPL  748
            RD++  +C  C+A AV    P +C  ++GCRVLYSSC  RYE YPF+FP+
Sbjct  195  RDITAADCGLCVAQAVA-ELPNYCRFRRGCRVLYSSCMARYETYPFFFPV  243



>ref|XP_003543377.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Glycine 
max]
Length=244

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 126/222 (57%), Gaps = 4/222 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgN-KVYGL  250
            T+   DP   FC N+ +   NS   +N+  L+ +L+      G+   + G   N K Y L
Sbjct  22   TSFGADPLFHFCSNSENFTANSPYESNLKTLINSLIYKTPSTGFGVGSVGQYQNQKAYAL  81

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
            A CRGDVS+ +C +C+ EA KEI  RCP    A IWY+YC  +Y D +F G++D      
Sbjct  82   ALCRGDVSASECKTCVSEAPKEILSRCPYNKGAIIWYDYCMFKYLDTDFLGKIDNTNKFY  141

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
              N+ NV+DP  FN    +L+  ++++A V  N+    G+ KL +  TLY L QCTRDLS
Sbjct  142  MWNLKNVSDPATFNYNTRDLLSQLAQKAYV-NNKLYATGEAKLENSETLYGLTQCTRDLS  200

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
              +C +CL  A+ N  P  C+ K+G RV+  SC  RYE+YPF
Sbjct  201  SSDCKKCLDDAI-NELPNCCDGKEGGRVVSGSCNFRYEIYPF  241



>ref|XP_002274745.2| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=243

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 130/221 (59%), Gaps = 3/221 (1%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNL-NSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            T    DP   FC+++ K + N    TN+ KL+  L  AA   G    + G + ++V GLA
Sbjct  21   TVVGVDPLFHFCSSSEKFIDNGPYETNLNKLMGYLYLAAPPTGSGKGSVGQNHDQVNGLA  80

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVS+ DC  CI EA+ EIRK CPD   A +WY++C L+Y++  FFG+VD       
Sbjct  81   LCRGDVSNTDCKDCITEASTEIRKLCPDNKAAIVWYDHCLLKYSNMNFFGQVDYQNRFYM  140

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             N+ NV+ P  FN+K   L+  ++++  V + +    G+ +L +   LY L QCTRDLS 
Sbjct  141  WNLNNVSYPTSFNQKTKELLSHLAQQGFVNQ-KMYAVGELELEESKKLYGLTQCTRDLSS  199

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             +C +CL  A+ +  P  C+ K+G RV+  SC +RYE+YPF
Sbjct  200  SDCKKCLDDAI-SELPSCCDGKEGGRVVGGSCNIRYEIYPF  239



>ref|XP_007024474.1| Receptor-like protein kinase-related family protein [Theobroma 
cacao]
 gb|EOY27096.1| Receptor-like protein kinase-related family protein [Theobroma 
cacao]
Length=242

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+ YGLA CRGDVS+ DC +CI EA  EIRKRCP    A IWY+ C L+Y++ EFFG++D
Sbjct  74   NQAYGLALCRGDVSTPDCKTCIVEAGSEIRKRCPSNKGAIIWYDNCLLKYSNTEFFGQID  133

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
                    N+ +V+DP+ FN+K   L+  ++ EA     +    G+T+L     LY L Q
Sbjct  134  NRNKFYMWNLRDVSDPQSFNQKTKELLSQLANEAYATP-KLYATGETELYGSQKLYGLTQ  192

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CTRDLS  +C +CL   +G   P  C+ K+G RV+  SC  RYE+YPF
Sbjct  193  CTRDLSSSDCKKCLDGIIG-ELPSCCDGKEGGRVVGGSCNFRYEIYPF  239



>ref|XP_010684085.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Beta 
vulgaris subsp. vulgaris]
Length=243

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 105/169 (62%), Gaps = 3/169 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++VYGLA CRGDV+S DC++C+ +A  EIRKRCP      IWY+ CFL+Y D  FFG++D
Sbjct  74   SQVYGLALCRGDVNSTDCTTCVYDARTEIRKRCPYNKGGIIWYDNCFLKYIDQNFFGQID  133

Query  413  TGYGILYANVANVTD-PERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
                   +NVAN+++ P  FN+K+  L+  ++ E+     +    G+ KL  F  LY L 
Sbjct  134  NKNEFQLSNVANISNAPSLFNQKVKGLLSQLANESASAR-KLYAAGEMKLDTFTNLYGLA  192

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            QCTRDLS  NC  CL  A+ N  P  C+  +G R +  SC VRYE+YPF
Sbjct  193  QCTRDLSSKNCKICLDEAI-NKLPTCCDGSQGGRTVGGSCNVRYEIYPF  240



>ref|XP_008236988.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=243

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 108/169 (64%), Gaps = 2/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+  GLA CRGDVSSK+C++C+  A+KE+R+RCP    A IWY++C L+Y+D  FFG++D
Sbjct  73   NQANGLALCRGDVSSKNCNTCVIGASKELRERCPYSKGAVIWYDHCLLKYSDVNFFGQID  132

Query  413  TGYGILYANVANV-TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
                   ANV  V  +   FNEK+  L+ G+S EA     +    G+ +L  F TLY + 
Sbjct  133  NRNKFSMANVQAVENNTTLFNEKVKELLSGLSNEASDANPKFYATGEVQLDTFTTLYGIA  192

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            QCTRDLS VNC +CL +A+ +  P  C+ K+G R++  SC V +ELYP 
Sbjct  193  QCTRDLSNVNCKKCLDVAI-SELPNCCDAKRGGRIVGGSCNVGFELYPI  240



>emb|CBI28973.3| unnamed protein product [Vitis vinifera]
Length=266

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 130/221 (59%), Gaps = 3/221 (1%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASKNL-NSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            T    DP   FC+++ K + N    TN+ KL+  L  AA   G    + G + ++V GLA
Sbjct  44   TVVGVDPLFHFCSSSEKFIDNGPYETNLNKLMGYLYLAAPPTGSGKGSVGQNHDQVNGLA  103

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVS+ DC  CI EA+ EIRK CPD   A +WY++C L+Y++  FFG+VD       
Sbjct  104  LCRGDVSNTDCKDCITEASTEIRKLCPDNKAAIVWYDHCLLKYSNMNFFGQVDYQNRFYM  163

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             N+ NV+ P  FN+K   L+  ++++  V + +    G+ +L +   LY L QCTRDLS 
Sbjct  164  WNLNNVSYPTSFNQKTKELLSHLAQQGFVNQ-KMYAVGELELEESKKLYGLTQCTRDLSS  222

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             +C +CL  A+ +  P  C+ K+G RV+  SC +RYE+YPF
Sbjct  223  SDCKKCLDDAI-SELPSCCDGKEGGRVVGGSCNIRYEIYPF  262



>gb|KDP25874.1| hypothetical protein JCGZ_22904 [Jatropha curcas]
Length=243

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 127/222 (57%), Gaps = 4/222 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            T  +TDP   FC+++     N    +N+ K++ NL     + G+   + G   ++ YGLA
Sbjct  21   TILATDPLFHFCSSSENFTTNGPYESNLNKIIGNLYIQTPQTGFGFGSSGQKPDQAYGLA  80

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVS+ DC +C+ EA+ EIRKRCP    A IWY+ C L+Y+D EFFG++D       
Sbjct  81   LCRGDVSTSDCKTCVVEASSEIRKRCPYNKAAIIWYDNCLLKYSDKEFFGQIDNRNKFYM  140

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSD-FLTLYALVQCTRDLS  610
             NV  V++P  FN K   L+  + K+A V   +    G+ KL + +  LY L QC+RDLS
Sbjct  141  WNVRVVSNPVEFNGKTKELLSQLVKDAYVSP-KLYATGELKLEETYDKLYGLTQCSRDLS  199

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
              +C  CL   +G   P  C+ K+G RV+  SC  RYE+YPF
Sbjct  200  SYDCKNCLDGIIG-ELPNCCDGKEGGRVVSGSCNFRYEIYPF  240



>ref|XP_010247023.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nelumbo 
nucifera]
Length=240

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 128/219 (58%), Gaps = 5/219 (2%)
 Frame = +2

Query  86   STDPSGLFCNTASKNLNSQT--STNILKLLTNLVPaasragyataayggsgNKVYGLAQC  259
            S DP   FC + S N ++++    N+ KL+++L      +G+   + G + ++  GLA C
Sbjct  23   SADPLFHFC-SKSGNFSAKSPYEINLNKLMSSLSYKVVPSGFGLGSVGQAPDRANGLALC  81

Query  260  RGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYAN  439
            RGDVSS DC +C+ EA  EI +RCP+  +  IWY+ C L+Y++ +FFG +D  Y     N
Sbjct  82   RGDVSSTDCKTCVSEAKTEILQRCPNDKEGIIWYDNCLLKYSNKDFFGNIDYKYKFYMWN  141

Query  440  VANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVN  619
            V NV++P  FN+K   L+  ++ EA     +    G+ KL +  TLY LVQCTRDLS   
Sbjct  142  VQNVSNPASFNQKTKELLSHLTNEA-YHSPKLFATGEQKLGEAQTLYGLVQCTRDLSTTG  200

Query  620  CAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            C +CL  A+ +     C+ K G RV+  SC  RYELYPF
Sbjct  201  CKKCLDEAI-SEISSCCDGKIGGRVVGGSCNFRYELYPF  238



>gb|ACU16205.1| unknown [Glycine max]
Length=242

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 125/222 (56%), Gaps = 4/222 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgN-KVYGL  250
            T+   DP   FC N+ +   NS   +N+  L+ +L+      G+   + G   N K Y L
Sbjct  22   TSFGADPLFHFCSNSENFTANSPYESNLKTLINSLIYKTPSTGFGAGSVGQYQNQKAYAL  81

Query  251  AQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGIL  430
            A CRGDVS+ +C +C+ EA KEI  RCP    A IWY+YC  +Y D +F G++D      
Sbjct  82   ALCRGDVSASECKTCVSEAPKEILSRCPYNKGAIIWYDYCMFKYLDTDFLGKIDNTNKFY  141

Query  431  YANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
              N+ NV+DP  FN    +L+  ++++A V  N+    G+ KL +  TLY L QCTRDLS
Sbjct  142  MWNLKNVSDPATFNYNTRDLLSQLAQKAYV-NNKLYATGEAKLENSETLYGLTQCTRDLS  200

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
              +C +CL  A+ N  P  C+ K+  RV+  SC  RYE+YPF
Sbjct  201  SSDCKKCLDDAI-NELPNCCDGKERGRVVSGSCNFRYEIYPF  241



>ref|XP_003566611.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Brachypodium 
distachyon]
Length=277

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 137/250 (55%), Gaps = 11/250 (4%)
 Frame = +2

Query  86   STDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRG  265
            + DP   +C  A     +QT  NI  +L +LVP AS A YA +  G   + V+GLAQCRG
Sbjct  30   AVDPVATYC--AKNGTTAQTQANIDAVLASLVPRASAAYYAVSTSGSGADAVHGLAQCRG  87

Query  266  DVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTD--DEFFGEVDTGYGILYAN  439
            DV  +DC+ C+  AA+ +   C    DAR +Y+YC LRY    D F G  DTGY ++  N
Sbjct  88   DVPRQDCALCLSAAARALASSCRGSGDARAFYDYCLLRYLSGGDNFIGLPDTGYTLILLN  147

Query  440  VANVT--DPERFNEKLGNLVDGISKEAV---VPENRGLGKGKTKLSDFLTLYALVQCTRD  604
              N +  D   F+     L+  ++ EA      + +GL +   KL   + LY L  CTRD
Sbjct  148  TQNASGVDLGAFDRAQSKLMARVAAEAGDVDRSKQQGLARETAKLGSSMILYGLGWCTRD  207

Query  605  LSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAASE  784
            ++P +C  C+A AV    P +C  ++GCRV+YSSC  RYE YPF+FP D   +   +A  
Sbjct  208  ITPADCGLCVAQAVA-ELPNYCRYRRGCRVIYSSCMARYETYPFFFPGDGGRQGDDSAEH  266

Query  785  ARNYRSTVVH  814
            A  Y + VVH
Sbjct  267  AGEY-AMVVH  275



>ref|XP_011079182.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Sesamum 
indicum]
Length=245

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 127/222 (57%), Gaps = 4/222 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            TA S  P    C N+ +   NS    N++KLL  L       G+   + G   ++ YGL+
Sbjct  23   TAISATPLFSICSNSHNFTANSPYEKNLIKLLGELYFKTPPTGFGLGSSGQGYDRAYGLS  82

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVS+KDC +C+ +A+ EI KRCP+   A IWY+ C L+Y D +F G++D       
Sbjct  83   LCRGDVSTKDCGACVVDASDEIIKRCPNDRGAIIWYDNCLLKYADSDFLGKIDGQNRFYM  142

Query  434  ANVANVT-DPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
             N+ NVT DP+ FN++   L+  +S+ A     +   KG+ +++ +  +Y + QC+RDLS
Sbjct  143  WNLQNVTIDPQEFNQRTRGLLSELSEHA-SKTGKMYAKGEVEVTGYEKIYGMAQCSRDLS  201

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
               C +CL  AV N  P  C  K+G RV+  SC +RYE+YPF
Sbjct  202  GAECKKCLDDAV-NELPRCCGGKQGGRVVGGSCNIRYEIYPF  242



>gb|AES67291.2| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=246

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 125/226 (55%), Gaps = 6/226 (3%)
 Frame = +2

Query  71   IFTAQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNLV---PaasragyataayggsgNK  238
            I T+   DP   FC N+ +   NS   +N+  L+ +L+   P+      +++       +
Sbjct  20   IQTSFGADPLFHFCSNSGNFTANSPYESNLKTLINSLIYKTPSTGFGNGSSSLVQNQNQQ  79

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTG  418
             YGLA CRGDVS  +C +C+ EA KEI+ RCP      IWY+YC  +Y+D +FFG++   
Sbjct  80   TYGLALCRGDVSPSECKTCVSEATKEIQSRCPYNKGGIIWYDYCLFKYSDTDFFGKIAKT  139

Query  419  YGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCT  598
                  N+ NV+DP  FN K  +L+  ++++A +   +    G+ KL +   LY L QCT
Sbjct  140  NRFYMWNLNNVSDPSTFNYKTKDLLSQLAQKASMNP-KLYATGEVKLEESKKLYGLTQCT  198

Query  599  RDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            RDLS  +C  CL  A+ N     C+ K+G RV+  SC  RYE+YPF
Sbjct  199  RDLSSADCKNCLDAAI-NELRNCCDGKEGGRVVGGSCNFRYEIYPF  243



>ref|XP_003633310.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Vitis vinifera]
 emb|CBI28970.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 130/221 (59%), Gaps = 6/221 (3%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASKNL-NSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQ  256
            A   DP   FC  + K + N    TN+ KL+ +L   A   G+  A+ G + ++  GLA 
Sbjct  22   AVGVDPLFHFCTGSEKFIDNGPYETNLNKLMDSLQILAPPTGFGKASVGLNADRSNGLAL  81

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CR DVS+ DC +C+ EA+ EI KRCPD   A IWY+ C L+Y++ +FFG+VD  +   Y+
Sbjct  82   CRPDVSNTDCKACVTEASTEILKRCPDYKAAIIWYDNCLLKYSNMDFFGQVD--HQKFYS  139

Query  437  -NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             N  NV++P  FN+K   L+  + +EA V  N     G+  L +   LY LVQCTRDLS 
Sbjct  140  FNEKNVSNPASFNQKTRELLSRLVEEAFVAPNM-YATGEVDLEESKKLYGLVQCTRDLST  198

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            ++C QCL  AV +  P  C+ K+G RV   SC +RYE YPF
Sbjct  199  IDCKQCLDDAV-SEVPNCCDGKEGGRVATGSCNIRYETYPF  238



>gb|AFK43074.1| unknown [Medicago truncatula]
Length=248

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/226 (37%), Positives = 125/226 (55%), Gaps = 6/226 (3%)
 Frame = +2

Query  71   IFTAQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNLV---PaasragyataayggsgNK  238
            I T+   DP   FC N+ +   NS   +N+  L+ +L+   P+      +++       +
Sbjct  20   IQTSFGADPLFHFCSNSGNFTANSPYESNLKTLINSLIYKTPSTGFGNGSSSLVQNQNQQ  79

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTG  418
             YGLA CRGDVS  +C +C+ EA KEI+ RCP      IWY+YC  +Y+D +FFG++   
Sbjct  80   TYGLALCRGDVSPSECKTCVSEATKEIQSRCPYNKGGIIWYDYCLFKYSDTDFFGKIAKT  139

Query  419  YGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCT  598
                  N+ NV+DP  FN K  +L+  ++++A +   +    G+ KL +   LY L QCT
Sbjct  140  NRFYMWNLNNVSDPSTFNYKTKDLLSQLAQKASMNP-KLYATGEVKLEESKKLYGLTQCT  198

Query  599  RDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            RDLS  +C  CL  A+ N     C+ K+G RV+  SC  RYE+YP+
Sbjct  199  RDLSSADCKNCLDAAI-NELRNCCDGKEGGRVVGGSCNFRYEIYPY  243



>ref|XP_010247032.1| PREDICTED: uncharacterized protein LOC104590182 [Nelumbo nucifera]
Length=1289

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 113/178 (63%), Gaps = 7/178 (4%)
 Frame = +2

Query  242  YGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGY  421
            YGL  C GDV+S+ C +C+  A+KEI +RCP++ +A IWY+ C LRY++   F  +    
Sbjct  711  YGLFLCEGDVTSEVCQNCVITASKEIMQRCPNKKEAIIWYDLCLLRYSNQSIFSTMQQIP  770

Query  422  GILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGL-GKGKTKLSDFLTLYALVQCT  598
            G+   N+ N+T+P+RFN+ LG+L++ + + A +  + G+   G+   + FL +Y LVQCT
Sbjct  771  GVSLLNINNITNPDRFNQILGDLMNSLVRRAALDPSTGMFATGEANFTSFLKIYGLVQCT  830

Query  599  RDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY-----FPLDPP  757
             D+S  +C  CL  AV ++ P  CN K+G RVL  SCY+RYE+YPFY      P  PP
Sbjct  831  PDISDTDCNICLTGAV-SDIPRCCNGKQGGRVLRPSCYIRYEIYPFYQLKPNAPASPP  887


 Score =   156 bits (394),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 110/170 (65%), Gaps = 2/170 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N  YGL  CRGDV+S+ C +C++ A+KEI +RCP++ +A IWY+ C LRY++   F  + 
Sbjct  74   NTAYGLFLCRGDVTSEVCQNCVEAASKEILQRCPNKKEAIIWYDLCLLRYSNQSIFSTMQ  133

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGL-GKGKTKLSDFLTLYALV  589
               G+   N+ N+T+P+RFN+ LG+L++ + + A +  + G+   G+   + F  +Y LV
Sbjct  134  QSPGVSLLNINNITNPDRFNQILGDLMNSLVRRAALDPSTGMFATGEANFTSFQQVYGLV  193

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT D+S  +C  CLA AVG   P  CN K+G RVL  SCY+RYE+  FY
Sbjct  194  QCTPDISQSDCNICLAEAVG-QIPICCNGKRGGRVLRPSCYIRYEIDLFY  242



>ref|XP_003597040.1| Cysteine-rich repeat secretory protein [Medicago truncatula]
Length=316

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 126/228 (55%), Gaps = 6/228 (3%)
 Frame = +2

Query  71   IFTAQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNLV---PaasragyataayggsgNK  238
            I T+   DP   FC N+ +   NS   +N+  L+ +L+   P+      +++       +
Sbjct  20   IQTSFGADPLFHFCSNSGNFTANSPYESNLKTLINSLIYKTPSTGFGNGSSSLVQNQNQQ  79

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTG  418
             YGLA CRGDVS  +C +C+ EA KEI+ RCP      IWY+YC  +Y+D +FFG++   
Sbjct  80   TYGLALCRGDVSPSECKTCVSEATKEIQSRCPYNKGGIIWYDYCLFKYSDTDFFGKIAKT  139

Query  419  YGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCT  598
                  N+ NV+DP  FN K  +L+  ++++A +   +    G+ KL +   LY L QCT
Sbjct  140  NRFYMWNLNNVSDPSTFNYKTKDLLSQLAQKASMNP-KLYATGEVKLEESKKLYGLTQCT  198

Query  599  RDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYF  742
            RDLS  +C  CL  A+ N     C+ K+G RV+  SC  RYE+YPF F
Sbjct  199  RDLSSADCKNCLDAAI-NELRNCCDGKEGGRVVGGSCNFRYEIYPFDF  245



>ref|XP_006380319.1| hypothetical protein POPTR_0007s02730g [Populus trichocarpa]
 gb|ERP58116.1| hypothetical protein POPTR_0007s02730g [Populus trichocarpa]
Length=242

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 121/223 (54%), Gaps = 3/223 (1%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYG  247
            + T    DP   FC+T      N    +N+ KL + L   A R G+   + G    + YG
Sbjct  19   VHTGFGADPLFHFCSTPENFTANGPYESNLNKLTSFLYYQAPRTGFGMGSKGQKPVQAYG  78

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            LA CRGD S+ DC +C+ EA  EIRKRCP    A IWY+ C L+Y++  FFG++D G   
Sbjct  79   LALCRGDASTSDCKTCVVEAGSEIRKRCPYNKAAIIWYDNCLLKYSNKGFFGQIDNGNKF  138

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
               NV  V++P  FNEK   L+  ++ +A     +    G  +L +   LY LVQCTRDL
Sbjct  139  YMWNVNAVSEPVPFNEKTKELLTQLANKAKATP-KLYATGGMELGESTKLYGLVQCTRDL  197

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            S   C +CL   +G   P  C+ K+G RV+  SC  RYE+YPF
Sbjct  198  SSAVCKKCLDGIIG-ELPSCCDGKEGGRVVSGSCNFRYEIYPF  239



>ref|XP_006387991.1| receptor-like protein kinase [Populus trichocarpa]
 gb|ERP46905.1| receptor-like protein kinase [Populus trichocarpa]
Length=242

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 121/223 (54%), Gaps = 3/223 (1%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYG  247
            + T    DP   FC+T      N    +N+ KL + L   A R G+   + G    + YG
Sbjct  19   VHTGFEADPLFHFCSTPENFTANGPYESNLNKLTSFLYYQAPRTGFGMGSKGQKPVQAYG  78

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            LA CRGD S+ DC +C+ EA  EIRKRCP    A IWY+ C L+Y++  FFG++D G   
Sbjct  79   LALCRGDASTSDCKTCVVEAGSEIRKRCPYNEAAIIWYDNCLLKYSNKGFFGQIDNGNKF  138

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
               NV  V++P  FNEK   L+  ++ +A     +    G  +L +   LY LVQCTRDL
Sbjct  139  YMWNVNAVSEPVPFNEKTKELLTQLANKAKATP-KLYATGGMELGESTKLYGLVQCTRDL  197

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            S   C +CL   +G   P  C+ K+G RV+  SC  RYE+YPF
Sbjct  198  SSAVCKKCLDGIIG-ELPSCCDGKEGGRVVSGSCNFRYEIYPF  239



>emb|CAN73040.1| hypothetical protein VITISV_044350 [Vitis vinifera]
Length=190

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 105/165 (64%), Gaps = 5/165 (3%)
 Frame = +2

Query  245  GLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYG  424
            GLA CR DVS+ DC +C+ EA+ EI KRCPD   A IWY+ C L+Y++ +FFG+VD  + 
Sbjct  27   GLALCRPDVSNTDCKACVTEASTEILKRCPDYKAAIIWYDNCLLKYSNMDFFGQVD--HQ  84

Query  425  ILYA-NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTR  601
              Y+ N  NV++P  FN+K   L+  +++EA V  N     G+  L D   LY LVQCTR
Sbjct  85   KFYSFNEKNVSNPASFNQKTRELLSRLAEEAFVAPNM-YATGEVDLEDSKKLYGLVQCTR  143

Query  602  DLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            DLS ++C QCL  AV +  P  C+ K+G RV   SC +RYE YPF
Sbjct  144  DLSTIDCKQCLDDAV-SEVPNCCDGKEGGRVATGSCNIRYETYPF  187



>ref|XP_007216907.1| hypothetical protein PRUPE_ppa019252mg [Prunus persica]
 gb|EMJ18106.1| hypothetical protein PRUPE_ppa019252mg [Prunus persica]
Length=215

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 116/204 (57%), Gaps = 2/204 (1%)
 Frame = +2

Query  134  NSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCSSCIQEAAK  313
            NS    N+++L   L       G+   + G   N+  GLA CRGDVSS+DC +C+ EA+K
Sbjct  14   NSPYGANLIQLFNLLYTKVPPTGFGLGSTGEGQNQANGLALCRGDVSSQDCKTCVVEASK  73

Query  314  EIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPERFNEKLGNLV  493
            E+ +RCP R  A IWY+ C  +Y++  F G++D        NV  V DP+ FN K+  L+
Sbjct  74   ELGERCPSRKGAIIWYDNCLFKYSNVNFAGKIDNNNRFYMWNVQEVDDPKPFNAKVEELL  133

Query  494  DGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCN  673
             G+S +A     +    G+ +LS   TLY L QCTRDLS  +C +CL  A+ +  P  C+
Sbjct  134  SGLSTKA-SSNPKFYATGELELSSSETLYGLTQCTRDLSSSDCKKCLDGAI-SELPNCCD  191

Query  674  DKKGCRVLYSSCYVRYELYPFYFP  745
             K+G RV+  SC  RYELYP   P
Sbjct  192  AKRGGRVVGGSCNFRYELYPIVDP  215



>ref|XP_011003220.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=242

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 121/223 (54%), Gaps = 3/223 (1%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYG  247
            + T    DP   FC+T      N    +N+ KL + L       G+   + G   ++ YG
Sbjct  19   VHTGFGADPLFHFCSTPENFTANGPYESNLNKLTSYLYYQTPSTGFGLGSIGQKPDRAYG  78

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            LA CRGD S+ DC +C+ EA  EIRKRCP    A IWY+ C L+Y+++ FFG++D G   
Sbjct  79   LALCRGDASTSDCKTCVVEAGGEIRKRCPYNKAAIIWYDNCLLKYSNNGFFGQIDNGNKF  138

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
               NV  V++P  FN K   L+  ++ + V    +    G+ +L +   LY LVQCTRDL
Sbjct  139  YMWNVKVVSEPVTFNGKTKELLTQLANK-VQATPKLYETGEMELGESTKLYGLVQCTRDL  197

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            S   C +CL   +G   P  C+ K+G RV+  SC  RYE+YPF
Sbjct  198  SSAVCKKCLDGIIG-ELPSCCDGKEGGRVVSGSCNFRYEIYPF  239



>ref|XP_007216947.1| hypothetical protein PRUPE_ppa016345mg [Prunus persica]
 gb|EMJ18146.1| hypothetical protein PRUPE_ppa016345mg [Prunus persica]
Length=210

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 116/204 (57%), Gaps = 2/204 (1%)
 Frame = +2

Query  134  NSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCSSCIQEAAK  313
            NS    N+++L   L       G+   + G   N+  GLA CRGDVSS+DC +C+ EA+K
Sbjct  9    NSPYGANLIQLFNLLYTKVPPTGFGLGSTGEGQNQANGLALCRGDVSSQDCKTCVVEASK  68

Query  314  EIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPERFNEKLGNLV  493
            ++ +RCP R  A IWY+ C  +Y++  F G++D        NV  V DP  FNEK+  L+
Sbjct  69   KLGERCPSRKGAIIWYDNCLFKYSNVNFAGKIDNNNRFYMWNVQEVDDPTPFNEKVKELL  128

Query  494  DGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCN  673
             G+S +A     +    G+ +LS   TLY L QCTRDLS  +C +CL  A+ +  P  C+
Sbjct  129  SGLSTKA-SSNPKFYATGELELSSSETLYGLTQCTRDLSSSDCKKCLDDAI-SELPNCCD  186

Query  674  DKKGCRVLYSSCYVRYELYPFYFP  745
             K+G RV+  SC  RYELYP   P
Sbjct  187  AKQGGRVVGGSCNFRYELYPIVDP  210



>ref|XP_006447470.1| hypothetical protein CICLE_v10017568mg, partial [Citrus clementina]
 gb|ESR60710.1| hypothetical protein CICLE_v10017568mg, partial [Citrus clementina]
Length=254

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 125/222 (56%), Gaps = 16/222 (7%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            TA   DP   FC+++     N    TN+ KL+  L   A   G+   A G   NK YGLA
Sbjct  44   TAFGVDPLFHFCSSSENFTANGPYETNLNKLIGYLDYQAPPTGFGKGALGQRPNKAYGLA  103

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVSS DC +CI +A+ EIRKRCP    A IWY+ C L+YT+ EFFG++D       
Sbjct  104  LCRGDVSSSDCKTCIVDASGEIRKRCPYNKAAIIWYDNCLLKYTNTEFFGQIDNKNKFYM  163

Query  434  ANVANVTDPERFNEKLGNLVDGISKEA-VVPENRGLGKGKTKLSDFLTLYALVQCTRDLS  610
             NV  VT+P  FN++   L+  ++++A V P+   +G+ +   S+   LY L QCTRDLS
Sbjct  164  WNVRVVTEPVSFNQRTKELLTQLAEKAYVTPKLYAVGEMELGKSN--KLYGLTQCTRDLS  221

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             V+C  C            C+ K+G RV+  SC  RYE+YPF
Sbjct  222  SVDCKNC------------CDGKEGGRVVSGSCNFRYEIYPF  251



>ref|XP_008228882.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=241

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 115/204 (56%), Gaps = 2/204 (1%)
 Frame = +2

Query  134  NSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCSSCIQEAAK  313
            NS    N+++L   L       G+   + G   N+  GLA CRGDVSS+DC +C+ EA+K
Sbjct  40   NSPYGANLIQLFNLLYTKVPPTGFGLGSTGEGQNQANGLALCRGDVSSQDCKTCVVEASK  99

Query  314  EIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPERFNEKLGNLV  493
            E+ +RCP R  A IWY+ C  +Y++  F G++D        NV  V DP  FN K+  L+
Sbjct  100  ELGERCPSRKGAIIWYDNCLFKYSNVNFAGKIDKNNRFYMWNVQEVDDPTPFNAKVKELL  159

Query  494  DGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCN  673
             G+S +A     +    G+ +LS   TLY L QCTRDLS  +C +CL  A+ +  P  C+
Sbjct  160  SGLSTKA-SSNPKFYATGELELSSSETLYGLTQCTRDLSSSDCNKCLDDAI-SELPNCCD  217

Query  674  DKKGCRVLYSSCYVRYELYPFYFP  745
             K+G RV+  SC  RYELYP   P
Sbjct  218  AKRGGRVVGGSCNFRYELYPIVHP  241



>ref|XP_002533571.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF28806.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
Length=243

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 103/166 (62%), Gaps = 2/166 (1%)
 Frame = +2

Query  242  YGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGY  421
            YGL  CRGD+++ DC +C+ EA+ EIR+RCP + +A IWY+ C L+Y++ +FFG++D   
Sbjct  76   YGLTLCRGDITASDCITCVAEASTEIRRRCPYKKEAIIWYDNCLLKYSNKDFFGQIDNKN  135

Query  422  GILYANVANVTDPERFNEKLGNLVDGISKEA-VVPENRGLGKGKTKLSDFLTLYALVQCT  598
             +   N+ NV+DP  FN+K   L+  ++ +A V P     G  +        +Y + QCT
Sbjct  136  KVYLLNLRNVSDPVTFNQKTKELLTQLAVDASVTPRMYAAGDLEFGDQGLKKIYGMAQCT  195

Query  599  RDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            RDLS  +C  CL  A+G   P  C+ K+G RV+  SC VRYE+YPF
Sbjct  196  RDLSSADCKSCLDRAIG-ELPSCCDGKEGGRVVGGSCTVRYEIYPF  240



>ref|XP_010051188.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89433.1| hypothetical protein EUGRSUZ_A01732 [Eucalyptus grandis]
Length=242

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 118/197 (60%), Gaps = 3/197 (2%)
 Frame = +2

Query  149  TNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKR  328
            TN+  LLT LV     +G+ T + G   ++VYGLA CRGDVSS DC SC+ +A  E+ +R
Sbjct  45   TNLDSLLTTLVSKVPPSGFGTGSSGEGNDQVYGLALCRGDVSSSDCKSCVSDAGPELLQR  104

Query  329  CPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV-TDPERFNEKLGNLVDGIS  505
            CP++  A IWY+ C L+Y++ EFFG++DT       NV +V  D   F  K+  L+  ++
Sbjct  105  CPEQKGAIIWYDNCLLKYSNVEFFGKIDTKNKFYLLNVQDVDMDFMEFYRKIKQLLSNLT  164

Query  506  KEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKG  685
             EAV    +    G+  L  + TL+ L QCTRDLS  +C  CL  A+ ++ P  C  K+G
Sbjct  165  DEAVAGP-KLYAYGELGLGGYKTLFGLAQCTRDLSADDCKTCLKGAI-SDLPSCCYGKRG  222

Query  686  CRVLYSSCYVRYELYPF  736
             R +  SC VRYELYPF
Sbjct  223  GRTVGGSCNVRYELYPF  239



>ref|XP_002515716.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF46663.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
Length=240

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 118/221 (53%), Gaps = 2/221 (1%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            T    DP   FC+++     N    +N+ KL  NL     + G+   + G   ++ YGLA
Sbjct  18   TVYGDDPLFHFCSSSENFTANGPYESNLNKLAGNLYFQVPKEGFGFGSSGRDPDQAYGLA  77

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVSS DC +C+ EA+ EIRKRCP    A IWY+ C  +Y+D ++FG++D       
Sbjct  78   LCRGDVSSSDCKTCVVEASSEIRKRCPTNKAAIIWYDNCLYKYSDKKYFGQIDNRNKFYM  137

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             NV  V D   FN+K   L+  ++ +A V           KL     LY LVQCTRDLS 
Sbjct  138  WNVRVVNDSAEFNQKTKELLSELASQAYVTSKLYATGESDKLGKSNKLYGLVQCTRDLSS  197

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             +C +CL   +    P  C+ K+G RV+  SC  RYE+YPF
Sbjct  198  GDCRKCLD-GIITELPSCCDGKEGGRVVSGSCNFRYEIYPF  237



>ref|XP_007149947.1| hypothetical protein PHAVU_005G112700g [Phaseolus vulgaris]
 gb|ESW21941.1| hypothetical protein PHAVU_005G112700g [Phaseolus vulgaris]
Length=249

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 107/169 (63%), Gaps = 4/169 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            +KV GLA CRGDV++ +C SC+ +A K++++RCP +  A +WY+YC L+Y+++ FFGE D
Sbjct  81   DKVNGLALCRGDVNATNCMSCVDDATKKLQERCPKKKGAIVWYDYCLLKYSNEYFFGESD  140

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAV-VPENRGLGKGKTKLSDFLTLYALV  589
                    N+ +V DP  FN K+  L+  +S  A   P    +  G+ +L +  TLY L 
Sbjct  141  EKNKFYMVNIYDVDDPATFNAKVNELLSALSYNASQTPMLYAV--GELQLEEAKTLYGLA  198

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            QCTRDL   +C +CL  A+ +  P FC+ K+G RV+  SCYVRYELYP 
Sbjct  199  QCTRDLFGPSCKKCLDEAI-SELPDFCDGKEGGRVVGGSCYVRYELYPI  246



>ref|XP_004144581.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 gb|KGN43545.1| hypothetical protein Csa_7G044850 [Cucumis sativus]
Length=256

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 108/170 (64%), Gaps = 3/170 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+V GLA CRGDVSS DC +C+  A++EI++RCP+R  A IWY++C L+Y++ +FFG++D
Sbjct  83   NQVNGLALCRGDVSSADCKNCVATASQEIQERCPNRKGAAIWYDFCLLKYSNTKFFGKID  142

Query  413  TGYGILYANVANVTD-PERFNEKLGNLVDGISKEAVVPENR-GLGKGKTKLSDFLTLYAL  586
                    N+    D PE FN+++  L+  +S++    +N   +G+ + +      LY L
Sbjct  143  NRNKFYMWNLQERDDEPEVFNKQVKRLLISLSEKVEGTKNLYVIGEVEMRTKGMEKLYGL  202

Query  587  VQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            VQC+RDLS   C +CL IA+G   P  CNDK G RV+  SC  RYELYP 
Sbjct  203  VQCSRDLSSNACKKCLQIAIG-ELPNCCNDKIGGRVVGGSCNFRYELYPI  251



>ref|XP_002309843.2| hypothetical protein POPTR_0007s02720g [Populus trichocarpa]
 ref|XP_006387148.1| receptor-like protein kinase [Populus trichocarpa]
 gb|ERP46062.1| receptor-like protein kinase [Populus trichocarpa]
 gb|EEE90293.2| hypothetical protein POPTR_0007s02720g [Populus trichocarpa]
Length=242

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 123/223 (55%), Gaps = 3/223 (1%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYG  247
            + T    DP   FC+T      N    +N+ KL + L   A   G+   + G + ++ YG
Sbjct  19   VHTGFGADPLFHFCSTPENFTANGPYESNLNKLTSYLYYQAPSTGFGLGSIGQNPDQAYG  78

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            LA CRGD S+ DC +C+ EA  EIRKRCP    A IWY+ C ++Y+++ FFG++D G   
Sbjct  79   LALCRGDASTSDCKTCVVEAGGEIRKRCPYNKAAIIWYDNCLVKYSNNGFFGQIDNGNKF  138

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
               NV  V++P  FN K   L+  ++ + V    +    G+ +L +   LY LVQCTRDL
Sbjct  139  YMWNVKVVSEPVTFNGKTKELLTQLANK-VEATPKLYETGEMELGESTKLYGLVQCTRDL  197

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            S   C +CL   +G   P  C+ K+G RV+  SC  RYE+YPF
Sbjct  198  SSAVCKKCLDGIIG-ELPSCCDGKEGGRVVSGSCNFRYEIYPF  239



>ref|XP_006380320.1| hypothetical protein POPTR_0007s02740g [Populus trichocarpa]
 gb|ERP58117.1| hypothetical protein POPTR_0007s02740g [Populus trichocarpa]
Length=245

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGL  CRGDVSS DCS+C+ +A +EIRKRCP      I Y+ C L+Y++ +FFG++D
Sbjct  77   DRPYGLVLCRGDVSSSDCSACVADATREIRKRCPYGKSGFIAYDNCLLKYSNKDFFGQID  136

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            +   I   NV NV++P  FN+K  +L+  ++ +A +   +    G+  L     LY + Q
Sbjct  137  SQNKIYLYNVRNVSNPVVFNQKTKDLLSQLANKAYIAR-KMYATGELGLGGSKKLYGMAQ  195

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CTRDLS  NC +CL  A+ +   GF   K+G RV   SC VRYE+YPF
Sbjct  196  CTRDLSSANCKKCLDGAI-SELQGFAGGKEGGRVTGGSCTVRYEIYPF  242



>ref|XP_010051161.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89429.1| hypothetical protein EUGRSUZ_A01728 [Eucalyptus grandis]
Length=240

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 118/219 (54%), Gaps = 5/219 (2%)
 Frame = +2

Query  86   STDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCR  262
              DP    C+T       S   +N+ KL + L      +G+   + G   ++ YGL  CR
Sbjct  22   GADPLFHVCSTPEDFTAGSPYESNLNKLTSFLYTNTPSSGFGPGSIGQYPDQPYGLTLCR  81

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GD S  DC +C+ +A  EIR+ CP    A IWY+ C  +Y D +FFG++D        N 
Sbjct  82   GDTSPLDCEACVADAVAEIRRHCPRNKGAIIWYDNCMFKYLDTDFFGQIDNANKFYMWNP  141

Query  443  ANVTDPERFNEKLGNLVDGISKEAV-VPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVN  619
             +V+DPE FN K+  L+ G+ +EA  VP  +    G+  L +   LY LVQCTRDLS   
Sbjct  142  KSVSDPEAFNGKVRGLLTGLVEEAYSVP--KLYATGEMGLEEKTKLYGLVQCTRDLSATQ  199

Query  620  CAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            C +CL  A+G   P + N K+G RV+  SC  RYE+YPF
Sbjct  200  CKECLEGAIG-ELPSYGNGKEGGRVVGGSCNFRYEIYPF  237



>ref|XP_010532487.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Tarenaya 
hassleriana]
Length=251

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 101/178 (57%), Gaps = 17/178 (10%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            +KV GLA CRGDVS  DC SCI  A  E+RKRCP+     IWY++C ++++   FFG++D
Sbjct  77   DKVNGLALCRGDVSPADCRSCITAATPELRKRCPNNKGGAIWYDFCLVKHSTINFFGKID  136

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPEN----------RGLGKGKTKLS  562
                    NV NVTDP  FN +  NL+  +SKEA   +            G G GK K  
Sbjct  137  YDNKFYLYNVNNVTDPTSFNAQTKNLLSRLSKEAAAVKKLYAAGEDNLYGGAGSGKKK--  194

Query  563  DFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
                LY LVQCTRDL+   C  CL   +G   P  C+ K+G RV+ +SC  RYE+YPF
Sbjct  195  ----LYGLVQCTRDLTSEACTACLDGIIG-ELPNCCDGKEGGRVVGTSCNFRYEIYPF  247



>ref|XP_003635324.2| PREDICTED: cysteine-rich repeat secretory protein 38-like, partial 
[Vitis vinifera]
Length=309

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 122/227 (54%), Gaps = 7/227 (3%)
 Frame = +2

Query  110  CNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCS  289
            C+  S+  ++   TN+  L ++L       G+     G + ++V+GL  CRGD +S DC 
Sbjct  34   CSNHSEIASNSYKTNLNSLFSSLTTKGPLTGFYNTTSGKTPDEVFGLVLCRGDDTSNDCQ  93

Query  290  SCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPERF  469
             CI+EA++E+ +RC    +  IWY+ C LRY+   FF  V     +   N  + +DP RF
Sbjct  94   ICIKEASQELLQRCNSTKEGTIWYDECLLRYSSQNFFSSVTLKKELSLLNTISASDPIRF  153

Query  470  NEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVG  649
            N  LG L+D IS EA    ++    G+  +S    +Y LVQCTRDLS  +C  CL  ++ 
Sbjct  154  NTILGQLMDNISSEAAFSSSQMFATGEAVVSSLQKIYGLVQCTRDLSKEDCNDCLESSI-  212

Query  650  NNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD------PPEKSTV  772
                  C+ K+G +V+  SC++RYE+YPF+          PPE + V
Sbjct  213  EKLSSCCSGKQGGQVISKSCFLRYEVYPFFRGASTGATSPPPENAMV  259



>ref|XP_011003221.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=245

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 105/168 (63%), Gaps = 2/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGL  CRGDVSS DCS+C+ +A +EIRKRCP      I Y+ C L+Y++ +FFG++D
Sbjct  77   DRPYGLVLCRGDVSSSDCSACVADATREIRKRCPYGKSGFIAYDNCLLKYSNKDFFGQID  136

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            +   I   NV NV++P  FN+K  +L+  ++ +A +   +    G+  L     LY + Q
Sbjct  137  SRNKIYLYNVRNVSNPVVFNQKTKDLLSQLANKAYIAR-KMYAAGELGLGGSKKLYGMAQ  195

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CTRDLS V+C +CL  A+ +   GF   K+G RV   SC VRYE+YPF
Sbjct  196  CTRDLSSVDCKKCLNSAI-SELQGFSGGKEGGRVTGGSCTVRYEIYPF  242



>ref|XP_006372981.1| hypothetical protein POPTR_0017s06750g [Populus trichocarpa]
 gb|ERP50778.1| hypothetical protein POPTR_0017s06750g [Populus trichocarpa]
Length=236

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGL  CRGDVSS DC +C  +A +EIRKRCP    A I Y+ C L+Y+D +FFG++D
Sbjct  66   DRPYGLVLCRGDVSSSDCRTCAADATREIRKRCPYSKRAIIAYDNCLLKYSDSDFFGQID  125

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSD-FLTLYALV  589
                    NV NV++P  FNEK   L+  ++ +A    ++    G+  L +  + LY + 
Sbjct  126  DQNKFYMWNVNNVSNPVLFNEKTSELLSQLADKASYNSSKLYAAGEMDLLEGSMKLYGMA  185

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            QCTRDLS V+C +CL  A+G   PG    K+G RV+  SC V YE+YPF
Sbjct  186  QCTRDLSSVDCKKCLDGAIG-ELPGVAYGKQGARVVGGSCMVIYEIYPF  233



>gb|AGT15891.1| hypothetical protein SHCRBa_258_I03_F_10 [Saccharum hybrid cultivar 
R570]
Length=662

 Score =   150 bits (379),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 107/169 (63%), Gaps = 1/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGLAQCRGDV++  C +C+  +A+ +   CP +  A + Y+ C LR++++ FFG VD
Sbjct  72   DQAYGLAQCRGDVNASACLACLDGSARHMAATCPGQKGAMLIYDECLLRHSNESFFGAVD  131

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T   +   N  N T+PE+F  +LG L+  ++  A     R    G+T L+ F+ ++ +VQ
Sbjct  132  TSVTVWGWNTQNATEPEKFMSRLGALMGNLTARAAFASPRMFAAGETALTPFVNIFGMVQ  191

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            CTRDL+  +C +CLA AV    P  C+ K+G RV+Y +C +R+E+YPFY
Sbjct  192  CTRDLADDDCNRCLANAVA-FIPNCCDGKQGGRVIYRTCSIRFEVYPFY  239



>ref|XP_004251507.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Solanum 
lycopersicum]
Length=240

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 129/224 (58%), Gaps = 3/224 (1%)
 Frame = +2

Query  68   TIFTAQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVY  244
            +I    STDP   FC N  +   NS  + N+  LL +L       G++T++ G + ++  
Sbjct  15   SIAIVISTDPLFHFCSNHENFTANSYYAQNLKNLLGDLYLKTPPTGFSTSSIGQNHDQTN  74

Query  245  GLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYG  424
            GL+ CRGDV+S +C SC+ +A++E+ KRCP   +A IWY+ C L+Y+D +F G +D  Y 
Sbjct  75   GLSLCRGDVTSNNCKSCVLDASEELGKRCPYDKEAIIWYDNCLLKYSDKDFLGNIDNTYK  134

Query  425  ILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRD  604
                NV  V++PE FN K   L+  +S+ A    N     G+ ++ +   LY LVQCTRD
Sbjct  135  FYMWNVRVVSNPEYFNAKTKELLGSLSENAYKTTNL-YAIGEMEIEENKKLYGLVQCTRD  193

Query  605  LSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            LS  +C +C+   +    P  C+ K+G RV+  SC  RYE+YPF
Sbjct  194  LSNEDCKKCVD-GIITEIPSCCDGKEGGRVVSGSCNFRYEIYPF  236



>ref|XP_006372983.1| hypothetical protein POPTR_0017s06770g [Populus trichocarpa]
 gb|ERP50780.1| hypothetical protein POPTR_0017s06770g [Populus trichocarpa]
Length=245

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGL  CRGDVSS DC +C   A +EIRKRCP+   A I Y+ C L+Y+D +FFG++D
Sbjct  75   DRPYGLVLCRGDVSSSDCRTCAANATREIRKRCPNGKRAIIAYDNCLLKYSDSDFFGQID  134

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSD-FLTLYALV  589
                    NV NV++P  FNEK   L+  ++ +A    ++    G+  L +  + LY + 
Sbjct  135  DQNKFYMWNVNNVSNPVLFNEKTTELLSQLADKASYNSSKLYAAGEMDLLEGSMKLYGMA  194

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            QCTRDLS V+C +CL  A+G   PG    K+G RV+  SC V YE+YPF
Sbjct  195  QCTRDLSSVDCKKCLDGAIG-ELPGVAYGKQGARVVGGSCMVIYEIYPF  242



>ref|XP_010247616.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Nelumbo 
nucifera]
Length=676

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 101/170 (59%), Gaps = 2/170 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N VYGL  CRGDV+   C SC+Q A +EI + CPDR  A +WY+ C LRY++   F  + 
Sbjct  88   NTVYGLFLCRGDVTEDACRSCVQTATQEILQLCPDRKVATVWYDECMLRYSNQSIFSTIS  147

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVV-PENRGLGKGKTKLSDFLTLYALV  589
                +  +N  N+++P++FN+ L N +D I+ +A     +R     +   + F  LY L 
Sbjct  148  DSILVYMSNTQNISNPDQFNQLLANKMDEIATQAASGGSSRKFATAEANFTTFQRLYTLA  207

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT DLS  +C +CL   + NN P  CN K+G RVL  SC VRYE+YPFY
Sbjct  208  QCTPDLSNQDCYRCLRNVI-NNLPSCCNSKQGGRVLADSCNVRYEIYPFY  256



>ref|XP_006592824.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Glycine 
max]
 gb|KHN25767.1| Cysteine-rich repeat secretory protein 38 [Glycine soja]
Length=171

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 108/169 (64%), Gaps = 4/169 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++V GLA CRGDV++ +C +C+ EA K++++RC  +  A +WY+YC L+Y+++ FFGE+D
Sbjct  2    DQVNGLALCRGDVNATNCMACVNEATKKLQERCSKKKGAIVWYDYCLLKYSNEYFFGEID  61

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAV-VPENRGLGKGKTKLSDFLTLYALV  589
                    N+ +V DP  F++K+  L+ G+S  A   P    +  G+ +L +  TLY L 
Sbjct  62   EKNKFYMVNIYDVDDPSTFSDKVNELLSGLSYNASQTPMLYAV--GELQLQESKTLYGLA  119

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            QCTRDL    C +CL  A+ ++ P  C+ K+G RV+  SCYVRYELYP 
Sbjct  120  QCTRDLLGPGCKKCLDDAI-SDLPNCCDGKQGARVVGGSCYVRYELYPI  167



>ref|XP_006372978.1| hypothetical protein POPTR_0017s06720g [Populus trichocarpa]
 gb|ERP50775.1| hypothetical protein POPTR_0017s06720g [Populus trichocarpa]
Length=242

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 100/168 (60%), Gaps = 2/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGLA CRGDVS+ DC +C+ EA+ EIRKRCP    A IWY+ C L+Y++  FFG+VD
Sbjct  74   DQTYGLALCRGDVSTSDCKTCVVEASSEIRKRCPYNKAAIIWYDNCLLKYSNTGFFGQVD  133

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            TG      NV  V+ P  FN+K   L+  ++ EA     +    G+ +L     LY LVQ
Sbjct  134  TGNKFYMWNVHVVSKPAPFNKKTKELLSQLANEAQATP-KLFATGERELGKSTKLYGLVQ  192

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CT DLS   C +CL   +G   P  C+ K+G RV+  SC   YE+YPF
Sbjct  193  CTGDLSSAVCKKCLDGIIG-ELPSCCDGKQGGRVVSGSCNFIYEIYPF  239



>ref|XP_006351953.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
tuberosum]
Length=240

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 129/224 (58%), Gaps = 3/224 (1%)
 Frame = +2

Query  68   TIFTAQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVY  244
            +I    STDP   FC N+ +   NS  + N+  LL +L       G++T++ G + ++  
Sbjct  15   SIALVISTDPLFHFCSNSENFTANSYYAQNLKNLLGDLYLKTPPTGFSTSSIGQNHDQTN  74

Query  245  GLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYG  424
            GL+ CRGDVSS  C SC+ +A++E+ KRCP   +A IWY+ C L+Y++ +F G +D  Y 
Sbjct  75   GLSLCRGDVSSNSCKSCVLDASEELGKRCPYDKEAIIWYDNCLLKYSNKDFLGNIDNTYK  134

Query  425  ILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRD  604
                NV  V++PE FN K   L+  +S+ A    N     G+ ++ +   LY LVQCTRD
Sbjct  135  FYMWNVRVVSNPEYFNAKTKELLGSLSENAYKTSNL-YAIGEMEIEENKKLYGLVQCTRD  193

Query  605  LSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            +S  +C +CL   +    P  C+ K+G RV+  SC  RYE+YPF
Sbjct  194  ISNEDCKKCLD-GIITEIPSCCDGKEGGRVVGGSCNFRYEIYPF  236



>ref|XP_009605992.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
tomentosiformis]
Length=246

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 126/222 (57%), Gaps = 3/222 (1%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            T  STDP   FC+ +     NS  + N+  LL +L       G++T++ G + ++ YGL+
Sbjct  22   TVISTDPLFHFCSKSGNFTANSYYAKNLKNLLGDLYLKTPLTGFSTSSIGQTPDQTYGLS  81

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVSS +C SC+ +A++E+ KRCP   +A IWY+ C L+Y+ ++F G++D  Y    
Sbjct  82   LCRGDVSSTNCKSCVVDASEELGKRCPYDKEAIIWYDNCLLKYSYNDFLGKIDNTYKFYM  141

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSD-FLTLYALVQCTRDLS  610
             NV  V  PE FN K   L+  + + A   +N         + D +  LY LVQCTRDLS
Sbjct  142  WNVRVVNKPESFNAKTKELLGSLVETAYKKQNLYASGDMELIGDQYEKLYGLVQCTRDLS  201

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
              +C +CL   +    P  C+ K+G RV+  SC  RYE+YPF
Sbjct  202  SEDCKKCLE-GIITEIPSCCDGKEGGRVVGGSCNFRYEIYPF  242



>ref|XP_009591406.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
tomentosiformis]
Length=246

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 126/222 (57%), Gaps = 3/222 (1%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            T  STDP   FC+ +     NS  + N+  LL +L       G++T++ G + ++ YGL+
Sbjct  22   TVVSTDPLFHFCSKSGNFTANSYYAKNLKNLLGDLYLKTPPTGFSTSSIGQTPDQTYGLS  81

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVSS +C SC+ +A++E+ KRCP   +A IWY+ C L+Y+ ++F G++D  Y    
Sbjct  82   LCRGDVSSTNCKSCVVDASEELGKRCPYDKEAIIWYDNCLLKYSYNDFLGKIDNTYKFYM  141

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSD-FLTLYALVQCTRDLS  610
             NV  V  PE FN K   L+  + + A   +N         + D +  LY LVQCTRDLS
Sbjct  142  WNVRVVNKPESFNAKTKELLGSLVETAYKKQNLYASGDMELIGDQYEKLYGLVQCTRDLS  201

Query  611  PVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
              +C +CL   +    P  C+ K+G RV+  SC  RYE+YPF
Sbjct  202  SEDCKKCLE-GIITEIPSCCDGKEGGRVVGGSCNFRYEIYPF  242



>ref|XP_010931363.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 [Elaeis 
guineensis]
Length=666

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 111/200 (56%), Gaps = 9/200 (5%)
 Frame = +2

Query  236  KVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            +VYGLA CRGDVS  +C+SC+  + KEI KRCP+ + + IWYE C LRY+D  FF   DT
Sbjct  84   QVYGLALCRGDVSPAECTSCLNTSTKEIIKRCPNGMSSAIWYEGCLLRYSDQNFFSTADT  143

Query  416  GYGILYANVANV-TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
             +   Y  V  + +DPE F + LG ++D +   A          G  K ++  TLY LVQ
Sbjct  144  SFN--YELVGGLASDPELFKKLLGQMMDNLITTAANVSTEMFATGVAKYTNSSTLYGLVQ  201

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFP-----LDPP  757
            CTRDL    C +CL   VG   P  CN + G RV   SCY+RYEL+PF+ P       PP
Sbjct  202  CTRDLPHDECYRCLQDFVG-IIPECCNGRSGARVYGFSCYLRYELFPFFNPSRATAWLPP  260

Query  758  EKSTVAASEARNYRSTVVHK  817
              + V+ S     +S+   K
Sbjct  261  TDAPVSPSPDSEPKSSPTTK  280



>ref|XP_006372982.1| hypothetical protein POPTR_0017s06760g [Populus trichocarpa]
 gb|ERP50779.1| hypothetical protein POPTR_0017s06760g [Populus trichocarpa]
Length=245

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGL  CRGDVSS DC +C   A +EIRKRCP+   A I Y+ C L+Y+D +FFG++D
Sbjct  75   DRPYGLVLCRGDVSSSDCRTCAANATREIRKRCPNGKRAIIAYDNCLLKYSDSDFFGQID  134

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSD-FLTLYALV  589
                    NV NV++P  FNEK   L+  ++ +A    ++    G+  L +  + LY + 
Sbjct  135  DQNKFYMWNVNNVSNPVLFNEKTTELLSQLADKASYNSSKLYAAGEMDLLEGSMKLYGMA  194

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             CTRDLS V+C +CL  A+G   PG    K+G RV+  SC V YE+YPF
Sbjct  195  HCTRDLSSVDCKKCLDGAIG-ELPGVAYGKEGARVVGGSCMVIYEIYPF  242



>ref|XP_008455543.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=277

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 105/168 (63%), Gaps = 4/168 (2%)
 Frame = +2

Query  236  KVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            +V  LA CRGDVS  DC +CI+ A+ EI++RCPD+    IWY++C L+Y++ +FFG++D 
Sbjct  108  QVNALALCRGDVSPTDCKTCIETASNEIQQRCPDKKGGSIWYDFCLLKYSNIKFFGKIDN  167

Query  416  GYGILYANVANVTDPERFNEKLGNLVDGISKEA-VVPENRGLGKGKTKLSDFLTLYALVQ  592
            G+ +   NV    +P  FNE++ NL+  + ++  V P+   +G+ + + S    LY LVQ
Sbjct  168  GFRLYMWNVQEAENPTLFNEQVKNLLTSLVEQVEVTPKLYVIGEKEIEGSK--KLYGLVQ  225

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CTRDLS   C +CL  AV    P  C+ K G RV+  SC  RYE+YP 
Sbjct  226  CTRDLSTAACKKCLNDAVA-ELPNCCDAKIGGRVIGGSCNFRYEIYPI  272



>ref|XP_006372985.1| hypothetical protein POPTR_0017s06790g [Populus trichocarpa]
 gb|ERP50782.1| hypothetical protein POPTR_0017s06790g [Populus trichocarpa]
Length=242

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 100/168 (60%), Gaps = 2/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGLA CRGDVS+ DC +C+ E + EIRKRCP    A IWY+ C L+Y+++ FFG++D
Sbjct  74   DQTYGLALCRGDVSTSDCKTCVVEVSSEIRKRCPYNKAAIIWYDNCLLKYSNNAFFGQID  133

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
             G      NV  V++P  FNEK   L+  ++ EA     +    G+ +L     LY LVQ
Sbjct  134  NGNKFYMWNVHVVSEPAPFNEKTKELLSQLANEAQATP-KLFATGERELGKSTKLYGLVQ  192

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CT DLS   C +CL   +G   P  C+ K+G RV+  SC   YE+YPF
Sbjct  193  CTGDLSSAVCKKCLDGIIG-ELPICCDGKQGGRVVSGSCNFIYEIYPF  239



>ref|XP_006387992.1| hypothetical protein POPTR_0421s00210g [Populus trichocarpa]
 gb|ERP46906.1| hypothetical protein POPTR_0421s00210g [Populus trichocarpa]
Length=245

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGL  CRGDVSS DCS+C+ +A +EIRKRCP      I Y+ C L+Y++ +FFG++D
Sbjct  77   DRPYGLVLCRGDVSSPDCSACVADATREIRKRCPYGKSGFIAYDNCLLKYSNKDFFGQID  136

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            +   I   NV NV++P  FN+K  +L+  ++ +A +   +    G+  L     LY + Q
Sbjct  137  SQNKIYLYNVRNVSNPVVFNQKTKDLLTQLANKAYIAR-KMYAAGELGLGGSKKLYGMAQ  195

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CTRDLS  +C +CL  A+ +   GF   K+G RV   SC VRYE+YPF
Sbjct  196  CTRDLSSADCKKCLDGAI-SELQGFAGGKEGGRVTGGSCTVRYEIYPF  242



>ref|XP_008455405.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=258

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 105/172 (61%), Gaps = 5/172 (3%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+V GLA CRGDVSS DC +CI  A++EI++RC +R  A IWY++C L+Y++ +FFG++D
Sbjct  83   NQVNGLALCRGDVSSADCKNCIAMASQEIQERCTNRKGAAIWYDFCLLKYSNTKFFGKID  142

Query  413  TGYGILYANVANV-TDPERFNEKLGNLVDGISKEAVVPENR---GLGKGKTKLSDFLTLY  580
                    N+     DPE FN+++  L+  +S++    +N    G  +   +      LY
Sbjct  143  NRNKFYMWNLQERDEDPEVFNKQVKRLLISLSEKVEGTKNLYVIGEVEMMIRTKGMEKLY  202

Query  581  ALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             LVQC+RDLS   C QCL IA+G   P  CNDK G RV+  SC  RYELYP 
Sbjct  203  GLVQCSRDLSSNACKQCLQIAIG-ELPNCCNDKIGGRVVGGSCNFRYELYPI  253



>ref|NP_566697.1| Receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
 sp|Q9LRJ9.1|CRR38_ARATH RecName: Full=Cysteine-rich repeat secretory protein 38; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB01391.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59407.1| unknown protein [Arabidopsis thaliana]
 gb|ABD91491.1| At3g22060 [Arabidopsis thaliana]
 gb|AEE76585.1| Receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
Length=252

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 97/168 (58%), Gaps = 1/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N V GLA CRGD SS DC SC++ A  E+R+RCP+     +WY+ C ++Y+   FFG++D
Sbjct  82   NNVNGLALCRGDASSSDCRSCLETAIPELRQRCPNNKAGIVWYDNCLVKYSSTNFFGKID  141

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
                    NV NV+DP  FN +   L+  ++K+A   +N+ L     K      LY LVQ
Sbjct  142  FENRFYLYNVKNVSDPSTFNSQTKALLTELTKKATTRDNQKLFATGEKNIGKNKLYGLVQ  201

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CTRDL  + C  CL   +G   P  C+ K+G RV+  SC  RYE+YPF
Sbjct  202  CTRDLKSITCKACLNGIIG-ELPNCCDGKEGGRVVGGSCNFRYEIYPF  248



>ref|XP_006372979.1| hypothetical protein POPTR_0017s06730g [Populus trichocarpa]
 gb|ERP50776.1| hypothetical protein POPTR_0017s06730g [Populus trichocarpa]
Length=242

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 99/168 (59%), Gaps = 2/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGL  CRGDVS+ DC +C+ EA+ EIRKRCP    A IWY+ C L+Y++  FFG+VD
Sbjct  74   DQTYGLDLCRGDVSTSDCKTCVVEASSEIRKRCPYNKAAIIWYDNCLLKYSNTGFFGQVD  133

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            TG      NV  V+ P  FN+K   L+  ++ EA     +    G+ +L     LY LVQ
Sbjct  134  TGNKFYMWNVHVVSKPAPFNKKTKELLSQLANEAQATP-KLFATGERELGKSTKLYGLVQ  192

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CT DLS   C +CL   +G   P  C+ K+G RV+  SC   YE+YPF
Sbjct  193  CTGDLSSAVCKKCLDGIIG-ELPSCCDGKQGGRVVSGSCNFIYEIYPF  239



>ref|XP_010051151.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89427.1| hypothetical protein EUGRSUZ_A01726 [Eucalyptus grandis]
Length=240

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 120/217 (55%), Gaps = 5/217 (2%)
 Frame = +2

Query  92   DPSGLFC-NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGD  268
            DP   FC N  +   +S   +N+ KL + L      +G+   + G   N+V+GLA CRGD
Sbjct  24   DPLFHFCSNPENFTASSPYESNLNKLTSFLYTKTPPSGFGLGSIGQYQNQVFGLALCRGD  83

Query  269  VSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVAN  448
             S   C +C+ +A  EIR+RCP    A IWY+ C  +Y D +FFG++D        N+ +
Sbjct  84   ASPSVCKACVADAGAEIRRRCPRNKGAIIWYDDCMFKYLDADFFGQIDKTNKFYMWNLND  143

Query  449  VTDPERFNEKLGNLVDGISKEA-VVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCA  625
            V+DP  FN K+  ++  ++K A  +P  R    G+  +     LY LVQCTRDLS   C 
Sbjct  144  VSDPALFNGKVRAMLTRLAKAASSIP--RLYAAGEKGVDSKTKLYGLVQCTRDLSATECE  201

Query  626  QCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            +CL  A+G   P  C+ K+G RV+  SC  RYE+YPF
Sbjct  202  KCLEGAIG-ELPSCCDGKEGGRVVGGSCNFRYEIYPF  237



>ref|XP_009793791.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
sylvestris]
Length=246

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 128/223 (57%), Gaps = 5/223 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            T  STDP   FC+ +     NS  + N+  +L +L       G++T++ G + ++ YG +
Sbjct  22   TVISTDPLFHFCSKSGNFTANSYYAKNLKNVLGDLYLKTPPTGFSTSSAGQTPDQTYGFS  81

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVSS +C SC+ +A++E+ K CP   +A IWY+ C L+Y+ ++F G++D  Y    
Sbjct  82   LCRGDVSSTNCKSCVVDASEELGKLCPYDKEAIIWYDNCLLKYSYNDFLGKIDNTYKFYM  141

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKL--SDFLTLYALVQCTRDL  607
             NV  V+ PE FN K   L+  + ++A   +N     G+ +L    +  LY LVQCTRDL
Sbjct  142  WNVRVVSKPESFNAKTKELLGSLVEKAYKKQNL-YANGEMELIGDQYEKLYGLVQCTRDL  200

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            S  +C QCL   +    P  C+ K+G RV+  SC  RYE+YPF
Sbjct  201  SSEDCKQCLE-GIITEIPSCCDGKEGGRVVGGSCNFRYEIYPF  242



>ref|XP_010087722.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
 gb|EXB29710.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
Length=667

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 104/175 (59%), Gaps = 11/175 (6%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N VYGL  CRGDV++  C  C++ A K++ +RCP    A +WY+ C LRY +  FFG+V 
Sbjct  76   NVVYGLFLCRGDVNATACRDCVKFAVKDVVERCPTEELAMLWYDECLLRYYNTSFFGQVA  135

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENR-GLGKGKTKLSD-----FLT  574
            T  G+   N ANVTD +RF   L N +    KEA V   R GLG+ K    D     F T
Sbjct  136  TRPGVYLLNTANVTDKDRFTRLLNNTM----KEAAVEAARGGLGEKKFATRDANINGFQT  191

Query  575  LYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            LY LVQCT DLS  +C  CL  A+G   P  C+ K G RVL+ SC +RYE+YPFY
Sbjct  192  LYNLVQCTPDLSGEDCGTCLTEAIG-RLPVCCDGKLGGRVLFPSCNIRYEVYPFY  245



>ref|XP_008342466.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=243

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N V+G+A CRGDVS K+C++C+ +A KE+R+RC     A IWY++C L+Y+D  FFG++D
Sbjct  73   NLVHGMALCRGDVSEKNCNTCVXDAGKELRQRCAYSKGAVIWYDHCLLKYSDVSFFGQID  132

Query  413  TGYGILYANVANV-TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
                   +NV  V  +   FNEK+  L+  +S EA     +    G+ +L    TLY + 
Sbjct  133  YATRFSMSNVREVDQNGTLFNEKVKELLSELSNEASDANPKLYATGELQLDTVTTLYGIA  192

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            QCTRDLS VNC +CL  A+ +  P  C  K G RV+  SC V +ELYP 
Sbjct  193  QCTRDLSGVNCKKCLDGAI-SELPNCCGAKLGGRVVGGSCNVGFELYPI  240



>ref|XP_009787631.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
sylvestris]
Length=246

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 129/223 (58%), Gaps = 5/223 (2%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            T  STDP   FC+ +     NS  + N+  +L +L       G++T++ G + +++YGL+
Sbjct  22   TVISTDPLFHFCSKSGNFTANSYYAKNLKNVLGDLYLKTPPTGFSTSSVGQTPDQIYGLS  81

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGDVSS +C SC+ +A++E+ K CP   +A IWY+ C L+Y+ ++F G++D  Y    
Sbjct  82   LCRGDVSSTNCKSCVVDASEELGKLCPYDKEAIIWYDNCLLKYSYNDFLGKIDNTYKFYM  141

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKL--SDFLTLYALVQCTRDL  607
             NV  V+ PE FN K   L+  + ++A   +N     G+ +L    +  LY LVQCTRDL
Sbjct  142  WNVRVVSKPESFNAKTKELLGSLVEKAYKKQNL-YANGEMELIGDQYEKLYGLVQCTRDL  200

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            S  +C QCL   +       C+ K+G RV+  SC  RYE+YPF
Sbjct  201  SSEDCKQCLE-GIITEISSCCDGKEGGRVVGGSCNFRYEIYPF  242



>ref|XP_004144485.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 ref|XP_004159198.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 gb|KGN43543.1| hypothetical protein Csa_7G044830 [Cucumis sativus]
Length=253

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 106/169 (63%), Gaps = 4/169 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+V  LA CRGDVS  DC +CIQ A+ EI+++C ++    IWY++CFL+Y++ +FFG++D
Sbjct  83   NQVNALALCRGDVSPTDCKTCIQVASNEIQQQCLNKKGGSIWYDFCFLKYSNIKFFGKID  142

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEA-VVPENRGLGKGKTKLSDFLTLYALV  589
             G+ +   NV    +P  FNE++ NL+  + ++  V P+   +G+ + + S    LY LV
Sbjct  143  NGFRLYMWNVQEAENPTVFNEQVKNLLTSLVEQVEVTPKLYVIGEKENEGSK--KLYGLV  200

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            QCTRDLS   C +CL  AV    P  C+ K G RV+  SC  RYE+YP 
Sbjct  201  QCTRDLSTAACKKCLTDAVA-ELPRCCDAKIGGRVIGGSCNFRYEIYPI  248



>ref|XP_003597035.1| Cysteine-rich repeat secretory protein [Medicago truncatula]
 gb|AES67286.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=246

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 129/227 (57%), Gaps = 8/227 (4%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCNTASKNLNSQT--STNILKLLTNLV---PaasragyataayggsgN  235
            I T   TDP    C+T S+N  + +   +N+  L+ +L+   P+      +         
Sbjct  20   IQTTLGTDPLFHICST-SENFTAHSPYESNLKTLINSLIYKTPSTGFGSGSIDLTQYQNQ  78

Query  236  KVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            K YGLA CRGDVS+ +C +C+ +A KEI   CP +  A IWY+ C  +Y D++FFG++D 
Sbjct  79   KAYGLALCRGDVSTSECKTCVSQATKEILNVCPYKKGAIIWYDNCMFKYLDNDFFGKIDN  138

Query  416  GYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQC  595
                   NV NV+DP +FN    +L+  ++ EA +  ++    G+ K+ +   +Y L QC
Sbjct  139  TNKFALLNVQNVSDPIKFNNMTNDLLSFLANEASM-NHKLYATGELKIGESERVYGLTQC  197

Query  596  TRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            TRD+S V+C +CL  A+ +  P  C+ KKG RV+  SC +RYE+YPF
Sbjct  198  TRDISSVDCKKCLDGAI-SELPNCCDGKKGGRVVGGSCNIRYEIYPF  243



>dbj|BAG87054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=164

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 97/159 (61%), Gaps = 6/159 (4%)
 Frame = +2

Query  344  DARIWYEYCFLRYTDDEFFGEVDT--GYGILYANVANVTDPERFNEKLGNLVDGISKEAV  517
            D+R+WYEYCF+RY +  F GEVDT     +      ++ +P+ F +  G  +   + +AV
Sbjct  10   DSRLWYEYCFMRYDNYNFLGEVDTREDASVTMRQWPDMDNPKAFQKAAGKAMGKATAQAV  69

Query  518  VPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVL  697
               + GLG+ K + + F+++YAL QCTRDLSP +CAQCL+ AV + F   C    GC++ 
Sbjct  70   AVGSSGLGRAKEQYTPFVSVYALAQCTRDLSPPSCAQCLSAAV-SKFDKACGSGPGCQID  128

Query  698  YSSCYVRYELYPFYFPLDPPEKSTVAASEARNYRSTVVH  814
            YSSC+ RYE+YPFYFPL    ++T+   +   Y    VH
Sbjct  129  YSSCWARYEIYPFYFPLAAAGRATI---DMTKYTKVTVH  164



>ref|XP_007043326.1| Cysteine-rich RLK 10, putative [Theobroma cacao]
 gb|EOX99157.1| Cysteine-rich RLK 10, putative [Theobroma cacao]
Length=642

 Score =   145 bits (366),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 102/175 (58%), Gaps = 2/175 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            +KVYGL QCRGDVS +DC +C+  AAKEI + CP++ +A I Y  C LRY+D  FF    
Sbjct  76   DKVYGLVQCRGDVSKEDCQTCVDTAAKEISQFCPNKTEAMIGYNNCSLRYSDWRFFSTAS  135

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
                    +  N TDP+ F+ +L +L   +S  A    ++    G T  SDF  +Y +VQ
Sbjct  136  NSPMFPIYSTRNATDPDLFDRQLADLFRNLSSTAASTTSK-FAVGSTSYSDFSDIYGMVQ  194

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPP  757
            CTRDL+  +C+ CL  A+ +  P  CN ++G R+   SC +R+ELY F+    PP
Sbjct  195  CTRDLAENSCSSCLQ-AIISYIPQCCNQRQGARIFTMSCNLRFELYTFFLAPSPP  248



>ref|XP_009418903.1| PREDICTED: cysteine-rich repeat secretory protein 38-like, partial 
[Musa acuminata subsp. malaccensis]
Length=250

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 106/169 (63%), Gaps = 2/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++V+GLA CRGDVSS  C +C+  A ++I + CP+ + + I Y+ C LRY++  FF  VD
Sbjct  73   DQVHGLALCRGDVSSSVCQTCLDAAVQDIIQSCPNGMTSTICYDDCLLRYSNQMFFSTVD  132

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T +     N+ NV+D ++F   LGNL+D ++++A     +    G  K++ F  LY LVQ
Sbjct  133  TSFRYWAWNIQNVSDQQQFETTLGNLMDDLTEKA-SSSPKLFAAGSAKVTSFDKLYGLVQ  191

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            C+RDLS  +C +CL   V    P  C+ K+G +V   SCY+R+ELYP+Y
Sbjct  192  CSRDLSADDCYRCLRDTV-TFIPKCCSWKQGGKVYAQSCYLRFELYPYY  239



>emb|CDP04889.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   144 bits (362),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 106/180 (59%), Gaps = 9/180 (5%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N VYGL  CRGDV+   C  C+  A  +I K C +R  A +WY+ C LRY+++  F   D
Sbjct  64   NMVYGLFNCRGDVNPDTCGRCVANARGDILKTCWNRTTAFVWYDECLLRYSNESMFSRAD  123

Query  413  TGYGILYA-NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFL----TL  577
             G  ILYA N  N TDP++FN+ LG+++  I+ +A    +R   K   K  D+      L
Sbjct  124  QGI-ILYAWNTQNATDPDKFNQVLGDMLKEIASQAA--NDRSGKKFAVKEEDYAPFQRRL  180

Query  578  YALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPP  757
            YAL QCT DLS  +C  CL+ A+ +  P  CN+++GCRV + SC +RYELY FY    PP
Sbjct  181  YALGQCTPDLSRNDCENCLSNAI-SQIPTLCNNRQGCRVTFFSCNIRYELYKFYNSTSPP  239



>ref|XP_010647173.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
Length=657

 Score =   145 bits (365),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 121/227 (53%), Gaps = 7/227 (3%)
 Frame = +2

Query  110  CNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCS  289
            C+  S+  ++   TN+  L ++L       G+     G + ++V+GL  CRGD +S DC 
Sbjct  34   CSNHSEIASNSYKTNLNSLFSSLTTKGPLTGFYNTTSGKTPDEVFGLVLCRGDDTSNDCQ  93

Query  290  SCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPERF  469
             CI+EA++E+ +RC    +  IWY+ C LRY+   FF  V     +   N  + +DP RF
Sbjct  94   ICIKEASQELLQRCNSTKEGTIWYDECLLRYSSQNFFSSVTLKKELSLLNTISASDPIRF  153

Query  470  NEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVG  649
            N  LG L+D IS EA    ++    G+  +S    +Y LVQCTRDLS  +C  CL  ++ 
Sbjct  154  NTILGQLMDNISSEAAFSSSQMFATGEAVVSSLQKIYGLVQCTRDLSKEDCNDCLESSI-  212

Query  650  NNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD------PPEKSTV  772
                  C+ K+G +V+  SC +RYE+YPF+          PPE + V
Sbjct  213  EKLSSCCSGKQGGQVISKSCILRYEVYPFFRGASTGATSPPPENAMV  259



>emb|CDP22123.1| unnamed protein product, partial [Coffea canephora]
Length=541

 Score =   144 bits (362),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 106/180 (59%), Gaps = 9/180 (5%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N VYGL  CRGDV+   C  C+  A  +I K C +R  A +WY+ C LRY+++  F   D
Sbjct  110  NMVYGLFNCRGDVNPDTCGRCVANARGDILKTCWNRTTAFVWYDECLLRYSNESMFSRAD  169

Query  413  TGYGILYA-NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFL----TL  577
             G  ILYA N  N TDP++FN+ LG+++  I+ +A    +R   K   K  D+      L
Sbjct  170  QGI-ILYAWNTQNATDPDKFNQVLGDMLKEIASQAA--NDRSGKKFAVKEEDYAPFQRRL  226

Query  578  YALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPP  757
            YAL QCT DLS  +C  CL+ A+ +  P  CN+++GCRV + SC +RYELY FY    PP
Sbjct  227  YALGQCTPDLSRNDCENCLSNAI-SQIPTLCNNRQGCRVTFFSCNIRYELYKFYNSTSPP  285



>ref|XP_010247024.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nelumbo 
nucifera]
Length=238

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/221 (40%), Positives = 128/221 (58%), Gaps = 9/221 (4%)
 Frame = +2

Query  86   STDPSGLFCN-TASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCR  262
            S DP   FC+ +A+   N     N+ +L   L       G+   + G + ++V GLA CR
Sbjct  20   SADPLFHFCSGSANYTSNGTYEKNLNQLTDYLSSKVPPTGFGFDSVGEAPDRVNGLALCR  79

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GDVS++DC SC+  A  EIR+RCP+  +A IWY+ C L+Y++ +F G++D  Y     N 
Sbjct  80   GDVSTEDCKSCVIGANSEIRQRCPNDKEAIIWYDNCLLKYSNLDFSGKIDYKYRFYMWNT  139

Query  443  ANVTDPERFNEKLGNLVDGISKEAVVPENRG---LGKGKTKLSDFLTLYALVQCTRDLSP  613
             NV+DP  FN+K   L+  ++++A     RG      G+ +L + +TLY LVQCTRDL  
Sbjct  140  QNVSDPASFNQKTEELLSRLAEQAY----RGAMLFATGEQQLDEAVTLYGLVQCTRDLPS  195

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
              C +CL  A+ +  P  C+ K+G RV+  SC  RYELYPF
Sbjct  196  AGCKRCLDDAI-SELPSCCDGKRGGRVVGGSCNFRYELYPF  235



>ref|XP_004961654.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Setaria italica]
Length=678

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 105/169 (62%), Gaps = 1/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGLAQCR D+++ DC +C+  +A+++   CP +  A + Y+ C LR+++  F G VD
Sbjct  85   DQAYGLAQCRADLNASDCRACLDGSARDMTAMCPGQKSAMLIYDGCLLRHSNASFSGVVD  144

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T   +   N  N+T PE F+ +LG L+  ++ +A     +    G+T L+ F+ ++ + Q
Sbjct  145  TSAWVCMCNTQNMTQPEEFSSRLGALMGNLTAKAAYASPQMFAAGETSLTPFVNIFGMAQ  204

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            CTRDL   +C +CL  AV  + P  C+ K+G RV+Y +C VRYE+YPFY
Sbjct  205  CTRDLDDDDCNRCLTRAVA-SIPSCCDRKQGGRVIYRTCSVRYEVYPFY  252



>ref|XP_010056929.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=527

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 102/170 (60%), Gaps = 3/170 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            +KVYGL  CRGDV++  C SCI  A ++I + CP+  +A IWY+ C +RY++  FF  ++
Sbjct  80   DKVYGLFLCRGDVAANLCQSCIDSATRKILENCPEEKEAIIWYDECLVRYSNRSFFTIME  139

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            +   +   NV NVTDP RF + L      ++  A +   R     K   S  +TL+ LVQ
Sbjct  140  STPALYMWNVNNVTDPNRFLQILRETFKNVTDSA-ISSKRLYATIKFNFSSLVTLHELVQ  198

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCND-KKGCRVLYSSCYVRYELYPFY  739
            CT DLS +NC+ CL  A+G   P F  D K+G RVL  SC +RYELYPFY
Sbjct  199  CTPDLSKLNCSDCLVSAIG-QLPTFIGDGKQGGRVLLPSCNIRYELYPFY  247



>emb|CAN73036.1| hypothetical protein VITISV_044346 [Vitis vinifera]
Length=229

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 99/158 (63%), Gaps = 2/158 (1%)
 Frame = +2

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GDVS+ DC  CI EA+ EIRK CPD   A +WY++C L+Y++  FFG+VD        N+
Sbjct  70   GDVSNTDCKDCITEASTEIRKLCPDNKAAIVWYDHCLLKYSNMNFFGQVDYQNRFYMWNL  129

Query  443  ANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNC  622
             NV+DP  FN+K   L+  ++++  V + +    G+ +L +   LY L QCTRDLS  +C
Sbjct  130  NNVSDPTSFNQKTKELLSHLAQQXFVNQ-KMYAVGELELEESKKLYGLTQCTRDLSSSDC  188

Query  623  AQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             +CL  A+ +  P  C+ K+G RV+  SC +RYE+YPF
Sbjct  189  KKCLDDAI-SELPSCCDGKEGGRVVGGSCNIRYEIYPF  225



>ref|XP_004292427.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Fragaria 
vesca subsp. vesca]
Length=244

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 106/168 (63%), Gaps = 3/168 (2%)
 Frame = +2

Query  236  KVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            K  GLA CRGDVSS+DC++C+ +A+K+IR+ CP+   A IWY++C L+Y++ +FFG++D 
Sbjct  74   KANGLALCRGDVSSEDCTTCVVDASKDIREFCPNSKGAIIWYDHCLLKYSNVDFFGKIDN  133

Query  416  GYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPEN--RGLGKGKTKLSDFLTLYALV  589
                   NV  V +P  FN+ + +L+ G++ EA       +    G+ +L  F TLY L 
Sbjct  134  KNKFYMWNVQEVQNPTLFNKSVKDLLSGLAVEASEAAAAPKFYATGELQLDTFTTLYGLA  193

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYP  733
             CTRDLS  +C +CL  AV +  P  C+ K+G RV+  SC V +ELYP
Sbjct  194  TCTRDLSAADCKKCLDGAV-SELPNCCSAKRGGRVVGGSCNVGFELYP  240



>ref|XP_010679273.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Beta 
vulgaris subsp. vulgaris]
Length=238

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 99/168 (59%), Gaps = 2/168 (1%)
 Frame = +2

Query  236  KVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            + +GL  CRGDVSS DC SCI EA  + RK CP    A IWY++C  +Y D  FFG++D 
Sbjct  69   QAHGLGLCRGDVSSFDCLSCISEAGIQARKLCPGNKGAVIWYDHCMFKYLDQNFFGQIDQ  128

Query  416  GYGILYANVANVTDPER-FNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
               +   NV NVT+ +  F +K   L+  +S+EA V   R    G+  +    T+Y L Q
Sbjct  129  SVAVSLLNVNNVTNNQMLFIQKNSELLGKLSEEASVDTKR-YASGEIIVDGNTTIYGLAQ  187

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CTRDLS  NC +CL   + +N P  C  K+G RVL  SC VRYE+YPF
Sbjct  188  CTRDLSSYNCKKCLDYQITSNLPNCCEGKRGGRVLVGSCNVRYEVYPF  235



>ref|XP_011037144.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=245

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 101/169 (60%), Gaps = 2/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGL  CRGDVSS DC +C   A +EIRKRCP+   A I Y+ C L+Y+D +FFG++D
Sbjct  75   DRPYGLVLCRGDVSSSDCRTCAANATREIRKRCPNSKRAIIAYDNCLLKYSDSDFFGQID  134

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSD-FLTLYALV  589
                    NV NV++P  FNEK   L+  ++ +A    ++    G+  L +  + LY + 
Sbjct  135  EQNKFYMWNVNNVSNPVLFNEKTTELLSQLADKASYNSSKLYAAGEMDLLEGSMKLYGMA  194

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            +CTRDLS V+C +CL  A+G   P     K+G RV+  SC V YE+YP 
Sbjct  195  ECTRDLSSVDCKKCLDGAIG-ELPRVAYGKEGARVVGGSCMVIYEIYPI  242



>ref|XP_006351952.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
tuberosum]
Length=244

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 126/221 (57%), Gaps = 3/221 (1%)
 Frame = +2

Query  77   TAQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            T  ST+P   FC N+ +   NS  + N+  LL +L       G++T + G + ++  GL+
Sbjct  22   TVISTNPLFHFCSNSENFTANSYYAQNLKNLLGDLYLKTPPTGFSTCSIGQNHDQTNGLS  81

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGD+SS +C SC+ +A++E+ KRCP   +A IWY+ C L+Y+D +F G++D       
Sbjct  82   LCRGDISSNNCKSCVLDASEELGKRCPYDKEAIIWYDNCLLKYSDKDFLGKIDNMNKFYM  141

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             NV  V +P+ FN K   L+  ++  A    N     G+ ++ +   LY LVQCTRDLS 
Sbjct  142  WNVRVVKNPKYFNAKTKELLGNLAANAYKTSNL-YATGEMEIEENKKLYGLVQCTRDLSN  200

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             +C +CL   + N  P  C+ K+G RV+  SC   YE+YPF
Sbjct  201  EDCKKCLD-GIINELPSCCDGKEGGRVISGSCNFIYEIYPF  240



>gb|KHN24392.1| Cysteine-rich receptor-like protein kinase 5 [Glycine soja]
Length=521

 Score =   142 bits (358),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 124/240 (52%), Gaps = 18/240 (8%)
 Frame = +2

Query  83   QSTDPSGLF--CNTASKNLNSQTSTNILKLLTNL---VPaasragyataayggsgNKVYG  247
            QS+ P  L+  C   +   NS    N+  LL++L    P  +     T       + V+G
Sbjct  38   QSSTPVYLYHYCYGRNTTANSAFQINVGNLLSSLSSNYPGDNGFYNTTVPALNPSDSVFG  97

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            L  CRGDV  + C  C+Q A +++   C   ++A IWYE C +RY++  FF  VDT    
Sbjct  98   LFMCRGDVPPQLCQHCVQSATQQLSSLCSLSIEAVIWYEECTVRYSNRSFFSTVDTTLAY  157

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
               N ANV++ E F   L + ++  + EA   +++     +T +S+F +LY L QCT DL
Sbjct  158  ALLNTANVSNQESFMSLLFSTINKTADEA-AKDDKKFATSQTSISEFQSLYCLAQCTPDL  216

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY-----------FPLDP  754
            SP++C  CL+  +G + P  C  K G RVL  SC VRYELYPFY           FP DP
Sbjct  217  SPLDCRSCLSQVIG-DLPWCCEGKPGGRVLCPSCNVRYELYPFYRSTNYPDADSQFPEDP  275



>gb|EYU43106.1| hypothetical protein MIMGU_mgv1a021349mg, partial [Erythranthe 
guttata]
Length=220

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 123/209 (59%), Gaps = 3/209 (1%)
 Frame = +2

Query  113  NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCSS  292
            NT + + NS    N+ KLL +L       G+   + G   ++VYGL+ CRGDVS+ DC +
Sbjct  12   NTQNFSTNSLYERNLNKLLGDLYFKTPPTGFGFGSSGQYNDRVYGLSLCRGDVSTNDCKT  71

Query  293  CIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV-TDPERF  469
            C+ EA+ ++ K CP+   A +WY+ C+L+Y+D +F G++D        N+ NV T+ E F
Sbjct  72   CVVEASSQVTKICPNLKGAVVWYDNCYLKYSDVDFHGKIDNRNKFYMWNLNNVSTNAELF  131

Query  470  NEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVG  649
            N+K   L++ +S  A    ++    G+T +     +Y +VQC+RDLS  +C +CL  AV 
Sbjct  132  NQKTRELIENLSTNA-SRTSKMYANGETDIGIESKIYGMVQCSRDLSRDDCKKCLDGAV-  189

Query  650  NNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            +  P  C  K+G RV+  SC +RYE+YPF
Sbjct  190  SELPSCCGGKQGGRVVGGSCNIRYEIYPF  218



>gb|KDO37425.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=418

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 103/199 (52%), Gaps = 14/199 (7%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+VYGL  CRGD ++ DC  C+  AA+++ + CP   +  +WY  C LRY+D   F  + 
Sbjct  83   NRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKETILWYAECLLRYSDQSIFSTMA  142

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T   +   N  NVTD  R NE +G  +  +  +AV    R     K   + F TLY+L Q
Sbjct  143  TSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNTKR-FATRKANFTTFQTLYSLAQ  201

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY-----------  739
            CT DLS  +C  CL  AV    P  C+ K+G RVL+ SC VRYELYPFY           
Sbjct  202  CTPDLSSSDCNTCLRGAVA-RLPSCCSGKQGGRVLFPSCNVRYELYPFYNESATAPPAPA  260

Query  740  -FPLDPPEKSTVAASEARN  793
               L PP   +V  S  ++
Sbjct  261  PVLLSPPPPGSVTTSRGKS  279



>ref|XP_006352035.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
tuberosum]
Length=244

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 126/221 (57%), Gaps = 3/221 (1%)
 Frame = +2

Query  77   TAQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLA  253
            T  ST+P   FC N+ +   NS  + N+  LL +L       G++T + G + ++  GL+
Sbjct  22   TVISTNPLFHFCSNSENFTANSYYAQNLKNLLGDLYLKTPPTGFSTCSIGQNHDQTNGLS  81

Query  254  QCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILY  433
             CRGD+SS +C SC+ +A++E+ KRCP   +A IWY+ C L+Y+D +F G++D       
Sbjct  82   LCRGDISSNNCKSCVLDASEELGKRCPYDKEAIIWYDNCLLKYSDKDFLGKIDNMNKFYM  141

Query  434  ANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSP  613
             NV  V +P+ FN K   L+  ++  A    N     G+ ++ +   LY LVQCTRDLS 
Sbjct  142  WNVRVVKNPKYFNAKTKELLGNLAANAYKTSNL-YATGEMEIEENKKLYGLVQCTRDLSN  200

Query  614  VNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             +C +CL   +    P  C+ K+G RV+  SC  RYE+YPF
Sbjct  201  DDCKKCLD-GIITEIPSCCDGKEGGRVVGGSCNFRYEIYPF  240



>ref|XP_006850460.1| hypothetical protein AMTR_s00035p00082360 [Amborella trichopoda]
 gb|ERN12041.1| hypothetical protein AMTR_s00035p00082360 [Amborella trichopoda]
Length=244

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 100/171 (58%), Gaps = 5/171 (3%)
 Frame = +2

Query  236  KVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            K +GL  CR DV+  DC  C+++A  EIR  CP++ +A +W++YC + Y++  FFG++D 
Sbjct  74   KYHGLGLCRADVTRYDCKVCMEDATAEIRHLCPNKEEAIVWFDYCLVHYSNKSFFGKIDE  133

Query  416  GYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLS---DFLTLYAL  586
               I   N  NV+ P  FN  LG L+   S +A +  +     G+ +LS   D  T+Y L
Sbjct  134  KNKIYMWNTLNVSAPHLFNRYLGELMYQFSSQASLSLSF-FATGEIQLSEVGDKTTIYGL  192

Query  587  VQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
             QC+ DLS  +C  CL   +G   P  C+ K+G RVL  SC +RYE+YPFY
Sbjct  193  AQCSYDLSSGDCKACLDEVIG-ELPTRCSGKQGGRVLTGSCNIRYEVYPFY  242



>ref|XP_003632027.1| PREDICTED: cysteine-rich receptor-like protein kinase 19 [Vitis 
vinifera]
Length=670

 Score =   143 bits (360),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/226 (37%), Positives = 126/226 (56%), Gaps = 3/226 (1%)
 Frame = +2

Query  107  FCNTASKNLNSQTSTNILKLLT-NLVPaasragyataayggsgNKVYGLAQCRGDVSSKD  283
            FCN  S   +++  +N+  LL+ +L      + ++    G   +KVYGL  CR DVS   
Sbjct  34   FCNNNSHAGSTKFQSNLGALLSRSLNNEGGISSFSMVYEGEDPDKVYGLFLCRPDVSKHI  93

Query  284  CSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPE  463
            C SCI  A  +I + C  + +A IWY  CFLRY++  FF  ++    +   N  N + P+
Sbjct  94   CQSCIDAATLKIVQVCQHKKEAIIWYNECFLRYSNRSFFSNLEMKPTLYMWNTQNASAPD  153

Query  464  RFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIA  643
            +F++KLG +   ++ +A   ++     G+ ++S+FL LY +VQCTRDL    C +CL   
Sbjct  154  KFDQKLGEMFQNLTAQATSSDDM-YAIGQVEVSNFLNLYGIVQCTRDLRMSYCRRCLDEV  212

Query  644  VGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTVAAS  781
            VG   P F   K+G RVL  SCY+RYE+YPF    DP  ++ V +S
Sbjct  213  VG-YIPNFMEGKQGGRVLAPSCYIRYEVYPFAAVEDPVVEAQVPSS  257



>ref|XP_008224859.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Prunus 
mume]
Length=668

 Score =   143 bits (360),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 99/170 (58%), Gaps = 4/170 (2%)
 Frame = +2

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKE-IRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            VYG   CR D++S  C  C+  AA+E +++ CP R    IWY+ C LRY++  FFG +D 
Sbjct  79   VYGSFLCRADLTSDACQDCVATAARETVQQYCPLRKVTIIWYDDCMLRYSNVSFFGNMDE  138

Query  416  GYGILYANVANVTDPERFNEKLGNLVDGISKEA--VVPENRGLGKGKTKLSDFLTLYALV  589
               +   NV N+TDP RFN+ L + ++G+   A       +     K   + F  LY+LV
Sbjct  139  APRVSLWNVGNITDPNRFNKVLADTINGLVPAAANAASGTKKFAAKKVNFTAFQELYSLV  198

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT DLS   C +CL  A+  N P  CN K+G RVLY SC VRYE+YPFY
Sbjct  199  QCTPDLSSTACDRCLIGAIA-NLPACCNGKQGGRVLYPSCNVRYEVYPFY  247



>gb|KDO37424.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=437

 Score =   140 bits (354),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 103/199 (52%), Gaps = 14/199 (7%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+VYGL  CRGD ++ DC  C+  AA+++ + CP   +  +WY  C LRY+D   F  + 
Sbjct  83   NRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKETILWYAECLLRYSDQSIFSTMA  142

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T   +   N  NVTD  R NE +G  +  +  +AV    R     K   + F TLY+L Q
Sbjct  143  TSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNTKR-FATRKANFTTFQTLYSLAQ  201

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY-----------  739
            CT DLS  +C  CL  AV    P  C+ K+G RVL+ SC VRYELYPFY           
Sbjct  202  CTPDLSSSDCNTCLRGAVA-RLPSCCSGKQGGRVLFPSCNVRYELYPFYNESATAPPAPA  260

Query  740  -FPLDPPEKSTVAASEARN  793
               L PP   +V  S  ++
Sbjct  261  PVLLSPPPPGSVTTSRGKS  279



>gb|KHN24396.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=505

 Score =   141 bits (356),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 123/231 (53%), Gaps = 7/231 (3%)
 Frame = +2

Query  83   QSTDPSGLF--CNTASKNLNSQTSTNILKLLTNL---VPaasragyataayggsgNKVYG  247
            QS+ P  ++  C+  +   NS    N+  LL++L    P  +     T       + V+G
Sbjct  26   QSSTPVYIYHNCSGGNTTANSAFQINVRTLLSSLSSNAPGDNGFYNTTVPPENPSDSVFG  85

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            L  CRGDV  + C  C+Q A + +R  C   + A IWY+ C +RY++  FF  VDT   +
Sbjct  86   LFMCRGDVPPQLCQQCVQNATQRLRSMCSLSIQAVIWYDECTVRYSNRSFFSTVDTRPRV  145

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
               N AN+++ E F   + + ++  + EA    ++     +T +S+F  LY L QCT DL
Sbjct  146  GLLNTANISNQESFMRLMFSTINKTADEAAT-NDKKFATRQTNISEFQNLYCLAQCTPDL  204

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPE  760
            SP++C  CL+  +G +    C  K+G RVLY SC VRYELYPFY   + P+
Sbjct  205  SPLDCRSCLSKVIG-DLSWCCEGKQGGRVLYPSCNVRYELYPFYRSTNYPD  254


 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 93/188 (49%), Gaps = 7/188 (4%)
 Frame = +2

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTG  418
            VYGL  CRGD+ S+ C  C+  A   I   C    +  IWY +C LRY++  FF E++  
Sbjct  310  VYGLFMCRGDLPSQLCQQCVLNATHRISSVCNSLQEGIIWYSHCMLRYSNRNFFSELEES  369

Query  419  -----YGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYA  583
                   +  ++   +     F   L + +  +++EA     R + K   KL+D  TLY 
Sbjct  370  PKTDMLSVTTSSTGPIPGQNFFTYTLSDTIVKLAQEAGDTTERYVTKS-LKLTDLQTLYT  428

Query  584  LVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEK  763
            L QCT+DLS   C +CL   +    P F     G RVLY SC +R+EL+ FY   D   +
Sbjct  429  LAQCTQDLSSDGCKKCLE-DINGKIPWFRLGSVGGRVLYPSCNLRFELFQFYRGSDEETQ  487

Query  764  STVAASEA  787
            S + A+ +
Sbjct  488  SPMPANPS  495


 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 78/188 (41%), Gaps = 21/188 (11%)
 Frame = +2

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFF-----G  403
            +Y LAQC  D+S  DC SC+ +   ++   C  +   R+ Y  C +RY    F+      
Sbjct  194  LYCLAQCTPDLSPLDCRSCLSKVIGDLSWCCEGKQGGRVLYPSCNVRYELYPFYRSTNYP  253

Query  404  EVDTGYG-----ILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDF  568
            + D+ +      + ++   NVT    F   L  L+  +S  A          GK    D 
Sbjct  254  DADSQFSEDPTYLNHSCPTNVTVGSTFQMYLKTLLFYLSSNAT--------NGKKYYEDN  305

Query  569  L--TLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYF  742
            +  T+Y L  C  DL    C QC+  A  +     CN  +   + YS C +RY    F+ 
Sbjct  306  VEQTVYGLFMCRGDLPSQLCQQCVLNAT-HRISSVCNSLQEGIIWYSHCMLRYSNRNFFS  364

Query  743  PLDPPEKS  766
             L+   K+
Sbjct  365  ELEESPKT  372



>ref|XP_010267891.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=673

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 108/170 (64%), Gaps = 3/170 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            +KVYGL  CRGDV+S  C SCI  A+ +I ++CP R  A IW++ CF+RY+D  FF  +D
Sbjct  89   DKVYGLFLCRGDVASDLCPSCIDVASHQIIEKCPGRKRATIWFDECFVRYSDTPFFSILD  148

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVV-PENRGLGKGKTKLSDFLTLYALV  589
            +    ++ N  NV++ + FN++L N+++ ++  A   P  R    G+   ++F ++Y L 
Sbjct  149  SPSFYMW-NTQNVSETDGFNQQLENMLNQLTTRAAFDPAARMFATGEVNFTEFRSIYGLA  207

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT DLS  +C  CL  A+ +  P  C+ K+G RV+  +CYVRYE+YPFY
Sbjct  208  QCTSDLSRNDCNTCLLTAI-SYIPICCDGKQGGRVIGQNCYVRYEIYPFY  256



>ref|XP_003541936.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Glycine 
max]
Length=245

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 124/219 (57%), Gaps = 7/219 (3%)
 Frame = +2

Query  92   DPSGLFCNTASKNL--NSQTSTNILKLLTNLVPaasragyataayggsgN-KVYGLAQCR  262
            +P   FC ++S+N   NS   +N+  L+ +L+      G+   + G   N K YGLA CR
Sbjct  27   NPLYHFC-SSSQNFKANSPYESNLKTLINSLIYRTPSTGFGVGSVGQYQNEKAYGLALCR  85

Query  263  GDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANV  442
            GDVSS +C +C+ +A KEI  RCP      IWY+ C L+Y D +FFG++D        NV
Sbjct  86   GDVSSSECKTCVSDATKEILSRCPYNKGGIIWYDNCMLKYLDTDFFGKIDNTNKFSLLNV  145

Query  443  ANVTDPERFNEKLGNLVDGIS-KEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVN  619
             NV+DP  FN     L+  ++ + ++ P+    G+ K    +   +Y L QCTRDLS  +
Sbjct  146  RNVSDPAMFNYMTKELLSLLAYRASLSPKMYASGELKIG-GESKDIYGLTQCTRDLSSSD  204

Query  620  CAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            C +CL  A+ +  P  C+ K+G RV+  SC +RYE+YPF
Sbjct  205  CNKCLDDAI-SQLPNCCDGKEGGRVVAGSCNIRYEIYPF  242



>ref|XP_007214583.1| hypothetical protein PRUPE_ppa026781mg [Prunus persica]
 gb|EMJ15782.1| hypothetical protein PRUPE_ppa026781mg [Prunus persica]
Length=659

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 99/170 (58%), Gaps = 4/170 (2%)
 Frame = +2

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKE-IRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            VYG   CR D++S  C  C+  AA+E +++ CP R    IWY+ C LRY++  FFG +D 
Sbjct  70   VYGSFLCRADLTSDACKDCVATAARETVKEYCPFRKVTIIWYDDCMLRYSNVSFFGNMDE  129

Query  416  GYGILYANVANVTDPERFNEKLGNLVDGISKEA--VVPENRGLGKGKTKLSDFLTLYALV  589
               +   NV N+TDP RFN+ LG  ++G+   A       +     KT  + F  LY+LV
Sbjct  130  APRVYLWNVGNITDPNRFNKVLGETINGLVPVAANAASGTKKFAAKKTNFTAFQELYSLV  189

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT DLS   C +CL  A+    P  CN K+G RVLY SC VRYE+YPFY
Sbjct  190  QCTPDLSSTACDRCLIGAIA-LLPACCNGKQGGRVLYPSCNVRYEVYPFY  238



>gb|KDO37426.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=438

 Score =   140 bits (353),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 103/199 (52%), Gaps = 14/199 (7%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+VYGL  CRGD ++ DC  C+  AA+++ + CP   +  +WY  C LRY+D   F  + 
Sbjct  83   NRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKETILWYAECLLRYSDQSIFSTMA  142

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T   +   N  NVTD  R NE +G  +  +  +AV    R     K   + F TLY+L Q
Sbjct  143  TSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNTKR-FATRKANFTTFQTLYSLAQ  201

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY-----------  739
            CT DLS  +C  CL  AV    P  C+ K+G RVL+ SC VRYELYPFY           
Sbjct  202  CTPDLSSSDCNTCLRGAVA-RLPSCCSGKQGGRVLFPSCNVRYELYPFYNESATAPPAPA  260

Query  740  -FPLDPPEKSTVAASEARN  793
               L PP   +V  S  ++
Sbjct  261  PVLLSPPPPGSVTTSRGKS  279



>ref|XP_010646958.1| PREDICTED: uncharacterized protein LOC100265431, partial [Vitis 
vinifera]
Length=1495

 Score =   144 bits (363),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 117/209 (56%), Gaps = 1/209 (0%)
 Frame = +2

Query  110   CNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCS  289
             C+  S+  ++   TN+  L ++L       G+     G + ++V+GL  CRGD +S DC 
Sbjct  1288  CSNHSEIASNSYKTNLNSLFSSLTTKGPLTGFYNTTSGKTPDEVFGLVLCRGDDTSNDCQ  1347

Query  290   SCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPERF  469
              CI+EA++E+ +RC    ++ IWY+ C LRY+   FF  V     +   N  + +DP RF
Sbjct  1348  ICIKEASQELLQRCNSSKESTIWYDECLLRYSSQNFFSSVTLKKELSLLNTISASDPIRF  1407

Query  470   NEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVG  649
             N  LG L+D IS EA    ++    G+  +S    +Y LVQCTRDLS  +C  CL  ++ 
Sbjct  1408  NTILGQLMDNISSEAAFSSSQMFATGEAVVSSLQKIYGLVQCTRDLSKEDCNDCLESSI-  1466

Query  650   NNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
                   C+ K+G +V+  SC++RYE+YPF
Sbjct  1467  EKLSSCCSGKQGGQVISKSCFLRYEVYPF  1495


 Score =   104 bits (260),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 89/169 (53%), Gaps = 3/169 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N++Y L  CRGDV +  C +C++ A++EI+KRC     A IWY+ C +RY++  FFG   
Sbjct  116  NQIYSLYLCRGDVDATTCQNCVKTASQEIQKRCQSNKTAIIWYDECIVRYSNLNFFGIGQ  175

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T   +L  N  N +  E    +   ++  +   A   EN      + KL D    Y LVQ
Sbjct  176  TTPMVLMWNAQNTSSREEPPWEAVGMISELLANAPYAENM-FNTSEKKL-DSGYRYGLVQ  233

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            C+RD+    C  CL   +  N    CN ++G +++  SCY+RYE + FY
Sbjct  234  CSRDMGRDECRNCLT-QLRENISQCCNGRRGWQIMCPSCYLRYEDHQFY  281


 Score = 98.6 bits (244),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 88/176 (50%), Gaps = 3/176 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N++Y L  CRGDV++  C +C++ A++E++++C     A IWY+ C LRY+ + FFG   
Sbjct  748  NQIYSLYLCRGDVNATTCQNCVRTASQEVQQQCQSNRTAIIWYDECKLRYSSENFFGIAA  807

Query  413  TGYGILYANVANVTDP-ERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
            T    L  N  N + P ER    L  +   +SK        G    +   +    +Y  V
Sbjct  808  TSPYFLLWNTRNNSSPDERDVGGLAFIYTLVSKAPNSENMFGTDVAEAVNNASQNIYGSV  867

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY-FPLDP  754
            QCTRD+S   C  CL   +     G C  K G  ++  SC +RYE Y FY  PL P
Sbjct  868  QCTRDISNDECRSCLLQQI-EEIEGCCQGKIGWNIMGPSCNMRYEQYLFYQQPLAP  922



>gb|KDO37427.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=467

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 103/199 (52%), Gaps = 14/199 (7%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+VYGL  CRGD ++ DC  C+  AA+++ + CP   +  +WY  C LRY+D   F  + 
Sbjct  83   NRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKETILWYAECLLRYSDQSIFSTMA  142

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T   +   N  NVTD  R NE +G  +  +  +AV    R     K   + F TLY+L Q
Sbjct  143  TSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNTKR-FATRKANFTTFQTLYSLAQ  201

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY-----------  739
            CT DLS  +C  CL  AV    P  C+ K+G RVL+ SC VRYELYPFY           
Sbjct  202  CTPDLSSSDCNTCLRGAVA-RLPSCCSGKQGGRVLFPSCNVRYELYPFYNESATAPPAPA  260

Query  740  -FPLDPPEKSTVAASEARN  793
               L PP   +V  S  ++
Sbjct  261  PVLLSPPPPGSVTTSRGKS  279



>ref|XP_006406217.1| hypothetical protein EUTSA_v10021371mg [Eutrema salsugineum]
 dbj|BAJ34612.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47670.1| hypothetical protein EUTSA_v10021371mg [Eutrema salsugineum]
Length=255

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 97/168 (58%), Gaps = 1/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            + V GLA CRGD SS DC SC+  A  E+R+RCP+     IWY+ C ++Y+   FFG++D
Sbjct  85   DNVNGLALCRGDASSSDCGSCLATAIPELRQRCPNNKAGIIWYDNCLVKYSSTNFFGKID  144

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
                    NV NV+DP  FN +   L+  ++++A   +N+ L     K  +   LY LVQ
Sbjct  145  YENRFYLYNVNNVSDPASFNTQTKALLTELTQKATTGDNQKLFATGEKNLEKKKLYGLVQ  204

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CTRDL   +C  CL   +G   P  C+ K+G RV+  SC  RYE+YPF
Sbjct  205  CTRDLRRESCKACLDGIIG-ELPNCCDGKEGGRVVGGSCNFRYEIYPF  251



>ref|XP_008224765.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Prunus 
mume]
Length=679

 Score =   141 bits (356),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 100/171 (58%), Gaps = 3/171 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKD-CSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEV  409
            ++VYGL  CRGDV++ D C +C+  A  E  +RCP      IWY+ C LRY+++ FF   
Sbjct  92   DRVYGLFLCRGDVAATDACKTCVSNATSEAVQRCPTEKQVVIWYDDCMLRYSNESFFSTA  151

Query  410  DTGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
                 +   N  N T+P RFN+ L   +D ++ EA    ++     +T +S  +++Y+L 
Sbjct  152  AESPAVYMWNTQNATEPTRFNQVLATGMDEVATEASTDADK-FATSQTNVSGLISVYSLG  210

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYF  742
            QCT+DLS  +C +CL  A+   FP  CN K G RV   SCYVRYE+YPF+ 
Sbjct  211  QCTQDLSTADCNRCLRGAIA-QFPSCCNGKLGGRVFNPSCYVRYEVYPFFL  260



>ref|XP_009357384.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=663

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 118/213 (55%), Gaps = 8/213 (4%)
 Frame = +2

Query  113  NTASKNLNSQTSTNILKLLTNLVPaasragy-ataayggsgNKVYGLAQCRGDVSSKD-C  286
            NT +   NS   +N+ +LL+NL   A+R+          + N VYGL  CRGDV   D C
Sbjct  34   NTTTFTPNSTFQSNLNRLLSNLSSNANRSTGFYNVTVQTTNNAVYGLFLCRGDVVGTDAC  93

Query  287  SSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPER  466
             +C+  A  E  +RCP      IWY+ C LRY+++ FF  V     +   N  N TDP R
Sbjct  94   ETCVATATTEAPQRCPVEKQVVIWYDDCMLRYSNESFFSTVTESPSVFMWNTQNATDPTR  153

Query  467  FNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCL--AI  640
            FN+ +   V+  + EAV   ++  G  +  +S  +++Y+L QCT+DLS  +C +CL   I
Sbjct  154  FNQVMAASVNQAASEAVGDADK-FGTNQANVSGLISVYSLGQCTQDLSATDCNRCLRGTI  212

Query  641  AVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            A+    P  CN K G RVL+ SC VRYE+YPFY
Sbjct  213  AL---LPSCCNRKLGGRVLFPSCNVRYEVYPFY  242



>ref|XP_003559575.2| PREDICTED: putative receptor-like protein kinase At4g00960 [Brachypodium 
distachyon]
Length=675

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 102/169 (60%), Gaps = 1/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGLAQCR D+++ DC +C+  + +++  +CP + +A ++Y+ C LR+ +  FFG  D
Sbjct  78   DQAYGLAQCRADLNASDCRACLDTSVRDMASKCPGQKNAMLFYDACVLRHANVSFFGADD  137

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T      AN  N T+PERF   LG L+  +++ A     R    G T L+ F+ +Y + +
Sbjct  138  TSREYPLANPGNATEPERFTPILGKLMGNLARRAAFESPRMFAVGMTSLTPFVNIYGMAE  197

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            C RDL   +C  CL  AV +  P  C+ K+G RV++ +C VR+E+YPFY
Sbjct  198  CIRDLRADDCNSCLVDAV-SRIPSCCDGKQGGRVVFRTCSVRFEVYPFY  245



>gb|KCW76447.1| hypothetical protein EUGRSUZ_D00839 [Eucalyptus grandis]
Length=271

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 103/171 (60%), Gaps = 3/171 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N V  +  CRGDV + DC SC+ E+A EI ++CP + +A +WY+ C LRY++   FG V+
Sbjct  68   NAVNAIFLCRGDVGAADCRSCLNESAAEIARQCPVQKEAIVWYDKCMLRYSNRSIFGVVE  127

Query  413  TGYGILYANVANVT-DPERFNEKLGNLVDGISKEAVVPEN-RGLGKGKTKLSDFLTLYAL  586
                +   NV NV+ + ++FN+ L NL D +   A    + R    G     +F TL+ L
Sbjct  128  VSPYMYMWNVNNVSKNVDQFNQDLRNLTDDLRDRAASGNSTRKFAVGNATAPNFKTLFGL  187

Query  587  VQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            +QCT DLS + C  CL  AVG + P  C+ K+G RV+Y SC +R+E+YPF+
Sbjct  188  MQCTPDLSQLQCEDCLTRAVG-DIPRCCDQKEGGRVIYPSCKIRFEVYPFF  237



>emb|CAN65425.1| hypothetical protein VITISV_005300 [Vitis vinifera]
Length=815

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 106/183 (58%), Gaps = 2/183 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            +KVYGL  CR DVS   C SCI  A  +I + C  + +A IWY  CFLRY++  FF  ++
Sbjct  222  DKVYGLFLCRPDVSKHICQSCIDAATLKIVQVCQHKKEAIIWYNECFLRYSNRSFFSNLE  281

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
                +   N  N + P++F++KLG +   ++ +A   +      G+ ++S+FL LY +VQ
Sbjct  282  MKPTLYMWNRQNASAPDKFDQKLGEMFQNLTAKATSSDGM-YAIGQVEVSNFLNLYGIVQ  340

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPPEKSTV  772
            CTRDL    C QCL   VG   P F   K+G RVL  SCY+RYE+YPF    DP  ++ V
Sbjct  341  CTRDLRMSYCRQCLDEVVG-YIPNFMEGKEGGRVLAPSCYIRYEIYPFAAVEDPIVEAQV  399

Query  773  AAS  781
             +S
Sbjct  400  PSS  402



>ref|XP_009340926.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=705

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 100/174 (57%), Gaps = 4/174 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKD-CSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEV  409
            N VYGL  CRGDV   D C +C+  A  EI +RCP   +  IWY+ C LRY+   FF   
Sbjct  117  NAVYGLFLCRGDVLGTDACETCVATATGEIPRRCPIDKEVVIWYDDCMLRYSYVSFFSTS  176

Query  410  DTGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
                G+   N  +VT+P RFN+ L   ++ ++ EA    ++     K K SD +TLY L 
Sbjct  177  AENPGVFLLNSQDVTEPTRFNQVLTASMNEVATEAANDADK-FATKKMKFSDLITLYTLG  235

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD  751
            QCT+DLS   C +CL I +    P  C+ K+G RVL+ SC VRYE+YPF FP D
Sbjct  236  QCTQDLSAATCHKCLKI-IAVQLPSCCSRKQGGRVLFPSCNVRYEIYPF-FPQD  287



>ref|XP_010644348.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Vitis vinifera]
Length=507

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 103/170 (61%), Gaps = 7/170 (4%)
 Frame = +2

Query  242  YGLAQCRGDVSSKDCSSCIQEAAKE-IRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTG  418
            YGL  CRGDV+S+ C  C+  A  E +R+RC     A IWY+ C LRY+++ FF +V   
Sbjct  76   YGLFLCRGDVTSQVCQDCVATAVNETVRQRCRGFKQAIIWYDECMLRYSNESFFSQVSES  135

Query  419  YGILYANVANVTDPERFNEKLGNLVDGISKEAVVPEN-RGLGKGKTKLSDFLTLYALVQC  595
              +   N  N+T+P++FN+ LG+ +D I  +AV  ++ +     +   + F  +Y+LVQC
Sbjct  136  PRVSMWNTQNITEPDQFNQVLGDTLDSIRTQAVNDQSGKKFATKEENFTGFQRVYSLVQC  195

Query  596  TRDLSPVNCAQCL--AIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            T DLSP  C +CL   IA+    P  C  K+G RVL+ SC VRYELYPFY
Sbjct  196  TPDLSPDQCDRCLIGTIAI---LPDCCGGKQGARVLFPSCNVRYELYPFY  242



>ref|XP_006383959.1| hypothetical protein POPTR_0004s02450g, partial [Populus trichocarpa]
 gb|ERP61756.1| hypothetical protein POPTR_0004s02450g, partial [Populus trichocarpa]
Length=280

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 103/172 (60%), Gaps = 4/172 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++VYGL  CRGDV +  C +C+  A K+I +RCP  + + ++Y+ C LRY++  FF +VD
Sbjct  78   DQVYGLFICRGDVRNTVCQNCVTFATKDIVQRCPIGIASIVYYDACILRYSNVNFFSKVD  137

Query  413  TGYGILYANVANV-TDPERFNEKLGNLVDGISKEAVV--PENRGLGKGKTKLSDFLTLYA  583
               G    N+ N+ T+P+RFN  +G  V+ ++  A    P  +     KT    F  LY+
Sbjct  138  QNPGYYMWNLQNITTEPQRFNNLVGTTVNDLAARAASAPPGAKKFAVNKTSFDAFRNLYS  197

Query  584  LVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            L QCT DLS  +C QCL+ A+G + P  C+ + G RVL+ SCY+ YE+  FY
Sbjct  198  LAQCTPDLSSFDCNQCLSAAIG-DLPFCCSSRTGGRVLFPSCYIHYEINLFY  248



>ref|XP_010644341.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=660

 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 101/168 (60%), Gaps = 3/168 (2%)
 Frame = +2

Query  242  YGLAQCRGDVSSKDCSSCIQEAAKE-IRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTG  418
            YGL  CRGDV+S+ C  C+  A  E +R+RC     A IWY+ C LRY+++ FF +V   
Sbjct  76   YGLFLCRGDVTSQVCQDCVATAVNETVRQRCRGFKQAIIWYDECMLRYSNESFFSQVSES  135

Query  419  YGILYANVANVTDPERFNEKLGNLVDGISKEAVVPEN-RGLGKGKTKLSDFLTLYALVQC  595
              +   N  N+T+P++FN+ LG+ +D I  +AV  ++ +     +   + F  +Y+LVQC
Sbjct  136  PRVSMWNTQNITEPDQFNQVLGDTLDSIRTQAVNDQSGKKFATKEENFTGFQRVYSLVQC  195

Query  596  TRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            T DLSP  C +CL I      P  C  K+G RVL+ SC VRYELYPFY
Sbjct  196  TPDLSPDQCDRCL-IGTIAILPDCCGGKQGARVLFPSCNVRYELYPFY  242



>gb|KDP32106.1| hypothetical protein JCGZ_12567 [Jatropha curcas]
Length=241

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 103/168 (61%), Gaps = 2/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGL  CRGD+S+ DC +CI EA+ EIR RCP+   A IWY+ C ++Y++  FFG++D
Sbjct  73   DRPYGLTLCRGDISASDCLTCIAEASNEIRTRCPNNKQATIWYDNCLIKYSNINFFGQID  132

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
                    NV NV+DP  FN  + +L+  +++ A V   R    G  ++     +Y L Q
Sbjct  133  EQNKFYLLNVQNVSDPASFNANVKDLLSKLAENASVSP-RMFAAGDMEIEGSKKVYGLAQ  191

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            C+RDLS  +C +C+  A+ +  P  C+ KKG RV+  SC VRYE+YPF
Sbjct  192  CSRDLSSGDCQKCIDSAI-SELPSCCDGKKGGRVVGGSCTVRYEIYPF  238



>gb|KFK39506.1| hypothetical protein AALP_AA3G252600 [Arabis alpina]
Length=255

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 92/168 (55%), Gaps = 1/168 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            +KV GLA CRGD SS DC SC+  A  EI +RCPD     IWY+ C ++Y    FFG++D
Sbjct  85   DKVNGLALCRGDASSSDCGSCLAIAIPEISRRCPDNKAGIIWYDNCLVKYASTNFFGKID  144

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
                    NV NV+DP  FN +   L+  ++K+     N  L     K      LY LVQ
Sbjct  145  FENRFYLYNVNNVSDPASFNMQTKTLLTELAKKVTAGINNKLFAAGEKNIGKQMLYGLVQ  204

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            CTRDL   +C  CL   +G   P  C+ K+G RV+  SC  RYE+YPF
Sbjct  205  CTRDLRSESCKACLDGIIG-EIPNCCDGKEGGRVVGGSCNFRYEIYPF  251



>gb|KDO37423.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=571

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 103/199 (52%), Gaps = 14/199 (7%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+VYGL  CRGD ++ DC  C+  AA+++ + CP   +  +WY  C LRY+D   F  + 
Sbjct  83   NRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKETILWYAECLLRYSDQSIFSTMA  142

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T   +   N  NVTD  R NE +G  +  +  +AV    R     K   + F TLY+L Q
Sbjct  143  TSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNTKR-FATRKANFTTFQTLYSLAQ  201

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY-----------  739
            CT DLS  +C  CL  AV    P  C+ K+G RVL+ SC VRYELYPFY           
Sbjct  202  CTPDLSSSDCNTCLRGAVA-RLPSCCSGKQGGRVLFPSCNVRYELYPFYNESATAPPAPA  260

Query  740  -FPLDPPEKSTVAASEARN  793
               L PP   +V  S  ++
Sbjct  261  PVLLSPPPPGSVTTSRGKS  279



>ref|XP_009340923.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Pyrus x bretschneideri]
Length=694

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 99/170 (58%), Gaps = 3/170 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKD-CSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEV  409
            N VYGL  CRGDV   D C +C+  A  E  +RC    +A IWY+ C LRY+   FF   
Sbjct  105  NAVYGLFLCRGDVVGTDACETCVATATGEAPQRCHIEKEAVIWYDDCMLRYSYVSFFSTS  164

Query  410  DTGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
                G+   NV NVTD  RFN+ L   ++ ++ EA    ++     +TK +D +TLY+L 
Sbjct  165  AENPGVFMMNVQNVTDGTRFNQVLAASMNEVATEAAKDTDK-FATKQTKFTDVITLYSLG  223

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT+DLS   C +C  IA+    P  C+ K+G RVL+ SC VRYE+YPFY
Sbjct  224  QCTQDLSAAVCDRCFRIAIA-QLPSCCSGKQGGRVLFPSCNVRYEIYPFY  272



>ref|XP_010054433.1| PREDICTED: cysteine-rich receptor-like protein kinase 26 [Eucalyptus 
grandis]
Length=634

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 127/228 (56%), Gaps = 6/228 (3%)
 Frame = +2

Query  77   TAQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragya--taayggsgNKVYG  247
            +A   DP  LFC T      N     N+  LL ++V  A+  G+     + GGS N V  
Sbjct  21   SAHGADPVKLFCGTTGNFTANGTYQANLNALLASVVATAAADGHGFYNLSAGGSTNAVNA  80

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            +A CRGDV + DC SC+ ++A ++ ++CP + +A IWY+ C LRY++   F  ++     
Sbjct  81   IALCRGDVGATDCQSCLNDSAPQVARQCPVQKEAIIWYDNCMLRYSNQSIFRAMEDSPVF  140

Query  428  LYANVANVT-DPERFNEKLGNLVDGISKEAVVPEN-RGLGKGKTKLSDFLTLYALVQCTR  601
             + N+ NVT + ++FN+ L NL+D + + A    + R    G     +FLTL+ LVQCT 
Sbjct  141  SWWNLNNVTNNVDQFNQVLRNLMDSLRERAASGNSTRKFAVGNATAPNFLTLFGLVQCTP  200

Query  602  DLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFP  745
            DLS   C  CL  A+G   P F N K+G  V+  SC +R+E+YPF+ P
Sbjct  201  DLSQPQCDDCLVSAIG-QIPWFSNQKQGETVVTPSCNIRFEVYPFFDP  247



>ref|XP_011037143.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=245

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 100/169 (59%), Gaps = 2/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGL  CRGDV S DC +C   A +EIRKRCP+   A I Y+ C L+Y+D +FFG++D
Sbjct  75   DRPYGLVLCRGDVPSSDCRTCAANATREIRKRCPNSKRAIIAYDNCLLKYSDSDFFGQID  134

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSD-FLTLYALV  589
                    NV NV++P  FNEK   L+  ++ +A    ++    G+  L +  + LY + 
Sbjct  135  DQNKFYMWNVNNVSNPVLFNEKTTELLSQLADKASYNSSKLYAAGEMDLLEGSMKLYGMA  194

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            QC+RDLS ++C +CL  A+G   P     K+  RV+  SC V YE+YPF
Sbjct  195  QCSRDLSSIDCKKCLDGAIG-ELPRVAYGKEEARVVGGSCMVIYEIYPF  242



>ref|XP_009340924.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Pyrus x bretschneideri]
Length=693

 Score =   140 bits (353),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 99/170 (58%), Gaps = 3/170 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKD-CSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEV  409
            N VYGL  CRGDV   D C +C+  A  E  +RC    +A IWY+ C LRY+   FF   
Sbjct  105  NAVYGLFLCRGDVVGTDACETCVATATGEAPQRCHIEKEAVIWYDDCMLRYSYVSFFSTS  164

Query  410  DTGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
                G+   NV NVTD  RFN+ L   ++ ++ EA    ++     +TK +D +TLY+L 
Sbjct  165  AENPGVFMMNVQNVTDGTRFNQVLAASMNEVATEAAKDTDK-FATKQTKFTDVITLYSLG  223

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT+DLS   C +C  IA+    P  C+ K+G RVL+ SC VRYE+YPFY
Sbjct  224  QCTQDLSAAVCDRCFRIAIA-QLPSCCSGKQGGRVLFPSCNVRYEIYPFY  272



>ref|XP_006467962.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Citrus sinensis]
Length=674

 Score =   140 bits (352),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 103/199 (52%), Gaps = 14/199 (7%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+VYGL  CRGD ++ DC  C+  AA+++ + CP   +  +WY  C LRY+D   F  + 
Sbjct  83   NRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKETILWYAECLLRYSDQSIFSTMA  142

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T   +   N  NVTD  R NE +G  +  +  +AV    R     K   + F TLY+L Q
Sbjct  143  TSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNTKR-FATRKANFTTFQTLYSLAQ  201

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY-----------  739
            CT DLS  +C  CL  AV    P  C+ K+G RVL+ SC VRYELYPFY           
Sbjct  202  CTPDLSSSDCNTCLRGAVA-RLPSCCSGKQGGRVLFPSCNVRYELYPFYNESATAPPAPA  260

Query  740  -FPLDPPEKSTVAASEARN  793
               L PP   +V  S  ++
Sbjct  261  PVLLSPPPPGSVTTSRGKS  279



>gb|KDO37422.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=674

 Score =   139 bits (351),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 103/199 (52%), Gaps = 14/199 (7%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N+VYGL  CRGD ++ DC  C+  AA+++ + CP   +  +WY  C LRY+D   F  + 
Sbjct  83   NRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKETILWYAECLLRYSDQSIFSTMA  142

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T   +   N  NVTD  R NE +G  +  +  +AV    R     K   + F TLY+L Q
Sbjct  143  TSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNTKR-FATRKANFTTFQTLYSLAQ  201

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY-----------  739
            CT DLS  +C  CL  AV    P  C+ K+G RVL+ SC VRYELYPFY           
Sbjct  202  CTPDLSSSDCNTCLRGAVA-RLPSCCSGKQGGRVLFPSCNVRYELYPFYNESATAPPAPA  260

Query  740  -FPLDPPEKSTVAASEARN  793
               L PP   +V  S  ++
Sbjct  261  PVLLSPPPPGSVTTSRGKS  279



>ref|XP_008232237.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Prunus 
mume]
Length=659

 Score =   139 bits (350),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 97/170 (57%), Gaps = 4/170 (2%)
 Frame = +2

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKE-IRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            VYG   CR D++S  C  C+  AA E ++K CP R    IWY+ C LRY++  FFG++D 
Sbjct  70   VYGSFLCRADLTSDACQVCVATAANETVQKYCPLRKVTIIWYDDCMLRYSNVSFFGKMDE  129

Query  416  GYGILYANVANVTDPERFNEKLGNLVDGISKEA--VVPENRGLGKGKTKLSDFLTLYALV  589
               +   NV N+TDP RFNE L   ++G+   A  +    +     K   + F  LY+LV
Sbjct  130  APSVSLWNVGNITDPNRFNEVLAETINGLVPVAANMASGTKKFAAKKANFTAFQELYSLV  189

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT  LS   C +CL  A+    P  CN K+G RVLY SC VRYE+YPFY
Sbjct  190  QCTPGLSSTACDRCLIGAIA-LLPACCNGKQGGRVLYPSCNVRYEVYPFY  238



>gb|KDO39525.1| hypothetical protein CISIN_1g007490mg [Citrus sinensis]
Length=601

 Score =   139 bits (349),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 101/169 (60%), Gaps = 2/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++VYGL +CRGD+ S  C  C+  A K + +RCP      I ++ C LRY++  FF   D
Sbjct  84   DRVYGLFRCRGDLGSTACQDCVTFATKNVTQRCPVEKRTTILFDECLLRYSNQSFFSNSD  143

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
                +   N+ NVT+P++FN  LGNL++ +  +AV    R     KT  S F T+Y+LVQ
Sbjct  144  MSSQLSMWNLQNVTEPDKFNVFLGNLMNQVITQAVNNPKR-FEIRKTNYSAFQTVYSLVQ  202

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            CT DLS  +C  CL  A+G   P  C+ ++G RVLY SC +RYE YPFY
Sbjct  203  CTPDLSSRDCEVCLRGALG-QLPRCCSGRQGGRVLYPSCNLRYESYPFY  250



>ref|XP_002441306.1| hypothetical protein SORBIDRAFT_09g024150 [Sorghum bicolor]
 gb|EES19736.1| hypothetical protein SORBIDRAFT_09g024150 [Sorghum bicolor]
Length=463

 Score =   137 bits (346),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 100/168 (60%), Gaps = 1/168 (1%)
 Frame = +2

Query  236  KVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDT  415
            + YGLAQCRGDV++  C +C+  +A+ +   CP + +  + Y+ C LR++++ FFG  D+
Sbjct  75   QAYGLAQCRGDVNASACLACLDGSARHMAGTCPGQKERMLIYDECLLRHSNESFFGVADS  134

Query  416  GYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQC  595
               +   N  N T PE F  +LG L+  ++  A     R    G+T ++ F+ ++ + QC
Sbjct  135  SVRLWAWNAQNATRPEEFTSRLGALMGNLTATAAFASPRMFAAGETAVTPFVNIFGMAQC  194

Query  596  TRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            TRDL+  +C +CL  AV    P  C+ K+G RV+  SC +R+E+YPFY
Sbjct  195  TRDLAADDCNRCLVNAVA-FIPNCCDGKQGGRVIGRSCSIRFEVYPFY  241



>gb|EYU43107.1| hypothetical protein MIMGU_mgv1a022379mg [Erythranthe guttata]
Length=242

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 84/224 (38%), Positives = 123/224 (55%), Gaps = 4/224 (2%)
 Frame = +2

Query  71   IFTAQSTDPSGLFCN-TASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYG  247
            I TA S  P    C+ T +   NS    N+ KLL +L       G+   + G   ++VYG
Sbjct  19   IQTALSASPLFSICSSTQNFTTNSLYERNLNKLLGDLYFKTPPTGFGFGSSGQYTDRVYG  78

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            L+ CRGDVS+ DC +C+ EA+  + K CP+   A IWY+ C+L+Y+D  F G +D     
Sbjct  79   LSLCRGDVSTNDCKTCVVEASSHVTKICPNIKGAVIWYDNCYLKYSDVNFHGTIDNRNKF  138

Query  428  LYANVANV-TDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRD  604
               N+ NV T+ E FN+K   L+  +S  A    ++    G+T +     +Y + QC+RD
Sbjct  139  YMWNLNNVSTNAELFNQKTRELIGNLSTNA-SRTSKMYANGETDIGIESKIYGMAQCSRD  197

Query  605  LSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            LS  +C +CL  AV +  P  C  K+G RV+  SC +RYE+YPF
Sbjct  198  LSRDDCKKCLDGAV-SELPSCCGGKQGGRVVGGSCNIRYEIYPF  240



>ref|XP_002304943.2| hypothetical protein POPTR_0004s02390g, partial [Populus trichocarpa]
 gb|EEE85454.2| hypothetical protein POPTR_0004s02390g, partial [Populus trichocarpa]
Length=282

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 102/172 (59%), Gaps = 4/172 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++VYGL  CRGDVS+  C +C+  A K+I +RCP  + + ++Y+ C LRY++  FF +VD
Sbjct  80   DQVYGLFICRGDVSNTVCQNCVTFATKDIVQRCPVGIASIVYYDACILRYSNVNFFSKVD  139

Query  413  TGYGILYANVANV-TDPERFNEKLGNLVDGISKEAVV--PENRGLGKGKTKLSDFLTLYA  583
               G    N  N+ T+P+RFN  +G  V+ ++  A    P  +     KT  + F  +Y+
Sbjct  140  QSPGFSLLNTQNITTEPQRFNNLVGAAVNDLAARAASAPPGAKKFAVNKTSFNAFQNIYS  199

Query  584  LVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            L QCT DLS  +C +CL+ A+    P  C+ K G RVL+ SCY+ YE+  FY
Sbjct  200  LAQCTPDLSSSDCNRCLSAAIA-GLPNCCSSKIGGRVLFPSCYIHYEITEFY  250



>gb|KEH26423.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=923

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 104/179 (58%), Gaps = 5/179 (3%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N VYGL  CRGDV+ + C  CI  A +++   CP    A I+YE C +RY+ + FF  VD
Sbjct  72   NSVYGLFMCRGDVTFQICDECIVNATQKLSLDCPLSKQAVIYYENCMVRYSSESFFSTVD  131

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVP----ENRGLGKGKTKLSDFLTLY  580
            T + +  +++ NV++ E F   L + +D  ++EA  P     N+     + ++S+  TLY
Sbjct  132  THHSLFMSSILNVSNTESFMPLLFSTMDKTAEEAAGPLTTDNNKKFATKEARISESQTLY  191

Query  581  ALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPP  757
             L QCT DLSP +C  CL  A+    P  C+ K G RVL+ SC VRYELYPFY  ++ P
Sbjct  192  CLAQCTPDLSPGDCRTCLNSAI-EKLPSCCDGKVGGRVLFPSCNVRYELYPFYRSINAP  249


 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 92/189 (49%), Gaps = 6/189 (3%)
 Frame = +2

Query  239  VYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTG  418
            VYGL  CRGD+  + C  C++ A  +I  +C       IWY +C L Y+D +FF  V+T 
Sbjct  316  VYGLFLCRGDLPVRLCGQCVKNATDQIYSKCLSSPKGIIWYSHCLLHYSDRKFFSNVETS  375

Query  419  --YGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
              Y  +     ++T+   F   L N +  ++ +      R       KL+D  TLY L Q
Sbjct  376  PMYSDINITKDSITNQNLFTSTLSNQLSQLANDTGDSGER-YKTNSLKLNDVQTLYTLGQ  434

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLD---PPEK  763
            CT+DLS  +C  CL   +    P       G R++Y SC +R+EL+ FY   D   PP  
Sbjct  435  CTQDLSSQDCTSCLNDVINTAIPWSNLGSVGGRIIYPSCNLRFELFQFYMDGDEAIPPGS  494

Query  764  STVAASEAR  790
              ++ +E +
Sbjct  495  PPLSGNEDK  503



>ref|XP_006850463.1| hypothetical protein AMTR_s00035p00086030 [Amborella trichopoda]
 gb|ERN12044.1| hypothetical protein AMTR_s00035p00086030 [Amborella trichopoda]
Length=255

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 118/227 (52%), Gaps = 11/227 (5%)
 Frame = +2

Query  80   AQSTDPSGLFC-NTASKNLNSQTSTNILKLLTNL---VPaasragyataayggsgNKVYG  247
            A +  P+G  C  T +   NSQ   N+ +LL +L   VP +      T       ++V+G
Sbjct  21   AMAAIPTGNVCLGTTNYTSNSQYEQNLNQLLQSLQANVPVSGGFNSTTLGTSP--DQVFG  78

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            L  CRGDV + +C+ CI  +  EI + CP   +A  WY+ C +RY+D  FFG VD GY  
Sbjct  79   LGLCRGDVKTTECTKCISNSTSEILRLCPGSKEAIAWYDTCIVRYSDSNFFGTVD-GYRG  137

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGL-GKGKTKLSDFLTLYALVQCTRD  604
               N  NV+D   F E LG L+  +S  A  P N  +   G+   +DF T Y LVQCTRD
Sbjct  138  GLLNTQNVSDVTSFREALGTLMRDLSSTA--PYNPLMYASGQAVYADFFTFYGLVQCTRD  195

Query  605  LSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFP  745
            L    C  CL   +    P  C+DK G +++  SC++R+E   F+ P
Sbjct  196  LDAPQCEVCLENLI-QKIPSCCSDKLGGQIISGSCFLRFEDSRFFTP  241



>ref|XP_003549139.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Glycine max]
Length=917

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 121/224 (54%), Gaps = 7/224 (3%)
 Frame = +2

Query  83   QSTDPSGLF--CNTASKNLNSQTSTNILKLLTNL---VPaasragyataayggsgNKVYG  247
            QS+ P  ++  C+  +   NS    N+  LL++L    P  +     T       + V+G
Sbjct  38   QSSTPLYIYHNCSGGNTTANSAFQINVRTLLSSLSSNAPGDNGFYNTTVPPKNPSDSVFG  97

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            L  CRGDV  + C  C+Q A + +R  C   + A IWY+ C +RY++  FF  VDT   +
Sbjct  98   LFMCRGDVPPQLCQQCVQNATQRLRSMCSLSIQAVIWYDECTVRYSNRSFFSTVDTRPRV  157

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDL  607
               N AN+++ E F   + + ++  + EA   +++     +T +S+F  LY L QCT DL
Sbjct  158  GLLNTANISNQESFMRLMFSTINKTADEA-AKDDKKFATRQTNISEFQNLYCLAQCTPDL  216

Query  608  SPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            SP++C  CL+  +G +    C  K+G RVLY SC VRYELYPFY
Sbjct  217  SPLDCRSCLSKVIG-DLSWCCEGKQGGRVLYPSCNVRYELYPFY  259


 Score =   107 bits (268),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 93/188 (49%), Gaps = 7/188 (4%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N VYGL  CRGD+ S+ C  C+  A   I   C    +  IWY +C +RY++  FF EV+
Sbjct  332  NTVYGLFMCRGDLPSQLCQQCVLNATHRISSVCNSVQEGIIWYSHCMIRYSNLYFFSEVE  391

Query  413  TGYGILYANVAN-----VTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTL  577
                    N+ +     +   + F   L + +  +++EA     R + K   KL+D  TL
Sbjct  392  ESPNFDMLNLTSSSTSIIPGQDYFTFTLSDTIVKLAQEAGDTTERYVTKS-LKLTDLQTL  450

Query  578  YALVQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFYFPLDPP  757
            Y L QCT+DLS   C  CL   +    P F     G RVLY SC +R+EL+ FY   D  
Sbjct  451  YTLAQCTQDLSSDGCKNCLE-DINGKIPWFRLGSVGGRVLYPSCNLRFELFQFYRGSDEE  509

Query  758  EKSTVAAS  781
             +S +A +
Sbjct  510  TQSPMAGN  517



>ref|XP_009360784.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=882

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 102/170 (60%), Gaps = 3/170 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            N VYGL  CRGDV +  C +C+ +A  E  K CP   +A IWY+ C LRY+ + FF    
Sbjct  72   NAVYGLFLCRGDVGTDVCETCVADATTEAPKLCPTEKEAVIWYDECMLRYSYESFFSTSA  131

Query  413  TGYGILYANVANVTDPE-RFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
                +   NV NVT+ + RFN+ L   ++ ++ EA     +   K +TK SD +TLY+L 
Sbjct  132  ENPSVFLRNVQNVTEQQTRFNQVLAASMNEVATEAANDAYKFAAK-QTKFSDQITLYSLG  190

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT+DLS   C +CLA+A+       C+ K+G RVL+ SC VRYE+YPFY
Sbjct  191  QCTQDLSAAVCNRCLAVAIA-QLQSCCSGKQGGRVLFPSCNVRYEIYPFY  239


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 82/170 (48%), Gaps = 7/170 (4%)
 Frame = +2

Query  233  NKVYGLAQCRGDV-SSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEV  409
            + VYGL  C  DV S+ DC +C+  A  E  + CP R +  IWY  C LRY+D  FF   
Sbjct  306  DTVYGLFLCGVDVVSTDDCKTCVATATSEAPQNCPSRKNVIIWYNNCMLRYSDVSFFSRA  365

Query  410  DTGYGILYANVANVT-DPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYAL  586
            D        N   VT +   F E L  +V+ ++ +A   E+R        +   ++L  L
Sbjct  366  DDEPFWPIENTGKVTVNQTSFYEVLAAMVNKLAAQA-SNESRKFATKTADVLGSISLKVL  424

Query  587  VQCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
             QCT+DLS  +C  CL   +   FP     ++G R+L  SC +  E+  +
Sbjct  425  AQCTQDLSSRDCNLCLRRTI-EKFPRI---QQGGRLLCPSCRLTIEVSQY  470



>ref|NP_001146710.1| uncharacterized protein LOC100280312 precursor [Zea mays]
 gb|ACL54600.1| unknown [Zea mays]
Length=668

 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 102/169 (60%), Gaps = 1/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGLAQCR DV++ DC +C+  + +++ + CP +  A + Y+ C LR+++  FFG VD
Sbjct  71   DQAYGLAQCRADVNASDCRACLDGSTRDMARVCPGQKSAMLIYDACQLRHSNASFFGAVD  130

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
                +   N  N T  E+F  +LG L+  +++ A     R    G   ++ F+ +Y + Q
Sbjct  131  ASVVVWQPNAQNATQQEQFTTRLGALMGSVTERAAYASPRRFAVGSAAVTPFVNVYGMAQ  190

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            CTRDL+  +C +CL  AV +  P  C+ ++G R++Y SC +R+E+YPFY
Sbjct  191  CTRDLAGDDCNRCLVGAV-SFIPTCCDGRQGARIVYPSCSIRFEVYPFY  238



>gb|AFW78495.1| putative DUF26-domain receptor-like protein kinase family protein 
[Zea mays]
Length=668

 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 102/169 (60%), Gaps = 1/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++ YGLAQCR DV++ DC +C+  + +++ + CP +  A + Y+ C LR+++  FFG VD
Sbjct  71   DQAYGLAQCRADVNASDCRACLDGSTRDMARVCPGQKSAMLIYDACQLRHSNASFFGAVD  130

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
                +   N  N T  E+F  +LG L+  +++ A     R    G   ++ F+ +Y + Q
Sbjct  131  ASVVVWQPNAQNATQQEQFTTRLGALMGSVTERAAYASPRRFAVGSAAVTPFVNVYGMAQ  190

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            CTRDL+  +C +CL  AV +  P  C+ ++G R++Y SC +R+E+YPFY
Sbjct  191  CTRDLAGDDCNRCLVGAV-SFIPTCCDGRQGARIVYPSCSIRFEVYPFY  238



>ref|XP_009340920.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=676

 Score =   138 bits (348),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 99/172 (58%), Gaps = 7/172 (4%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKD-CSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEV  409
            N VYGL  CRGDV   D C +C+  A  E  +RCP      IWY+ C LRY+++ FF  V
Sbjct  88   NAVYGLFLCRGDVVGTDACETCVATATTEAPQRCPVEKQVVIWYDDCMLRYSNESFFSTV  147

Query  410  DTGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALV  589
                 +   N  N TDP RFN+ +   V+  + EAV   ++  G  +  +S  +++Y+L 
Sbjct  148  TESPSVFMWNTQNATDPTRFNQVMAASVNQAASEAVGDADK-FGTNQANVSGLISVYSLG  206

Query  590  QCTRDLSPVNCAQCL--AIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT+DLS  +C +CL   IA+    P  CN K G RVL+ SC VRYE+YPFY
Sbjct  207  QCTQDLSATDCNRCLRGTIAL---LPSCCNRKLGGRVLFPSCNVRYEVYPFY  255



>gb|KDO75587.1| hypothetical protein CISIN_1g040542mg, partial [Citrus sinensis]
Length=250

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 99/170 (58%), Gaps = 2/170 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++V  +A CRGDV+   C SCI+ +A E+RK CP++ +A IWY+YC LRY++  FFG ++
Sbjct  77   DQVNAMALCRGDVNPNSCRSCIKTSAVELRKHCPNQKEAVIWYDYCMLRYSNRYFFGNME  136

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPEN-RGLGKGKTKLSDFLTLYALV  589
             G      N+ NV+D   FN  +  L++ +  +A   +N R    G    ++ LT+YALV
Sbjct  137  FGPWFWMYNLHNVSDATTFNRDVATLLNILKNKATSGDNCRKFATGNATTTNSLTIYALV  196

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT DL    C  CL  A     P  C+ ++G RV+  SC  RYE+  FY
Sbjct  197  QCTPDLEKQQCIDCLNNATA-LLPKCCDGRQGGRVIAPSCNFRYEIGRFY  245



>ref|XP_006468227.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
Length=251

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 99/170 (58%), Gaps = 2/170 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++V  +A CRGDV+   C SCI+ +A E+RK CP++ +A IWY+YC LRY++  FFG ++
Sbjct  77   DQVNAMALCRGDVNPNSCRSCIKTSAVELRKHCPNQKEAVIWYDYCMLRYSNRYFFGNME  136

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPEN-RGLGKGKTKLSDFLTLYALV  589
             G      N+ NV+D   FN  +  L++ +  +A   +N R    G    ++ LT+YALV
Sbjct  137  FGPWFWMYNLHNVSDATTFNRDVATLLNILKNKATSGDNCRKFATGNATTTNSLTIYALV  196

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT DL    C  CL  A     P  C+ ++G RV+  SC  RYE+  FY
Sbjct  197  QCTPDLEKQQCIDCLNNATA-LLPKCCDGRQGGRVIAPSCNFRYEIGRFY  245



>ref|XP_008340068.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=668

 Score =   138 bits (348),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 116/213 (54%), Gaps = 8/213 (4%)
 Frame = +2

Query  113  NTASKNLNSQTSTNILKLLTNLVPaasragy-ataayggsgNKVYGLAQCRGDVSSKD-C  286
            NT +   NS   +N+ +LL+NL   A+R+          + N VYGL  CRGDV S D C
Sbjct  39   NTTTFTPNSTFQSNLNRLLSNLSSNANRSTGFYNVTVQTTNNAVYGLFLCRGDVVSTDAC  98

Query  287  SSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANVTDPER  466
             +C+  A  E  +RCP      IWY+ C LRY++  FF  V         N  N TDP R
Sbjct  99   ETCVATATTEAPQRCPVEKQVVIWYDDCMLRYSNVSFFSTVTESPRWYMWNTQNATDPTR  158

Query  467  FNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCL--AI  640
            FN+ +   V+  + EAV   ++  G  +  +S  +++Y+L QCT+DLS  +C +CL   I
Sbjct  159  FNQVMAASVNQAASEAVGDADK-FGTNQANVSGLISVYSLGQCTQDLSATDCNRCLRGTI  217

Query  641  AVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            A+    P  CN   G RVLY SC VRYE+YPFY
Sbjct  218  AL---LPSCCNGALGARVLYPSCNVRYEVYPFY  247



>ref|XP_006449123.1| hypothetical protein CICLE_v10018168mg, partial [Citrus clementina]
 gb|ESR62363.1| hypothetical protein CICLE_v10018168mg, partial [Citrus clementina]
Length=250

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 99/170 (58%), Gaps = 2/170 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++V  +A CRGDV+   C SCI+ +A E+RK CP++ +A IWY+YC LRY++  FFG ++
Sbjct  77   DQVNAMALCRGDVNPNSCRSCIKTSAVELRKHCPNQKEAVIWYDYCMLRYSNRYFFGNME  136

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPEN-RGLGKGKTKLSDFLTLYALV  589
             G      N+ NV+D   FN  +  L++ +  +A   +N R    G    ++ LT+YALV
Sbjct  137  FGPWFWMYNLHNVSDATTFNRDVATLLNILKNKAASGDNCRKFATGNATTTNSLTIYALV  196

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT DL    C  CL  A     P  C+ ++G RV+  SC  RYE+  FY
Sbjct  197  QCTPDLEKQQCIDCLNNATA-LLPKCCDGRQGGRVIAPSCNFRYEIGRFY  245



>gb|EYU43108.1| hypothetical protein MIMGU_mgv1a018557mg, partial [Erythranthe 
guttata]
Length=220

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 115/202 (57%), Gaps = 3/202 (1%)
 Frame = +2

Query  134  NSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQCRGDVSSKDCSSCIQEAAK  313
            NS    N+ KLL +L       G+   + G   ++ YGL+ CRGDVS+ DC +C+ EA+ 
Sbjct  19   NSLYERNLNKLLGDLYFKTPPTGFGFGSSGQYNDRAYGLSLCRGDVSTNDCKTCVVEASS  78

Query  314  EIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYANVANV-TDPERFNEKLGNL  490
            ++ K CP+   A IWY+ C+L+Y+D  F G +D        N+ NV T+ E FN+K   L
Sbjct  79   QVTKICPNLKGAVIWYDNCYLKYSDVNFHGTIDNRNKFYMWNLNNVSTNAELFNQKTREL  138

Query  491  VDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPVNCAQCLAIAVGNNFPGFC  670
            +  +S  A    ++    G+T +     +Y +VQC+RDLS  +C +CL  AV +  P  C
Sbjct  139  IGNLSTNA-SRTSKMYAHGETDIGIESKIYGMVQCSRDLSRDDCKKCLDGAV-SELPSCC  196

Query  671  NDKKGCRVLYSSCYVRYELYPF  736
              K+G RV+  SC +RYE+YPF
Sbjct  197  GGKQGGRVVGGSCNIRYEIYPF  218



>ref|XP_010247622.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=675

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 104/170 (61%), Gaps = 3/170 (2%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            ++VYGL  CRGD++   C SC++ A ++I +RCP+R  A IWY+ C LRY+D  FF  V 
Sbjct  84   DRVYGLFLCRGDITDDVCQSCVETATQDIIQRCPNRKVATIWYDDCMLRYSDLSFF-SVA  142

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPEN-RGLGKGKTKLSDFLTLYALV  589
            +G      N  N+TD  +F++ L + ++ I+  A    + +     +   S F TLY+LV
Sbjct  143  SGVSFYMWNTQNITDRNKFDQILDDTMNQIANRAAFNSSPKKFSTQEANFSSFQTLYSLV  202

Query  590  QCTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            QCT DLS  +C  CL  A+ +N P  C+ K+G RVL  SC +RYE+YPFY
Sbjct  203  QCTPDLSGNSCYNCLLGAI-SNIPTCCDGKQGGRVLGPSCNLRYEIYPFY  251



>gb|KDO37599.1| hypothetical protein CISIN_1g008238mg [Citrus sinensis]
Length=451

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 94/169 (56%), Gaps = 2/169 (1%)
 Frame = +2

Query  233  NKVYGLAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVD  412
            NKVYGL  CRGD ++  C  C+  A +++ +RCPD     IWY+ C LRY++   F  +D
Sbjct  87   NKVYGLFLCRGDQTASSCQDCVTFATRDLVQRCPDGKQTIIWYDQCLLRYSNRSIFSTMD  146

Query  413  TGYGILYANVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQ  592
            T   +   N  NVTD  RFN+ L +L+  +  +A V  +R         +   TLY+L Q
Sbjct  147  TVPYVSLLNTQNVTDRGRFNQILASLMSQVVNQA-VNNSRKFATRTANFTALQTLYSLAQ  205

Query  593  CTRDLSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPFY  739
            CT DLS  +C  CL  A+    P  C+ K G +VL  SC VRYE YPFY
Sbjct  206  CTPDLSSSDCNVCLQAAIA-ELPNCCSGKTGAQVLIPSCIVRYEFYPFY  253



>emb|CAN73038.1| hypothetical protein VITISV_044348 [Vitis vinifera]
Length=243

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 118/220 (54%), Gaps = 3/220 (1%)
 Frame = +2

Query  80   AQSTDPSGLFCNTASK-NLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYGLAQ  256
            A   DP   FC        N   S+N+ +L T L       G+  A+ G   + V GLA 
Sbjct  21   AIGADPLFHFCFIPENYTANDPFSSNLNELTTLLSSKVPPTGFGLASTGQGQDSVNGLAL  80

Query  257  CRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGILYA  436
            CRGDVSS+DC +C+ EA KE+  RCP    A IWY+ C   Y++ +FFGE+D        
Sbjct  81   CRGDVSSRDCKTCVTEATKELHNRCPYNKGAIIWYDNCLFNYSNVKFFGEIDNKNKFYVY  140

Query  437  NVANVTDPERFNEKLGNLVDGISKEAVVPENRGLGKGKTKLSDFLTLYALVQCTRDLSPV  616
            NV +  DP  FN K   L+  +S +A          G+  L + + LY L QCTRDLS +
Sbjct  141  NVQSADDPTSFNVKTKELLSSLSNKA-YGSPMLFATGELVLEESMKLYGLAQCTRDLSSL  199

Query  617  NCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            +C + L  AV +  P +C+ K+G RV+  SC VRYELYPF
Sbjct  200  DCKKSLDDAV-SELPSYCDGKRGGRVVGGSCNVRYELYPF  238



>ref|XP_006469774.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
Length=246

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 120/224 (54%), Gaps = 2/224 (1%)
 Frame = +2

Query  68   TIFTAQSTDPSGLFCNTASKNLNSQTSTNILKLLTNLVPaasragyataayggsgNKVYG  247
            T+    + DP    C+  +   N    TN+  L+  L   A   G+   + G + ++  G
Sbjct  21   TVALGANVDPLFHSCSNENFTANGPYQTNLNTLVGYLYHQAPTTGFGIGSLGQNPSQANG  80

Query  248  LAQCRGDVSSKDCSSCIQEAAKEIRKRCPDRVDARIWYEYCFLRYTDDEFFGEVDTGYGI  427
            LA CRGDVS+ DC  C+ +A   IRK CP    A+I+Y+ C  +Y++D FFG++D G   
Sbjct  81   LALCRGDVSASDCKRCVADAVSTIRKSCPYSKSAKIFYDNCMFKYSNDNFFGQIDNGTKY  140

Query  428  LYANVANVTDPERFNEKLGNLVDGISKEAVV-PENRGLGKGKTKLSDFLTLYALVQCTRD  604
               NV NV++   FN+K   L+  ++ EA   P+    G+ +        +Y L QCTRD
Sbjct  141  FMWNVNNVSNRVTFNQKSKELLSRLANEASGNPKLYAAGELELNEESKKKIYGLAQCTRD  200

Query  605  LSPVNCAQCLAIAVGNNFPGFCNDKKGCRVLYSSCYVRYELYPF  736
            LS  +C  CL   +G + P  C+ K+G RV+ +SC + YE+YPF
Sbjct  201  LSYNDCKMCLDRIIG-DLPSCCDGKQGGRVITASCIINYEIYPF  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2641654646496