BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17205_g1_i2 len=1755 path=[871:0-1018 653:1019-1754]

Length=1755
                                                                      Score     E

gb|ACA64095.1|  WOX4                                                    287   5e-89   Petunia x hybrida [garden petunia]
ref|XP_009613514.1|  PREDICTED: WUSCHEL-related homeobox 4              283   1e-87   
ref|XP_009776871.1|  PREDICTED: WUSCHEL-related homeobox 4              283   2e-87   
ref|XP_007017177.1|  WUSCHEL related homeobox 4                         279   2e-86   
ref|XP_006374903.1|  homeobox-leucine zipper transcription factor...    276   2e-85   
ref|XP_002284927.1|  PREDICTED: WUSCHEL-related homeobox 4              276   3e-85   Vitis vinifera
gb|AHL29314.1|  WOX4b                                                   275   6e-85   
emb|CDP01306.1|  unnamed protein product                                275   1e-84   
ref|XP_006434726.1|  hypothetical protein CICLE_v10002438mg             275   1e-84   
ref|XP_011029533.1|  PREDICTED: WUSCHEL-related homeobox 4-like         275   1e-84   
gb|KDO84106.1|  hypothetical protein CISIN_1g027928mg                   274   2e-84   
gb|ABK93839.1|  unknown                                                 273   3e-84   Populus trichocarpa [western balsam poplar]
ref|XP_002301170.1|  homeobox-leucine zipper transcription factor...    272   9e-84   Populus trichocarpa [western balsam poplar]
ref|XP_006354857.1|  PREDICTED: WUSCHEL-related homeobox 4-like         271   6e-83   
ref|XP_002510184.1|  transcription factor, putative                     270   8e-83   Ricinus communis
ref|XP_011017175.1|  PREDICTED: WUSCHEL-related homeobox 4-like         270   1e-82   
gb|KDP41702.1|  hypothetical protein JCGZ_16109                         270   1e-82   
gb|AHL29313.1|  WOX4a                                                   269   1e-82   
ref|NP_001234251.1|  WOX4                                               269   3e-82   
gb|KHN22335.1|  WUSCHEL-related homeobox 4                              266   5e-81   
ref|NP_001241420.1|  uncharacterized protein LOC100781015               265   1e-80   
gb|KHN04484.1|  WUSCHEL-related homeobox 4                              256   1e-77   
ref|XP_010110805.1|  WUSCHEL-related homeobox 4                         257   2e-77   
ref|NP_001237560.1|  uncharacterized protein LOC100499894               255   4e-77   
ref|XP_010263471.1|  PREDICTED: WUSCHEL-related homeobox 4-like         252   4e-76   
ref|XP_004291086.1|  PREDICTED: WUSCHEL-related homeobox 4-like         251   2e-75   
gb|AFK34088.1|  unknown                                                 248   2e-74   
gb|AFK47658.1|  unknown                                                 248   4e-74   
ref|XP_010270556.1|  PREDICTED: WUSCHEL-related homeobox 4-like         246   7e-74   
ref|XP_007223910.1|  hypothetical protein PRUPE_ppa010951mg             246   1e-73   
ref|XP_004499043.1|  PREDICTED: WUSCHEL-related homeobox 4-like         246   3e-73   
ref|XP_003589158.1|  WUSCHEL-related homeobox                           245   5e-73   
ref|XP_008378020.1|  PREDICTED: WUSCHEL-related homeobox 4              245   5e-73   
ref|XP_007160869.1|  hypothetical protein PHAVU_001G023600g             244   9e-73   
ref|XP_010061730.1|  PREDICTED: WUSCHEL-related homeobox 4              243   2e-72   
ref|XP_008444600.1|  PREDICTED: WUSCHEL-related homeobox 4              241   1e-71   
ref|XP_010549248.1|  PREDICTED: WUSCHEL-related homeobox 4-like         241   1e-71   
gb|ADN33723.1|  homeodomain transcription factor                        241   2e-71   
ref|XP_009359904.1|  PREDICTED: WUSCHEL-related homeobox 4              241   2e-71   
ref|XP_008351991.1|  PREDICTED: LOW QUALITY PROTEIN: WUSCHEL-rela...    238   3e-70   
ref|XP_004142872.1|  PREDICTED: WUSCHEL-related homeobox 4-like         237   4e-70   
gb|ACU15815.1|  unknown                                                 237   5e-70   Glycine max [soybeans]
ref|XP_003544467.1|  PREDICTED: WUSCHEL-related homeobox 4              237   5e-70   
ref|XP_004156369.1|  PREDICTED: LOW QUALITY PROTEIN: WUSCHEL-rela...    234   3e-69   
gb|KHN12799.1|  WUSCHEL-related homeobox 4                              235   4e-69   
ref|XP_006601279.1|  PREDICTED: WUSCHEL-related homeobox 4-like         234   6e-69   
ref|XP_011074398.1|  PREDICTED: WUSCHEL-related homeobox 4-like i...    233   1e-68   
ref|XP_011074399.1|  PREDICTED: WUSCHEL-related homeobox 4-like i...    233   2e-68   
ref|XP_006305551.1|  hypothetical protein CARUB_v10010093mg             233   3e-68   
ref|XP_011074397.1|  PREDICTED: WUSCHEL-related homeobox 4-like i...    230   2e-67   
ref|XP_010500232.1|  PREDICTED: WUSCHEL-related homeobox 4-like i...    229   1e-66   
ref|XP_011069676.1|  PREDICTED: WUSCHEL-related homeobox 4-like         229   1e-66   
ref|XP_007140278.1|  hypothetical protein PHAVU_008G098800g             228   2e-66   
ref|XP_010479107.1|  PREDICTED: WUSCHEL-related homeobox 4 isofor...    227   4e-66   
ref|XP_010688717.1|  PREDICTED: WUSCHEL-related homeobox 4 isofor...    225   2e-65   
ref|XP_002894029.1|  homeobox-leucine zipper transcription factor...    225   3e-65   
gb|KFK44644.1|  hypothetical protein AALP_AA1G285400                    224   5e-65   
ref|XP_010461508.1|  PREDICTED: WUSCHEL-related homeobox 4-like i...    224   6e-65   
gb|KEH40030.1|  wuschel-related homeobox protein                        223   7e-65   
ref|XP_010500231.1|  PREDICTED: WUSCHEL-related homeobox 4-like i...    224   9e-65   
ref|XP_009145045.1|  PREDICTED: WUSCHEL-related homeobox 4-like         223   2e-64   
emb|CDY25659.1|  BnaC05g25380D                                          222   3e-64   
ref|XP_010479106.1|  PREDICTED: WUSCHEL-related homeobox 4 isofor...    223   3e-64   
ref|NP_175145.2|  WUSCHEL-related homeobox 4                            221   7e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAG50620.1|AC083835_5  hypothetical protein                          220   2e-63   Arabidopsis thaliana [mouse-ear cress]
gb|ACN56439.1|  WUSCHEL-related homeobox-containing protein 4           219   2e-63   Ocotea catharinensis
emb|CDY17046.1|  BnaA08g04100D                                          219   5e-63   
ref|XP_010461506.1|  PREDICTED: WUSCHEL-related homeobox 4-like i...    219   7e-63   
gb|ABC47840.1|  WOX4 protein                                            216   8e-63   Glycine max [soybeans]
ref|XP_006393630.1|  hypothetical protein EUTSA_v10011723mg             218   2e-62   
emb|CDY40847.1|  BnaC08g04810D                                          214   3e-61   
ref|XP_009107441.1|  PREDICTED: WUSCHEL-related homeobox 4              213   1e-60   
ref|XP_010688724.1|  PREDICTED: WUSCHEL-related homeobox 4 isofor...    212   1e-60   
gb|EYU25452.1|  hypothetical protein MIMGU_mgv1a012633mg                205   8e-58   
ref|XP_010538129.1|  PREDICTED: WUSCHEL-related homeobox 4              181   1e-48   
ref|XP_006855139.1|  hypothetical protein AMTR_s00051p00020930          169   6e-45   
ref|XP_010909238.1|  PREDICTED: WUSCHEL-related homeobox 4              167   8e-44   
ref|XP_009413452.1|  PREDICTED: WUSCHEL-related homeobox 4-like         151   5e-39   
gb|EYU36332.1|  hypothetical protein MIMGU_mgv1a024335mg                143   1e-36   
ref|XP_008778641.1|  PREDICTED: WUSCHEL-related homeobox 4              143   2e-36   
ref|XP_006652920.1|  PREDICTED: WUSCHEL-related homeobox 4-like         144   6e-36   
sp|Q7XTV3.2|WOX4_ORYSJ  RecName: Full=WUSCHEL-related homeobox 4;...    142   4e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054082.1|  Os04g0649400                                       142   5e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977039.1|  PREDICTED: WUSCHEL-related homeobox 4-like         137   3e-33   
emb|CAJ84151.1|  WOX4 protein                                           131   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_002448640.1|  hypothetical protein SORBIDRAFT_06g030700          136   5e-33   Sorghum bicolor [broomcorn]
gb|EMS58062.1|  WUSCHEL-related homeobox 4                              135   7e-33   
ref|XP_009417388.1|  PREDICTED: WUSCHEL-related homeobox 4-like         129   2e-31   
emb|CCP29680.1|  HD transcription factor                                137   2e-31   
gb|EMT29255.1|  WUSCHEL-related homeobox 4                              131   3e-31   
emb|CAD88982.1|  Homeobox protein HB3                                   130   1e-30   Oryza sativa Japonica Group [Japonica rice]
emb|CCP29681.1|  HD transcription factor                                130   2e-29   
gb|ABR17078.1|  unknown                                                 130   3e-29   Picea sitchensis
gb|AGL53582.1|  WUSCHEL homeobox protein WOX4                           130   4e-29   
emb|CCP29677.1|  HD transcription factor                                128   1e-28   
ref|XP_010227318.1|  PREDICTED: WUSCHEL-related homeobox 4-like         121   2e-28   
emb|CAJ84142.1|  WOX4 protein                                           117   3e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CDY02582.1|  BnaC02g08530D                                          117   1e-27   
gb|ACF80523.1|  unknown                                                 117   9e-27   Zea mays [maize]
ref|NP_001288390.1|  WUSCHEL-related homeobox 4-like                    119   1e-26   
gb|AGL53581.1|  WUSCHEL homeobox protein WOX3                           116   3e-26   
emb|CAJ84160.1|  WOX4 protein                                           112   4e-26   Zea mays [maize]
emb|CAT02931.1|  putative wuschel homeobox protein WOX3                 115   7e-26   Gnetum gnemon
emb|CDP09037.1|  unnamed protein product                                116   7e-26   
ref|XP_006406665.1|  hypothetical protein EUTSA_v10022042mg             118   1e-25   
emb|CAT02936.1|  putative wuschel homeobox protein WOX3                 113   2e-25   Pinus sylvestris [Scotch pine]
gb|AGL53583.1|  WUSCHEL homeobox protein WOX5                           116   2e-25   
emb|CAM32347.1|  putative wuschel homeobox protein                      114   3e-25   Zea mays [maize]
emb|CAT02922.1|  putative wuschel homeobox protein WOX4                 108   5e-25   Amborella trichopoda
ref|XP_010260182.1|  PREDICTED: WUSCHEL-related homeobox 2              113   1e-24   
ref|XP_011077272.1|  PREDICTED: WUSCHEL-related homeobox 2              113   2e-24   
ref|XP_010043567.1|  PREDICTED: WUSCHEL-related homeobox 2              112   3e-24   
gb|KCW85584.1|  hypothetical protein EUGRSUZ_B02379                     112   3e-24   
ref|XP_007210608.1|  hypothetical protein PRUPE_ppa017419mg             114   4e-24   
emb|CAL18267.1|  homeodomain transcription factor                       110   5e-24   Picea abies
gb|KFK39124.1|  hypothetical protein AALP_AA3G204000                    113   5e-24   
ref|XP_010253422.1|  PREDICTED: WUSCHEL-related homeobox 3A             110   6e-24   
emb|CAT02938.1|  putative wuschel homeobox protein WUS                  111   6e-24   Pinus sylvestris [Scotch pine]
ref|XP_002885236.1|  WOX1 protein                                       113   6e-24   
ref|XP_002862807.1|  WOX1 protein                                       113   6e-24   
ref|XP_010506258.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    112   8e-24   
ref|XP_010536241.1|  PREDICTED: WUSCHEL-related homeobox 2              111   9e-24   
emb|CDX75955.1|  BnaC03g40380D                                          112   1e-23   
gb|KDP23920.1|  hypothetical protein JCGZ_27080                         112   1e-23   
gb|KCW84062.1|  hypothetical protein EUGRSUZ_B00945                     112   1e-23   
ref|XP_010033710.1|  PREDICTED: WUSCHEL-related homeobox 1              112   1e-23   
ref|XP_003566641.2|  PREDICTED: putative WUSCHEL-related homeobox 2     110   1e-23   
ref|XP_010259966.1|  PREDICTED: WUSCHEL-related homeobox 3-like         110   1e-23   
gb|AAP37133.1|  WOX1 protein                                            112   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008240291.1|  PREDICTED: WUSCHEL-related homeobox 1              112   2e-23   
ref|NP_188428.3|  WUSCHEL-related homeobox 1                            112   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001106239.1|  putative wuschel homeobox protein                  110   2e-23   Zea mays [maize]
ref|XP_009410026.1|  PREDICTED: WUSCHEL-related homeobox 3B-like        108   2e-23   
dbj|BAJ14108.1|  PRESSED FLOWER a                                       108   2e-23   
gb|EMT01548.1|  Putative WUSCHEL-related homeobox 2                     110   2e-23   
gb|EMS65099.1|  Putative WUSCHEL-related homeobox 2                     107   2e-23   
ref|XP_009135564.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    111   2e-23   
ref|XP_002440499.1|  hypothetical protein SORBIDRAFT_09g002010          110   2e-23   Sorghum bicolor [broomcorn]
emb|CBI16222.3|  unnamed protein product                                106   3e-23   
ref|XP_010487712.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    111   3e-23   
ref|XP_009360081.1|  PREDICTED: WUSCHEL-related homeobox 1-like         111   4e-23   
ref|XP_009416700.1|  PREDICTED: WUSCHEL-related homeobox 3-like         107   4e-23   
dbj|BAJ14111.1|  PRESSED FLOWER a                                       107   4e-23   
ref|XP_008360925.1|  PREDICTED: WUSCHEL-related homeobox 1-like         111   4e-23   
ref|XP_010465874.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    110   4e-23   
ref|XP_002531361.1|  transcription factor, putative                     109   5e-23   Ricinus communis
ref|XP_010922362.1|  PREDICTED: WUSCHEL-related homeobox 5-like         108   6e-23   
ref|XP_009135563.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    110   6e-23   
gb|KDP44220.1|  hypothetical protein JCGZ_05687                         108   7e-23   
emb|CDP21288.1|  unnamed protein product                                107   7e-23   
ref|XP_006341531.1|  PREDICTED: WUSCHEL-related homeobox 1-like         110   7e-23   
ref|XP_002313442.2|  hypothetical protein POPTR_0009s03460g             108   7e-23   Populus trichocarpa [western balsam poplar]
ref|XP_008802781.1|  PREDICTED: WUSCHEL-related homeobox 5-like         108   7e-23   
gb|AHL29312.1|  WOX2b                                                   108   8e-23   
ref|XP_011042737.1|  PREDICTED: WUSCHEL-related homeobox 2-like         107   8e-23   
ref|XP_010686181.1|  PREDICTED: WUSCHEL-related homeobox 3-like         107   9e-23   
ref|XP_010551135.1|  PREDICTED: WUSCHEL-related homeobox 1              110   9e-23   
ref|XP_002281707.1|  PREDICTED: WUSCHEL-related homeobox 3              107   9e-23   Vitis vinifera
gb|EYU33964.1|  hypothetical protein MIMGU_mgv1a026259mg                109   9e-23   
ref|XP_009145947.1|  PREDICTED: WUSCHEL-related homeobox 1              109   9e-23   
gb|AFW82793.1|  putative homeobox DNA-binding domain superfamily ...    107   1e-22   
ref|XP_006828230.1|  hypothetical protein AMTR_s00023p00181320          105   1e-22   
ref|XP_010506251.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    109   1e-22   
ref|XP_008776170.1|  PREDICTED: WUSCHEL-related homeobox 3B-like        106   1e-22   
ref|XP_010506265.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    109   1e-22   
ref|XP_009587628.1|  PREDICTED: WUSCHEL-related homeobox 1              110   1e-22   
ref|XP_010046418.1|  PREDICTED: WUSCHEL-related homeobox 3-like         105   1e-22   
ref|XP_009397491.1|  PREDICTED: WUSCHEL-related homeobox 3-like         106   1e-22   
ref|XP_008364689.1|  PREDICTED: WUSCHEL-related homeobox 1-like         109   1e-22   
emb|CDY66658.1|  BnaCnng51820D                                          109   1e-22   
ref|XP_003623058.1|  WUSCHEL-related homeobox 3B                        106   1e-22   
ref|XP_008374987.1|  PREDICTED: WUSCHEL-related homeobox 1              109   1e-22   
gb|AIR72306.1|  LOOSE-FLOWER                                            106   2e-22   
ref|XP_004173565.1|  PREDICTED: WUSCHEL-related homeobox 1-like         106   2e-22   
ref|XP_009758504.1|  PREDICTED: WUSCHEL-related homeobox 2              107   2e-22   
ref|XP_003631107.1|  WUSCHEL-related homeobox                           109   2e-22   
gb|AFQ69082.1|  LATHYROIDES                                             109   2e-22   
ref|XP_008656542.1|  PREDICTED: putative WUSCHEL-related homeobox 2     107   2e-22   
ref|XP_008783634.1|  PREDICTED: WUSCHEL-related homeobox 3B-like        105   2e-22   
ref|XP_004960326.1|  PREDICTED: putative WUSCHEL-related homeobox...    107   2e-22   
gb|ACA64094.1|  WOX2                                                    107   2e-22   Petunia x hybrida [garden petunia]
ref|XP_009356043.1|  PREDICTED: WUSCHEL-related homeobox 1              109   2e-22   
ref|XP_002532820.1|  hypothetical protein RCOM_1264090                  105   2e-22   Ricinus communis
gb|AEL30892.1|  STENOFOLIA                                              108   2e-22   
emb|CAT02902.2|  putative wuschel homeobox protein WOX2                 108   2e-22   Ginkgo biloba [ginkgo]
ref|XP_010909262.1|  PREDICTED: WUSCHEL-related homeobox 3-like         105   2e-22   
ref|XP_006424705.1|  hypothetical protein CICLE_v10030293mg             105   2e-22   
gb|KDO73034.1|  hypothetical protein CISIN_1g039144mg                   105   2e-22   
ref|XP_006488654.1|  PREDICTED: WUSCHEL-related homeobox 3-like         105   2e-22   
ref|XP_004235799.1|  PREDICTED: WUSCHEL-related homeobox 1 isofor...    108   2e-22   
ref|XP_009388641.1|  PREDICTED: WUSCHEL-related homeobox 3-like         105   2e-22   
ref|XP_010922460.1|  PREDICTED: WUSCHEL-related homeobox 3B-like        105   3e-22   
ref|XP_009804164.1|  PREDICTED: WUSCHEL-related homeobox 1              108   3e-22   
emb|CDP08964.1|  unnamed protein product                                105   3e-22   
ref|XP_009412983.1|  PREDICTED: WUSCHEL-related homeobox 3B-like        105   3e-22   
ref|XP_006846122.1|  hypothetical protein AMTR_s00012p00149750          106   3e-22   
emb|CDX92182.1|  BnaA05g22250D                                          108   3e-22   
gb|AEL30893.1|  STENOFOLIA 1                                            108   3e-22   
ref|XP_008453687.1|  PREDICTED: WUSCHEL-related homeobox 1              105   3e-22   
ref|XP_002281161.1|  PREDICTED: WUSCHEL-related homeobox 2              106   3e-22   Vitis vinifera
gb|KCW85646.1|  hypothetical protein EUGRSUZ_B02435                     105   4e-22   
gb|AGQ04538.1|  WUS                                                     103   4e-22   
ref|XP_006602580.1|  PREDICTED: WUSCHEL-related homeobox 3-like         105   4e-22   
ref|XP_010487711.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    107   4e-22   
ref|XP_008224295.1|  PREDICTED: WUSCHEL-related homeobox 5              105   4e-22   
gb|KHN16235.1|  WUSCHEL-related homeobox 3                              105   4e-22   
dbj|BAJ14112.1|  PRESSED FLOWER b                                       104   5e-22   
ref|XP_008222596.1|  PREDICTED: WUSCHEL-related homeobox 3              105   5e-22   
ref|XP_007140303.1|  hypothetical protein PHAVU_008G100800g             105   5e-22   
ref|XP_010465873.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    107   5e-22   
ref|XP_006350912.1|  PREDICTED: WUSCHEL-related homeobox 2-like         105   6e-22   
ref|XP_004301251.1|  PREDICTED: WUSCHEL-related homeobox 1-like         107   6e-22   
emb|CAJ84141.1|  WOX2 protein                                           100   6e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006490833.1|  PREDICTED: WUSCHEL-related homeobox 1-like         104   7e-22   
ref|XP_007207641.1|  hypothetical protein PRUPE_ppa021063mg             105   7e-22   
ref|XP_010106446.1|  WUSCHEL-related homeobox 2                         106   7e-22   
ref|XP_003530958.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    107   7e-22   
ref|XP_010558083.1|  PREDICTED: WUSCHEL-related homeobox 5              104   7e-22   
ref|XP_004242075.2|  PREDICTED: WUSCHEL-related homeobox 2              105   8e-22   
ref|XP_009353812.1|  PREDICTED: WUSCHEL-related homeobox 2              105   8e-22   
sp|A2XZR3.1|WOX2_ORYSI  RecName: Full=Putative WUSCHEL-related ho...    106   8e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_009354530.1|  PREDICTED: WUSCHEL-related homeobox 3-like         105   8e-22   
ref|XP_008385208.1|  PREDICTED: WUSCHEL-related homeobox 3-like         105   9e-22   
gb|KDP38065.1|  hypothetical protein JCGZ_04708                         106   9e-22   
gb|EYU24133.1|  hypothetical protein MIMGU_mgv1a021220mg                107   9e-22   
sp|Q5W7C3.1|WOX2_ORYSJ  RecName: Full=Putative WUSCHEL-related ho...    105   9e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010918397.1|  PREDICTED: WUSCHEL-related homeobox 2-like         107   9e-22   
ref|XP_010318647.1|  PREDICTED: WUSCHEL-related homeobox 1 isofor...    106   9e-22   
emb|CAJ84140.1|  NS protein                                             100   9e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008385223.1|  PREDICTED: WUSCHEL-related homeobox 2              105   9e-22   
ref|XP_007160532.1|  hypothetical protein PHAVU_002G329500g             107   9e-22   
ref|XP_004166032.1|  PREDICTED: WUSCHEL-related homeobox 6-like         106   9e-22   
ref|XP_007208702.1|  hypothetical protein PRUPE_ppa019793mg             105   9e-22   
ref|XP_010092997.1|  WUSCHEL-related homeobox 3                         104   9e-22   
ref|XP_007016457.1|  WUSCHEL related homeobox 2, putative               105   9e-22   
gb|AEL30895.1|  STENOFOLIA-like 2 protein                               107   1e-21   
gb|AGQ04540.1|  WUS                                                     102   1e-21   
ref|XP_010474004.1|  PREDICTED: WUSCHEL-related homeobox 3-like         104   1e-21   
ref|XP_007132075.1|  hypothetical protein PHAVU_011G064900g             105   1e-21   
gb|KHN00156.1|  WUSCHEL-related homeobox 1                              106   1e-21   
gb|ACA64093.1|  MAEWEST protein                                         107   1e-21   Petunia x hybrida [garden petunia]
ref|XP_002280774.2|  PREDICTED: WUSCHEL-related homeobox 1              106   1e-21   Vitis vinifera
emb|CDX95764.1|  BnaC03g26450D                                          104   1e-21   
ref|XP_003525189.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    106   1e-21   
ref|XP_009133866.1|  PREDICTED: WUSCHEL-related homeobox 3-like         104   1e-21   
ref|XP_004503282.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    106   1e-21   
ref|XP_006580400.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    106   1e-21   
ref|XP_006583586.1|  PREDICTED: WUSCHEL-related homeobox 3-like         103   1e-21   
ref|XP_004503283.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    106   1e-21   
ref|XP_006580401.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    106   1e-21   
gb|AFQ69083.1|  NARROW ORGAN 1                                          106   1e-21   
emb|CBI31530.3|  unnamed protein product                                102   1e-21   
gb|AGQ04541.1|  WUS                                                     101   2e-21   
ref|XP_002276008.2|  PREDICTED: WUSCHEL-related homeobox 7-like         102   2e-21   Vitis vinifera
ref|NP_001106240.1|  WUSCHEL-related homeobox 3B                        104   2e-21   Zea mays [maize]
ref|XP_004503281.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    106   2e-21   
ref|XP_004503280.1|  PREDICTED: WUSCHEL-related homeobox 1-like i...    106   2e-21   
emb|CAN77014.1|  hypothetical protein VITISV_036884                     107   2e-21   Vitis vinifera
ref|XP_007036555.1|  Associated molecule with the SH3 domain of S...    106   2e-21   
ref|XP_004505911.1|  PREDICTED: WUSCHEL-related homeobox 2-like         104   2e-21   
ref|XP_010256620.1|  PREDICTED: WUSCHEL-related homeobox 7-like         102   2e-21   
ref|XP_004492364.1|  PREDICTED: WUSCHEL-related homeobox 3-like         103   2e-21   
ref|XP_003539089.1|  PREDICTED: WUSCHEL-related homeobox 2-like         104   2e-21   
gb|AEL30894.1|  STENOFOLIA-like 1 protein                               105   2e-21   
ref|XP_002519188.1|  amsh, putative                                     107   2e-21   Ricinus communis
gb|KHN21965.1|  WUSCHEL-related homeobox 2                              104   2e-21   
ref|XP_009381843.1|  PREDICTED: WUSCHEL-related homeobox 5              103   2e-21   
dbj|BAJ14109.1|  PRESSED FLOWER b                                       102   2e-21   
ref|XP_003540730.2|  PREDICTED: WUSCHEL-related homeobox 2-like         105   2e-21   
ref|XP_006848137.1|  hypothetical protein AMTR_s00029p00225270          100   2e-21   
ref|XP_010470062.1|  PREDICTED: WUSCHEL-related homeobox 3-like         103   2e-21   
gb|AGQ04534.1|  WUS                                                     101   2e-21   
ref|XP_006297887.1|  hypothetical protein CARUB_v10013929mg             105   2e-21   
ref|XP_002879170.1|  hypothetical protein ARALYDRAFT_481772             103   2e-21   
emb|CAJ84148.1|  WOX1A protein                                        99.0    3e-21   Populus trichocarpa [western balsam poplar]
gb|KDP27884.1|  hypothetical protein JCGZ_18964                         107   3e-21   
ref|XP_011084246.1|  PREDICTED: WUSCHEL-related homeobox 1              105   3e-21   
gb|KHG13726.1|  AMSH-like ubiquitin thioesterase 1                      107   3e-21   
ref|XP_010097568.1|  WUSCHEL-related homeobox 1                         106   3e-21   
ref|XP_009358281.1|  PREDICTED: WUSCHEL-related homeobox 3-like         103   3e-21   
ref|NP_180429.1|  protein PRESSED FLOWER                                103   3e-21   
ref|XP_004137626.1|  PREDICTED: WUSCHEL-related homeobox 1-like         105   3e-21   
ref|XP_010414499.1|  PREDICTED: WUSCHEL-related homeobox 3-like         103   3e-21   
emb|CAJ84149.1|  WOX1B protein                                        99.0    3e-21   
ref|XP_009140922.1|  PREDICTED: WUSCHEL-related homeobox 3              103   3e-21   
ref|XP_010510610.1|  PREDICTED: WUSCHEL-related homeobox 3-like         103   3e-21   
ref|XP_002533700.1|  amsh, putative                                     107   3e-21   
ref|XP_004295961.1|  PREDICTED: WUSCHEL-related homeobox 3-like         103   3e-21   
ref|NP_001105960.1|  WUS1 protein                                       104   3e-21   
emb|CDO98352.1|  unnamed protein product                                105   3e-21   
gb|ABK28517.1|  unknown                                                 103   3e-21   
ref|XP_007163960.1|  hypothetical protein PHAVU_L002200g                105   3e-21   
gb|ACU68503.1|  WOX3 protein                                            102   3e-21   
gb|KDP44153.1|  hypothetical protein JCGZ_05620                         102   4e-21   
ref|XP_008666981.1|  PREDICTED: WUS1 protein isoform X1                 104   4e-21   
gb|EYU39620.1|  hypothetical protein MIMGU_mgv1a025148mg                103   4e-21   
ref|XP_006295654.1|  hypothetical protein CARUB_v10024767mg             103   4e-21   
ref|XP_006400972.1|  hypothetical protein EUTSA_v10014457mg             103   4e-21   
ref|XP_007016605.1|  Homeodomain-like superfamily protein, putative     103   4e-21   
ref|XP_002526032.1|  Protein WUSCHEL, putative                          104   4e-21   
emb|CAN59842.1|  hypothetical protein VITISV_030358                     104   4e-21   
gb|KDP44818.1|  hypothetical protein JCGZ_01318                         102   4e-21   
gb|KHG18981.1|  WUSCHEL-related homeobox 1 -like protein                105   4e-21   
ref|XP_007036553.1|  Associated molecule with the SH3 domain of S...    106   4e-21   
ref|XP_010663679.1|  PREDICTED: WUSCHEL-related homeobox 1              104   4e-21   
ref|XP_007036797.1|  WUSCHEL, putative isoform 2                        104   4e-21   
ref|XP_006583454.1|  PREDICTED: WUSCHEL-related homeobox 1-like         104   5e-21   
ref|XP_007036796.1|  WUSCHEL, putative isoform 1                        104   5e-21   
gb|KFK32282.1|  hypothetical protein AALP_AA6G222100                    102   5e-21   
gb|KEH30134.1|  wuschel-related homeobox protein                        103   5e-21   
emb|CDX77191.1|  BnaC04g39860D                                          102   5e-21   
ref|XP_009402755.1|  PREDICTED: WUSCHEL-related homeobox 3-like         101   5e-21   
ref|XP_006488662.1|  PREDICTED: WUSCHEL-related homeobox 2-like         102   5e-21   
ref|XP_010910753.1|  PREDICTED: WUSCHEL-related homeobox 3-like         102   5e-21   
ref|XP_004972245.1|  PREDICTED: WUSCHEL-related homeobox 5-like         104   5e-21   
gb|AAP37131.1|  WOX2 protein                                            103   6e-21   
ref|NP_200742.2|  WUSCHEL-related homeobox 2                            103   6e-21   
ref|XP_006409891.1|  hypothetical protein EUTSA_v10017168mg             102   6e-21   
ref|XP_002882721.1|  hypothetical protein ARALYDRAFT_478466             101   6e-21   
ref|XP_007045156.1|  WUSCHEL related homeobox 1, putative isoform 1     103   6e-21   
ref|XP_002278560.1|  PREDICTED: AMSH-like ubiquitin thioesterase 1      106   6e-21   
gb|KGN64171.1|  hypothetical protein Csa_1G042780                       104   6e-21   
ref|XP_009778688.1|  PREDICTED: WUSCHEL-related homeobox 3-like         102   7e-21   
emb|CDY01007.1|  BnaC05g41930D                                          101   7e-21   
ref|XP_006424801.1|  hypothetical protein CICLE_v10029815mg             102   7e-21   
ref|XP_008463696.1|  PREDICTED: WUSCHEL-related homeobox 1-like         104   7e-21   
ref|XP_007036552.1|  Associated molecule with the SH3 domain of S...    106   7e-21   
emb|CAJ84159.1|  WOX2A protein                                        97.4    8e-21   
gb|EPS72786.1|  hypothetical protein M569_01972                         100   8e-21   
gb|KDO72891.1|  hypothetical protein CISIN_1g046813mg                   102   8e-21   
gb|KEH30840.1|  wuschel-related homeobox protein                        100   8e-21   
ref|XP_008795405.1|  PREDICTED: WUSCHEL-related homeobox 3B-like        101   8e-21   
emb|CDP14053.1|  unnamed protein product                                100   9e-21   
ref|XP_011076726.1|  PREDICTED: WUSCHEL-related homeobox 5              100   9e-21   
ref|NP_187735.2|  WUSCHEL-related homeobox 5                            100   9e-21   
gb|AIT55438.1|  WUSCHEL-related homeobox protein                        100   1e-20   
ref|XP_009146741.1|  PREDICTED: WUSCHEL-related homeobox 5              100   1e-20   
ref|XP_002866327.1|  predicted protein                                  102   1e-20   
ref|XP_010464829.1|  PREDICTED: WUSCHEL-related homeobox 5              100   1e-20   
gb|EPS60227.1|  hypothetical protein M569_14576                       97.4    1e-20   
ref|XP_008233726.1|  PREDICTED: WUSCHEL-related homeobox 7              100   1e-20   
ref|XP_007036554.1|  Associated molecule with the SH3 domain of S...    105   1e-20   
gb|KDO45348.1|  hypothetical protein CISIN_1g010474mg                   104   1e-20   
emb|CAT03216.1|  putative wuschel-related homeobox 5 protein            100   1e-20   
emb|CAT02904.1|  putative wuschel homeobox protein WOX3B                100   1e-20   
gb|KDO64638.1|  hypothetical protein CISIN_1g035594mg                   103   1e-20   
ref|XP_006451629.1|  hypothetical protein CICLE_v10008783mg             103   1e-20   
ref|XP_007220856.1|  hypothetical protein PRUPE_ppa020183mg             100   1e-20   
ref|XP_009783476.1|  PREDICTED: WUSCHEL-related homeobox 5-like         100   1e-20   
dbj|BAA90492.1|  unnamed protein product                                102   1e-20   
ref|XP_008674842.1|  PREDICTED: WUSCHEL-related homeobox 5              103   1e-20   
ref|NP_001105961.1|  WUS2 protein                                       103   1e-20   
ref|XP_008810527.1|  PREDICTED: WUSCHEL-related homeobox 3-like         101   1e-20   
ref|XP_010452483.1|  PREDICTED: WUSCHEL-related homeobox 7-like         100   1e-20   
ref|XP_010262794.1|  PREDICTED: WUSCHEL-related homeobox 5-like         100   1e-20   
gb|AHB33633.1|  WUSCHEL-related homeobox 5                              100   1e-20   
ref|XP_004308922.1|  PREDICTED: WUSCHEL-related homeobox 5-like         100   1e-20   
ref|XP_009618151.1|  PREDICTED: WUSCHEL-related homeobox 3-like         101   2e-20   
ref|XP_006653851.1|  PREDICTED: WUSCHEL-related homeobox 1B-like        102   2e-20   
emb|CAT02905.1|  putative wuschel homeobox protein WOX4               96.3    2e-20   
ref|XP_009613150.1|  PREDICTED: WUSCHEL-related homeobox 5-like         100   2e-20   
emb|CAT02906.1|  putative wuschel homeobox protein WUS                  102   2e-20   
ref|XP_010259369.1|  PREDICTED: AMSH-like ubiquitin thioesterase ...    104   2e-20   
gb|AGQ04529.1|  WUS                                                   99.0    2e-20   
ref|XP_007009082.1|  WUSCHEL related homeobox 5                         100   2e-20   
gb|AGQ04535.1|  WUS                                                   99.0    2e-20   
ref|XP_010067503.1|  PREDICTED: WUSCHEL-related homeobox 7            99.8    2e-20   
ref|XP_009603578.1|  PREDICTED: AMSH-like ubiquitin thioesterase 3      102   2e-20   
gb|KFK38516.1|  hypothetical protein AALP_AA3G123300                    100   2e-20   
gb|AGQ04532.1|  WUS                                                   98.6    2e-20   
ref|XP_006282087.1|  hypothetical protein CARUB_v10028333mg             101   2e-20   
gb|KDO45347.1|  hypothetical protein CISIN_1g010474mg                   104   2e-20   
gb|EYU31824.1|  hypothetical protein MIMGU_mgv1a025465mg                102   2e-20   
gb|KDO69079.1|  hypothetical protein CISIN_1g036802mg                 99.8    2e-20   
ref|XP_010259368.1|  PREDICTED: AMSH-like ubiquitin thioesterase ...    104   2e-20   
emb|CDY08539.1|  BnaA05g27750D                                        99.8    2e-20   
ref|XP_011000265.1|  PREDICTED: WUSCHEL-related homeobox 2-like         101   2e-20   
ref|XP_010094734.1|  AMSH-like ubiquitin thioesterase 1                 104   2e-20   
ref|XP_010423430.1|  PREDICTED: WUSCHEL-related homeobox 7-like       99.8    2e-20   
ref|XP_004295925.1|  PREDICTED: WUSCHEL-related homeobox 2-like         101   2e-20   
ref|XP_006842325.1|  hypothetical protein AMTR_s00079p00153610          104   3e-20   
ref|XP_008351763.1|  PREDICTED: WUSCHEL-related homeobox 7-like       99.4    3e-20   
ref|XP_003534145.1|  PREDICTED: WUSCHEL-related homeobox 1-like         102   3e-20   
ref|XP_010259367.1|  PREDICTED: AMSH-like ubiquitin thioesterase ...    104   3e-20   
ref|XP_006435683.1|  hypothetical protein CICLE_v10033868mg           99.4    3e-20   
ref|XP_010443686.1|  PREDICTED: WUSCHEL-related homeobox 2-like         101   3e-20   
gb|AGL54197.1|  WUSCHEL homeobox protein WUS                            100   3e-20   
ref|XP_002532093.1|  Protein WUSCHEL, putative                          103   3e-20   
ref|XP_002448707.1|  hypothetical protein SORBIDRAFT_06g031880          102   3e-20   
ref|XP_004960192.1|  PREDICTED: WUSCHEL-related homeobox 1B-like        102   3e-20   
gb|KDO45344.1|  hypothetical protein CISIN_1g010474mg                   104   3e-20   
ref|XP_006485813.1|  PREDICTED: AMSH-like ubiquitin thioesterase ...    104   3e-20   
ref|XP_010095069.1|  WUSCHEL-related homeobox 5                       99.8    3e-20   
ref|XP_009344529.1|  PREDICTED: WUSCHEL-related homeobox 7            99.0    3e-20   
ref|XP_006442621.1|  hypothetical protein CICLE_v10019782mg             104   3e-20   
ref|XP_006486360.1|  PREDICTED: WUSCHEL-related homeobox 5-like       99.4    3e-20   
ref|XP_010259366.1|  PREDICTED: AMSH-like ubiquitin thioesterase ...    104   3e-20   
ref|XP_010483552.1|  PREDICTED: WUSCHEL-related homeobox 2              100   3e-20   
ref|XP_010454891.1|  PREDICTED: WUSCHEL-related homeobox 2-like         100   3e-20   
gb|EYU44004.1|  hypothetical protein MIMGU_mgv1a022115mg              99.0    4e-20   
ref|XP_002526863.1|  Protein WUSCHEL, putative                        99.4    4e-20   
ref|XP_009126701.1|  PREDICTED: WUSCHEL-related homeobox 2-like         100   4e-20   
ref|XP_006398542.1|  hypothetical protein EUTSA_v10001174mg             100   4e-20   
gb|AHL29309.1|  WOX1a                                                   102   4e-20   
ref|XP_008392988.1|  PREDICTED: WUSCHEL-related homeobox 7-like       99.0    4e-20   
ref|XP_011039127.1|  PREDICTED: WUSCHEL-related homeobox 1-like         102   4e-20   
gb|EYU19986.1|  hypothetical protein MIMGU_mgv1a013900mg              99.4    4e-20   
ref|XP_010521804.1|  PREDICTED: WUSCHEL-related homeobox 3              100   4e-20   
ref|XP_004235459.1|  PREDICTED: WUSCHEL-related homeobox 5-like       98.6    4e-20   
ref|XP_011008807.1|  PREDICTED: WUSCHEL-related homeobox 1              102   5e-20   
gb|AHL29310.1|  WOX1b                                                   102   5e-20   
gb|KGN45774.1|  hypothetical protein Csa_6G010010                     97.1    5e-20   
emb|CDY70975.1|  BnaAnng35720D                                        98.2    5e-20   
ref|XP_010093366.1|  WUSCHEL-related homeobox 1                         101   5e-20   
ref|XP_006290162.1|  hypothetical protein CARUB_v10003830mg           99.0    5e-20   
ref|XP_011089388.1|  PREDICTED: WUSCHEL-related homeobox 3-like       99.4    5e-20   
ref|XP_002317877.2|  hypothetical protein POPTR_0012s04510g             102   6e-20   
ref|XP_009351453.1|  PREDICTED: WUSCHEL-related homeobox 7-like       98.6    6e-20   
ref|XP_002876753.1|  HOS9/PFS2                                          100   6e-20   
ref|XP_004251286.1|  PREDICTED: WUSCHEL-related homeobox 3-like       99.4    6e-20   
ref|XP_002322100.2|  hypothetical protein POPTR_0015s04520g             101   7e-20   
gb|EPS65844.1|  hypothetical protein M569_08935                       95.1    7e-20   
ref|XP_006407462.1|  hypothetical protein EUTSA_v10022017mg           98.6    7e-20   
ref|XP_009120441.1|  PREDICTED: WUSCHEL-related homeobox 2            99.8    7e-20   
ref|XP_004148244.1|  PREDICTED: WUSCHEL-related homeobox 3-like       98.2    8e-20   
ref|XP_003616581.1|  WUSCHEL-related homeobox                         98.2    8e-20   
ref|XP_009125614.1|  PREDICTED: WUSCHEL-related homeobox 7-like       97.8    8e-20   
ref|XP_008463857.1|  PREDICTED: WUSCHEL-related homeobox 3            98.2    8e-20   
ref|XP_010491114.1|  PREDICTED: WUSCHEL-related homeobox 7 isofor...  98.2    8e-20   
emb|CAJ84150.1|  WOX2 protein                                         94.7    8e-20   
emb|CAT02935.1|  putative wuschel homeobox protein WOX4               94.4    9e-20   
ref|XP_010486774.1|  PREDICTED: WUSCHEL-related homeobox 5            98.2    9e-20   
ref|XP_010486592.1|  PREDICTED: WUSCHEL-related homeobox 5-like       98.2    9e-20   
emb|CAT02920.1|  putative wuschel homeobox protein WOX3               94.4    9e-20   
ref|XP_002298364.1|  homeobox-leucine zipper transcription factor...  99.4    1e-19   
gb|KFK43756.1|  hypothetical protein AALP_AA1G168800                  99.8    1e-19   
ref|XP_010689998.1|  PREDICTED: WUSCHEL-related homeobox 5-like       98.2    1e-19   
ref|XP_006362994.1|  PREDICTED: WUSCHEL-related homeobox 5-like       98.6    1e-19   
dbj|BAJ10712.1|  WUSCHEL ortholog                                     98.6    1e-19   
ref|XP_008358043.1|  PREDICTED: WUSCHEL-related homeobox 3-like       99.0    1e-19   
ref|XP_003518406.1|  PREDICTED: WUSCHEL-related homeobox 5-like       97.4    1e-19   
gb|KDP20138.1|  hypothetical protein JCGZ_05907                         102   1e-19   
ref|XP_011096984.1|  PREDICTED: AMSH-like ubiquitin thioesterase 1      102   1e-19   
ref|XP_006299957.1|  hypothetical protein CARUB_v10016169mg           97.8    1e-19   
emb|CAT02915.1|  putative wuschel homeobox protein WOX4               93.6    1e-19   
ref|XP_010268043.1|  PREDICTED: AMSH-like ubiquitin thioesterase ...    102   1e-19   
ref|XP_008441440.1|  PREDICTED: WUSCHEL-related homeobox 5            97.8    1e-19   
ref|XP_011075487.1|  PREDICTED: uncharacterized protein LOC105159...    101   1e-19   
ref|XP_004165973.1|  PREDICTED: WUSCHEL-related homeobox 5-like       97.8    1e-19   
ref|XP_004138570.1|  PREDICTED: WUSCHEL-related homeobox 5-like       97.8    1e-19   
ref|XP_011042044.1|  PREDICTED: WUSCHEL-related homeobox 7            97.1    1e-19   
dbj|BAE48303.1|  OsWUS protein                                        99.4    1e-19   
sp|Q33DK0.2|WOX1B_ORYSJ  RecName: Full=WUSCHEL-related homeobox 1...  99.4    1e-19   
gb|EEE61851.1|  hypothetical protein OsJ_16519                        99.4    1e-19   
gb|AHL29316.1|  WOX5b                                                 97.4    1e-19   
emb|CAH66891.1|  OSIGBa0099L20.6                                      99.4    1e-19   
gb|EEC78192.1|  hypothetical protein OsI_17799                        99.4    2e-19   
ref|XP_009766203.1|  PREDICTED: AMSH-like ubiquitin thioesterase 3    99.0    2e-19   
ref|XP_011035997.1|  PREDICTED: WUSCHEL-related homeobox 7-like       97.1    2e-19   
sp|Q7XM13.2|WOX1A_ORYSJ  RecName: Full=WUSCHEL-related homeobox 1...  99.4    2e-19   
ref|XP_002315173.2|  homeobox-leucine zipper transcription factor...  97.1    2e-19   
gb|EPS70474.1|  hypothetical protein M569_04286                       97.8    2e-19   
ref|XP_004490959.1|  PREDICTED: WUSCHEL-related homeobox 5-like       96.7    2e-19   
ref|XP_010491113.1|  PREDICTED: WUSCHEL-related homeobox 7 isofor...  95.5    2e-19   
ref|XP_008390552.1|  PREDICTED: AMSH-like ubiquitin thioesterase 3      101   2e-19   
ref|XP_007141792.1|  hypothetical protein PHAVU_008G226100g           98.6    2e-19   
emb|CDY41086.1|  BnaA09g18650D                                        98.6    2e-19   
ref|XP_010554415.1|  PREDICTED: WUSCHEL-related homeobox 6 isofor...  99.0    2e-19   
ref|XP_011070619.1|  PREDICTED: WUSCHEL-related homeobox 1-like       99.4    2e-19   
ref|XP_010554416.1|  PREDICTED: WUSCHEL-related homeobox 6 isofor...  98.6    2e-19   
ref|XP_010424922.1|  PREDICTED: WUSCHEL-related homeobox 6-like       98.6    2e-19   
dbj|BAJ10709.1|  WUSCHEL ortholog                                     97.4    3e-19   
ref|XP_002871179.1|  hypothetical protein ARALYDRAFT_349845           97.1    3e-19   
gb|ACN56438.1|  WUSCHEL-like protein 1                                98.2    3e-19   
ref|XP_010268042.1|  PREDICTED: AMSH-like ubiquitin thioesterase ...    101   3e-19   
emb|CDP00788.1|  unnamed protein product                              99.0    3e-19   
gb|AEX88468.1|  homeobox transcription factor WOX5                    96.3    3e-19   
ref|XP_008457574.1|  PREDICTED: WUSCHEL-related homeobox 5-like       97.4    3e-19   
emb|CAJ84158.1|  WOX5/7B protein                                      92.8    3e-19   
gb|AHL29311.1|  WOX2a                                                 97.8    4e-19   
ref|XP_004150189.1|  PREDICTED: WUSCHEL-related homeobox 2-like       97.4    4e-19   
gb|KGN65708.1|  hypothetical protein Csa_1G505930                     97.4    4e-19   
dbj|BAJ10706.1|  WUSCHEL ortholog                                     97.1    4e-19   
ref|XP_006488873.1|  PREDICTED: AMSH-like ubiquitin thioesterase ...    100   4e-19   
ref|XP_006591381.1|  PREDICTED: WUSCHEL-related homeobox 5-like i...  96.3    4e-19   
gb|KFK27463.1|  hypothetical protein AALP_AA8G386400                  97.8    4e-19   
ref|XP_006419435.1|  hypothetical protein CICLE_v10004794mg             100   4e-19   
ref|XP_006584877.1|  PREDICTED: AMSH-like ubiquitin thioesterase ...    100   4e-19   
emb|CAJ84152.1|  WOX6 protein                                         92.8    4e-19   
ref|XP_003537483.1|  PREDICTED: WUSCHEL-related homeobox 5-like i...  95.9    4e-19   
dbj|BAP47431.1|  WUSCHEL                                              97.1    5e-19   
emb|CAT02928.1|  putative wuschel homeobox protein WOX4               92.0    5e-19   
gb|KHN34739.1|  WUSCHEL-related homeobox 5                            95.9    5e-19   
emb|CAT02913.1|  putative wuschel homeobox protein WOX3               92.0    5e-19   
ref|XP_002310306.1|  hypothetical protein POPTR_0007s14130g           97.4    5e-19   
ref|XP_008778011.1|  PREDICTED: WUSCHEL-related homeobox 5-like       97.4    5e-19   
ref|XP_009369960.1|  PREDICTED: AMSH-like ubiquitin thioesterase 3      100   5e-19   
ref|XP_003631941.2|  PREDICTED: AMSH-like ubiquitin thioesterase 3      100   5e-19   
ref|XP_009408701.1|  PREDICTED: protein WUSCHEL                       97.8    5e-19   
ref|XP_009114434.1|  PREDICTED: WUSCHEL-related homeobox 6            97.4    6e-19   



>gb|ACA64095.1| WOX4 [Petunia x hybrida]
Length=237

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 172/231 (74%), Gaps = 19/231 (8%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQ-VPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIK  824
            +MKVHQFTRGF+   D   PSLSLGCKR RPLAPKL   +    +I+VTPP FDLKSFI+
Sbjct  9    SMKVHQFTRGFLEHNDAATPSLSLGCKRLRPLAPKLTTNN--NDSINVTPPPFDLKSFIR  66

Query  823  PES-SPRSP-------DEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  668
            PES S  SP       D+KK+S Q E+HPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI
Sbjct  67   PESCSNTSPGKLSFINDDKKESSQVESHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  126

Query  667  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTF  488
            EQIT QLGKYGKIEGKNVFYWFQNHKARERQKQKRNS+GL+ S   P  PP    S LTF
Sbjct  127  EQITLQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSMGLSQS---PRTPPAIVTSPLTF  183

Query  487  DPWG-----EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
            D  G     ED   KRKCR W FE LEEE++  C  +  D TLELFPLHPE
Sbjct  184  DTRGEVVREEDSPYKRKCRTWTFEYLEEEEKRNCREDASDRTLELFPLHPE  234



>ref|XP_009613514.1| PREDICTED: WUSCHEL-related homeobox 4 [Nicotiana tomentosiformis]
Length=243

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 168/227 (74%), Gaps = 19/227 (8%)
 Frame = -3

Query  994  KVHQFTRGFIFEQDQV-PSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPE  818
            KVHQFTRG I E D   PSL+LGCKR RPLAPKL     +T   ++  P FDLKSFI+PE
Sbjct  21   KVHQFTRGLILEHDSAAPSLTLGCKRLRPLAPKLS---TSTNDPNIVTPPFDLKSFIRPE  77

Query  817  SSPRSP------DEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQIT  656
            SS  SP      D+KKDS Q E+HPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQIT
Sbjct  78   SS-TSPGKNSFNDDKKDSSQVESHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQIT  136

Query  655  AQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWG  476
             QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGL+ S   P  PP    S L+FD  G
Sbjct  137  VQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSQS---PRTPPAIVTSPLSFDTRG  193

Query  475  -----EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
                 ED   KRKCR W FE LEEE++  C  + GD TLELFPLHPE
Sbjct  194  EVVREEDSPYKRKCRGWTFEYLEEEEKRNCREDNGDRTLELFPLHPE  240



>ref|XP_009776871.1| PREDICTED: WUSCHEL-related homeobox 4 [Nicotiana sylvestris]
Length=235

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 168/227 (74%), Gaps = 19/227 (8%)
 Frame = -3

Query  994  KVHQFTRGFIFEQDQV-PSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPE  818
            KVHQFTRG I E D   PSL+LGCKR RPLAPKL    + T   S+  P FDLKSFI+PE
Sbjct  13   KVHQFTRGLILEHDSAAPSLTLGCKRLRPLAPKLS---SCTNDPSIVTPPFDLKSFIRPE  69

Query  817  SSPRSP------DEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQIT  656
            SS  SP      D+KKDS Q E+HPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQIT
Sbjct  70   SS-TSPGKTSFNDDKKDSSQVESHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQIT  128

Query  655  AQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWG  476
             QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGL+ S   P  PP    S L+FD  G
Sbjct  129  VQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSQS---PRTPPAIVTSPLSFDTRG  185

Query  475  -----EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
                 ED   KRKCR W +E LEEE++  C  + GD TLELFPLHPE
Sbjct  186  EVVREEDSPYKRKCRGWTYEYLEEEEKRNCREDNGDRTLELFPLHPE  232



>ref|XP_007017177.1| WUSCHEL related homeobox 4 [Theobroma cacao]
 gb|EOY14402.1| WUSCHEL related homeobox 4 [Theobroma cacao]
Length=215

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 165/226 (73%), Gaps = 24/226 (11%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
             MKVHQ  RGF    +  PSLSLGCKR RPLAPKL      T +      +FDLKSFI+P
Sbjct  3    NMKVHQLARGFW---EHEPSLSLGCKRLRPLAPKLATSTDNTVS------SFDLKSFIRP  53

Query  820  ESSPRSP---DEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            ES PR     DEK+DSPQ ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ
Sbjct  54   ESGPRKLGPLDEKRDSPQVETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  113

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDP----  482
            LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNH      P     ++++T D     
Sbjct  114  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHC-----PRSSAPITTITLDTRVEL  168

Query  481  --WGEDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
                ED   KRKCR W+FE LEEE R +C +EE + TLELFPLHPE
Sbjct  169  MEREEDSPYKRKCRSWSFEYLEEESRSSC-KEEENRTLELFPLHPE  213



>ref|XP_006374903.1| homeobox-leucine zipper transcription factor family protein [Populus 
trichocarpa]
 gb|AGM48535.1| WUSCHEL-related homeobox 4 [Populus x canadensis]
 gb|ERP52700.1| homeobox-leucine zipper transcription factor family protein [Populus 
trichocarpa]
Length=213

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 168/225 (75%), Gaps = 24/225 (11%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
            +MKVHQ  RGF    +  PSL+LGCKR RPLAPKL   D      SVT  +FDLKSFI+P
Sbjct  3    SMKVHQLARGFW---EHEPSLTLGCKRLRPLAPKLANTDH-----SVT--SFDLKSFIRP  52

Query  820  ESSPR---SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            +S PR   S DEKKDSPQ ETHPGGTRWNPTQEQIGILEMLYRGGMRTPN QQIE ITAQ
Sbjct  53   DSGPRKLASSDEKKDSPQGETHPGGTRWNPTQEQIGILEMLYRGGMRTPNGQQIEDITAQ  112

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWG--  476
            L +YGKIEGKNVFYWFQNHKARERQKQKRNSLGL+HS     P   + ++ ++ D  G  
Sbjct  113  LSRYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHS-----PRTPSPITIISLDTRGEV  167

Query  475  ---EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
               ED   KRKCR W+FEC E E+  +C +EEGD TLELFPLHPE
Sbjct  168  EKDEDSPYKRKCRSWSFECFELEESRSC-KEEGDRTLELFPLHPE  211



>ref|XP_002284927.1| PREDICTED: WUSCHEL-related homeobox 4 [Vitis vinifera]
 emb|CAN76463.1| hypothetical protein VITISV_017034 [Vitis vinifera]
 emb|CBI19488.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 163/220 (74%), Gaps = 16/220 (7%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
            +MKVHQF RGF    +  PSL+LGCKR RPLAPKL   D+  A        FDLKSFI+P
Sbjct  3    SMKVHQFARGFW---EHEPSLTLGCKRLRPLAPKLANSDSVAA--------FDLKSFIRP  51

Query  820  ESSPRS---PDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            ES PR     D+K+DSPQ ETHPGGTRWNPTQEQIGILEMLY+ GMRTPNAQQIEQITAQ
Sbjct  52   ESGPRKLGCSDDKRDSPQVETHPGGTRWNPTQEQIGILEMLYKSGMRTPNAQQIEQITAQ  111

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWGED  470
            LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGL H PRTP      T+ +       ED
Sbjct  112  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLGHCPRTPTSITTITLDTRVEVGREED  171

Query  469  IACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
               KRKC+ W FE +EE  R+   REEGD TLELFPLHPE
Sbjct  172  SPNKRKCKSWTFETVEENNRYY--REEGDKTLELFPLHPE  209



>gb|AHL29314.1| WOX4b [Populus tomentosa]
Length=213

 Score =   275 bits (704),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 168/225 (75%), Gaps = 24/225 (11%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
            +MKVHQ  RGF    +  PSL+LGCKR RPLAPKL   D      SVT  +FDLKSFI+P
Sbjct  3    SMKVHQLARGFW---EHEPSLTLGCKRLRPLAPKLANTDH-----SVT--SFDLKSFIRP  52

Query  820  ESSPR---SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            +S PR   S DEKKDSPQ ETHPGGTRWNPTQEQIGILEMLYRGGMRTPN QQIE ITAQ
Sbjct  53   DSGPRKLASSDEKKDSPQGETHPGGTRWNPTQEQIGILEMLYRGGMRTPNGQQIEDITAQ  112

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWG--  476
            L +YGKIEGKNVFYWFQNHKARERQKQKRNSLGL+HS     P   + ++ ++ D  G  
Sbjct  113  LSRYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHS-----PRTPSPITIISLDTRGEV  167

Query  475  ---EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
               ED   KRKC+ W+FEC E E+  +C +EEGD TLELFPLHPE
Sbjct  168  EKDEDSPYKRKCKSWSFECFELEESRSC-KEEGDRTLELFPLHPE  211



>emb|CDP01306.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 167/226 (74%), Gaps = 18/226 (8%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
            +MKVHQF RGF    +  PSL+LGCKR RPLAPKL   D     +    P FDLKSFI+P
Sbjct  3    SMKVHQFARGFW---EHEPSLTLGCKRLRPLAPKLSNTDNTPTTV----PPFDLKSFIRP  55

Query  820  ESSPR---SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            ES PR   S D+K+++   +THPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ
Sbjct  56   ESGPRKLGSSDDKRETAHVDTHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  115

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHS-prtpppppitTVSSLTFDPWG-  476
            LGKYGKIEGKNVFYWFQNHKARERQKQKRN+LGLNHS          T  SSLT +  G 
Sbjct  116  LGKYGKIEGKNVFYWFQNHKARERQKQKRNNLGLNHSPRAPGVTTTTTISSSLTHESRGD  175

Query  475  ----EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
                ED   KRKCR W FECLEE+KR+   R EGD TLELFPLHPE
Sbjct  176  FGREEDSPYKRKCRSWTFECLEEDKRYC--RNEGDRTLELFPLHPE  219



>ref|XP_006434726.1| hypothetical protein CICLE_v10002438mg [Citrus clementina]
 ref|XP_006473292.1| PREDICTED: WUSCHEL-related homeobox 4-like [Citrus sinensis]
 gb|ESR47966.1| hypothetical protein CICLE_v10002438mg [Citrus clementina]
Length=217

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 165/222 (74%), Gaps = 14/222 (6%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
            +MKVHQ  RGF   +   PSL+LGCKR RPLAPKL   ++ + +      +FDLKSFI+P
Sbjct  3    SMKVHQLARGFW--EHAEPSLTLGCKRLRPLAPKLPNAESTSVS------SFDLKSFIRP  54

Query  820  ESSPR---SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            ES PR   S DEK++ PQ ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ
Sbjct  55   ESGPRKLVSSDEKRNPPQVETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  114

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNH--SprtpppppitTVSSLTFDPWG  476
            LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGL+H            TT+S  + +   
Sbjct  115  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHCPRTPAATASFTTTISLDSREREE  174

Query  475  EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
            E    KRKC  W FECLEEE R +C  ++GD TLELFPLHPE
Sbjct  175  ESSPYKRKCMNWTFECLEEESR-SCKEDQGDRTLELFPLHPE  215



>ref|XP_011029533.1| PREDICTED: WUSCHEL-related homeobox 4-like [Populus euphratica]
Length=213

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 167/225 (74%), Gaps = 24/225 (11%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
            +MKVHQ  RGF    +  PSL+L CKR RPLAPKL   D      SVT  +FDLKSFI+P
Sbjct  3    SMKVHQLARGFW---EHEPSLTLSCKRLRPLAPKLANTDH-----SVT--SFDLKSFIRP  52

Query  820  ESSPR---SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            +S PR   S DEKKDSPQ ETHPGGTRWNPTQEQIGILEMLYRGGMRTPN QQIE ITAQ
Sbjct  53   DSGPRKLASSDEKKDSPQGETHPGGTRWNPTQEQIGILEMLYRGGMRTPNGQQIEDITAQ  112

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWG--  476
            L +YGKIEGKNVFYWFQNHKARERQKQKRNSLGL+HS     P   + ++ ++ D  G  
Sbjct  113  LSRYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHS-----PRTPSPITIISLDTRGEV  167

Query  475  ---EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
               ED   KRKCR W+FEC E E+  +C +EEGD TLELFPLHPE
Sbjct  168  EKDEDSPYKRKCRSWSFECFELEESRSC-KEEGDRTLELFPLHPE  211



>gb|KDO84106.1| hypothetical protein CISIN_1g027928mg [Citrus sinensis]
Length=217

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 164/221 (74%), Gaps = 14/221 (6%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPE  818
            MKVHQ  RGF   +   PSL+LGCKR RPLAPKL   ++ + +      +FDLKSFI+PE
Sbjct  4    MKVHQLARGFW--EHAEPSLTLGCKRLRPLAPKLPNAESTSVS------SFDLKSFIRPE  55

Query  817  SSPR---SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQL  647
            S PR   S DEK++ PQ ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQL
Sbjct  56   SGPRKLVSSDEKRNPPQVETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQL  115

Query  646  GKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNH--SprtpppppitTVSSLTFDPWGE  473
            GKYGKIEGKNVFYWFQNHKARERQKQKRNSLGL+H            TT+S  + +   E
Sbjct  116  GKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHCPRTPAATASFTTTISLDSREREEE  175

Query  472  DIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
                KRKC  W FECLEEE R +C  ++GD TLELFPLHPE
Sbjct  176  SSPYKRKCMNWTFECLEEESR-SCKEDQGDRTLELFPLHPE  215



>gb|ABK93839.1| unknown [Populus trichocarpa]
Length=213

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 167/225 (74%), Gaps = 24/225 (11%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
            +MKVHQ  RGF    +  PSL+LGCKR RPLAPKL   D      SVT  +FDLKSFI+P
Sbjct  3    SMKVHQLARGFW---EHEPSLTLGCKRLRPLAPKLANTDH-----SVT--SFDLKSFIRP  52

Query  820  ESSPR---SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            +S PR   S DEKKDSPQ ETHPGGTRWNPTQEQIGILEMLYRGGMRTPN QQIE ITAQ
Sbjct  53   DSGPRKLASSDEKKDSPQGETHPGGTRWNPTQEQIGILEMLYRGGMRTPNGQQIEDITAQ  112

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWG--  476
            L +YGKIEGKNVFYWFQNHKARERQKQKRNSLGL+HS     P   + ++ ++ D  G  
Sbjct  113  LSRYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHS-----PRTPSPITIISLDTRGEV  167

Query  475  ---EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
               ED   K KCR W+FEC E E+  +C +EEGD TLELFPLHPE
Sbjct  168  EKDEDSPYKGKCRSWSFECFELEESRSC-KEEGDRTLELFPLHPE  211



>ref|XP_002301170.1| homeobox-leucine zipper transcription factor family protein [Populus 
trichocarpa]
 gb|EEE80443.1| homeobox-leucine zipper transcription factor family protein [Populus 
trichocarpa]
Length=213

 Score =   272 bits (696),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 164/225 (73%), Gaps = 24/225 (11%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
            +MKVHQ  RGF    +  P L+LG KR RPLAPKL   D + A+       FDLKSFI+P
Sbjct  3    SMKVHQLARGFW---EHEPFLTLGFKRLRPLAPKLANTDHSAAS-------FDLKSFIRP  52

Query  820  ESSPR---SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            +S PR   S DEKKDSPQ ETHPGGTRWNPTQEQIGILEMLYRGGMRTPN QQIE ITAQ
Sbjct  53   DSGPRNLASSDEKKDSPQGETHPGGTRWNPTQEQIGILEMLYRGGMRTPNGQQIEDITAQ  112

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWG--  476
            L +YGKIEGKNVFYWFQNHKARERQKQKRNSLGL+HS     P   + V+ ++ D  G  
Sbjct  113  LSRYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHS-----PRTPSPVTIISLDTRGEV  167

Query  475  ---EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
               ED   KRKCR W FECLE E   +C RE+GD TLELFPLHPE
Sbjct  168  EGEEDSPYKRKCRSWTFECLELEDSRSC-REKGDRTLELFPLHPE  211



>ref|XP_006354857.1| PREDICTED: WUSCHEL-related homeobox 4-like [Solanum tuberosum]
Length=243

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 171/234 (73%), Gaps = 21/234 (9%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
            +MKVHQFTRGF+  +   PSL+LGCKR RPLAPKL   +  T    VTPP FDLKSFI+P
Sbjct  11   SMKVHQFTRGFLEHEAASPSLTLGCKRLRPLAPKLNTTNNDTTTTIVTPP-FDLKSFIRP  69

Query  820  ESSPRSP-----DEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQIT  656
            ESS   P     ++KKDS Q E+HPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQIT
Sbjct  70   ESSNSPPKLAYNEDKKDSSQVESHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQIT  129

Query  655  AQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWG  476
            AQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGL+ S   P  PP    S L+FD  G
Sbjct  130  AQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSQS---PRTPPPIVTSPLSFDTRG  186

Query  475  -----EDIACKRKCRPWAFECL-------EEEKRWACSREEGDGTLELFPLHPE  350
                 ED   KRKCR W FE +       ++E+ +   RE GD TL+LFPLHPE
Sbjct  187  EIVRDEDSPYKRKCRGWTFEYMEEEQQQQQDEEEFINCRENGDRTLQLFPLHPE  240



>ref|XP_002510184.1| transcription factor, putative [Ricinus communis]
 gb|EEF52371.1| transcription factor, putative [Ricinus communis]
Length=228

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 152/231 (66%), Positives = 170/231 (74%), Gaps = 21/231 (9%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISV----TPPAFDLKS  833
            +MKVHQ  RGF +E +Q  SLSLGCKR RPLAPKL      TA        +  +FDLKS
Sbjct  3    SMKVHQLARGF-WEHEQT-SLSLGCKRLRPLAPKLANNTTTTATEITNTITSVSSFDLKS  60

Query  832  FIKPESSPR---SPDEKKDSP-QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE  665
            FI+PES PR   S ++KKDSP Q ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE
Sbjct  61   FIRPESGPRKLGSSEDKKDSPPQVETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE  120

Query  664  QITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFD  485
            QITAQL +YGKIEGKNVFYWFQNHKARERQKQKRNSLGL+HS     P     +++++ +
Sbjct  121  QITAQLSRYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHS-----PRTPGPITTISLE  175

Query  484  PWG------EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
              G      ED   KRKCR W FECLE E+  +  REEGD TLELFPLHPE
Sbjct  176  TKGEVLEKDEDSPYKRKCRSWGFECLELEESRSSCREEGDRTLELFPLHPE  226



>ref|XP_011017175.1| PREDICTED: WUSCHEL-related homeobox 4-like [Populus euphratica]
Length=213

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 162/225 (72%), Gaps = 24/225 (11%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
             MKVHQ  RGF    +  P L+LG KR RPLAPKL   D + A+       FDLKSFI+P
Sbjct  3    NMKVHQLARGFW---EHEPFLTLGFKRLRPLAPKLANTDHSAAS-------FDLKSFIRP  52

Query  820  ESSPR---SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            ES PR   S DEKKDS Q ETHPGGTRWNPTQEQIG+LEMLYRGGMRTPN QQIE ITAQ
Sbjct  53   ESGPRNLASSDEKKDSHQGETHPGGTRWNPTQEQIGVLEMLYRGGMRTPNGQQIEDITAQ  112

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWG--  476
            L +YGKIEGKNVFYWFQNHKARERQKQKRNSLGL+HS     P   + V+ ++ D  G  
Sbjct  113  LSRYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHS-----PRTPSPVTIISLDTRGEV  167

Query  475  ---EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
               ED   KRKCR W FECLE E   +C RE+GD TLELFPLHPE
Sbjct  168  EREEDSPYKRKCRSWTFECLELEDSRSC-REKGDRTLELFPLHPE  211



>gb|KDP41702.1| hypothetical protein JCGZ_16109 [Jatropha curcas]
Length=217

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 163/227 (72%), Gaps = 23/227 (10%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPE  818
            MKVHQ  RGF    +  PSL+LGCKR RPLAPKL      T   S     FDLKSFI+PE
Sbjct  1    MKVHQLARGFW---EHEPSLTLGCKRLRPLAPKLSNDTTTTTVTS-----FDLKSFIRPE  52

Query  817  SSPR---SPDEKKDSPQ--AETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA  653
            S PR   S D+KKDSPQ   ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA
Sbjct  53   SGPRKLGSSDDKKDSPQPQVETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA  112

Query  652  QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWGE  473
            QLG+YGKIEGKNVFYWFQNHKARERQKQKRNSLGL+HS    P  P    +S++ +  GE
Sbjct  113  QLGRYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHS----PRTPSPITTSISLETRGE  168

Query  472  -----DIACKRKCRPWAFECLE-EEKRWACSREEGDGTLELFPLHPE  350
                 D   KRKCR W FE LE EE R  C  E  D TLELFPLHPE
Sbjct  169  VEREKDSPYKRKCRSWGFESLELEESRSTCREEGADRTLELFPLHPE  215



>gb|AHL29313.1| WOX4a [Populus tomentosa]
Length=213

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 163/225 (72%), Gaps = 24/225 (11%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
            +MKVHQ  RGF    +  P L+LG KR RPLAPKL   D + A+       FDLKSFI+P
Sbjct  3    SMKVHQLARGFW---EHEPFLTLGFKRLRPLAPKLANTDHSAAS-------FDLKSFIRP  52

Query  820  ESSP---RSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            +S P    S DEKKDSPQ E HPGGTRWNPTQEQIGILEMLYRGGMRTPN QQIE ITAQ
Sbjct  53   DSGPINLASSDEKKDSPQGEAHPGGTRWNPTQEQIGILEMLYRGGMRTPNGQQIEDITAQ  112

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWG--  476
            L +YGKIEGKNVFYWFQNHKARERQKQKRNSLGL+HS     P   + V+ ++ D  G  
Sbjct  113  LSRYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHS-----PRTPSPVTIISLDTRGEV  167

Query  475  ---EDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
               ED   KRKCR WAFECLE E   +C RE+GD TLELFPLHPE
Sbjct  168  EREEDSPYKRKCRSWAFECLELEDSRSC-REKGDRTLELFPLHPE  211



>ref|NP_001234251.1| WOX4 [Solanum lycopersicum]
 gb|ACJ61689.1| WOX4 [Solanum lycopersicum]
 gb|ACJ61691.1| WOX4 [Solanum lycopersicum]
Length=242

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 168/231 (73%), Gaps = 20/231 (9%)
 Frame = -3

Query  994  KVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPES  815
            KVHQFTRGF+  +   PSL+LGCKR RPLAPKL   +  T    VTPP FDLKSFI+PES
Sbjct  13   KVHQFTRGFLEHEAASPSLTLGCKRLRPLAPKLNTTNNDTTTTIVTPP-FDLKSFIRPES  71

Query  814  SPRSP-----DEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            S   P     ++KKDS Q E+HPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ
Sbjct  72   SNSPPKLAYNEDKKDSSQVESHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  131

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWG--  476
            LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGL+ S   P  P     S L+FD  G  
Sbjct  132  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSQS---PRTPSAIVTSPLSFDTRGEV  188

Query  475  ---EDIACKRKCRPWAFECLEEEKRWACS------REEGDGTLELFPLHPE  350
               ED   KRKCR W FE +EEE++          RE GD TL+LFPLHPE
Sbjct  189  VRDEDSPYKRKCRGWTFEYMEEEQQQQDEEEIINCRENGDRTLQLFPLHPE  239



>gb|KHN22335.1| WUSCHEL-related homeobox 4 [Glycine soja]
Length=230

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 165/230 (72%), Gaps = 17/230 (7%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPA-FDLKSFIK  824
            +MKVHQFTRG I+E +  P L+LGCKR RPLAPKL   +  T  I  TP   FDLKSFI+
Sbjct  3    SMKVHQFTRGLIWEHE--PFLTLGCKRLRPLAPKLP--NTQTNTIPTTPSVPFDLKSFIR  58

Query  823  PESSPRSP----DEKKDSP----QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  668
            PES PR P    D KKD P    Q ETHPGGTRWNPTQEQIGILEMLY+GG+RTPNAQQI
Sbjct  59   PESGPRKPVSSDDSKKDPPSPQGQVETHPGGTRWNPTQEQIGILEMLYKGGIRTPNAQQI  118

Query  667  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSS---  497
            EQIT QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL  +HSPRT     I T+ +   
Sbjct  119  EQITVQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLAFSHSPRTHTIHSIVTLETTRG  178

Query  496  -LTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
             +      ED   K+KCR W FECLEE+   +   +E   TLELFPLHPE
Sbjct  179  EVVERDHEEDSPYKKKCRRWVFECLEEQNMSSACEQEEHRTLELFPLHPE  228



>ref|NP_001241420.1| uncharacterized protein LOC100781015 [Glycine max]
 gb|ACU20736.1| unknown [Glycine max]
Length=230

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 165/230 (72%), Gaps = 17/230 (7%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPA-FDLKSFIK  824
            +MKVHQFTRGF +E +  P L+LGCKR RPLAPKL   +  T  I  TP   FDLKSFI+
Sbjct  3    SMKVHQFTRGFCWEHE--PFLTLGCKRLRPLAPKLP--NTQTNTIPTTPSVPFDLKSFIR  58

Query  823  PESSPRSP----DEKKDSP----QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  668
            PES PR P    D KKD P    Q ETHPGGTRWNPTQEQIGILEMLY+GG+RTPNAQQI
Sbjct  59   PESGPRKPVSSDDSKKDPPSPQGQVETHPGGTRWNPTQEQIGILEMLYKGGIRTPNAQQI  118

Query  667  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSS---  497
            EQIT QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL  +HSPRT     I T+ +   
Sbjct  119  EQITVQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLAFSHSPRTHTIHSIVTLETTRG  178

Query  496  -LTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
             +      ED   K+KCR W FECLEE+   +   +E   TLELFPLHPE
Sbjct  179  EVVERDHEEDSPYKKKCRRWVFECLEEQNMSSACEQEEHRTLELFPLHPE  228



>gb|KHN04484.1| WUSCHEL-related homeobox 4 [Glycine soja]
Length=224

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 162/229 (71%), Gaps = 21/229 (9%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
            +MKVHQFTRG I+E +  P L+LGCKR RPLAPKL      T         FDLKSFI+P
Sbjct  3    SMKVHQFTRGLIWEHE--PFLTLGCKRLRPLAPKLPNTKTITTP-------FDLKSFIRP  53

Query  820  ESSPRSP----DEKKDSP----QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE  665
            ES PR P    D KKD P    Q ETHPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE
Sbjct  54   ESGPRKPVSSDDTKKDPPSPQGQIETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIE  113

Query  664  QITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSS----  497
            QIT QLGKYGKIEGKNVFYWFQNHKARERQKQKR+SL  +HSPRTP    + T+ +    
Sbjct  114  QITVQLGKYGKIEGKNVFYWFQNHKARERQKQKRSSLASSHSPRTPTIHSVVTLETTRGE  173

Query  496  LTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
            +      ED   K+KCR W F+CLEE+   +   +E   TLELFPLHPE
Sbjct  174  VVERDHEEDSPYKKKCRRWVFDCLEEQNMSSPCEQEEHRTLELFPLHPE  222



>ref|XP_010110805.1| WUSCHEL-related homeobox 4 [Morus notabilis]
 gb|EXC28177.1| WUSCHEL-related homeobox 4 [Morus notabilis]
Length=252

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 152/247 (62%), Positives = 165/247 (67%), Gaps = 32/247 (13%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGG----------DAATAAISVTPP  851
            +MKVHQF RG    +   PSL+LGCKR RPLAPKL             +  T AIS +P 
Sbjct  6    SMKVHQFARGLW--EAHEPSLTLGCKRLRPLAPKLPNSPTSSTTLDTHNITTTAISTSPN  63

Query  850  A----FDLKSFIKPESSPR----SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGG  695
            +    FDLKSFI+PES PR    S  +KKDSP  ETHPGGTRWNPTQEQIGILE LYRGG
Sbjct  64   SSIAPFDLKSFIRPESGPRKTGSSDVDKKDSPPVETHPGGTRWNPTQEQIGILETLYRGG  123

Query  694  MRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpp--p  521
            MRTPNAQQIEQITAQL K+GKIEGKNVFYWFQNHKARERQKQKRNSLGL+HSPRTP    
Sbjct  124  MRTPNAQQIEQITAQLSKFGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHSPRTPTPIT  183

Query  520  ppitTVSSLTFDPWGEDIAC--KRKCRPWAFECLEEEKRWACSR--------EEGDGTLE  371
                 +S    +   ED     KRKCR W FECL  E   +           EEGD TLE
Sbjct  184  IANLDISRGDVERDREDSTSPYKRKCRSWGFECLMVEDHSSTRSLYNNNYRPEEGDRTLE  243

Query  370  LFPLHPE  350
            LFPLHPE
Sbjct  244  LFPLHPE  250



>ref|NP_001237560.1| uncharacterized protein LOC100499894 [Glycine max]
 gb|ACU14085.1| unknown [Glycine max]
Length=224

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 161/229 (70%), Gaps = 21/229 (9%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
            +MKVHQFTRG I+E +  P L+LGCKR RPLAPKL      T         FDLKSFI+P
Sbjct  3    SMKVHQFTRGLIWEHE--PFLTLGCKRLRPLAPKLPNTKTITTP-------FDLKSFIRP  53

Query  820  ESSPRSP----DEKKDSP----QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE  665
            ES PR P    D KKD P    Q ETHPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE
Sbjct  54   ESGPRKPVSSDDTKKDPPSPQGQIETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIE  113

Query  664  QITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSS----  497
            QIT QLGKYGKIEGKNVFYWFQNHKARERQKQ R+SL  +HSPRTP    + T+ +    
Sbjct  114  QITVQLGKYGKIEGKNVFYWFQNHKARERQKQNRSSLASSHSPRTPTIHSVVTLETTRGE  173

Query  496  LTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
            +      ED   K+KCR W F+CLEE+   +   +E   TLELFPLHPE
Sbjct  174  VVERDHEEDSPYKKKCRRWVFDCLEEQNMSSPCEQEEHRTLELFPLHPE  222



>ref|XP_010263471.1| PREDICTED: WUSCHEL-related homeobox 4-like [Nelumbo nucifera]
Length=216

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 154/226 (68%), Gaps = 25/226 (11%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
             MKVHQ  RG ++E +  PSL+LGCKR RPL PKL  GD+ +          DLKSFIKP
Sbjct  5    NMKVHQLARG-LWEHE--PSLTLGCKRLRPLVPKLTNGDSVSN--------LDLKSFIKP  53

Query  820  ESSPRSP----DEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA  653
            ESSP+ P    DEK+   Q E   GGTRWNPTQEQIGILEMLYRGGMRTPNA QIEQITA
Sbjct  54   ESSPKKPAGSTDEKRQPVQVEAPSGGTRWNPTQEQIGILEMLYRGGMRTPNAHQIEQITA  113

Query  652  QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPW--  479
            QLGK+GKIEGKNVFYWFQNHKARERQKQKRNSLGL HS     P      +++T DP   
Sbjct  114  QLGKFGKIEGKNVFYWFQNHKARERQKQKRNSLGLTHS-----PRIAPPTTTVTLDPGRE  168

Query  478  ---GEDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
                ED   KRK R W  E   E+    C  EEGD TLELFPLHPE
Sbjct  169  VEREEDSHYKRKHRSWGVEFFGEDSSRLCGGEEGDKTLELFPLHPE  214



>ref|XP_004291086.1| PREDICTED: WUSCHEL-related homeobox 4-like [Fragaria vesca subsp. 
vesca]
Length=226

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 162/233 (70%), Gaps = 27/233 (12%)
 Frame = -3

Query  997  MKVHQFTRGFIFE--QDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIK  824
            MKVHQF RG       +  PSLSLGCKR RPLAPKL    AAT A++     FDLKSFI+
Sbjct  1    MKVHQFARGLWDSPTTNLEPSLSLGCKRLRPLAPKLSD-TAATTALA----PFDLKSFIR  55

Query  823  PESSPR----SP---DEKKDSP--QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQ  671
            PES PR    SP    EKKDS   Q E HPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQ
Sbjct  56   PESGPRNKLPSPPHDHEKKDSSPSQVEMHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQ  115

Query  670  IEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLT  491
            IEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKR++LGL HS     P     V + T
Sbjct  116  IEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRSTLGLTHS-----PRTPAPVITTT  170

Query  490  FDPW---GEDIACKRKCRPWAFECL-EEEKRWACSRE--EGDGTLELFPLHPE  350
             D      ED   KRKC  WAF+CL ++     C+ +  EGD TLELFPL PE
Sbjct  171  GDVVLEREEDSPYKRKCMSWAFDCLTDDSSTITCNNDVVEGDRTLELFPLRPE  223



>gb|AFK34088.1| unknown [Lotus japonicus]
Length=227

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 151/230 (66%), Positives = 164/230 (71%), Gaps = 20/230 (9%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPA---FDLKSF  830
            +MKVHQFTRGF    +  PSL+LGCKR RPLAPKL      TAA + T      FD+KSF
Sbjct  3    SMKVHQFTRGFW---EHEPSLTLGCKRLRPLAPKLPNTTDTTAAATTTTTHSLPFDIKSF  59

Query  829  IKPESSP----RSPDEKKDSP----QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQ  674
            I+PES P     S D KKD P    Q ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQ
Sbjct  60   IRPESGPIKLLSSDDNKKDPPSPQSQVETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQ  119

Query  673  QIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSL  494
            QIEQITAQL KYGKIEGKNVFYWFQNHKARERQKQKRNSLGL+HSPRT     I+  +  
Sbjct  120  QIEQITAQLSKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHSPRTSTIQTISLETRR  179

Query  493  --TFDPWGEDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
                +   ED   KR CR W FECLEE+     ++EE   TLELFPLHPE
Sbjct  180  GEVVERDEEDSPYKR-CRRWGFECLEEQ---IGNKEEEHRTLELFPLHPE  225



>gb|AFK47658.1| unknown [Medicago truncatula]
Length=236

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 164/238 (69%), Gaps = 26/238 (11%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPE  818
            MKVHQFTRGF    +  PSL+LGCKR RPLAPK+   +   +  +  P +FDLKSFI+PE
Sbjct  1    MKVHQFTRGFW---EHEPSLTLGCKRLRPLAPKISSNNTDNSTTNTPPLSFDLKSFIRPE  57

Query  817  SSPR-----SPDEKKDSP----QAETH-PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  668
            ++PR     S D KKD P    Q ETH PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI
Sbjct  58   TAPRISLSSSDDNKKDPPSPQSQVETHIPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  117

Query  667  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSL--  494
            EQIT QL KYGKIEGKNVFYWFQNHKARERQKQKRNSLGL HSPRTP    ++   +   
Sbjct  118  EQITVQLSKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLPHSPRTPTTTLVSMSPTFST  177

Query  493  --TFDP--------WGEDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
              T D           ++ +  +K R W FE L EEK W+  + E   TLELFPLHPE
Sbjct  178  ITTLDTPKRVQVMERDQEDSPLKKSRSWPFEYL-EEKNWSMCKVEEHKTLELFPLHPE  234



>ref|XP_010270556.1| PREDICTED: WUSCHEL-related homeobox 4-like [Nelumbo nucifera]
 ref|XP_010270564.1| PREDICTED: WUSCHEL-related homeobox 4-like [Nelumbo nucifera]
 ref|XP_010270572.1| PREDICTED: WUSCHEL-related homeobox 4-like [Nelumbo nucifera]
Length=214

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 159/219 (73%), Gaps = 13/219 (6%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKP  821
             MKVHQ  RG ++E +  PSL+LGCKR RPLAPKL  G+        TP   DLKSFIKP
Sbjct  5    NMKVHQLARG-LWEHE--PSLTLGCKRLRPLAPKLTNGE--------TPAILDLKSFIKP  53

Query  820  ESS--PRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQL  647
            ESS  P   D+K+++ Q +   GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE+ITAQL
Sbjct  54   ESSSGPSKSDDKREAVQVDAPSGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEKITAQL  113

Query  646  GKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDI  467
            GK+GKIEGKNVFYWFQNHKARERQKQKRNSLGL HSPRTPP   +    +       ED 
Sbjct  114  GKFGKIEGKNVFYWFQNHKARERQKQKRNSLGLVHSPRTPPATTVALDVNRDEIEREEDS  173

Query  466  ACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
              KRK R WA E  ++++ +    EEGD TLELFPLHPE
Sbjct  174  HYKRKHRGWAIEFFQQDRGFCGGGEEGDKTLELFPLHPE  212



>ref|XP_007223910.1| hypothetical protein PRUPE_ppa010951mg [Prunus persica]
 ref|XP_008220253.1| PREDICTED: WUSCHEL-related homeobox 4 [Prunus mume]
 gb|EMJ25109.1| hypothetical protein PRUPE_ppa010951mg [Prunus persica]
Length=229

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 165/231 (71%), Gaps = 22/231 (10%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGC-KRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIK  824
            +MKVHQF RG ++E +  PSL+LGC KR RPLAPKL    A     +   P FDLKSFI+
Sbjct  5    SMKVHQFARG-LWEHE--PSLTLGCTKRLRPLAPKLANTTAGDTTTTALAP-FDLKSFIR  60

Query  823  PESSPR---SPD--EKKDSP--QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE  665
            PES PR   S D  EKKDSP  Q ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE
Sbjct  61   PESGPRKLGSSDHQEKKDSPHPQVETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE  120

Query  664  QITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSL--T  491
            QITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGL+HS    P  P   +++L   
Sbjct  121  QITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHS----PRTPTPVITNLGEV  176

Query  490  FDPWGEDIACKRKCRPWAFECLEEEKRWACSREEGDG----TLELFPLHPE  350
                 ED   KRKCR W F+C  E+     + E  +G    TLELFPLHPE
Sbjct  177  VGEREEDSPYKRKCRSWGFDCSVEDSVVCKADEVVEGGRGRTLELFPLHPE  227



>ref|XP_004499043.1| PREDICTED: WUSCHEL-related homeobox 4-like [Cicer arietinum]
Length=233

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 163/237 (69%), Gaps = 27/237 (11%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPP-AFDLKSFIKP  821
            MKVHQFTRGF    +  PSL+LGCKR RPLAPK+   +    + + TP  +FDLKSFI+P
Sbjct  1    MKVHQFTRGFW---EHEPSLTLGCKRLRPLAPKIS--NNTDHSTTNTPSLSFDLKSFIRP  55

Query  820  ESSPR-----SPDEKKDSP----QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  668
            ES+ R     S D KKD P    Q ET PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI
Sbjct  56   ESASRINLASSDDNKKDPPSPQGQVETLPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  115

Query  667  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHS----prtpppppitTVS  500
            EQIT QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGL HS      T   P  + ++
Sbjct  116  EQITIQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLVHSPRTPTTTLVSPTFSCIT  175

Query  499  SLTFDPWGE-------DIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
            +L     GE       D +  +K R W  E +EE+  W+  +EE   TLELFPLHPE
Sbjct  176  TLDTPKRGEVMERDQGDHSPLKKSRSWPLEYIEEQN-WSMCKEEEHKTLELFPLHPE  231



>ref|XP_003589158.1| WUSCHEL-related homeobox [Medicago truncatula]
 gb|AES59409.1| wuschel-related homeobox protein [Medicago truncatula]
Length=236

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 161/239 (67%), Gaps = 28/239 (12%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPE  818
            MKVHQFTRGF    +  PSL+LGCKR RPLAPK+   +   +  +    +FDLKSFI+PE
Sbjct  1    MKVHQFTRGFW---EHEPSLTLGCKRLRPLAPKISSNNTDNSTTNTPSLSFDLKSFIRPE  57

Query  817  SSPR-----SPDEKKDSP----QAETH-PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  668
            ++PR     S D KKD P    Q ETH PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI
Sbjct  58   TAPRISLSSSDDNKKDPPSPQSQVETHIPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  117

Query  667  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHS---prtpppppitTVSS  497
            EQIT QL KYGKIEGKNVFYWFQNHKARERQKQKRNSLGL HS   P T       T S+
Sbjct  118  EQITVQLSKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLPHSPRTPTTTLVSMSPTFST  177

Query  496  LT----------FDPWGEDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
            +T           +   ED   K K R W FE L EEK W+  + E   TLELFPLHPE
Sbjct  178  ITTLDTPKRVQVMERDQEDSPLK-KSRSWPFEYL-EEKNWSMCKVEEHKTLELFPLHPE  234



>ref|XP_008378020.1| PREDICTED: WUSCHEL-related homeobox 4 [Malus domestica]
Length=239

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 169/237 (71%), Gaps = 25/237 (11%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGC-KRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIK  824
            +MKVHQF RG ++E +  PSL+LGC KR RPLAPKL    AAT+  + T   FDLKSFI+
Sbjct  5    SMKVHQFARG-LWEHE--PSLTLGCTKRLRPLAPKLANTAAATSDTTTTLAPFDLKSFIR  61

Query  823  PESSPR---SPD---EKKDSP--QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  668
            PES PR   S D   EKKDSP  Q ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI
Sbjct  62   PESGPRKLGSSDHLQEKKDSPHPQVETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  121

Query  667  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTF  488
            EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKR+SLGL+HSPRTP P   T    +  
Sbjct  122  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRSSLGLSHSPRTPTPVITTXGEIVVE  181

Query  487  DPWGEDIACKRKCRPWAFECLEEEKRWA--CSREEGDG---------TLELFPLHPE  350
                ED   KRKCR W F+CL E    +  C  +  D          TLELFPLHPE
Sbjct  182  RE--EDSPYKRKCRSWGFDCLVEGDHGSVVCKVDNDDAVKGGSVGVMTLELFPLHPE  236



>ref|XP_007160869.1| hypothetical protein PHAVU_001G023600g [Phaseolus vulgaris]
 gb|ESW32863.1| hypothetical protein PHAVU_001G023600g [Phaseolus vulgaris]
Length=234

 Score =   244 bits (623),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 156/236 (66%), Gaps = 24/236 (10%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPE  818
            MKVHQ  RGF    +  PSL+LGCKR RPLAPKL   ++ T+  S     FDLKSFIKPE
Sbjct  1    MKVHQLARGFW---EHEPSLTLGCKRLRPLAPKLSNTNSTTSITSPPVTTFDLKSFIKPE  57

Query  817  SSPR---SPDEKKDSP-----QAETH-PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE  665
            S+     S D  K  P     Q ETH PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE
Sbjct  58   SASIKLGSCDHNKRDPTSPEGQVETHIPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE  117

Query  664  QITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHS-----prtpppppitTVS  500
             IT QL KYGKIEGKNVFYWFQNHKARERQKQKRN+LGL HS              + ++
Sbjct  118  HITVQLSKYGKIEGKNVFYWFQNHKARERQKQKRNNLGLAHSPRTPTTLLSSSFSCSVIT  177

Query  499  SLTFDPWGEDI------ACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
            S      GE +      +  +KCR WAFE LE++  W+  +EE   TLELFPLHPE
Sbjct  178  SFDTTKRGEGVERDEEDSPLKKCRSWAFEYLEDQS-WSSWKEEEHRTLELFPLHPE  232



>ref|XP_010061730.1| PREDICTED: WUSCHEL-related homeobox 4 [Eucalyptus grandis]
 gb|KCW68717.1| hypothetical protein EUGRSUZ_F02320 [Eucalyptus grandis]
Length=232

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 159/236 (67%), Gaps = 26/236 (11%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPE  818
            MKVHQF RGF FE +   +L+LGCKR RPL PKL         +  T    D+KSFI+PE
Sbjct  1    MKVHQFARGF-FELEPT-TLTLGCKRLRPLVPKL----PHQTDVVSTAAFVDIKSFIRPE  54

Query  817  SSPR----SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  650
            S PR    S D+K+D PQ ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ
Sbjct  55   SGPRRLGSSSDDKRDPPQVETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQ  114

Query  649  LGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWG--  476
            L KYGKIEGKNVFYWFQNHKARERQKQKRNSLGL+H  RTP         +L        
Sbjct  115  LSKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLSHCSRTPTTAATIATVTLNTTKGSEG  174

Query  475  -----EDIACKRKCRPWAFECLEEEKRWACS-----REEGDG----TLELFPLHPE  350
                 ED   KRKCR WAF+  E E+  + S     R+E +     TLELFPLHPE
Sbjct  175  EIRGEEDSPYKRKCRSWAFDFSEVEEDVSRSSSSSFRDEDEAVHCRTLELFPLHPE  230



>ref|XP_008444600.1| PREDICTED: WUSCHEL-related homeobox 4 [Cucumis melo]
Length=229

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 150/233 (64%), Gaps = 24/233 (10%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKL---GGGDAATAAISVTPPAFDLKSF  830
             MKVHQF RGF  E    PSLSLGCKR RPLAPKL      +  T   + T   FDLK+F
Sbjct  4    NMKVHQFARGFWDE----PSLSLGCKRLRPLAPKLQQPTSDNTTTTTTTTTLTTFDLKTF  59

Query  829  IKPESSPRSPDEKKDSPQ------------AETHPGGTRWNPTQEQIGILEMLYRGGMRT  686
            IKP+  PR P    D  +             ETHPGGTRWNPTQEQIGILEMLY  GMRT
Sbjct  60   IKPDCGPRKPGSSHDHSKDSSSSSSSLQTGVETHPGGTRWNPTQEQIGILEMLYSRGMRT  119

Query  685  PNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitT  506
            PNAQQIE ITAQLG YGKIEGKNVFYWFQNHKARERQKQKRNSLGL HS    P  P   
Sbjct  120  PNAQQIEHITAQLGNYGKIEGKNVFYWFQNHKARERQKQKRNSLGLPHS----PRTPPPP  175

Query  505  VSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREEG-DGTLELFPLHPE  350
                 F    ED   KRKC  W FECL E+    C +EEG D TLELFPLHPE
Sbjct  176  PIIPAFHTGDEDSPYKRKCLYWGFECLVEDNGLMCKKEEGHDRTLELFPLHPE  228



>ref|XP_010549248.1| PREDICTED: WUSCHEL-related homeobox 4-like [Tarenaya hassleriana]
Length=248

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 163/250 (65%), Gaps = 35/250 (14%)
 Frame = -3

Query  1000 TMKVHQFTRGFI-FEQDQV------PSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFD  842
            +MKVH  +RG   ++ +Q       PSLSL CKR RPLAPKL     ++++ +    AFD
Sbjct  3    SMKVHHLSRGLSSWDNNQTHHDHSQPSLSLSCKRLRPLAPKLSPSSPSSSSSAT---AFD  59

Query  841  LKSFIKPESSPRSP---DEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQ  671
            LKSFI+PE+ PRS    D K+D PQ ETHPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQ
Sbjct  60   LKSFIRPENRPRSTLTDDNKRDPPQVETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQ  119

Query  670  IEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLT  491
            IEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL L+     P    +TT ++L+
Sbjct  120  IEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLSLSGQSPKPVVSNMTTPTTLS  179

Query  490  FD----------PWGEDIACKRKCRPWAFECLEEEKRWACSREEGDG----------TLE  371
             D             ED   KR CR W  E   E K   C+    +           TLE
Sbjct  180  LDNNIRREQVVEKGLEDSPYKRTCRSWNVET--ESKTSPCNNNYNNYNNNKIINNVITLE  237

Query  370  LFPLHPELGR  341
            LFPLHPELGR
Sbjct  238  LFPLHPELGR  247



>gb|ADN33723.1| homeodomain transcription factor [Cucumis melo subsp. melo]
Length=225

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 150/232 (65%), Gaps = 24/232 (10%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKL---GGGDAATAAISVTPPAFDLKSFI  827
            MKVHQF RGF  E    PSLSLGCKR RPLAPKL      +  T   + T   FDLK+FI
Sbjct  1    MKVHQFARGFWDE----PSLSLGCKRLRPLAPKLQQPTSDNTTTTTTTTTLTTFDLKTFI  56

Query  826  KPESSPRSPDEKKDSPQ------------AETHPGGTRWNPTQEQIGILEMLYRGGMRTP  683
            KP+  PR P    D  +             ETHPGGTRWNPTQEQIGILEMLY  GMRTP
Sbjct  57   KPDCGPRKPGSSHDHSKDSSSSSSSLQTGVETHPGGTRWNPTQEQIGILEMLYSRGMRTP  116

Query  682  NAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTV  503
            NAQQIE ITAQLG YGKIEGKNVFYWFQNHKARERQKQKRNSLGL HS    P  P    
Sbjct  117  NAQQIEHITAQLGNYGKIEGKNVFYWFQNHKARERQKQKRNSLGLPHS----PRTPPPPP  172

Query  502  SSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREEG-DGTLELFPLHPE  350
                F    ED   KRKC  W FECL E+    C +EEG D TLELFPLHPE
Sbjct  173  IIPAFHTGDEDSPYKRKCLYWGFECLVEDNGLMCKKEEGHDRTLELFPLHPE  224



>ref|XP_009359904.1| PREDICTED: WUSCHEL-related homeobox 4 [Pyrus x bretschneideri]
Length=238

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 163/237 (69%), Gaps = 26/237 (11%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGC-KRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIK  824
            +MKVHQF RG ++E +  PSL+LGC KR RPLAP+L    A +   +   P FDLKSFI+
Sbjct  5    SMKVHQFARG-LWEHE--PSLTLGCTKRLRPLAPRLANTAATSDTTTTLAP-FDLKSFIR  60

Query  823  PESSPR------SPDEKKDSP--QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  668
            PES PR         EKKDSP  Q ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI
Sbjct  61   PESGPRKLGSSNQLQEKKDSPHPQVETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  120

Query  667  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTF  488
            EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKR+SLGL+HSPRTP     T    +  
Sbjct  121  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRSSLGLSHSPRTPTSVITTLGEVVVE  180

Query  487  DPWGEDIACKRKCRPWAFECLEEEKRWACSRE-----------EGDGTLELFPLHPE  350
                ED   KRK R W F+CL E    + +             EG  TLELFPLHPE
Sbjct  181  RE--EDNPYKRKGRSWEFDCLVEGDHSSSTSSVVCKLDNDDAIEGGRTLELFPLHPE  235



>ref|XP_008351991.1| PREDICTED: LOW QUALITY PROTEIN: WUSCHEL-related homeobox 4-like 
[Malus domestica]
Length=238

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 165/237 (70%), Gaps = 26/237 (11%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGC-KRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIK  824
            +MKVHQF RG ++E +  PSL+LGC KR RPLAP+L    AA+   +   P FDLKSFI+
Sbjct  5    SMKVHQFARG-LWEHE--PSLTLGCTKRLRPLAPRLANTAAASDTTTTLAP-FDLKSFIR  60

Query  823  PESSPR------SPDEKKDSP--QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  668
            P+S PR         EKKDSP  Q ETHPGGTRWNPTQEQIGILEMLYR GMRTPNAQQI
Sbjct  61   PDSGPRKLGSSNQLQEKKDSPHPQVETHPGGTRWNPTQEQIGILEMLYREGMRTPNAQQI  120

Query  667  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTF  488
            E+ITAQLGKYGKIEGKNVFYWFQNHKARERQKQKR+SLGL+HSPRTP P   T    +  
Sbjct  121  EKITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRSSLGLSHSPRTPTPVITTLGEVVVE  180

Query  487  DPWGEDIACKRKCRPWAFECLEEEKRWACSRE-----------EGDGTLELFPLHPE  350
                ED   KRKCR W F+CL E    + +             EG  TLELFPLHPE
Sbjct  181  RE--EDNPYKRKCRSWEFDCLVEGDHSSSTSSVVCKLDNDDAVEGGRTLELFPLHPE  235



>ref|XP_004142872.1| PREDICTED: WUSCHEL-related homeobox 4-like [Cucumis sativus]
 gb|KGN62487.1| hypothetical protein Csa_2G356610 [Cucumis sativus]
Length=227

 Score =   237 bits (604),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 148/231 (64%), Gaps = 22/231 (10%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPA-FDLKSFIK  824
             MKVHQF RGF  E    PSLSLGCKR RPLAPKL    +     + T    FDLK+FIK
Sbjct  4    NMKVHQFARGFWDE----PSLSLGCKRLRPLAPKLQQPTSDNTTTTTTTLTTFDLKTFIK  59

Query  823  PESSPRSPDEKKDSPQ------------AETHPGGTRWNPTQEQIGILEMLYRGGMRTPN  680
            P+  PR P    D  +             ETHPGGTRWNPTQEQIGILEMLY  GMRTPN
Sbjct  60   PDCGPRKPGSSHDHSKDSSSSSSSLQTGVETHPGGTRWNPTQEQIGILEMLYSRGMRTPN  119

Query  679  AQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVS  500
            AQQIE ITAQLG YGKIEGKNVFYWFQNHKARERQKQKRNSLGL HS    P  P     
Sbjct  120  AQQIEHITAQLGNYGKIEGKNVFYWFQNHKARERQKQKRNSLGLPHS----PRTPPPPPI  175

Query  499  SLTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREEG-DGTLELFPLHPE  350
               F    ED   KRKC  W FECL E+    C +EE  D TLELFPLHPE
Sbjct  176  IPAFHTGEEDSPYKRKCLYWGFECLVEDNGLMCKKEEDHDRTLELFPLHPE  226



>gb|ACU15815.1| unknown [Glycine max]
Length=231

 Score =   237 bits (604),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 161/244 (66%), Gaps = 43/244 (18%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPP-----AFDLKS  833
            MKVHQF RGF    +  PSL+LGCKR RPLAPKL   D      +++PP      FDLKS
Sbjct  1    MKVHQFARGFW---EHEPSLTLGCKRLRPLAPKLSNTD------TISPPHHPVTTFDLKS  51

Query  832  FIKPESSPR-----SPDEKKD-----SPQ--AETH-PGGTRWNPTQEQIGILEMLYRGGM  692
            FIKPES+ R     S D+  +     SPQ  AETH PGGTRWNPTQEQIGILEMLYRGGM
Sbjct  52   FIKPESASRKLGIGSSDDNTNKRGPSSPQGQAETHIPGGTRWNPTQEQIGILEMLYRGGM  111

Query  691  RTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppi  512
            RTPNAQQIEQITAQL KYGKIEGKNVFYWFQNHKARERQKQKRN+LGL HSPRT      
Sbjct  112  RTPNAQQIEQITAQLSKYGKIEGKNVFYWFQNHKARERQKQKRNNLGLAHSPRTTLTTSP  171

Query  511  tTVSSL--TFDPWGEDIACK--------RKCRPWAFECLEEEKRWACSREEGDGTLELFP  362
                 +  T D        +        +KCR WAFE LE++      REE   TLELFP
Sbjct  172  PFSCCVITTMDTTKRGEVVEREEEDSPLKKCRSWAFEYLEDQ------REEEHRTLELFP  225

Query  361  LHPE  350
            LHPE
Sbjct  226  LHPE  229



>ref|XP_003544467.1| PREDICTED: WUSCHEL-related homeobox 4 [Glycine max]
 gb|KHN35694.1| WUSCHEL-related homeobox 4 [Glycine soja]
Length=231

 Score =   237 bits (604),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 163/244 (67%), Gaps = 43/244 (18%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPP-----AFDLKS  833
            MKVHQF RGF    +  PSL+LGCKR RPLAPKL   D      +++PP      FDLKS
Sbjct  1    MKVHQFARGFW---EHEPSLTLGCKRLRPLAPKLSNTD------TISPPHHPVTTFDLKS  51

Query  832  FIKPESSPR-----SPDE---KKD--SPQ--AETH-PGGTRWNPTQEQIGILEMLYRGGM  692
            FIKPES+ R     S D+   K+D  SPQ  AETH PGGTRWNPTQEQIGILEMLYRGGM
Sbjct  52   FIKPESASRKLGIGSSDDNTNKRDPSSPQGQAETHIPGGTRWNPTQEQIGILEMLYRGGM  111

Query  691  RTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppi  512
            RTPNAQQIEQITAQL KYGKIEGKNVFYWFQNHKARERQKQKRN+LGL HSPRT      
Sbjct  112  RTPNAQQIEQITAQLSKYGKIEGKNVFYWFQNHKARERQKQKRNNLGLAHSPRTTLTTSP  171

Query  511  tTVSSL--TFDPWGEDIACK--------RKCRPWAFECLEEEKRWACSREEGDGTLELFP  362
                 +  T D        +        +KCR WAFE LE++      REE   TLELFP
Sbjct  172  PFSCCVITTMDTTKRGEVVEREEEDSPLKKCRSWAFEYLEDQ------REEEHRTLELFP  225

Query  361  LHPE  350
            LHPE
Sbjct  226  LHPE  229



>ref|XP_004156369.1| PREDICTED: LOW QUALITY PROTEIN: WUSCHEL-related homeobox 4-like 
[Cucumis sativus]
Length=227

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 147/231 (64%), Gaps = 22/231 (10%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPA-FDLKSFIK  824
             MKVHQF RGF  E    PSLSLGCKR RPLAPKL    +     + T    FDLK+FIK
Sbjct  4    NMKVHQFARGFWDE----PSLSLGCKRLRPLAPKLQQPTSDNTTTTTTTLTTFDLKTFIK  59

Query  823  PESSPRSPDEKKDSPQ------------AETHPGGTRWNPTQEQIGILEMLYRGGMRTPN  680
            P+  PR P    D  +             ETHPGGTRWNPTQEQIGILEMLY  GMRTPN
Sbjct  60   PDCGPRKPGSSHDHSKDSSSSSSSLQTGVETHPGGTRWNPTQEQIGILEMLYSRGMRTPN  119

Query  679  AQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVS  500
            AQQIE ITAQLG YGKIEGKN FYWFQNHKARERQKQKRNSLGL HS    P  P     
Sbjct  120  AQQIEHITAQLGNYGKIEGKNXFYWFQNHKARERQKQKRNSLGLPHS----PRTPPPPPI  175

Query  499  SLTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREEG-DGTLELFPLHPE  350
               F    ED   KRKC  W FECL E+    C +EE  D TLELFPLHPE
Sbjct  176  IPAFHTGEEDSPYKRKCLYWGFECLVEDNGLMCKKEEDHDRTLELFPLHPE  226



>gb|KHN12799.1| WUSCHEL-related homeobox 4 [Glycine soja]
Length=243

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 166/250 (66%), Gaps = 48/250 (19%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPP------AFDLK  836
            MKVHQF RGF    +  PSL+LGCKR RPLAPKL   D      +++PP        DLK
Sbjct  1    MKVHQFARGFW---EHEPSLTLGCKRLRPLAPKLSNTDD-----TISPPHHHPVTTLDLK  52

Query  835  SFIKPESSPR-----------SPDEKKD--SP--QAETH-PGGTRWNPTQEQIGILEMLY  704
            SFIKP+S+ R           + + K+D  SP  Q ETH PGGTRWNPTQEQIGILEMLY
Sbjct  53   SFIKPQSASRKLGIGSSSDDNNNNNKRDPSSPHGQVETHIPGGTRWNPTQEQIGILEMLY  112

Query  703  RGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpp  524
            RGGMRTPNAQQIEQITAQL KYGKIEGKNVFYWFQNHKARERQKQKRN+LGL HS RT P
Sbjct  113  RGGMRTPNAQQIEQITAQLSKYGKIEGKNVFYWFQNHKARERQKQKRNNLGLAHSLRTTP  172

Query  523  pppi------tTVSSLTFDPWGEDIACK------RKCRPWAFECLEEEKRWACSREEGDG  380
               +      + +++L     GE +  +      +KCR WAFE LE++      REE   
Sbjct  173  TTIVSHPFSCSVITTLDTTKRGEIVEREEEDSPLKKCRSWAFEYLEDQ------REEEHR  226

Query  379  TLELFPLHPE  350
            TLELFPLHPE
Sbjct  227  TLELFPLHPE  236



>ref|XP_006601279.1| PREDICTED: WUSCHEL-related homeobox 4-like [Glycine max]
Length=244

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 145/251 (58%), Positives = 166/251 (66%), Gaps = 49/251 (20%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPP------AFDLK  836
            MKVHQF RGF    +  PSL+LGCKR RPLAPKL   D      +++PP        DLK
Sbjct  1    MKVHQFARGFW---EHEPSLTLGCKRLRPLAPKLSNTDD-----TISPPHHHPVTTLDLK  52

Query  835  SFIKPESSPR------------SPDEKKD--SP--QAETH-PGGTRWNPTQEQIGILEML  707
            SFIKP+S+ R            + + K+D  SP  Q ETH PGGTRWNPTQEQIGILEML
Sbjct  53   SFIKPQSASRKLGIGSSSDDNNNNNNKRDPSSPHGQVETHIPGGTRWNPTQEQIGILEML  112

Query  706  YRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtp  527
            YRGGMRTPNAQQIEQITAQL KYGKIEGKNVFYWFQNHKARERQKQKRN+LGL HS RT 
Sbjct  113  YRGGMRTPNAQQIEQITAQLSKYGKIEGKNVFYWFQNHKARERQKQKRNNLGLAHSLRTT  172

Query  526  ppppi------tTVSSLTFDPWGEDIACK------RKCRPWAFECLEEEKRWACSREEGD  383
            P   +      + +++L     GE +  +      +KCR WAFE LE++      REE  
Sbjct  173  PTTIVSHPFSCSVITTLDTTKRGEIVEREEEDSPLKKCRSWAFEYLEDQ------REEEH  226

Query  382  GTLELFPLHPE  350
             TLELFPLHPE
Sbjct  227  RTLELFPLHPE  237



>ref|XP_011074398.1| PREDICTED: WUSCHEL-related homeobox 4-like isoform X2 [Sesamum 
indicum]
Length=234

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 161/237 (68%), Gaps = 27/237 (11%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPE  818
            MKVH F RGF    +  PSL  GCKR RPLAPKL      T A +    AFDLKSFI+PE
Sbjct  1    MKVHHFARGFW---EHEPSL--GCKRLRPLAPKLVTTPTTTTATTTVN-AFDLKSFIRPE  54

Query  817  SSPR----SPDEKKDSPQAETH-PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA  653
            S PR    S  EKK+S Q E    GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA
Sbjct  55   SGPRKLESSDFEKKESAQVEAQQAGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA  114

Query  652  QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtppp---------ppitTVS  500
            QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGL HS RT              + + S
Sbjct  115  QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLTHSLRTSASPFTTTTTTNYLLLSTS  174

Query  499  SLTFDPWGEDIAC-KRKCRPWAF-ECL----EEEKRWACSREEG-DGTLELFPLHPE  350
             L     G D++  KRK R W F EC+    EE+ R+ C+ EEG D TL+LFPLHPE
Sbjct  175  KLLQGEEGLDVSSYKRKWRSWGFDECVEEEEEEDSRYCCTEEEGEDRTLKLFPLHPE  231



>ref|XP_011074399.1| PREDICTED: WUSCHEL-related homeobox 4-like isoform X3 [Sesamum 
indicum]
Length=231

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 160/234 (68%), Gaps = 24/234 (10%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPE  818
            MKVH F RGF    +  PSL  GCKR RPLAPKL      T A +    AFDLKSFI+PE
Sbjct  1    MKVHHFARGFW---EHEPSL--GCKRLRPLAPKLVTTPTTTTATTTVN-AFDLKSFIRPE  54

Query  817  SSPR----SPDEKKDSPQAETH-PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA  653
            S PR    S  EKK+S Q E    GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA
Sbjct  55   SGPRKLESSDFEKKESAQVEAQQAGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA  114

Query  652  QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtppp------ppitTVSSLT  491
            QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGL HS RT              + S +
Sbjct  115  QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLTHSLRTSASPFTTTTTTNYLLLSTS  174

Query  490  FDPWGEDIAC-KRKCRPWAF-ECL----EEEKRWACSREEG-DGTLELFPLHPE  350
                G D++  KRK R W F EC+    EE+ R+ C+ EEG D TL+LFPLHPE
Sbjct  175  KGEEGLDVSSYKRKWRSWGFDECVEEEEEEDSRYCCTEEEGEDRTLKLFPLHPE  228



>ref|XP_006305551.1| hypothetical protein CARUB_v10010093mg [Capsella rubella]
 gb|EOA38449.1| hypothetical protein CARUB_v10010093mg [Capsella rubella]
Length=251

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 152/249 (61%), Gaps = 33/249 (13%)
 Frame = -3

Query  997  MKVHQFTRGFIF---EQDQVPSLSLGCKRFRPLAPKLGGGDAATAAIS---VTPPAFDLK  836
            MKVH+F+ GF     + D   SLSL CKR RPLAPKL  G   +   S   VT   FDLK
Sbjct  1    MKVHEFSNGFSSSWDQHDSTSSLSLSCKRLRPLAPKLSAGSPPSPPSSSSGVTSATFDLK  60

Query  835  SFIKPE-SSPRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQI  659
            SFI+P+ + P   + K+D PQ ETHPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE I
Sbjct  61   SFIRPDQTGPTKNEHKRDPPQLETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIEHI  120

Query  658  TAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL-------GLNHSprtpppppitTVS  500
            T+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L           +  + P       +
Sbjct  121  TSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLISLSCQSSFTTTSVSNPSVTTKIRT  180

Query  499  SLTFD----------PWGEDIACKRKCRPWAFECLEEEKRWACSREE---------GDGT  377
            S + D             E+   KR CR W FE LE E R   +             + T
Sbjct  181  SSSLDIRRDSMVEKQELVEENEYKRTCRSWGFENLEIEGRRNKNNSTMSTTFHKIIDNVT  240

Query  376  LELFPLHPE  350
            LELFPLHPE
Sbjct  241  LELFPLHPE  249



>ref|XP_011074397.1| PREDICTED: WUSCHEL-related homeobox 4-like isoform X1 [Sesamum 
indicum]
Length=237

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 159/240 (66%), Gaps = 30/240 (13%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPE  818
            MKVH F RGF    +  PSL  GCKR RPLAPKL      T A +    AFDLKSFI+PE
Sbjct  1    MKVHHFARGFW---EHEPSL--GCKRLRPLAPKLVTTPTTTTATTTVN-AFDLKSFIRPE  54

Query  817  SSPR----SPDEKKDSPQAETH-PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA  653
            S PR    S  EKK+S Q E    GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA
Sbjct  55   SGPRKLESSDFEKKESAQVEAQQAGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA  114

Query  652  QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtppp------------ppit  509
            QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGL HS RT                  +
Sbjct  115  QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLTHSLRTSASPFTTTTTTNYLLLSTS  174

Query  508  TVSSLTFDPWGEDIAC-KRKCRPWAF-ECL----EEEKRWACSREEG-DGTLELFPLHPE  350
                L     G D++  KRK R W F EC+    EE+ R+ C+ EEG D TL+LFPLHPE
Sbjct  175  KDKKLLQGEEGLDVSSYKRKWRSWGFDECVEEEEEEDSRYCCTEEEGEDRTLKLFPLHPE  234



>ref|XP_010500232.1| PREDICTED: WUSCHEL-related homeobox 4-like isoform X2 [Camelina 
sativa]
Length=250

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 155/248 (63%), Gaps = 32/248 (13%)
 Frame = -3

Query  997  MKVHQFTRGFIF---EQDQVPSLSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKS  833
            MKVH+F+ GF     E D   SLS+ CKR RPLAPKL G   +  + S  VT   FDLKS
Sbjct  1    MKVHEFSNGFSSSWDEHDSTSSLSISCKRLRPLAPKLSGSPPSPPSSSSGVTSATFDLKS  60

Query  832  FIKPESS-PRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQIT  656
            FI+P+ + P+  + K+D PQ ETHPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE IT
Sbjct  61   FIRPDQTGPKKFEHKRDPPQLETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIEHIT  120

Query  655  AQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL-------GLNHSprtpppppitTVSS  497
            +QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L           +  + P     T +S
Sbjct  121  SQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLISLSFQTSCTTTSVSNPSVTTKTRTS  180

Query  496  LTFD----------PWGEDIACKRKCRPWAFECLEEEKRWACSREE---------GDGTL  374
             + D             E+   KR CR W FE LE E R   +             + TL
Sbjct  181  SSLDIRRDSMVEKQELVEENEYKRTCRSWGFENLEIEGRRNKNSSTLATTFHKIIDNVTL  240

Query  373  ELFPLHPE  350
            ELFPLHPE
Sbjct  241  ELFPLHPE  248



>ref|XP_011069676.1| PREDICTED: WUSCHEL-related homeobox 4-like [Sesamum indicum]
Length=242

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 157/241 (65%), Gaps = 27/241 (11%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAAT--AAISVTPPAFDLKSFIK  824
            MKVHQF RGF     + PSLSLGCKRFRPLAPKL    +A      +VT   FDLKSFI+
Sbjct  1    MKVHQFPRGFF--DHEPPSLSLGCKRFRPLAPKLPTTTSAADDTLTAVTTTTFDLKSFIR  58

Query  823  PESSPR---SPDE--KKDSPQAET-HPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQ  662
            PES PR   S D   K+ + Q E   PGGTRWNPTQEQIGILEMLYR GMRTPNAQQIEQ
Sbjct  59   PESGPRRVGSLDHQTKESAHQVEAAQPGGTRWNPTQEQIGILEMLYRSGMRTPNAQQIEQ  118

Query  661  ITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHS----------prtpppppi  512
            ITAQLGKYGKIEGKNVFYWFQNHKARERQKQKR SLGL+HS            T      
Sbjct  119  ITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRTSLGLSHSPRTPPSPFMTTTTTSLMLS  178

Query  511  tTVSSLTFDPWGEDIACKRKCRPWAFECLEEEK--RWACSRE-----EGDGTLELFPLHP  353
            T           ++   KRKCR W F+   +EK  R+ C+ E     + D TL+LFPLHP
Sbjct  179  TATGVRGEGSLSDNTPYKRKCRSWGFDGNSDEKNSRYNCTEEEEEEGQEDRTLKLFPLHP  238

Query  352  E  350
            E
Sbjct  239  E  239



>ref|XP_007140278.1| hypothetical protein PHAVU_008G098800g [Phaseolus vulgaris]
 gb|ESW12272.1| hypothetical protein PHAVU_008G098800g [Phaseolus vulgaris]
Length=235

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 154/232 (66%), Gaps = 23/232 (10%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPA-FDLKSFIK  824
            +MKVH FTR F    +  P L+LGC R RPLAPKL      T     TP   FDLKSFI+
Sbjct  4    SMKVHHFTRAFW---EHEPFLTLGCNRLRPLAPKLPSLHTTT-----TPSLPFDLKSFIR  55

Query  823  PESSPRS----PDEKKDSP----QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  668
            PES PR         KD P    Q ET PGGTRWNPTQEQIGILEMLY+GG RTPNAQQI
Sbjct  56   PESGPRKLVSLIHNNKDPPSPQAQVETLPGGTRWNPTQEQIGILEMLYKGGTRTPNAQQI  115

Query  667  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTF  488
            EQIT QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL  +HSPRTP    + T+ +   
Sbjct  116  EQITVQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLAFSHSPRTPTIHTVVTLETARG  175

Query  487  DPWGED----IACKRKCRPWAFECLEEEKRWACSREEGDG--TLELFPLHPE  350
            +    D      CK+KCR W F+CLEE+   + S  E +   TLELFPL PE
Sbjct  176  EVVDRDEEEGSPCKKKCRRWVFDCLEEQSMSSSSLCEEEEHRTLELFPLQPE  227



>ref|XP_010479107.1| PREDICTED: WUSCHEL-related homeobox 4 isoform X2 [Camelina sativa]
Length=250

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 152/248 (61%), Gaps = 32/248 (13%)
 Frame = -3

Query  997  MKVHQFTRGFIF---EQDQVPSLSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKS  833
            MKVH+F+ GF     + D   SLSL CKR RPLAPKL G   +  + S  VT   FDLKS
Sbjct  1    MKVHEFSNGFSSSWDQHDSTSSLSLSCKRLRPLAPKLSGSPPSPPSSSSGVTSATFDLKS  60

Query  832  FIKPESS-PRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQIT  656
            FI+P+ + P   + K+D PQ ETHPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE IT
Sbjct  61   FIRPDQTGPTKFEHKRDPPQLETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIEHIT  120

Query  655  AQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL-----------------GLNHSprtp  527
            +QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L                  +    RT 
Sbjct  121  SQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLISLSCQTSFTSTSVSNPSVTTKTRTS  180

Query  526  ppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREE---------GDGTL  374
                I   S +      E+   KR CR W FE LE E R   +             + TL
Sbjct  181  SSLNIRRDSMVEKQELVEENEYKRTCRSWGFENLEIEGRRNKNSSTMATTFHKIIDNVTL  240

Query  373  ELFPLHPE  350
            ELFPLHPE
Sbjct  241  ELFPLHPE  248



>ref|XP_010688717.1| PREDICTED: WUSCHEL-related homeobox 4 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=255

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 157/251 (63%), Gaps = 36/251 (14%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPS-----LSLGCKRFRPLAPKLGGGDAATAAISV------TP  854
            +MKVH F RGF ++  Q  +     L+LGCKRFRPLAPK+G  +      +         
Sbjct  5    SMKVHPFGRGF-WDNHQTTAHDSQALTLGCKRFRPLAPKVGSNNNVVNNTTTSTGHHNNN  63

Query  853  PAFDLKSFIKPESSP----RSPDEKKDSP--QAET--HPGGTRWNPTQEQIGILEMLYRG  698
              FDLKSFI+P   P      PD KKDS   QAET  HPGGTRWNPTQEQIGILEMLYRG
Sbjct  64   ATFDLKSFIRPHCGPPKMVSPPDHKKDSASHQAETLSHPGGTRWNPTQEQIGILEMLYRG  123

Query  697  GMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHS-------  539
            GMRTPNAQQIEQIT QL KYGKIEGKNVFYWFQNHKARERQKQKR  LGL+H+       
Sbjct  124  GMRTPNAQQIEQITEQLSKYGKIEGKNVFYWFQNHKARERQKQKRTILGLSHNPRTPTAA  183

Query  538  -prtpppppitTVSSLTFDPWGEDIA-------CKRKCRPWAFECLEEEKRWACSREEGD  383
                     +   ++LT D   E I         KRK R W F+  EE+++   + EE D
Sbjct  184  TATATATTQLNASTTLTLDTRVEFIDQEEQISPYKRKFRNWTFKSSEEKQKKDYTNEE-D  242

Query  382  GTLELFPLHPE  350
             TLELFPLHPE
Sbjct  243  KTLELFPLHPE  253



>ref|XP_002894029.1| homeobox-leucine zipper transcription factor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH70288.1| homeobox-leucine zipper transcription factor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=251

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 154/249 (62%), Gaps = 33/249 (13%)
 Frame = -3

Query  997  MKVHQFTRGFIF---EQDQVPSLSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKS  833
            MKVH+F+ GF     + D   SLSL CKR RPLAPKL G   +  + S  VT   FDLKS
Sbjct  1    MKVHEFSNGFSSSWDQHDSTSSLSLSCKRLRPLAPKLSGSPPSPPSSSSGVTSATFDLKS  60

Query  832  FIKPE-SSPRSPDEKKDSP-QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQI  659
            FI+P+ + P   + K+D P Q ETHPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE I
Sbjct  61   FIRPDLTGPTKFEHKRDPPHQLETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIEHI  120

Query  658  TAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL-------GLNHSprtpppppitTVS  500
            T+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L           +  + P     T +
Sbjct  121  TSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLISLSCQSSFTTTSISNPSVATKTRT  180

Query  499  SLTFDPWGEDIAC----------KRKCRPWAFECLEEEKR---------WACSREEGDGT  377
            S + D     +            KR CR W FE LE E R            ++   + T
Sbjct  181  SSSLDTRRASMVEKEELVEENEYKRTCRSWGFENLEIENRRNKNSSTMATTINKIIDNVT  240

Query  376  LELFPLHPE  350
            LELFPLHPE
Sbjct  241  LELFPLHPE  249



>gb|KFK44644.1| hypothetical protein AALP_AA1G285400 [Arabis alpina]
Length=245

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 157/243 (65%), Gaps = 29/243 (12%)
 Frame = -3

Query  997  MKVHQFTRGFI-FEQDQVPS-LSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKSF  830
            MKVHQF+ GF  ++Q + PS LSL CKR RPLAPKL G  ++  + S  +T   FDLKSF
Sbjct  1    MKVHQFSDGFSSWDQHESPSSLSLSCKRLRPLAPKLSGSPSSPPSSSSGITSATFDLKSF  60

Query  829  IKPESS-PRS----PDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE  665
            I+P+ + PR      + K+D PQ ETHPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE
Sbjct  61   IRPDQTGPRKFEYPIEHKRDPPQVETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIE  120

Query  664  QITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNH---------------Sprt  530
             IT+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L +N                +   
Sbjct  121  HITSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNL-MNLSCQSSLNSSSVSNPCATIK  179

Query  529  pppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACS----REEGDGTLELFP  362
                    +   + +   ED   KR CR W FE LE E R   +    +   + TLELFP
Sbjct  180  TRTSSSLDIRRDSVEELVEDNGYKRTCRSWGFENLEIESRKYINATFDKIIDNVTLELFP  239

Query  361  LHP  353
            LHP
Sbjct  240  LHP  242



>ref|XP_010461508.1| PREDICTED: WUSCHEL-related homeobox 4-like isoform X2 [Camelina 
sativa]
Length=250

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 135/248 (54%), Positives = 155/248 (63%), Gaps = 32/248 (13%)
 Frame = -3

Query  997  MKVHQFTRGFIF---EQDQVPSLSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKS  833
            MKVH+F+ GF     + D   SLSL CKR RPLAPKL G   +  + S  VT   FDLKS
Sbjct  1    MKVHEFSNGFSSSWGQHDSTSSLSLSCKRLRPLAPKLSGSPPSPPSSSSGVTSATFDLKS  60

Query  832  FIKPE-SSPRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQIT  656
            FI+P+ + P   + K+D PQ ET PGGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE IT
Sbjct  61   FIRPDQTGPTKCEHKRDPPQLETPPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIEHIT  120

Query  655  AQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL-------GLNHSprtpppppitTVSS  497
            +QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L           +  + P     T +S
Sbjct  121  SQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLISISCQTSFTTTSVSNPSVTTKTRTS  180

Query  496  LTFD----------PWGEDIACKRKCRPWAFECLE-EEKRWACSREEG--------DGTL  374
             + D             E+   KR CR W FE LE E +R   S   G        + TL
Sbjct  181  SSLDIRRDSMVEKQELVEENEYKRTCRSWGFENLEIEGRRNKNSSTMGTTYHKIIDNVTL  240

Query  373  ELFPLHPE  350
            ELFPLHPE
Sbjct  241  ELFPLHPE  248



>gb|KEH40030.1| wuschel-related homeobox protein [Medicago truncatula]
Length=228

 Score =   223 bits (569),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 129/163 (79%), Gaps = 13/163 (8%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPE  818
            MKVHQFTRGF +E +  PSL+LGCKR RPLAPK+   +   +  +    +FDLKSFI+PE
Sbjct  1    MKVHQFTRGF-WEHE--PSLTLGCKRLRPLAPKISSNNTDNSTTNTPSLSFDLKSFIRPE  57

Query  817  SSPR-----SPDEKKDSP----QAETH-PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  668
            ++PR     S D KKD P    Q ETH PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI
Sbjct  58   TAPRISLSSSDDNKKDPPSPQSQVETHIPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  117

Query  667  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHS  539
            EQIT QL KYGKIEGKNVFYWFQNHKARERQKQKRNSLGL HS
Sbjct  118  EQITVQLSKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLPHS  160



>ref|XP_010500231.1| PREDICTED: WUSCHEL-related homeobox 4-like isoform X1 [Camelina 
sativa]
Length=255

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 155/253 (61%), Gaps = 37/253 (15%)
 Frame = -3

Query  997  MKVHQFTRGFIF---EQDQVPSLSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKS  833
            MKVH+F+ GF     E D   SLS+ CKR RPLAPKL G   +  + S  VT   FDLKS
Sbjct  1    MKVHEFSNGFSSSWDEHDSTSSLSISCKRLRPLAPKLSGSPPSPPSSSSGVTSATFDLKS  60

Query  832  FIKPESS-PRSPDEKKDSPQA-----ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQ  671
            FI+P+ + P+  + K+D PQ      ETHPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQ
Sbjct  61   FIRPDQTGPKKFEHKRDPPQVSSLTLETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQ  120

Query  670  IEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL-------GLNHSprtpppppi  512
            IE IT+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L           +  + P    
Sbjct  121  IEHITSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLISLSFQTSCTTTSVSNPSVTT  180

Query  511  tTVSSLTFD----------PWGEDIACKRKCRPWAFECLEEEKRWACSREE---------  389
             T +S + D             E+   KR CR W FE LE E R   +            
Sbjct  181  KTRTSSSLDIRRDSMVEKQELVEENEYKRTCRSWGFENLEIEGRRNKNSSTLATTFHKII  240

Query  388  GDGTLELFPLHPE  350
             + TLELFPLHPE
Sbjct  241  DNVTLELFPLHPE  253



>ref|XP_009145045.1| PREDICTED: WUSCHEL-related homeobox 4-like [Brassica rapa]
 emb|CDY43848.1| BnaA05g18600D [Brassica napus]
Length=251

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 152/249 (61%), Gaps = 33/249 (13%)
 Frame = -3

Query  997  MKVHQFTRGFI-FEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKSFI  827
            MKVH+F+ GF  +EQ Q    S  CKRFRPLAPKL G  ++  + S  VT   FDLKSFI
Sbjct  1    MKVHEFSNGFSSWEQQQESPSSFSCKRFRPLAPKLSGSPSSPPSSSSGVTSATFDLKSFI  60

Query  826  KPES-----SPRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQ  662
            KP+      S  S + K+D  Q E HPGGTRWNPTQEQI ILE+LY+GGMRTPNAQQIE 
Sbjct  61   KPDQAAPTKSHYSLEHKRDFSQVEMHPGGTRWNPTQEQIKILEILYKGGMRTPNAQQIEH  120

Query  661  ITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLN-------HSprtpppppitTV  503
            IT+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L L+        S         T  
Sbjct  121  ITSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLSLSCQGSLSTTSVSNASVTMKTRT  180

Query  502  SS--------LTFDPWGEDIACKRKCRPWAFECLEEEKR----------WACSREEGDGT  377
            SS        +      E+   KR CR W FE L+ E R           A +    + T
Sbjct  181  SSSPDFKREPMVMKELLEENEYKRTCRSWGFENLKIESRRNINSSINATIATTFNIDNVT  240

Query  376  LELFPLHPE  350
            LELFPLHPE
Sbjct  241  LELFPLHPE  249



>emb|CDY25659.1| BnaC05g25380D [Brassica napus]
Length=251

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 153/249 (61%), Gaps = 33/249 (13%)
 Frame = -3

Query  997  MKVHQFTRGFI-FEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKSFI  827
            MKVH+F+ GF  +EQ Q    SL CKRFRPLAPKL G  ++  + S  VT   FDLKSFI
Sbjct  1    MKVHEFSNGFSSWEQQQESPSSLSCKRFRPLAPKLSGSPSSPPSSSSGVTSATFDLKSFI  60

Query  826  KPES-----SPRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQ  662
            KP+      S  S + K+D  Q E HPGGTRWNPTQEQI ILE+LY+GGMRTPNA+QIE 
Sbjct  61   KPDQAAPTKSHYSLEHKRDFSQVEMHPGGTRWNPTQEQIRILEVLYKGGMRTPNAEQIEH  120

Query  661  ITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLN-------HSprtpppppitTV  503
            +T+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L L+        S         T  
Sbjct  121  VTSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLSLSCQGSLSTTSVSNASVTMKTRT  180

Query  502  SS--------LTFDPWGEDIACKRKCRPWAFECLEEEKR----------WACSREEGDGT  377
            SS        +      E+   KR CR W FE L+ E R           A +    + T
Sbjct  181  SSSTDFKREPMVMKELLEENEYKRTCRSWGFENLKIESRRNINSSINATIATTFNIDNVT  240

Query  376  LELFPLHPE  350
            LELFPLHPE
Sbjct  241  LELFPLHPE  249



>ref|XP_010479106.1| PREDICTED: WUSCHEL-related homeobox 4 isoform X1 [Camelina sativa]
Length=255

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 152/253 (60%), Gaps = 37/253 (15%)
 Frame = -3

Query  997  MKVHQFTRGFIF---EQDQVPSLSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKS  833
            MKVH+F+ GF     + D   SLSL CKR RPLAPKL G   +  + S  VT   FDLKS
Sbjct  1    MKVHEFSNGFSSSWDQHDSTSSLSLSCKRLRPLAPKLSGSPPSPPSSSSGVTSATFDLKS  60

Query  832  FIKPESS-PRSPDEKKDSPQA-----ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQ  671
            FI+P+ + P   + K+D PQ      ETHPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQ
Sbjct  61   FIRPDQTGPTKFEHKRDPPQVSSLILETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQ  120

Query  670  IEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL-----------------GLNH  542
            IE IT+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L                  +  
Sbjct  121  IEHITSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLISLSCQTSFTSTSVSNPSVTT  180

Query  541  SprtpppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREE---------  389
              RT     I   S +      E+   KR CR W FE LE E R   +            
Sbjct  181  KTRTSSSLNIRRDSMVEKQELVEENEYKRTCRSWGFENLEIEGRRNKNSSTMATTFHKII  240

Query  388  GDGTLELFPLHPE  350
             + TLELFPLHPE
Sbjct  241  DNVTLELFPLHPE  253



>ref|NP_175145.2| WUSCHEL-related homeobox 4 [Arabidopsis thaliana]
 sp|Q6X7J9.1|WOX4_ARATH RecName: Full=WUSCHEL-related homeobox 4 [Arabidopsis thaliana]
 gb|AAP37134.1| WOX4 protein [Arabidopsis thaliana]
 gb|AAR20749.1| At1g46480 [Arabidopsis thaliana]
 gb|AAR24752.1| At1g46480 [Arabidopsis thaliana]
 gb|ACJ61690.1| WOX4 [Arabidopsis thaliana]
 dbj|BAH30339.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32127.1| WUSCHEL-related homeobox 4 [Arabidopsis thaliana]
Length=251

 Score =   221 bits (564),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 154/249 (62%), Gaps = 33/249 (13%)
 Frame = -3

Query  997  MKVHQFTRGFIF---EQDQVPSLSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKS  833
            MKVH+F+ GF     + D   SLSL CKR RPLAPKL G   +  + S  VT   FDLK+
Sbjct  1    MKVHEFSNGFSSSWDQHDSTSSLSLSCKRLRPLAPKLSGSPPSPPSSSSGVTSATFDLKN  60

Query  832  FIKPE-SSPRSPDEKKDSP-QAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQI  659
            FI+P+ + P   + K+D P Q ETHPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE I
Sbjct  61   FIRPDQTGPTKFEHKRDPPHQLETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIEHI  120

Query  658  TAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL-------GLNHSprtpppppitTVS  500
            T QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L           +    P   + T +
Sbjct  121  TLQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLISLSCQSSFTTTGVFNPSVTMKTRT  180

Query  499  SLTFDPWGEDIA----------CKRKCRPWAFECLEEEKR---------WACSREEGDGT  377
            S + D   E +            KR CR W FE LE E R            ++   + T
Sbjct  181  SSSLDIMREPMVEKEELVEENEYKRTCRSWGFENLEIENRRNKNSSTMATTFNKIIDNVT  240

Query  376  LELFPLHPE  350
            LELFPLHPE
Sbjct  241  LELFPLHPE  249



>gb|AAG50620.1|AC083835_5 hypothetical protein [Arabidopsis thaliana]
Length=249

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 151/247 (61%), Gaps = 31/247 (13%)
 Frame = -3

Query  997  MKVHQFTRGFIF---EQDQVPSLSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKS  833
            MKVH+F+ GF     + D   SLSL CKR RPLAPKL G   +  + S  VT   FDLK+
Sbjct  1    MKVHEFSNGFSSSWDQHDSTSSLSLSCKRLRPLAPKLSGSPPSPPSSSSGVTSATFDLKN  60

Query  832  FIKPESSPRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITA  653
            FI+P+ +  +  E K  P  +THPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE IT 
Sbjct  61   FIRPDQTGPTKFEHKRDPPHQTHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIEHITL  120

Query  652  QLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL-------GLNHSprtpppppitTVSSL  494
            QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L           +    P   + T +S 
Sbjct  121  QLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLISLSCQSSFTTTGVFNPSVTMKTRTSS  180

Query  493  TFDPWGEDIA----------CKRKCRPWAFECLEEEKR---------WACSREEGDGTLE  371
            + D   E +            KR CR W FE LE E R            ++   + TLE
Sbjct  181  SLDIMREPMVEKEELVEENEYKRTCRSWGFENLEIENRRNKNSSTMATTFNKIIDNVTLE  240

Query  370  LFPLHPE  350
            LFPLHPE
Sbjct  241  LFPLHPE  247



>gb|ACN56439.1| WUSCHEL-related homeobox-containing protein 4 [Ocotea catharinensis]
Length=213

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 148/218 (68%), Gaps = 14/218 (6%)
 Frame = -3

Query  994  KVHQFTRGFIFEQDQVPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPES  815
            K+H+  RG   EQD  PSL+LG KRFRPLAPKL     A     VT  +F+LK  I P +
Sbjct  5    KLHKMPRGLC-EQD--PSLTLGWKRFRPLAPKL-----AKTEQRVT--SFELKRLISPGT  54

Query  814  SPR---SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLG  644
             PR   S ++ KDSP  ET PGGTRWNPTQEQIGILEMLYRGGMRTPN QQIE ITAQL 
Sbjct  55   GPRKQASSEDNKDSPHGETQPGGTRWNPTQEQIGILEMLYRGGMRTPNGQQIEDITAQLS  114

Query  643  KYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIA  464
            +YGKIEGKNVFYWFQNHKARERQKQK N LGL   P TP P  I  + S       E+  
Sbjct  115  RYGKIEGKNVFYWFQNHKARERQKQKSNRLGLRQRPSTPSPMTIIFLDSTGDAEKDEESL  174

Query  463  CKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
             KR  R  +F+C + E R +C+ +EG+ TLEL PL P+
Sbjct  175  YKRNSRSCSFDCFDLEDRSSCN-DEGETTLELLPLQPD  211



>emb|CDY17046.1| BnaA08g04100D [Brassica napus]
Length=256

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 132/254 (52%), Positives = 158/254 (62%), Gaps = 38/254 (15%)
 Frame = -3

Query  997  MKVHQFTRGFI-FEQDQVPS-LSLGCKRFRPLAPKLGGGDAATAAIS-VTPPAFDLKSFI  827
            MKVH+F+ G   +EQ   PS LSL CKR RPLAPKL G   + ++ S VT   FDLKSFI
Sbjct  1    MKVHEFSNGSSSWEQHDSPSSLSLSCKRLRPLAPKLSGSPCSPSSSSGVTSATFDLKSFI  60

Query  826  KPESS-PR----SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQ  662
            KP+ + PR    S + ++D PQ ETH GGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE 
Sbjct  61   KPDQTGPRKFEYSIEHQRDLPQVETHQGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIEH  120

Query  661  ITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL------------GLNHSprtpppp  518
            IT+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+              +N++  T    
Sbjct  121  ITSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNFISLSCQSSFKTTNINNASVTTKTT  180

Query  517  pitTVSSLTFDPW------GEDIACKRKCRPWAFECLEEEKRWACSREEG----------  386
              ++   +  D         E+   KR CR W FE LE + R   +  +           
Sbjct  181  TTSSFDVIRRDSMVEKGELVEETEYKRTCRSWGFENLEIDSRRNINSSKNATMATTFNKI  240

Query  385  --DGTLELFPLHPE  350
              + TLELFPL+PE
Sbjct  241  IDNVTLELFPLYPE  254



>ref|XP_010461506.1| PREDICTED: WUSCHEL-related homeobox 4-like isoform X1 [Camelina 
sativa]
Length=255

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 155/253 (61%), Gaps = 37/253 (15%)
 Frame = -3

Query  997  MKVHQFTRGFIF---EQDQVPSLSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKS  833
            MKVH+F+ GF     + D   SLSL CKR RPLAPKL G   +  + S  VT   FDLKS
Sbjct  1    MKVHEFSNGFSSSWGQHDSTSSLSLSCKRLRPLAPKLSGSPPSPPSSSSGVTSATFDLKS  60

Query  832  FIKPE-SSPRSPDEKKDSPQA-----ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQ  671
            FI+P+ + P   + K+D PQ      ET PGGTRWNPTQEQIGILEMLY+GGMRTPNAQQ
Sbjct  61   FIRPDQTGPTKCEHKRDPPQVSSLTLETPPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQ  120

Query  670  IEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL-------GLNHSprtpppppi  512
            IE IT+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L           +  + P    
Sbjct  121  IEHITSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLISISCQTSFTTTSVSNPSVTT  180

Query  511  tTVSSLTFD----------PWGEDIACKRKCRPWAFECLE-EEKRWACSREEG-------  386
             T +S + D             E+   KR CR W FE LE E +R   S   G       
Sbjct  181  KTRTSSSLDIRRDSMVEKQELVEENEYKRTCRSWGFENLEIEGRRNKNSSTMGTTYHKII  240

Query  385  -DGTLELFPLHPE  350
             + TLELFPLHPE
Sbjct  241  DNVTLELFPLHPE  253



>gb|ABC47840.1| WOX4 protein [Glycine max]
Length=188

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 136/184 (74%), Gaps = 13/184 (7%)
 Frame = -3

Query  865  SVTPPAFDLKSFIKPESSPRSP----DEKKDSP----QAETHPGGTRWNPTQEQIGILEM  710
            ++T P FDLKSFI+PES PR P    D KKD P    Q ETHPGGTRWNPTQEQIGILEM
Sbjct  4    TITTP-FDLKSFIRPESGPRKPVSSDDTKKDPPSPQGQIETHPGGTRWNPTQEQIGILEM  62

Query  709  LYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprt  530
            LY+GGMRTPNAQQIEQIT QLGKYGKIEGKNVFYWFQNHKARERQKQKR+SL  +HSPRT
Sbjct  63   LYKGGMRTPNAQQIEQITVQLGKYGKIEGKNVFYWFQNHKARERQKQKRSSLASSHSPRT  122

Query  529  pppppitTVSS----LTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREEGDGTLELFP  362
            P    + T+ +    +      ED   K+KCR W F+CLEE+   +   +E   TLELFP
Sbjct  123  PTIHSVVTLETTRGEVVERDHEEDSPYKKKCRRWVFDCLEEQNMSSPCEQEEHRTLELFP  182

Query  361  LHPE  350
            LHPE
Sbjct  183  LHPE  186



>ref|XP_006393630.1| hypothetical protein EUTSA_v10011723mg [Eutrema salsugineum]
 gb|ESQ30916.1| hypothetical protein EUTSA_v10011723mg [Eutrema salsugineum]
Length=257

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 154/255 (60%), Gaps = 39/255 (15%)
 Frame = -3

Query  997  MKVHQFTRGFI-FEQDQVPS-LSLGCKRFRPLAPKLGGGDAATAAIS--VTPPAFDLKSF  830
            MKVH+F+ GF  +EQ   PS LSL CKR RPL  KL G  ++  + S  VT    DLKSF
Sbjct  1    MKVHEFSNGFSSWEQHDSPSSLSLSCKRLRPLVRKLSGSPSSPPSSSSGVTSATLDLKSF  60

Query  829  IKPES-SPR----SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIE  665
            IKP+   PR    S + K+D PQ ETHPGGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE
Sbjct  61   IKPDQMGPRKFEYSLEHKRDLPQVETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIE  120

Query  664  QITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL-GLNHSprtpppppi--------  512
             IT+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+L GL+                   
Sbjct  121  HITSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLIGLSFQSSFKTTSVADPSVTTTK  180

Query  511  ---------tTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREEG---------  386
                        S +  +   E+   KR CR W FE LE E++   +             
Sbjct  181  TRTSSSLEIRRESMMEKEELVEENEYKRTCRSWGFENLEIERKRNINSSTNATMATTFNK  240

Query  385  ---DGTLELFPLHPE  350
               + TLELFPLHPE
Sbjct  241  IIDNVTLELFPLHPE  255



>emb|CDY40847.1| BnaC08g04810D [Brassica napus]
Length=255

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 155/253 (61%), Gaps = 37/253 (15%)
 Frame = -3

Query  997  MKVHQFTRGFI-FEQDQVPS-LSLGCKRFRPLAPKLGGGDAATAAIS-VTPPAFDLKSFI  827
            MKVH+F+ GF  +EQ   PS LSL CKR RPL PKL G   + ++ S VT   FDLKSFI
Sbjct  1    MKVHEFSNGFSSWEQHDSPSSLSLSCKRLRPLGPKLSGSPCSPSSSSGVTSATFDLKSFI  60

Query  826  KPE-SSPR----SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQ  662
            KP+ + PR    S + ++D P   TH GGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE 
Sbjct  61   KPDQTGPRKFEYSIEHQRDLPHVGTHQGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIEN  120

Query  661  ITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL------------GLNHS-----pr  533
            IT+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+              +N++       
Sbjct  121  ITSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNFISLSCLSSFKTTNINNASVTTKTT  180

Query  532  tpppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACSREEG-----------  386
            T     I   S +      E+   KR CR W FE LE + R   +  +            
Sbjct  181  TSSNDVIRRDSMVEKGELVEEAEYKRTCRSWGFENLEIDSRRNINSSKNATMATTFNKII  240

Query  385  -DGTLELFPLHPE  350
             + TLELFPLHPE
Sbjct  241  ENVTLELFPLHPE  253



>ref|XP_009107441.1| PREDICTED: WUSCHEL-related homeobox 4 [Brassica rapa]
Length=257

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 159/256 (62%), Gaps = 41/256 (16%)
 Frame = -3

Query  997  MKVHQFTRGFI-FEQDQVPS-LSLGCKRFRPLAPKLGGGDAATAAIS-VTPPAFDLKSFI  827
            MKVH+F+ G   +EQ   PS LSL CKR RPLAPKL G   + ++ S VT   FDLKSFI
Sbjct  1    MKVHEFSNGSSSWEQHDSPSSLSLSCKRLRPLAPKLSGSPCSPSSSSGVTSATFDLKSFI  60

Query  826  KPESS-PR----SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQ  662
            KP+ + PR    S + ++D PQ ETH GGTRWNPTQEQIGILEMLY+GGMRTPNAQQIE 
Sbjct  61   KPDQTGPRKFEYSIEHQRDLPQVETHQGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIEH  120

Query  661  ITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSL----  494
            IT+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+  ++ S ++         +S+    
Sbjct  121  ITSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNF-ISLSCQSSFKTTNINNASVTTKT  179

Query  493  -----TFD-----------PWGEDIACKRKCRPWAFECLEEEKRWACSREEG--------  386
                 +FD              E+   KR  R W FE LE + R   +  +         
Sbjct  180  TTTTSSFDVIRRDSMVEKGELVEETEYKRTGRSWGFENLEIDSRRNINSSKNATMATTFD  239

Query  385  ----DGTLELFPLHPE  350
                + TLELFPL+PE
Sbjct  240  KIIDNVTLELFPLYPE  255



>ref|XP_010688724.1| PREDICTED: WUSCHEL-related homeobox 4 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=228

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 146/244 (60%), Gaps = 49/244 (20%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVP----SLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKS  833
            +MKVH F RGF            +L+LGCKRFRPLAPK                     S
Sbjct  5    SMKVHPFGRGFWDNHQTTAHDSQALTLGCKRFRPLAPK---------------------S  43

Query  832  FIKPESSP----RSPDEKKDSP--QAET--HPGGTRWNPTQEQIGILEMLYRGGMRTPNA  677
            FI+P   P      PD KKDS   QAET  HPGGTRWNPTQEQIGILEMLYRGGMRTPNA
Sbjct  44   FIRPHCGPPKMVSPPDHKKDSASHQAETLSHPGGTRWNPTQEQIGILEMLYRGGMRTPNA  103

Query  676  QQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHS--------prtppp  521
            QQIEQIT QL KYGKIEGKNVFYWFQNHKARERQKQKR  LGL+H+              
Sbjct  104  QQIEQITEQLSKYGKIEGKNVFYWFQNHKARERQKQKRTILGLSHNPRTPTAATATATAT  163

Query  520  ppitTVSSLTFDPWGEDIA-------CKRKCRPWAFECLEEEKRWACSREEGDGTLELFP  362
              +   ++LT D   E I         KRK R W F+  EE+++   + EE D TLELFP
Sbjct  164  TQLNASTTLTLDTRVEFIDQEEQISPYKRKFRNWTFKSSEEKQKKDYTNEE-DKTLELFP  222

Query  361  LHPE  350
            LHPE
Sbjct  223  LHPE  226



>gb|EYU25452.1| hypothetical protein MIMGU_mgv1a012633mg [Erythranthe guttata]
Length=244

 Score =   205 bits (522),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 150/243 (62%), Gaps = 32/243 (13%)
 Frame = -3

Query  1000 TMKVHQFTRGFIFEQDQVPSLSLGCK-RFRPLAPKLGGGDAATAAISVTPPAFDLKSFIK  824
             MK+H   R  I++ D  PSL+LGCK R RPLAPKL      T A + T   FDLKSFI+
Sbjct  5    AMKIHHLARALIWDHDP-PSLTLGCKKRLRPLAPKL-----TTTAATTTAATFDLKSFIR  58

Query  823  PESSP----RSPD-EKKDSPQAE-THPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQ  662
            PES P      PD +KK+  Q E   PGGTRWNPTQEQIGILEMLY  GMRTPNA QIEQ
Sbjct  59   PESGPPKIESPPDYQKKELAQVEGAQPGGTRWNPTQEQIGILEMLYGNGMRTPNANQIEQ  118

Query  661  ITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDP  482
            ITAQL KYGKIEGKNVFYWFQNHKARERQKQKR SLGL+ S    PP P    S+     
Sbjct  119  ITAQLAKYGKIEGKNVFYWFQNHKARERQKQKRISLGLSRSRPRTPPSPFPAFSTPLLSS  178

Query  481  WG-------------EDIACKRKCRPWAFECLEEEKRWACSREEGDG------TLELFPL  359
                           ED   KRK R WAF+   +E    C+ EE +G      TLELFPL
Sbjct  179  SSSSTKSEGRHGELFEDNPYKRKSRSWAFDLCLQEDNIRCTEEEEEGGWKDTTTLELFPL  238

Query  358  HPE  350
             PE
Sbjct  239  QPE  241



>ref|XP_010538129.1| PREDICTED: WUSCHEL-related homeobox 4 [Tarenaya hassleriana]
Length=260

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 148/261 (57%), Gaps = 44/261 (17%)
 Frame = -3

Query  997  MKVHQFTRGFIF-----------------EQDQVPSLSLGCKRFRPLAPKLGGGDAATAA  869
            MK+HQ +RG                          SL+L CKR   LA        ++ +
Sbjct  1    MKMHQLSRGLSSWDNNNHIIINNNRSSSNHHGCQTSLTLSCKRLHSLAAA--SPPPSSPS  58

Query  868  ISVTPPAFDLKSFI-KPESSPRSPDEKKDSP-QAETHPGGTRWNPTQEQIGILEMLYRGG  695
             + +  A DLKSFI +   +  + D ++DSP Q ETHPGGTRWNPTQEQIGILEMLY+ G
Sbjct  59   SATSASALDLKSFINEARETGTNNDHRRDSPHQVETHPGGTRWNPTQEQIGILEMLYKDG  118

Query  694  MRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtppppp  515
            MRTP A+QIE IT+QLGKYGKIEGKNVFYWFQNHKARERQKQKRN+   N SP+      
Sbjct  119  MRTPTAEQIEHITSQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNNNNNLSPKPVSNMT  178

Query  514  itTVSSL------TFDPWGEDIACKRKCRPWAFECLEEE-KRWACSREEGDG--------  380
             TTV SL        +   ED   KR CR W FE +E E K   C+  + D         
Sbjct  179  TTTVLSLDNRREVMAEKGIEDSPYKRACRSWGFEDVELECKTNPCNSSKHDNNGNNHNNN  238

Query  379  --------TLELFPLHPELGR  341
                    TLELFPLHPELG+
Sbjct  239  KLFNNNVKTLELFPLHPELGK  259



>ref|XP_006855139.1| hypothetical protein AMTR_s00051p00020930 [Amborella trichopoda]
 gb|ERN16606.1| hypothetical protein AMTR_s00051p00020930 [Amborella trichopoda]
Length=222

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 123/212 (58%), Gaps = 34/212 (16%)
 Frame = -3

Query  937  SLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDS--------  782
            ++ CKR RPL   L    A         P+ +  S I   +  R P  K           
Sbjct  24   TVRCKRLRPLTLSLSTPAAT--------PSSESNSGIATPTFIRCPPRKAAEAAQQQQAT  75

Query  781  ----PQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNV  614
                PQA+   G TRWNPTQEQI ILEMLYRGGMRTPNAQQIE ITAQLG+YGKIEGKNV
Sbjct  76   AEAMPQAQV--GSTRWNPTQEQIAILEMLYRGGMRTPNAQQIEHITAQLGRYGKIEGKNV  133

Query  613  FYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIAC--KRKCRPW  440
            FYWFQNHKARERQKQKR S  L     T       + ++      GE   C  KRKCR W
Sbjct  134  FYWFQNHKARERQKQKRTSGALTLGLTTTTTIAAASSTAK-----GEGEGCFFKRKCRSW  188

Query  439  AFEC--LEEEKRWACSREEGDGTLELFPLHPE  350
            A +   LEEE+R   SR + D TLELFPLHPE
Sbjct  189  ALQSLDLEEEER---SRFQADKTLELFPLHPE  217



>ref|XP_010909238.1| PREDICTED: WUSCHEL-related homeobox 4 [Elaeis guineensis]
Length=244

 Score =   167 bits (422),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 117/251 (47%), Positives = 135/251 (54%), Gaps = 47/251 (19%)
 Frame = -3

Query  997  MKVHQFTRGFIFEQD--------------QVPSLSLGCKRFRPLAPKLGGGDAATAAI-S  863
            MKV Q   G  +E                   SL++  KR RPLAPKL     AT    S
Sbjct  1    MKVQQLAMGGFWEHQLQEPSSPSSSSSSSTTSSLTIHFKRLRPLAPKLTATVTATTVAAS  60

Query  862  VTPPAFDLKSFIKPES--SPRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMR  689
             T  + D+K F  P++  + R+PD    S Q ET  GGTRWNP  EQI  LE LYRGGMR
Sbjct  61   QTIASLDVKGFNFPKAKCTARNPD----SSQVETQSGGTRWNPAPEQIRALEALYRGGMR  116

Query  688  TPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSL-GLNHSprtpppppi  512
            TPNAQQIE ITA+LGKYG+IEGKNVFYWFQNHKARERQKQKR++L  L+ S         
Sbjct  117  TPNAQQIEHITAELGKYGRIEGKNVFYWFQNHKARERQKQKRSALLALSSSNNDSSSNSS  176

Query  511  tTVSSLTFDPWGE--------------DIACKRKCRPWA---FECLEEEKRWACSREEGD  383
            T    +     G               D +CKRKCR W     + +EE          GD
Sbjct  177  TCPPIMALKSTGSRGGRVGGGEVEEYYDGSCKRKCRSWGGVGRDIMEEGG--------GD  228

Query  382  GTLELFPLHPE  350
             TLELFPLHPE
Sbjct  229  RTLELFPLHPE  239



>ref|XP_009413452.1| PREDICTED: WUSCHEL-related homeobox 4-like [Musa acuminata subsp. 
malaccensis]
Length=175

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 106/172 (62%), Gaps = 12/172 (7%)
 Frame = -3

Query  847  FDLKSFIKPESSPRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQI  668
              LKSF  P ++ +      D+   +   GGTRWNP  EQI +LE LY+GGMRTPN  QI
Sbjct  5    ISLKSFNSPLTT-KFASRNVDASLMQLQSGGTRWNPMPEQIKLLEALYQGGMRTPNPVQI  63

Query  667  EQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTF  488
            E+ITA+L KYG+IEGKNVFYWFQNHKARERQKQKR++L    +     P  +   +   F
Sbjct  64   ERITAELSKYGRIEGKNVFYWFQNHKARERQKQKRSALLALATNSASLPNLLKVRTKHGF  123

Query  487  DPWGEDI------ACKRKCRPWAFECLEEEKRWACSREEGDGTLELFPLHPE  350
             P GE++      +CKRKCR W    LE +         GD TLELFPLHPE
Sbjct  124  SPHGEEMKELHDGSCKRKCRSWG--SLEPD---VEDSGPGDRTLELFPLHPE  170



>gb|EYU36332.1| hypothetical protein MIMGU_mgv1a024335mg, partial [Erythranthe 
guttata]
Length=147

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 92/149 (62%), Gaps = 15/149 (10%)
 Frame = -3

Query  775  AETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQN  596
             E   GGTRWNPTQEQI ILEMLYRGGMRTPNAQQIEQI+ QL KYGKIEGKNVFYWFQN
Sbjct  1    VEAQAGGTRWNPTQEQITILEMLYRGGMRTPNAQQIEQISVQLAKYGKIEGKNVFYWFQN  60

Query  595  HKARERQKQKRNSLGLNHSprtpppppit-------TVSSLTFDPWGEDIACKRKCRPWA  437
            HKARERQKQKR +     +      P           + S + + +      KRK R W 
Sbjct  61   HKARERQKQKRITTTTIFNTTPDSSPSPPPFIISSCQLISSSPEEFEYCTPYKRKWRSWG  120

Query  436  FECLEEEKRWACSREEGDGTLELFPLHPE  350
            F+  EE+          D TL LFPLHPE
Sbjct  121  FDQEEEQVE--------DRTLNLFPLHPE  141



>ref|XP_008778641.1| PREDICTED: WUSCHEL-related homeobox 4 [Phoenix dactylifera]
Length=151

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 93/150 (62%), Gaps = 18/150 (12%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            PGGTRWNPT EQI +LE LYRGGMRTPNA QIE+IT +L K+G+IEGKNVFYWFQNHKAR
Sbjct  3    PGGTRWNPTPEQIRVLEALYRGGMRTPNAHQIERITGELSKHGRIEGKNVFYWFQNHKAR  62

Query  583  ERQKQKRNSLGLNHSprtpppppitTVSSLT------------FDPWGEDIACKRKCRPW  440
            ERQKQKR++L L  S           + +L              D    D +CKRKCR W
Sbjct  63   ERQKQKRSAL-LALSSSNNDSSASPPIMTLVSTSSRGGGGGEEADQECYDGSCKRKCRSW  121

Query  439  AFECLEEEKRWACSREEGDGTLELFPLHPE  350
                L+           GD TLELFPLHPE
Sbjct  122  GRLGLD-----VVEEGGGDRTLELFPLHPE  146



>ref|XP_006652920.1| PREDICTED: WUSCHEL-related homeobox 4-like [Oryza brachyantha]
Length=227

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 122/210 (58%), Gaps = 26/210 (12%)
 Frame = -3

Query  946  PSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAET  767
            P+ +L C   RPLAPK          IS+  P    K+   P+  PR+ +  K    A  
Sbjct  35   PAFALKC--LRPLAPK----------ISLPEPR---KTIAPPDFVPRARNVSKLLNYAVQ  79

Query  766  HP--GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNH  593
             P  G TRWNP+ EQI +LEMLYRGGMRTPN+ QIE+IT +LGKYG+IEGKNVFYWFQNH
Sbjct  80   VPTAGTTRWNPSPEQIKVLEMLYRGGMRTPNSVQIERITEELGKYGRIEGKNVFYWFQNH  139

Query  592  KARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDI------ACKRKCRPWAFE  431
            KARERQKQKR +L L  S       P      +  +   +++      +CKR+C+ W   
Sbjct  140  KARERQKQKRAAL-LTLSTLDSSSLPSNQTKDMPDEKKKKELHDDGLTSCKRRCKAWGDG  198

Query  430  CLEEEKRWACSREEGDGTLELFPLHPELGR  341
              + +     + ++ D TLELFPL P LG+
Sbjct  199  AGDGDAATEDATDD-DVTLELFPLRP-LGK  226



>sp|Q7XTV3.2|WOX4_ORYSJ RecName: Full=WUSCHEL-related homeobox 4; AltName: Full=OsWOX4 
[Oryza sativa Japonica Group]
 sp|Q25AM2.1|WOX4_ORYSI RecName: Full=WUSCHEL-related homeobox 4; AltName: Full=OsWOX4 
[Oryza sativa Indica Group]
 emb|CAE04492.1| OSJNBb0059K02.2 [Oryza sativa Japonica Group]
 emb|CAD41713.2| OSJNBa0010D21.16 [Oryza sativa Japonica Group]
 emb|CAH68258.1| H0212B02.3 [Oryza sativa Indica Group]
 gb|EAY95820.1| hypothetical protein OsI_17689 [Oryza sativa Indica Group]
 gb|EAZ32215.1| hypothetical protein OsJ_16422 [Oryza sativa Japonica Group]
 gb|AEE81047.1| WUSCHEL-like homeobox protein [Oryza sativa Japonica Group]
Length=236

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 116/212 (55%), Gaps = 30/212 (14%)
 Frame = -3

Query  946  PSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAET  767
            P+ S  C   RPLAPK+   +       + PP F +         PR+ +  K       
Sbjct  39   PAFSFKC--LRPLAPKISLPEPRKM---IAPPDFVV---------PRARNASKLLNYTVQ  84

Query  766  HP--GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNH  593
             P  G TRWNP+ EQI +LEMLYRGGMRTPN+ QIE+IT +LGKYG+IEGKNVFYWFQNH
Sbjct  85   VPAAGTTRWNPSAEQIKVLEMLYRGGMRTPNSVQIERITEELGKYGRIEGKNVFYWFQNH  144

Query  592  KARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDI-----ACKRKCRPW----  440
            KARERQKQKR +L    +      P     +    +   +D+     +CKR+C+ W    
Sbjct  145  KARERQKQKRAALLTLSTLDPSLLPATANETKEAPEKKEKDVEDGLASCKRRCKAWGDGA  204

Query  439  --AFECLEEEKRWACSREEGDGTLELFPLHPE  350
                  +  E    C+ E    TLELFPLHP+
Sbjct  205  GDGDAVVATEAAGGCTDEV---TLELFPLHPQ  233



>ref|NP_001054082.1| Os04g0649400 [Oryza sativa Japonica Group]
 dbj|BAF15996.1| Os04g0649400, partial [Oryza sativa Japonica Group]
Length=232

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 115/211 (55%), Gaps = 30/211 (14%)
 Frame = -3

Query  946  PSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAET  767
            P+ S  C   RPLAPK+   +       + PP F +         PR+ +  K       
Sbjct  39   PAFSFKC--LRPLAPKISLPEPRKM---IAPPDFVV---------PRARNASKLLNYTVQ  84

Query  766  HP--GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNH  593
             P  G TRWNP+ EQI +LEMLYRGGMRTPN+ QIE+IT +LGKYG+IEGKNVFYWFQNH
Sbjct  85   VPAAGTTRWNPSAEQIKVLEMLYRGGMRTPNSVQIERITEELGKYGRIEGKNVFYWFQNH  144

Query  592  KARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDI-----ACKRKCRPW----  440
            KARERQKQKR +L    +      P     +    +   +D+     +CKR+C+ W    
Sbjct  145  KARERQKQKRAALLTLSTLDPSLLPATANETKEAPEKKEKDVEDGLASCKRRCKAWGDGA  204

Query  439  --AFECLEEEKRWACSREEGDGTLELFPLHP  353
                  +  E    C+ E    TLELFPLHP
Sbjct  205  GDGDAVVATEAAGGCTDEV---TLELFPLHP  232



>ref|XP_004977039.1| PREDICTED: WUSCHEL-related homeobox 4-like [Setaria italica]
Length=228

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 116/206 (56%), Gaps = 23/206 (11%)
 Frame = -3

Query  940  LSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHP  761
            L+L C   RPLAPK+   +A    +        L  F +  ++ R  +     P      
Sbjct  35   LALQC--LRPLAPKISFPEARKMVV--------LPEFSRVRNASRLLNCTVQVPTG----  80

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRWNP+ +QI +LEMLYRGGMRTPN+ QIEQIT +LGKYG+IEGKNVFYWFQNHKARE
Sbjct  81   GTTRWNPSPDQIKVLEMLYRGGMRTPNSFQIEQITEELGKYGRIEGKNVFYWFQNHKARE  140

Query  580  RQKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIAC-KRKCRPWAFECLEE-----  419
            RQKQKR +L    +  + P P          +   ED +  KR+CR W  +   +     
Sbjct  141  RQKQKRAALLTLSTTSSLPSPETKVGVGKEEEASCEDASSRKRRCRTWGDDVHGDAAPAT  200

Query  418  EKRWACSREEGDGTLELFPLHPELGR  341
            E    C+    D TLELFPL P+ G+
Sbjct  201  EVVADCT---DDVTLELFPLRPDQGK  223



>emb|CAJ84151.1| WOX4 protein [Populus trichocarpa]
Length=65

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            PGGTRWNPTQEQIGILEMLYRGGMRTPN QQIE ITAQL +YGKIEGKNVFYWFQNHKAR
Sbjct  1    PGGTRWNPTQEQIGILEMLYRGGMRTPNGQQIEDITAQLSRYGKIEGKNVFYWFQNHKAR  60

Query  583  ERQKQ  569
            ERQKQ
Sbjct  61   ERQKQ  65



>ref|XP_002448640.1| hypothetical protein SORBIDRAFT_06g030700 [Sorghum bicolor]
 gb|EES12968.1| hypothetical protein SORBIDRAFT_06g030700 [Sorghum bicolor]
Length=245

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 124/223 (56%), Gaps = 26/223 (12%)
 Frame = -3

Query  970  FIFEQDQVPSLSLGCKRF--RPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPD  797
             +  Q    ++ L  +++  RPLAPK+   +A    +        L  F +  ++  S  
Sbjct  29   LVASQSSSAAIPLALQQYCLRPLAPKISFPEARKMVV--------LPEFARVRNA--SSR  78

Query  796  EKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKN  617
                + Q  T  G TRWNP+ +QI +LEMLYRGGMRTPN+ QIEQIT +LGKYG+IEGKN
Sbjct  79   LLNCTVQVPTAGGTTRWNPSPDQIRVLEMLYRGGMRTPNSFQIEQITEELGKYGRIEGKN  138

Query  616  VFYWFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFD--PWGEDIAC------  461
            VFYWFQNHKARERQKQKR +L    +  T    P++  ++ T D     ++ AC      
Sbjct  139  VFYWFQNHKARERQKQKRAALLTLSTTATSTLLPLSPAAAETKDGVETKKEEACEDASSR  198

Query  460  KRKCRPWAFECLEEEKRWACSREEGDG------TLELFPLHPE  350
            KR+CR W  + +        ++E  D       TLELFPL P+
Sbjct  199  KRRCRTWDGDVVHGGGGDDAAKEVADDYYTDDVTLELFPLRPQ  241



>gb|EMS58062.1| WUSCHEL-related homeobox 4 [Triticum urartu]
Length=234

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 110/198 (56%), Gaps = 18/198 (9%)
 Frame = -3

Query  919  FRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHPGGTRWNP  740
             RPLAPK+   D     ++  PP  D+   ++  +   S   +  + Q     G TRWNP
Sbjct  43   LRPLAPKISLPDQPKKLVA--PP--DVLGRVRSATKLLSCTVRNHTVQVPVG-GTTRWNP  97

Query  739  TQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRN  560
            + EQI +LE LYRGGMRTPN+ QIE+IT +LG++G+IEGKNVFYWFQNHKARERQKQKR 
Sbjct  98   SAEQIKVLEALYRGGMRTPNSAQIERITEELGRHGRIEGKNVFYWFQNHKARERQKQKRA  157

Query  559  SLGLNHSprtpppppitTVSSLTFDPWGED--------IACKRKCRPWAFECLEEEKRWA  404
            +L              +  ++ T D  G+          +CKR+CR W     +     A
Sbjct  158  AL-----LTLSTLDSSSLPATATKDGAGDKKEACDDAVTSCKRQCRTWGDGHGDAAAEVA  212

Query  403  CSREEGDGTLELFPLHPE  350
                  + TLELFPL P+
Sbjct  213  AEGCTENVTLELFPLRPQ  230



>ref|XP_009417388.1| PREDICTED: WUSCHEL-related homeobox 4-like [Musa acuminata subsp. 
malaccensis]
Length=147

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 92/146 (63%), Gaps = 13/146 (9%)
 Frame = -3

Query  787  DSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFY  608
            D    +   GGTRWNPT EQI +LE LY+GG+RTPN  QIE+ITA+LGKYG+IEGKNVFY
Sbjct  11   DVSLIQMQSGGTRWNPTPEQIKLLEALYQGGLRTPNPVQIERITAELGKYGRIEGKNVFY  70

Query  607  WFQNHKARERQKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIACKRKCRPWAFEC  428
            WFQNHKAR   KQKR+ L +  +    P P      +  F       +CKRKCR W    
Sbjct  71   WFQNHKAR---KQKRSEL-VALAASAAPLPHPEIEETKEF----HGGSCKRKCRSWGSLE  122

Query  427  LEEEKRWACSREEGDGTLELFPLHPE  350
            L+ E+        GD TLELFPLHPE
Sbjct  123  LDVEEEGP-----GDRTLELFPLHPE  143



>emb|CCP29680.1| HD transcription factor [Ginkgo biloba]
Length=498

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  769  THPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHK  590
            +HP GTRWNPT EQI ILEM Y+GGMRTPNA+QIE ITAQL  YGKIEGKNVFYWFQNHK
Sbjct  128  SHPSGTRWNPTPEQIRILEMFYKGGMRTPNAEQIEHITAQLRHYGKIEGKNVFYWFQNHK  187

Query  589  ARERQKQKRNSL  554
            ARERQKQKRNSL
Sbjct  188  ARERQKQKRNSL  199



>gb|EMT29255.1| WUSCHEL-related homeobox 4 [Aegilops tauschii]
Length=235

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 111/199 (56%), Gaps = 19/199 (10%)
 Frame = -3

Query  919  FRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHPGGTRWNP  740
             RPLAPK+   D     ++  PP  D+   ++  +   S   +  + Q     G TRWNP
Sbjct  43   LRPLAPKISLPDQPKKLVA--PP--DVLGRVRNATKLLSCTVRNHTVQVPVG-GTTRWNP  97

Query  739  TQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRN  560
            + EQI +LE LYRGGMRTPN+ QIE+IT +LG++G+IEGKNVFYWFQNHKARERQKQKR 
Sbjct  98   SAEQIKVLEALYRGGMRTPNSAQIERITEELGRHGRIEGKNVFYWFQNHKARERQKQKRA  157

Query  559  SLGLNHSprtpppppitTVSSLTFDPWG---EDI-----ACKRKCRPWAFECLEEEKRWA  404
            +L              +  ++ T D  G   ED      +CKR+C  W+    +     A
Sbjct  158  AL-----LTLSTLDSSSLPATATKDGAGDKKEDCDEATNSCKRRCMKWSAGHGDAAAEVA  212

Query  403  CSREEGDG-TLELFPLHPE  350
                  D  TLELFPL P+
Sbjct  213  APDGCTDNVTLELFPLRPQ  231



>emb|CAD88982.1| Homeobox protein HB3 [Oryza sativa Japonica Group]
Length=238

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 86/133 (65%), Gaps = 16/133 (12%)
 Frame = -3

Query  946  PSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAET  767
            P+ S  C   RPLAPK+   +       + PP F +         PR+ +  K       
Sbjct  39   PAFSFKC--LRPLAPKISLPEPRKM---IAPPDFVV---------PRARNASKLLNYTVQ  84

Query  766  HP--GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNH  593
             P  G TRWNP+ EQI +LEMLYRGGMRTPN+ QIE+IT +LGKYG+IEGKNVFYWFQNH
Sbjct  85   VPAAGTTRWNPSAEQIKVLEMLYRGGMRTPNSVQIERITEELGKYGRIEGKNVFYWFQNH  144

Query  592  KARERQKQKRNSL  554
            KARERQKQKR +L
Sbjct  145  KARERQKQKRAAL  157



>emb|CCP29681.1| HD transcription factor [Pinus sylvestris]
Length=478

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = -3

Query  799  DEKKDSPQAETHPG--GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIE  626
            +E+ +S   ++ P   GTRWNPT +QI ILEM Y+GGMRTPNA+QIE ITAQL +YGKIE
Sbjct  113  EEQAESCAVQSQPAASGTRWNPTPDQIRILEMFYKGGMRTPNAEQIEHITAQLRQYGKIE  172

Query  625  GKNVFYWFQNHKARERQKQKRNS  557
            GKNVFYWFQNHKARERQKQKRNS
Sbjct  173  GKNVFYWFQNHKARERQKQKRNS  195



>gb|ABR17078.1| unknown [Picea sitchensis]
Length=481

 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = -3

Query  799  DEKKDSPQAETHP--GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIE  626
            +E+ +S   ++ P   GTRWNPT +QI ILEM Y+GGMRTPNA+QIE ITAQL +YGKIE
Sbjct  117  EEQAESCAVQSQPTASGTRWNPTPDQIRILEMFYKGGMRTPNAEQIEHITAQLRQYGKIE  176

Query  625  GKNVFYWFQNHKARERQKQKRNS  557
            GKNVFYWFQNHKARERQKQKRNS
Sbjct  177  GKNVFYWFQNHKARERQKQKRNS  199



>gb|AGL53582.1| WUSCHEL homeobox protein WOX4 [Picea abies]
Length=481

 Score =   130 bits (326),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = -3

Query  799  DEKKDSPQAETHP--GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIE  626
            +E+ +S   ++ P   GTRWNPT +QI ILEM Y+GGMRTPNA+QIE ITAQL +YGKIE
Sbjct  117  EEQAESCAVQSQPTASGTRWNPTPDQIRILEMFYKGGMRTPNAEQIEHITAQLRQYGKIE  176

Query  625  GKNVFYWFQNHKARERQKQKRNS  557
            GKNVFYWFQNHKARERQKQKRNS
Sbjct  177  GKNVFYWFQNHKARERQKQKRNS  199



>emb|CCP29677.1| HD transcription factor [Gnetum gnemon]
Length=430

 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
             GTRWNPT EQI  LEMLYR GMRTPNA+QIE ITAQL +YGKIEGKNVFYWFQNHKARE
Sbjct  146  SGTRWNPTPEQIKFLEMLYRSGMRTPNAEQIEHITAQLRQYGKIEGKNVFYWFQNHKARE  205

Query  580  RQKQKRNSL  554
            RQKQKR S+
Sbjct  206  RQKQKRTSM  214



>ref|XP_010227318.1| PREDICTED: WUSCHEL-related homeobox 4-like, partial [Brachypodium 
distachyon]
Length=167

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRWNP+ EQI +LE LYRGGMRTPNA QIE+IT +LG++G+IEGKNVFYWFQNHKARE
Sbjct  80   GTTRWNPSTEQIKVLEALYRGGMRTPNAAQIERITEELGRHGRIEGKNVFYWFQNHKARE  139

Query  580  RQKQKRNSL  554
            RQKQKR +L
Sbjct  140  RQKQKRAAL  148



>emb|CAJ84142.1| WOX4 protein [Oryza sativa]
Length=65

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRWNP+ EQI +LEMLYRGGMRTPN+ QIE+IT +LGKYG+IEGKNVFYWFQNHKARE
Sbjct  2    GTTRWNPSAEQIKVLEMLYRGGMRTPNSVQIERITEELGKYGRIEGKNVFYWFQNHKARE  61

Query  580  RQKQ  569
            RQKQ
Sbjct  62   RQKQ  65



>emb|CDY02582.1| BnaC02g08530D [Brassica napus]
Length=121

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 75/125 (60%), Gaps = 16/125 (13%)
 Frame = -3

Query  694  MRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRNSLGLNHSprtppppp  515
            MRTPNA+QIE +T+QLG+YGKIEGKNVFYWFQNHKARERQKQKRN+L L+          
Sbjct  1    MRTPNAEQIEHVTSQLGEYGKIEGKNVFYWFQNHKARERQKQKRNNLSLSCQGSLSTTSV  60

Query  514  itTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKR----------WACSREEGDGTLELF  365
                  L      E+   KR CR W FE L+ E R           A +    + TLELF
Sbjct  61   SNASELL------EENEYKRTCRSWGFENLKIESRRNINSSINATIATTFNIDNVTLELF  114

Query  364  PLHPE  350
            PLHPE
Sbjct  115  PLHPE  119



>gb|ACF80523.1| unknown [Zea mays]
Length=180

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 90/149 (60%), Gaps = 12/149 (8%)
 Frame = -3

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNP+ +QI +LEMLYRGGMRTPN+ QIEQIT +LGKYG+IEGKNVFYWFQNHKARERQK
Sbjct  32   RWNPSPDQIRVLEMLYRGGMRTPNSFQIEQITEELGKYGRIEGKNVFYWFQNHKARERQK  91

Query  571  QKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIAC------KRKCRPWAFECLEEEKR  410
            QKR +L    +  T          +       ++ AC      KR+CR W    +     
Sbjct  92   QKRAALLTLSTTTTASTLLPPAAETKEGVETKKEEACEDASSRKRRCRAWEDVVVHGGGD  151

Query  409  WACSR------EEGDGTLELFPLHPELGR  341
             A +        + D TLELFPL P+ G+
Sbjct  152  DAGTEVADDYYTDDDVTLELFPLRPDQGK  180



>ref|NP_001288390.1| WUSCHEL-related homeobox 4-like [Zea mays]
 ref|XP_008663661.1| PREDICTED: WUSCHEL-related homeobox 4-like [Zea mays]
 gb|ACG36393.1| WUSCHEL-related homeobox 4 [Zea mays]
 gb|ACR35548.1| unknown [Zea mays]
Length=250

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 111/205 (54%), Gaps = 18/205 (9%)
 Frame = -3

Query  919  FRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHPGGTRWNP  740
             RPLAPK+   +A      V  P F   + ++  SS       +  P   T  G TRWNP
Sbjct  52   LRPLAPKISFPEARKM---VVLPEF---ARVRNASSRLLNCTVQVPPTTTTVGGTTRWNP  105

Query  739  TQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKRN  560
            + +QI +LEMLYRGGMRTPN+ QIEQIT +LGKYG+IEGKNVFYWFQNHKARERQKQKR 
Sbjct  106  SPDQIRVLEMLYRGGMRTPNSFQIEQITEELGKYGRIEGKNVFYWFQNHKARERQKQKRA  165

Query  559  SLGLNHSprtpppppitTVSSLTFDPWGEDIAC------KRKCRPWAFECLE------EE  416
            +L    +  T          +       ++ AC      KR+CR W    +         
Sbjct  166  ALLTLSTTTTASTLLPPAAETKEGVETKKEEACEDASSRKRRCRAWEDVVVHGGGDDAGT  225

Query  415  KRWACSREEGDGTLELFPLHPELGR  341
            +       + D TLELFPL P+ G+
Sbjct  226  EVADDYYTDDDVTLELFPLRPDQGK  250



>gb|AGL53581.1| WUSCHEL homeobox protein WOX3 [Picea abies]
Length=181

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -3

Query  781  PQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWF  602
            P A   P  TRWNPT EQ+ ILE +YRGG+RTPNA QI+QITA L  YGKIEGKNVFYWF
Sbjct  32   PTAMPQPATTRWNPTPEQLMILEEMYRGGIRTPNADQIQQITAHLALYGKIEGKNVFYWF  91

Query  601  QNHKARERQKQKR  563
            QNHKAR+RQK +R
Sbjct  92   QNHKARDRQKLRR  104



>emb|CAJ84160.1| WOX4 protein [Zea mays]
Length=65

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRWNP+ +QI +LEMLYRGGMRTPN+ QIEQIT +LGKYG+IEGKNVFYWFQN KARE
Sbjct  2    GTTRWNPSPDQIRVLEMLYRGGMRTPNSFQIEQITEELGKYGRIEGKNVFYWFQNRKARE  61

Query  580  RQKQ  569
            RQKQ
Sbjct  62   RQKQ  65



>emb|CAT02931.1| putative wuschel homeobox protein WOX3 [Gnetum gnemon]
Length=178

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            P  TRWNPT EQ+ ILE LYRGGMRTP+A+QI+QITA L  YGKIEGKNVFYWFQNHKAR
Sbjct  33   PATTRWNPTAEQLMILEELYRGGMRTPSAEQIQQITAHLSLYGKIEGKNVFYWFQNHKAR  92

Query  583  ERQKQKR  563
            +RQK +R
Sbjct  93   DRQKLRR  99



>emb|CDP09037.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   116 bits (291),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 95/166 (57%), Gaps = 21/166 (13%)
 Frame = -3

Query  787  DSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFY  608
            D P +   P G+RWNPT+EQI +LE LY+ G+RTP+A+QI+QIT +L  YG IEGKNVFY
Sbjct  8    DMPISGGAPVGSRWNPTKEQIDMLESLYKQGLRTPSAEQIQQITNRLRAYGHIEGKNVFY  67

Query  607  WFQNHKARERQKQKRNSLG----LNHSprtpppppitTVSSLTFDPWGEDIACKR-----  455
            WFQNHKAR+RQKQK++ +       H   +  PP    + S  + P+ E   C +     
Sbjct  68   WFQNHKARQRQKQKQDHVSPFNRFLHKTASVLPPCTNVLCSPYYMPYPETGLCHQQQQLS  127

Query  454  --------KCRPWAFECLEEEKRWAC----SREEGDGTLELFPLHP  353
                    K RP   E LE+ K   C    S++    TL+LFP  P
Sbjct  128  KVLLPRSFKRRPILPEKLEKSKLLECVMSNSKQFNQETLDLFPQQP  173



>ref|XP_006406665.1| hypothetical protein EUTSA_v10022042mg [Eutrema salsugineum]
 gb|ESQ48118.1| hypothetical protein EUTSA_v10022042mg [Eutrema salsugineum]
Length=353

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 79/124 (64%), Gaps = 1/124 (1%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSF-IKPESSPRSPDEKKDSPQAETHPGG  755
            G ++ RPL P+L     ATAA + +   F++    +  E + R        P        
Sbjct  16   GARKLRPLIPRLSSCPTATAANTNSDHRFNMAVVTMTAEQNKRELMMLNSEPHHPPVMVS  75

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            +RWNPT +Q+ +LE LYR G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARERQ
Sbjct  76   SRWNPTPDQLRVLEELYRQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQ  135

Query  574  KQKR  563
            K++R
Sbjct  136  KRRR  139



>emb|CAT02936.1| putative wuschel homeobox protein WOX3 [Pinus sylvestris]
Length=147

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  766  HPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKA  587
             P  TRWNPT EQ+ ILE +YRGG+RTPNA QI+QITA L  YGKIEGKNVFYWFQNHKA
Sbjct  3    QPATTRWNPTPEQLVILEEMYRGGIRTPNADQIQQITAHLALYGKIEGKNVFYWFQNHKA  62

Query  586  RERQKQKR  563
            R+RQK +R
Sbjct  63   RDRQKLRR  70



>gb|AGL53583.1| WUSCHEL homeobox protein WOX5 [Picea abies]
Length=285

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
            G+RWNPT EQ+ IL+ LYRGGMRTP A+QI+QI++QL +YGKIEGKNVFYWFQNHKARER
Sbjct  48   GSRWNPTAEQVTILKELYRGGMRTPTAEQIQQISSQLKRYGKIEGKNVFYWFQNHKARER  107

Query  577  QKQKRNSL  554
            QK++R ++
Sbjct  108  QKRRRYTI  115



>emb|CAM32347.1| putative wuschel homeobox protein [Zea mays]
Length=245

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 79/119 (66%), Gaps = 6/119 (5%)
 Frame = -3

Query  919  FRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHPGGTRWNP  740
             RPLAPK+   +A      V  P F   + ++  SS       +      T  G TRWNP
Sbjct  46   LRPLAPKISFPEARKM---VVLPEF---ARVRNASSRLLNCTVQVPTTTTTVGGTTRWNP  99

Query  739  TQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQKR  563
            + +QI +LEMLYRGGMRTPN+ QIEQIT +LGKYG+IEGKNVFYWFQN KARERQKQKR
Sbjct  100  SPDQIRVLEMLYRGGMRTPNSFQIEQITEELGKYGRIEGKNVFYWFQNRKARERQKQKR  158



>emb|CAT02922.1| putative wuschel homeobox protein WOX4 [Amborella trichopoda]
Length=54

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQ  599
            G TRWNPTQEQI ILEMLYRGGMRTPNAQQIE ITAQLG+YGKIEGKNVFYWFQ
Sbjct  1    GTTRWNPTQEQIAILEMLYRGGMRTPNAQQIEHITAQLGRYGKIEGKNVFYWFQ  54



>ref|XP_010260182.1| PREDICTED: WUSCHEL-related homeobox 2 [Nelumbo nucifera]
Length=253

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            P  TRWNPT+EQI ILE LYR G+RTP A+QI+QI+++L  YG IEGKNVFYWFQNHKAR
Sbjct  15   PASTRWNPTKEQISILESLYRQGIRTPTAEQIQQISSRLRMYGHIEGKNVFYWFQNHKAR  74

Query  583  ERQKQKRNSL  554
            +RQKQK+ S+
Sbjct  75   QRQKQKQESM  84



>ref|XP_011077272.1| PREDICTED: WUSCHEL-related homeobox 2 [Sesamum indicum]
Length=248

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            GG+RWNPT+EQI +LE LYR G+RTP A+QI+QITA+L  +G IEGKNVFYWFQNHKAR+
Sbjct  18   GGSRWNPTKEQINMLEGLYRQGLRTPTAEQIQQITARLRAFGHIEGKNVFYWFQNHKARQ  77

Query  580  RQKQKRNSLGL  548
            RQKQK++S   
Sbjct  78   RQKQKQDSFAY  88



>ref|XP_010043567.1| PREDICTED: WUSCHEL-related homeobox 2 [Eucalyptus grandis]
Length=264

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            P  +RWNPT+EQIGILE LYR G+RTP A QI+QIT +L  YG IEGKNVFYWFQNHKAR
Sbjct  22   PATSRWNPTKEQIGILESLYRQGIRTPTADQIQQITGRLKAYGHIEGKNVFYWFQNHKAR  81

Query  583  ERQKQKRNSLGL  548
            +RQK+K+ SL  
Sbjct  82   QRQKEKQESLAY  93



>gb|KCW85584.1| hypothetical protein EUGRSUZ_B02379 [Eucalyptus grandis]
Length=251

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            P  +RWNPT+EQIGILE LYR G+RTP A QI+QIT +L  YG IEGKNVFYWFQNHKAR
Sbjct  9    PATSRWNPTKEQIGILESLYRQGIRTPTADQIQQITGRLKAYGHIEGKNVFYWFQNHKAR  68

Query  583  ERQKQKRNSLGL  548
            +RQK+K+ SL  
Sbjct  69   QRQKEKQESLAY  80



>ref|XP_007210608.1| hypothetical protein PRUPE_ppa017419mg [Prunus persica]
 gb|EMJ11807.1| hypothetical protein PRUPE_ppa017419mg [Prunus persica]
Length=408

 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 81/139 (58%), Gaps = 17/139 (12%)
 Frame = -3

Query  937  SLGCKRFRPLAPKL---GGGDAATAAISVTPPA-----------FDLKSFIKPESSPRSP  800
            S   ++ RPL P+       +A ++ I+ TPP            F     +   +     
Sbjct  19   SFNGRKLRPLIPRPLVPSANNATSSVIAATPPCLNRIHGVSHDFFTQYHHLAAMAEQNKR  78

Query  799  DEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGK  620
             E  ++PQ       +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL KYGKIEGK
Sbjct  79   SEFINTPQVVV---SSRWNPTPEQLRALEELYRRGTRTPSAEQIQHITAQLRKYGKIEGK  135

Query  619  NVFYWFQNHKARERQKQKR  563
            NVFYWFQNHKARERQK++R
Sbjct  136  NVFYWFQNHKARERQKRRR  154



>emb|CAL18267.1| homeodomain transcription factor [Picea abies]
Length=201

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 82/140 (59%), Gaps = 9/140 (6%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            TRWNPT+EQI +LE +Y  G+RTP+A QIEQI ++LG YG IEGKNVFYWFQNHKARERQ
Sbjct  10   TRWNPTKEQIELLEAMYSQGIRTPSADQIEQIASRLGMYGNIEGKNVFYWFQNHKARERQ  69

Query  574  KQK--RNSLGLNHSprtpppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWAC  401
            +QK  R   G N   + P     +   +    P  +      K    +   L+E+K +  
Sbjct  70   RQKQERGVFG-NQFLQPPSFSGASHTHTEVLPPQQQSAMAMPKV--GSTLTLKEQKTYTF  126

Query  400  SREEGD----GTLELFPLHP  353
               +       TLELFPLHP
Sbjct  127  QHSQDSLCEPQTLELFPLHP  146



>gb|KFK39124.1| hypothetical protein AALP_AA3G204000 [Arabis alpina]
Length=341

 Score =   113 bits (283),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 77/123 (63%), Gaps = 1/123 (1%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHPGGT  752
            G ++ RPL P+L      TAA + +   F++   +  E + R        PQ       +
Sbjct  16   GGRKLRPLIPRLSSC-PTTAANTNSDHRFNMVVTMTAEQNKRELMMLNSEPQHPPVMVSS  74

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT +Q+  LE LYR G RTP+A  I+QIT QL +YGKIEGKNVFYWFQNHKARERQK
Sbjct  75   RWNPTPDQLRALEELYRQGTRTPSADHIQQITGQLRRYGKIEGKNVFYWFQNHKARERQK  134

Query  571  QKR  563
            ++R
Sbjct  135  RRR  137



>ref|XP_010253422.1| PREDICTED: WUSCHEL-related homeobox 3A [Nelumbo nucifera]
Length=190

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              TRW PT EQ+ ILE +YRGG+RTPNA QI+QITA L  YGKIEGKNVFYWFQNHKARE
Sbjct  5    ASTRWCPTPEQLMILEEMYRGGIRTPNATQIQQITAHLSFYGKIEGKNVFYWFQNHKARE  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>emb|CAT02938.1| putative wuschel homeobox protein WUS [Pinus sylvestris]
Length=245

 Score =   111 bits (277),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
            G+RWNPT EQ+ +L+ LYR GMRTP A+QI+QI++QL +YGKIEGKNVFYWFQNHKARER
Sbjct  9    GSRWNPTAEQVTLLKELYRSGMRTPTAEQIQQISSQLKRYGKIEGKNVFYWFQNHKARER  68

Query  577  QKQKRNSL  554
            QK++R ++
Sbjct  69   QKRRRYTI  76



>ref|XP_002885236.1| WOX1 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61495.1| WOX1 protein [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score =   113 bits (282),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 97/180 (54%), Gaps = 18/180 (10%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPA-FDLKSF-IKPESSPRSPDEKKDSPQAETHPG  758
            G ++ RPL P+L      TAA++      F++    +  E + R        PQ      
Sbjct  16   GGRKLRPLIPRLSS--CPTAAVNTNSDHRFNMAVVTMTAEQNKRELMMLNSEPQHPPVMV  73

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT +Q+ +LE LYR G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARER
Sbjct  74   SSRWNPTPDQLRVLEELYRQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARER  133

Query  577  QKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACS  398
            QK++R    +            + VS+  FD          K  P  ++ +E+ K W CS
Sbjct  134  QKRRRQ---MEAGHEESVFSTTSLVSNHGFD----------KKDPSGYK-VEQSKNWICS  179



>ref|XP_002862807.1| WOX1 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39065.1| WOX1 protein [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score =   113 bits (282),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 97/180 (54%), Gaps = 18/180 (10%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPA-FDLKSF-IKPESSPRSPDEKKDSPQAETHPG  758
            G ++ RPL P+L      TAA++      F++    +  E + R        PQ      
Sbjct  16   GGRKLRPLIPRLSS--CPTAAVNTNSDHRFNMAVVTMTAEQNKRELMMLNSEPQHPPVMV  73

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT +Q+ +LE LYR G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARER
Sbjct  74   SSRWNPTPDQLRVLEELYRQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARER  133

Query  577  QKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACS  398
            QK++R    +            + VS+  FD          K  P  ++ +E+ K W CS
Sbjct  134  QKRRRQ---MEAGHEESVFSTTSLVSNHGFD----------KKDPSGYK-VEQSKNWICS  179



>ref|XP_010506258.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X2 [Camelina 
sativa]
Length=350

 Score =   112 bits (281),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 78/123 (63%), Gaps = 1/123 (1%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHPGGT  752
            G ++ RPL P+L     A+   + +   F++   +K E + R        PQ       +
Sbjct  16   GGRKLRPLIPRLSSCPTASPNTN-SDHRFNMVMTMKAEQNKRELMMLNSEPQHPPVMVSS  74

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT +Q+ +LE LY  G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARERQK
Sbjct  75   RWNPTPDQLRVLEELYGQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQK  134

Query  571  QKR  563
            ++R
Sbjct  135  RRR  137



>ref|XP_010536241.1| PREDICTED: WUSCHEL-related homeobox 2 [Tarenaya hassleriana]
Length=269

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = -3

Query  799  DEKKDSPQAET--HPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIE  626
            D +  +P  ET  + G +RWNPT+EQI ILE LY+ G+RTP+A QI+ IT +L  YG IE
Sbjct  2    DRQNQTPNMETEGNSGSSRWNPTKEQITILENLYKQGIRTPSADQIQHITGRLRAYGHIE  61

Query  625  GKNVFYWFQNHKARERQKQKRNSLG  551
            GKNVFYWFQNHKAR+RQKQK+ S+ 
Sbjct  62   GKNVFYWFQNHKARQRQKQKQESIA  86



>emb|CDX75955.1| BnaC03g40380D [Brassica napus]
Length=350

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 99/180 (55%), Gaps = 17/180 (9%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLK--SFIKPESSPRSPDEKKDSPQAETHPG  758
            G ++ RPL P+L     ATA  + +   F++   + +  E + R        PQ      
Sbjct  16   GGRKLRPLIPRLSSCPTATAN-TYSDHRFNMAVVTTMTAEQNKRELMMLNSEPQHPPAMV  74

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT +Q+  LE LY+ G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARER
Sbjct  75   SSRWNPTPDQLKALEELYQQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARER  134

Query  577  QKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACS  398
            QK++R    + +         ++ VS+  FD        K+  + +    +E+ K W CS
Sbjct  135  QKRRRQ---MENGHDESVVTTMSLVSNQGFD--------KKDSKGYK---VEQTKNWICS  180



>gb|KDP23920.1| hypothetical protein JCGZ_27080 [Jatropha curcas]
Length=392

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 80/135 (59%), Gaps = 8/135 (6%)
 Frame = -3

Query  949  VPSLSLGCKRFRPLAPKLGGGDAATAAISVTPPAF------DLKSFIKPESSPRSPDEKK  788
            +P+ S   +R RPL P+      +    + +PP        D  S     +S    D+ K
Sbjct  14   MPTDSFNGRRLRPLIPRTPSLPPSNNTSNTSPPRLRTLYGSDFFSLNHHLAS--MADQSK  71

Query  787  DSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFY  608
                 +     +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL +YGKIEGKNVFY
Sbjct  72   RDIHTQPVVVSSRWNPTPEQLRTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFY  131

Query  607  WFQNHKARERQKQKR  563
            WFQNHKARERQK++R
Sbjct  132  WFQNHKARERQKRRR  146



>gb|KCW84062.1| hypothetical protein EUGRSUZ_B00945 [Eucalyptus grandis]
Length=367

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 82/133 (62%), Gaps = 12/133 (9%)
 Frame = -3

Query  937  SLGCKRFRPLAPK--------LGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDS  782
            S   ++ RPL P+         GG +AA   +S    A D+ +     ++      + +S
Sbjct  14   SFNGRKLRPLMPRPVTNPSPNNGGTNAAPPCLSRIHGA-DILALNHHLATMAEQKREFNS  72

Query  781  PQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWF  602
            PQ       +RWNPT EQ+  LE LYR G RTPNA QI+QITAQL +YGKIEGKNVFYWF
Sbjct  73   PQVVV---SSRWNPTPEQLRTLEELYRRGTRTPNADQIQQITAQLRRYGKIEGKNVFYWF  129

Query  601  QNHKARERQKQKR  563
            QNHKARERQK++R
Sbjct  130  QNHKARERQKRRR  142



>ref|XP_010033710.1| PREDICTED: WUSCHEL-related homeobox 1 [Eucalyptus grandis]
Length=370

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 82/133 (62%), Gaps = 12/133 (9%)
 Frame = -3

Query  937  SLGCKRFRPL--------APKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDS  782
            S   ++ RPL        +P  GG +AA   +S    A D+ +     ++      + +S
Sbjct  17   SFNGRKLRPLMPRPVTNPSPNNGGTNAAPPCLSRIHGA-DILALNHHLATMAEQKREFNS  75

Query  781  PQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWF  602
            PQ       +RWNPT EQ+  LE LYR G RTPNA QI+QITAQL +YGKIEGKNVFYWF
Sbjct  76   PQVVV---SSRWNPTPEQLRTLEELYRRGTRTPNADQIQQITAQLRRYGKIEGKNVFYWF  132

Query  601  QNHKARERQKQKR  563
            QNHKARERQK++R
Sbjct  133  QNHKARERQKRRR  145



>ref|XP_003566641.2| PREDICTED: putative WUSCHEL-related homeobox 2, partial [Brachypodium 
distachyon]
Length=265

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRW PT EQ+ +LE +YRGG+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+
Sbjct  7    GTTRWCPTAEQLMVLEEMYRGGLRTPNASQIQQITAHLAHYGRIEGKNVFYWFQNHKARD  66

Query  580  RQKQKRNSLGLNH  542
            RQK +R     +H
Sbjct  67   RQKLRRRLCMTHH  79



>ref|XP_010259966.1| PREDICTED: WUSCHEL-related homeobox 3-like [Nelumbo nucifera]
Length=269

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -3

Query  805  SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIE  626
            S D K+   +  +    TRW PT EQI ILE +YRGG+RTPNA QI+QITA L  YGKIE
Sbjct  59   STDSKRKCWKKMSPAASTRWCPTPEQIMILEEMYRGGIRTPNATQIQQITAHLSFYGKIE  118

Query  625  GKNVFYWFQNHKARERQKQKR  563
            GKNVFYWFQNHKARERQK +R
Sbjct  119  GKNVFYWFQNHKARERQKLRR  139



>gb|AAP37133.1| WOX1 protein [Arabidopsis thaliana]
Length=349

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 97/180 (54%), Gaps = 18/180 (10%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPA-FDLKSF-IKPESSPRSPDEKKDSPQAETHPG  758
            G ++ RPL P+L      TAA++      F++    +  E + R        PQ      
Sbjct  16   GGRKLRPLIPRLTS--CPTAAVNTNSDHRFNMAVVTMTAEQNKRELMMLNSEPQHPPVMV  73

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT +Q+ +LE LYR G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARER
Sbjct  74   SSRWNPTPDQLRVLEELYRQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARER  133

Query  577  QKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACS  398
            QK++R    +            + VS+  FD          K  P  ++ +E+ K W CS
Sbjct  134  QKRRRQ---METGHEETVLSTTSLVSNHGFD----------KKDPPGYK-VEQAKNWICS  179



>ref|XP_008240291.1| PREDICTED: WUSCHEL-related homeobox 1 [Prunus mume]
Length=403

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 83/141 (59%), Gaps = 21/141 (15%)
 Frame = -3

Query  937  SLGCKRFRPLAPKL---GGGDAATAAISVTPPAFDLKSFIK-------------PESSPR  806
            S   ++ RPL P+       +A ++  + TPP  +    +               E + R
Sbjct  19   SFNGRKLRPLIPRPLVPSANNATSSVTAATPPCLNRIHGVSHDFFTQYHHLAAMAEQNKR  78

Query  805  SPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIE  626
            S  E  ++PQ       +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL KYGKIE
Sbjct  79   S--EFINTPQVVV---SSRWNPTPEQLRALEELYRRGTRTPSAEQIQHITAQLRKYGKIE  133

Query  625  GKNVFYWFQNHKARERQKQKR  563
            GKNVFYWFQNHKARERQK++R
Sbjct  134  GKNVFYWFQNHKARERQKRRR  154



>ref|NP_188428.3| WUSCHEL-related homeobox 1 [Arabidopsis thaliana]
 sp|Q6X7K0.2|WOX1_ARATH RecName: Full=WUSCHEL-related homeobox 1; AltName: Full=PFS2-like 
protein [Arabidopsis thaliana]
 dbj|BAB02721.1| homeodomain transcription factor-like protein [Arabidopsis thaliana]
 gb|AEE76034.1| WUSCHEL-related homeobox 1 [Arabidopsis thaliana]
Length=350

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 79/125 (63%), Gaps = 4/125 (3%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPA-FDLKSF-IKPESSPRSPDEKKDSPQAETHPG  758
            G ++ RPL P+L      TAA++      F++    +  E + R        PQ      
Sbjct  16   GGRKLRPLIPRLTS--CPTAAVNTNSDHRFNMAVVTMTAEQNKRELMMLNSEPQHPPVMV  73

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT +Q+ +LE LYR G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARER
Sbjct  74   SSRWNPTPDQLRVLEELYRQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARER  133

Query  577  QKQKR  563
            QK++R
Sbjct  134  QKRRR  138



>ref|NP_001106239.1| putative wuschel homeobox protein [Zea mays]
 emb|CAM32346.1| putative wuschel homeobox protein [Zea mays]
 gb|ACF85189.1| unknown [Zea mays]
 gb|AFW74803.1| putative homeobox DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04437.1| HB transcription factor, partial [Zea mays]
Length=258

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRW PT EQ+ ILE +YRGG+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+
Sbjct  16   GSTRWCPTPEQLMILEDMYRGGLRTPNASQIQQITAHLACYGRIEGKNVFYWFQNHKARD  75

Query  580  RQKQKRNSLGLNH  542
            RQK +R  L ++H
Sbjct  76   RQKMRRR-LCMSH  87



>ref|XP_009410026.1| PREDICTED: WUSCHEL-related homeobox 3B-like [Musa acuminata subsp. 
malaccensis]
Length=193

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             TRW PT EQ+ ILE LYR G+RTP+A QI+QITA L +YG+IEGKNVFYWFQNHKARER
Sbjct  6    STRWCPTPEQLMILEELYRSGVRTPDASQIQQITAHLSRYGRIEGKNVFYWFQNHKARER  65

Query  577  QKQKRNSLGLNH  542
            QK +R  L ++H
Sbjct  66   QKLRRR-LSIHH  76



>dbj|BAJ14108.1| PRESSED FLOWER a [Juncus prismatocarpus subsp. leschenaultii]
Length=199

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             TRW PT EQ+ ILE +YR GMRTPNA QI+QITA L  YGKIEGKNVFYWFQNHKARER
Sbjct  6    STRWCPTPEQVMILEEMYRSGMRTPNAAQIQQITAHLAFYGKIEGKNVFYWFQNHKARER  65

Query  577  QKQKR  563
            QK +R
Sbjct  66   QKLRR  70



>gb|EMT01548.1| Putative WUSCHEL-related homeobox 2 [Aegilops tauschii]
Length=264

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRW PT EQ+ ILE +YRGG+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+
Sbjct  17   GTTRWCPTPEQLMILEEMYRGGLRTPNASQIQQITAHLAHYGRIEGKNVFYWFQNHKARD  76

Query  580  RQKQKRNSLGLNH  542
            RQK +R  L ++H
Sbjct  77   RQKLRRR-LCMSH  88



>gb|EMS65099.1| Putative WUSCHEL-related homeobox 2 [Triticum urartu]
Length=162

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            TRW PT EQ+ ILE +YRGG+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+RQ
Sbjct  7    TRWCPTPEQLMILEEMYRGGLRTPNASQIQQITAHLAHYGRIEGKNVFYWFQNHKARDRQ  66

Query  574  KQKR  563
            K +R
Sbjct  67   KLRR  70



>ref|XP_009135564.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X2 [Brassica 
rapa]
Length=352

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 93/178 (52%), Gaps = 14/178 (8%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHPGGT  752
            G ++ RPL P+L     AT   +       + + +  E + R        PQ       +
Sbjct  16   GGRKLRPLIPRLSSCPTATGNTNSDHRFNMVVTTMTAEQNKRELMMLNSEPQHPPAMVSS  75

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT +Q+  LE LY+ G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARERQK
Sbjct  76   RWNPTPDQLKALEELYQQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQK  135

Query  571  QKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACS  398
            ++R    + +          + VS+  FD        K+  + +    +E  K W CS
Sbjct  136  RRRQ---MENGHDESVVTTTSLVSNQGFD--------KKDSKGYK---VEHTKNWICS  179



>ref|XP_002440499.1| hypothetical protein SORBIDRAFT_09g002010 [Sorghum bicolor]
 gb|EES18929.1| hypothetical protein SORBIDRAFT_09g002010 [Sorghum bicolor]
Length=268

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRW PT EQ+ ILE +YRGG+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+
Sbjct  20   GSTRWCPTPEQLMILEEMYRGGLRTPNASQIQQITAHLACYGRIEGKNVFYWFQNHKARD  79

Query  580  RQKQKRNSLGLNH  542
            RQK +R  L ++H
Sbjct  80   RQKLRRR-LCMSH  91



>emb|CBI16222.3| unnamed protein product [Vitis vinifera]
Length=132

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              +RW PT EQ+ ILE +YRGG+RTPNA QI+QITA L  YGKIEGKNVFYWFQNHKAR+
Sbjct  5    ASSRWCPTPEQLMILEEMYRGGVRTPNASQIQQITAHLSFYGKIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>ref|XP_010487712.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X2 [Camelina 
sativa]
Length=350

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 77/123 (63%), Gaps = 1/123 (1%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHPGGT  752
            G ++ RPL P+L     A+   + +   F++   +  E + R        PQ       +
Sbjct  16   GGRKLRPLIPRLSSCPTASPNTN-SDHRFNMVMTMTAEQNKRELMMLNSEPQHPPVMVSS  74

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT +Q+ +LE LY  G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARERQK
Sbjct  75   RWNPTPDQLRVLEELYGQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQK  134

Query  571  QKR  563
            ++R
Sbjct  135  RRR  137



>ref|XP_009360081.1| PREDICTED: WUSCHEL-related homeobox 1-like [Pyrus x bretschneideri]
Length=377

 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 82/140 (59%), Gaps = 20/140 (14%)
 Frame = -3

Query  937  SLGCKRFRPLAPK-LGGGDAATAAISVTPPAFDLKSF--------------IKPESSPRS  803
            S   ++ RPL P+ L   +   ++   TPP  +  +                  E + RS
Sbjct  19   SFNGRKLRPLVPRPLPSVNNTVSSTITTPPCLNRSAIHGSHDFFPQYHQLAAMAEQNKRS  78

Query  802  PDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEG  623
              E  ++PQ       +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL KYGKIEG
Sbjct  79   --EFLNTPQVVV---SSRWNPTPEQLRALEELYRRGTRTPSAEQIQHITAQLRKYGKIEG  133

Query  622  KNVFYWFQNHKARERQKQKR  563
            KNVFYWFQNHKARERQK++R
Sbjct  134  KNVFYWFQNHKARERQKRRR  153



>ref|XP_009416700.1| PREDICTED: WUSCHEL-related homeobox 3-like [Musa acuminata subsp. 
malaccensis]
Length=189

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             TRW PT EQ+ ILE +YR G+RTPNA QI+QITA+L  YG+IEGKNVFYWFQNHKARER
Sbjct  6    STRWCPTPEQLMILEEMYRSGVRTPNASQIQQITARLSYYGRIEGKNVFYWFQNHKARER  65

Query  577  QKQKR  563
            QK +R
Sbjct  66   QKLRR  70



>dbj|BAJ14111.1| PRESSED FLOWER a [Juncus wallichianus]
Length=199

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             TRW PT EQ+ ILE +YR GMRTPNA QI+QITA L  YGKIEGKNVFYWFQNHKARER
Sbjct  6    STRWCPTPEQVMILEEMYRSGMRTPNAAQIQQITAHLAFYGKIEGKNVFYWFQNHKARER  65

Query  577  QKQKR  563
            QK +R
Sbjct  66   QKLRR  70



>ref|XP_008360925.1| PREDICTED: WUSCHEL-related homeobox 1-like [Malus domestica]
Length=381

 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 82/140 (59%), Gaps = 20/140 (14%)
 Frame = -3

Query  937  SLGCKRFRPLAPK-LGGGDAATAAISVTPPAFDLKSF--------------IKPESSPRS  803
            S   ++ RPL P+ L   +   ++   TPP  +  +                  E + RS
Sbjct  19   SFNGRKLRPLVPRPLPSVNNTVSSTITTPPCLNRSAIHGSHDFFPQYHQLAAMAEQNKRS  78

Query  802  PDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEG  623
              E  ++PQ       +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL KYGKIEG
Sbjct  79   --EFLNTPQVVV---SSRWNPTPEQLRALEELYRRGTRTPSAEQIQHITAQLRKYGKIEG  133

Query  622  KNVFYWFQNHKARERQKQKR  563
            KNVFYWFQNHKARERQK++R
Sbjct  134  KNVFYWFQNHKARERQKRRR  153



>ref|XP_010465874.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X2 [Camelina 
sativa]
Length=349

 Score =   110 bits (276),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 77/123 (63%), Gaps = 1/123 (1%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHPGGT  752
            G ++ RPL P+L     A+   + +   F++   +  E + R        PQ       +
Sbjct  16   GGRKLRPLIPRLSSCPTASPNTN-SDHRFNMVMTMTAEQNKRELMMLNSEPQHPPVMVSS  74

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT +Q+ +LE LY  G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARERQK
Sbjct  75   RWNPTPDQLRVLEELYGQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQK  134

Query  571  QKR  563
            ++R
Sbjct  135  RRR  137



>ref|XP_002531361.1| transcription factor, putative [Ricinus communis]
 gb|EEF31009.1| transcription factor, putative [Ricinus communis]
Length=268

 Score =   109 bits (272),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  766  HPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKA  587
            H   +RWNPT+EQIG+LE +YR G+RTP A+QI+QIT +L  YG IEGKNVFYWFQNHKA
Sbjct  18   HQVNSRWNPTKEQIGLLENMYRQGIRTPTAEQIQQITTRLRDYGHIEGKNVFYWFQNHKA  77

Query  586  RERQKQKRNSLG  551
            R+RQKQK+ ++ 
Sbjct  78   RQRQKQKQENIA  89



>ref|XP_010922362.1| PREDICTED: WUSCHEL-related homeobox 5-like [Elaeis guineensis]
Length=252

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
            G+RWNPT+EQI ILE LYR G+RTP+A+QI+QIT +L +YG IEGKNVFYWFQNHKAR+R
Sbjct  17   GSRWNPTKEQIAILEGLYRQGIRTPSAEQIQQITGKLREYGSIEGKNVFYWFQNHKARQR  76

Query  577  QKQKR  563
            QKQK+
Sbjct  77   QKQKQ  81



>ref|XP_009135563.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X1 [Brassica 
rapa]
 emb|CDY51928.1| BnaAnng11050D [Brassica napus]
Length=353

 Score =   110 bits (275),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 96/180 (53%), Gaps = 17/180 (9%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLK--SFIKPESSPRSPDEKKDSPQAETHPG  758
            G ++ RPL P+L     AT   + +   F++   + +  E + R        PQ      
Sbjct  16   GGRKLRPLIPRLSSCPTATGNTN-SDHRFNMAVVTTMTAEQNKRELMMLNSEPQHPPAMV  74

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT +Q+  LE LY+ G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARER
Sbjct  75   SSRWNPTPDQLKALEELYQQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARER  134

Query  577  QKQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACS  398
            QK++R    + +          + VS+  FD        K+  + +    +E  K W CS
Sbjct  135  QKRRRQ---MENGHDESVVTTTSLVSNQGFD--------KKDSKGYK---VEHTKNWICS  180



>gb|KDP44220.1| hypothetical protein JCGZ_05687 [Jatropha curcas]
Length=237

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            +RWNPT+EQI +LE LYR G+RTP A QI+QITA+L  +G IEGKNVFYWFQNHKAR+RQ
Sbjct  19   SRWNPTKEQISLLEGLYRQGIRTPTADQIQQITARLKAFGHIEGKNVFYWFQNHKARQRQ  78

Query  574  KQKRNSLGLNH  542
            KQK+  +G N+
Sbjct  79   KQKQEIMGYNN  89



>emb|CDP21288.1| unnamed protein product [Coffea canephora]
Length=215

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              TRW PT EQ+ ILE +YRGG+RTPNA QI++ITA L  YGKIEGKNVFYWFQNHKARE
Sbjct  5    NSTRWCPTPEQLMILEEMYRGGIRTPNASQIQRITAHLSFYGKIEGKNVFYWFQNHKARE  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>ref|XP_006341531.1| PREDICTED: WUSCHEL-related homeobox 1-like [Solanum tuberosum]
Length=391

 Score =   110 bits (275),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 78/130 (60%), Gaps = 9/130 (7%)
 Frame = -3

Query  937  SLGCKRFRPLAPKLGGGDAATAAISVTPPA-----FDLKSFIKPESSPRSPDEKKDSPQA  773
            S   ++ RPL P++     ATA    T P      F  ++FI       +  E+      
Sbjct  17   SFNGRKLRPLMPRVPHAPTATA----TNPTNCLRNFHGENFIALNHHQLAMSEQNKRDFN  72

Query  772  ETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNH  593
                  +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL +YGKIEGKNVFYWFQNH
Sbjct  73   TQLVVSSRWNPTPEQLQTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNH  132

Query  592  KARERQKQKR  563
            KARERQK++R
Sbjct  133  KARERQKRRR  142



>ref|XP_002313442.2| hypothetical protein POPTR_0009s03460g [Populus trichocarpa]
 gb|EEE87397.2| hypothetical protein POPTR_0009s03460g [Populus trichocarpa]
Length=246

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            PG +RWNPT+EQI +LE  Y  G+RTP+ + IEQIT++L  YG IEGKNVFYWFQNHKAR
Sbjct  15   PGNSRWNPTKEQISMLESFYSQGIRTPSTEMIEQITSRLKAYGHIEGKNVFYWFQNHKAR  74

Query  583  ERQKQKRNSLG  551
            +RQKQK+ S+ 
Sbjct  75   QRQKQKQESMA  85



>ref|XP_008802781.1| PREDICTED: WUSCHEL-related homeobox 5-like [Phoenix dactylifera]
Length=252

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT+EQI ILE LYR G+RTP+A+QI+QIT +L +YG IEGKNVFYWFQNHKAR+RQK
Sbjct  19   RWNPTKEQIAILEGLYRQGIRTPSAEQIQQITGKLREYGSIEGKNVFYWFQNHKARQRQK  78

Query  571  QKRNSLG  551
            QK+ S  
Sbjct  79   QKQESFA  85



>gb|AHL29312.1| WOX2b [Populus tomentosa]
Length=245

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            PG +RWNPT+EQI +LE  Y  G+RTP+ + IEQIT++L  YG IEGKNVFYWFQNHKAR
Sbjct  15   PGNSRWNPTKEQISMLESFYSQGIRTPSTEMIEQITSRLKAYGHIEGKNVFYWFQNHKAR  74

Query  583  ERQKQKRNSLG  551
            +RQKQK+ S+ 
Sbjct  75   QRQKQKQESMA  85



>ref|XP_011042737.1| PREDICTED: WUSCHEL-related homeobox 2-like [Populus euphratica]
Length=240

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            PG +RWNPT+EQI +LE  Y  G+RTP+ + IEQIT++L  YG IEGKNVFYWFQNHKAR
Sbjct  10   PGNSRWNPTKEQISMLESFYSQGIRTPSTEMIEQITSRLKAYGHIEGKNVFYWFQNHKAR  69

Query  583  ERQKQKRNSLG  551
            +RQKQK+ S+ 
Sbjct  70   QRQKQKQESMA  80



>ref|XP_010686181.1| PREDICTED: WUSCHEL-related homeobox 3-like, partial [Beta vulgaris 
subsp. vulgaris]
Length=202

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              TRW PT EQ+ ILE +YRGG+RTPNA QI+QITA L  YGKIEGKNVFYWFQNHKAR+
Sbjct  5    ASTRWCPTPEQVMILEEMYRGGVRTPNASQIQQITAHLSLYGKIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK ++
Sbjct  65   RQKLRK  70



>ref|XP_010551135.1| PREDICTED: WUSCHEL-related homeobox 1 [Tarenaya hassleriana]
Length=379

 Score =   110 bits (274),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 75/126 (60%), Gaps = 17/126 (13%)
 Frame = -3

Query  940  LSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHP  761
            +S   ++ RPL P+L         +      F L           SP    +S +     
Sbjct  14   MSGAGRKLRPLIPRLSSSSTKPTEV------FSL-----------SPHLGNESKREAVVV  56

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              +RWNPT EQ+ +LE LYR G RTP+A QI+QIT+QL +YGKIEGKNVFYWFQNHKARE
Sbjct  57   SSSRWNPTPEQLRVLEDLYRRGTRTPSADQIQQITSQLRRYGKIEGKNVFYWFQNHKARE  116

Query  580  RQKQKR  563
            RQK++R
Sbjct  117  RQKRRR  122



>ref|XP_002281707.1| PREDICTED: WUSCHEL-related homeobox 3 [Vitis vinifera]
 emb|CAN60351.1| hypothetical protein VITISV_005805 [Vitis vinifera]
Length=208

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              +RW PT EQ+ ILE +YRGG+RTPNA QI+QITA L  YGKIEGKNVFYWFQNHKAR+
Sbjct  5    ASSRWCPTPEQLMILEEMYRGGVRTPNASQIQQITAHLSFYGKIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>gb|EYU33964.1| hypothetical protein MIMGU_mgv1a026259mg [Erythranthe guttata]
Length=326

 Score =   109 bits (272),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 75/117 (64%), Gaps = 4/117 (3%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            TRWNPT EQI  LE LYR G RTP+A+QI+ ITAQL +YGKIEGKNVFYWFQNHKARERQ
Sbjct  81   TRWNPTLEQIQTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHKARERQ  140

Query  574  KQKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWA  404
            K++R    L+H      PP     +  T     ++ +   +     FE +EE K WA
Sbjct  141  KRRRQ---LDHDQVVDEPPTHNYSTQFTHHVQNKESSSPEENGTVIFE-VEESKNWA  193



>ref|XP_009145947.1| PREDICTED: WUSCHEL-related homeobox 1 [Brassica rapa]
Length=351

 Score =   109 bits (273),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 95/178 (53%), Gaps = 14/178 (8%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHPGGT  752
            G ++ RPL P+L    +A A  +       + + +  E + R         Q       +
Sbjct  16   GGRKLRPLIPRLSSCPSAAANTNSDHRFNMVMATMTAEQNKRELMMLNSEHQHPPMMVSS  75

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT +Q+  LE LY+ G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARERQK
Sbjct  76   RWNPTPDQLKALEELYQQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQK  135

Query  571  QKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACS  398
            ++R    + +          + VS+  FD          K  P  ++ +E+ K+W CS
Sbjct  136  RRRQ---MENGHDESVFTTTSLVSNHGFD----------KKYPPGYK-VEQTKKWICS  179



>gb|AFW82793.1| putative homeobox DNA-binding domain superfamily protein [Zea 
mays]
Length=220

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRW PT EQ+ +LE  YRGG+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+
Sbjct  13   GSTRWCPTPEQLMVLEETYRGGLRTPNASQIQQITAHLACYGRIEGKNVFYWFQNHKARD  72

Query  580  RQKQKR  563
            RQK +R
Sbjct  73   RQKLRR  78



>ref|XP_006828230.1| hypothetical protein AMTR_s00023p00181320 [Amborella trichopoda]
 gb|ERM95646.1| hypothetical protein AMTR_s00023p00181320 [Amborella trichopoda]
Length=163

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             TRW PT EQ+ ILE +YRGG+RTPNA QI+ IT  L  YGKIEGKNVFYWFQNHKAR+R
Sbjct  6    STRWCPTAEQLMILEEMYRGGIRTPNALQIQHITTHLSYYGKIEGKNVFYWFQNHKARDR  65

Query  577  QKQKRNSL  554
            QK +R  +
Sbjct  66   QKLRRKMI  73



>ref|XP_010506251.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X1 [Camelina 
sativa]
Length=351

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSF-IKPESSPRSPDEKKDSPQAETHPGG  755
            G ++ RPL P+L     A+   + +   F++    +K E + R        PQ       
Sbjct  16   GGRKLRPLIPRLSSCPTASPNTN-SDHRFNMAVMTMKAEQNKRELMMLNSEPQHPPVMVS  74

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            +RWNPT +Q+ +LE LY  G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARERQ
Sbjct  75   SRWNPTPDQLRVLEELYGQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQ  134

Query  574  KQKR  563
            K++R
Sbjct  135  KRRR  138



>ref|XP_008776170.1| PREDICTED: WUSCHEL-related homeobox 3B-like [Phoenix dactylifera]
Length=205

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             TRW PT EQ+ ILE +YR G+RTPNA QI+QITA L  YGKIEGKNVFYWFQNHKARER
Sbjct  6    STRWCPTPEQLMILEEMYRSGVRTPNAAQIQQITAHLSYYGKIEGKNVFYWFQNHKARER  65

Query  577  QKQKR  563
            QK +R
Sbjct  66   QKLRR  70



>ref|XP_010506265.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X3 [Camelina 
sativa]
Length=343

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSF-IKPESSPRSPDEKKDSPQAETHPGG  755
            G ++ RPL P+L     A+   + +   F++    +K E + R        PQ       
Sbjct  16   GGRKLRPLIPRLSSCPTASPNTN-SDHRFNMAVMTMKAEQNKRELMMLNSEPQHPPVMVS  74

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            +RWNPT +Q+ +LE LY  G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARERQ
Sbjct  75   SRWNPTPDQLRVLEELYGQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQ  134

Query  574  KQKR  563
            K++R
Sbjct  135  KRRR  138



>ref|XP_009587628.1| PREDICTED: WUSCHEL-related homeobox 1 [Nicotiana tomentosiformis]
Length=383

 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 80/129 (62%), Gaps = 6/129 (5%)
 Frame = -3

Query  937  SLGCKRFRPLAPKLGGGDAATAAISVTPP---AFDLKSFIKPESSPRSPDEK-KDSPQAE  770
            S   ++ RPL P++      TA IS  P    +   ++FI       +  E+ K     +
Sbjct  17   SFNGRKLRPLMPRVP--HLPTANISTNPTCLRSIHGENFIALNHHQLAMSEQNKRDFNTQ  74

Query  769  THPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHK  590
                 +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL +YGKIEGKNVFYWFQNHK
Sbjct  75   QLVVSSRWNPTPEQLQTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHK  134

Query  589  ARERQKQKR  563
            ARERQK++R
Sbjct  135  ARERQKRRR  143



>ref|XP_010046418.1| PREDICTED: WUSCHEL-related homeobox 3-like [Eucalyptus grandis]
Length=165

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              TRW PT EQ+ ILE +YR G+RTPNA  I+QITA L  YGKIEGKNVFYWFQNHKAR+
Sbjct  5    ASTRWCPTPEQLMILEEMYRSGVRTPNAAHIQQITAHLSLYGKIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>ref|XP_009397491.1| PREDICTED: WUSCHEL-related homeobox 3-like [Musa acuminata subsp. 
malaccensis]
Length=184

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            TRW PT EQ+ ILE +YR G+RTPNA QI+QITA L  YGKIEGKNVFYWFQNHKARERQ
Sbjct  8    TRWCPTPEQLMILEEMYRSGVRTPNASQIQQITAHLSLYGKIEGKNVFYWFQNHKARERQ  67

Query  574  KQKRNSLGLNH  542
            K +R  LG  H
Sbjct  68   KLRRR-LGWQH  77



>ref|XP_008364689.1| PREDICTED: WUSCHEL-related homeobox 1-like [Malus domestica]
Length=380

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 80/139 (58%), Gaps = 19/139 (14%)
 Frame = -3

Query  937  SLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFI--------------KPESSPRSP  800
            S   ++ R L P+       T++   TPP  +  +                  E + RS 
Sbjct  19   SFNGRKLRTLIPRSLPSVNNTSSTITTPPCLNRSAIYGSHDFLTQYHQLAAMAEXNKRS-  77

Query  799  DEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGK  620
             E  ++PQ       +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL KYGKIEGK
Sbjct  78   -EFLNTPQVVV---SSRWNPTPEQLRALEELYRRGTRTPSAEQIQHITAQLRKYGKIEGK  133

Query  619  NVFYWFQNHKARERQKQKR  563
            NVFYWFQNHKARERQK++R
Sbjct  134  NVFYWFQNHKARERQKRRR  152



>emb|CDY66658.1| BnaCnng51820D [Brassica napus]
Length=351

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 94/178 (53%), Gaps = 14/178 (8%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHPGGT  752
            G ++ RPL P+L    +A A  +       + + +  E + R         Q       +
Sbjct  16   GGRKLRPLIPRLSSCPSAAANTNSDHRFNMVMTTMTAEQNKRELMMLNSEHQHPPMMVSS  75

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT +Q+  LE LY+ G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARERQK
Sbjct  76   RWNPTPDQLKALEELYQQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQK  135

Query  571  QKRNSLGLNHSprtpppppitTVSSLTFDPWGEDIACKRKCRPWAFECLEEEKRWACS  398
            ++R    + +          + VS+  FD          K  P  ++ +E+ K W CS
Sbjct  136  RRRQ---MENGHDESVFTTTSLVSNHGFD----------KKYPPGYK-VEQTKNWICS  179



>ref|XP_003623058.1| WUSCHEL-related homeobox 3B [Medicago truncatula]
 gb|AES79276.1| wuschel-related homeobox protein [Medicago truncatula]
Length=206

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            PG +RW+PT EQ+ ILE LYR G+RTP+A QI+QIT  L  YG+IEGKNVFYWFQNHKAR
Sbjct  4    PGSSRWSPTTEQLMILEELYRSGIRTPSAVQIQQITTHLSFYGRIEGKNVFYWFQNHKAR  63

Query  583  ERQKQKR  563
            +RQK +R
Sbjct  64   DRQKLRR  70



>ref|XP_008374987.1| PREDICTED: WUSCHEL-related homeobox 1 [Malus domestica]
Length=380

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 80/139 (58%), Gaps = 19/139 (14%)
 Frame = -3

Query  937  SLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFI--------------KPESSPRSP  800
            S   ++ R L P+       T++   TPP  +  +                  E + RS 
Sbjct  19   SFNGRKLRTLIPRSLPSVNNTSSTITTPPCLNRSAIYGSHDFLTQYHQLAAMAEQNKRS-  77

Query  799  DEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGK  620
             E  ++PQ       +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL KYGKIEGK
Sbjct  78   -EFLNTPQVVV---SSRWNPTPEQLRALEELYRRGTRTPSAEQIQHITAQLRKYGKIEGK  133

Query  619  NVFYWFQNHKARERQKQKR  563
            NVFYWFQNHKARERQK++R
Sbjct  134  NVFYWFQNHKARERQKRRR  152



>gb|AIR72306.1| LOOSE-FLOWER [Medicago truncatula]
Length=204

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            PG +RW+PT EQ+ ILE LYR G+RTP+A QI+QIT  L  YG+IEGKNVFYWFQNHKAR
Sbjct  4    PGSSRWSPTTEQLMILEELYRSGIRTPSAVQIQQITTHLSFYGRIEGKNVFYWFQNHKAR  63

Query  583  ERQKQKR  563
            +RQK +R
Sbjct  64   DRQKLRR  70



>ref|XP_004173565.1| PREDICTED: WUSCHEL-related homeobox 1-like, partial [Cucumis 
sativus]
Length=193

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -3

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT EQ+ +LE LYR G RTP+A QI+ IT+QL +YGKIEGKNVFYWFQNHKARERQK
Sbjct  81   RWNPTPEQLRVLEELYRRGTRTPSADQIQHITSQLRRYGKIEGKNVFYWFQNHKARERQK  140

Query  571  QKR  563
            ++R
Sbjct  141  RRR  143



>ref|XP_009758504.1| PREDICTED: WUSCHEL-related homeobox 2 [Nicotiana sylvestris]
Length=246

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            P G+RWNPT+EQI +LE +YR G+RTP+A+QI+QIT +L  +G IEGKNVFYWFQNHKAR
Sbjct  16   PVGSRWNPTKEQIDLLESIYRQGIRTPSAEQIQQITLRLRAFGHIEGKNVFYWFQNHKAR  75

Query  583  ERQKQKRNSLG  551
            +RQKQK++   
Sbjct  76   QRQKQKQDKFA  86



>ref|XP_003631107.1| WUSCHEL-related homeobox [Medicago truncatula]
 gb|AET05583.1| stenofolia-like protein [Medicago truncatula]
Length=358

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = -3

Query  820  ESSPRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGK  641
            + S RS     ++P A      +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL K
Sbjct  74   DHSKRSELNNNNNPSAAV-VVSSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRK  132

Query  640  YGKIEGKNVFYWFQNHKARERQKQKR  563
            +GKIEGKNVFYWFQNHKARERQK++R
Sbjct  133  FGKIEGKNVFYWFQNHKARERQKRRR  158



>gb|AFQ69082.1| LATHYROIDES [Pisum sativum]
Length=373

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = -3

Query  925  KRFRPLAPKLGGGDAATAAISV-TPPAFDL-----KSFIKPESSPRSPDEKK----DSPQ  776
            ++ RPL PK     +    IS  T P+ +        F +  +  +  D+ K    ++P 
Sbjct  23   RKLRPLIPKPLTSSSPNNNISTSTTPSLNRIHGSNDFFSQYHNLHQVGDQSKRPEMNNPA  82

Query  775  AETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQN  596
            A      +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL ++GKIEGKNVFYWFQN
Sbjct  83   AAAVVVSSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQN  142

Query  595  HKARERQKQKR  563
            HKARERQK++R
Sbjct  143  HKARERQKRRR  153



>ref|XP_008656542.1| PREDICTED: putative WUSCHEL-related homeobox 2 [Zea mays]
Length=245

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRW PT EQ+ +LE  YRGG+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+
Sbjct  13   GSTRWCPTPEQLMVLEETYRGGLRTPNASQIQQITAHLACYGRIEGKNVFYWFQNHKARD  72

Query  580  RQKQKR  563
            RQK +R
Sbjct  73   RQKLRR  78



>ref|XP_008783634.1| PREDICTED: WUSCHEL-related homeobox 3B-like [Phoenix dactylifera]
Length=192

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             TRW PT EQ+ ILE +YR G+RTPNA QI+QITA L  YGKIEGKNVFYWFQNHKAR+R
Sbjct  6    STRWCPTPEQLMILEEMYRSGVRTPNAAQIQQITAHLSYYGKIEGKNVFYWFQNHKARDR  65

Query  577  QKQKR  563
            QK +R
Sbjct  66   QKLRR  70



>ref|XP_004960326.1| PREDICTED: putative WUSCHEL-related homeobox 2-like [Setaria 
italica]
Length=273

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRW PT EQ+ ILE +YRGG+RTP+A QI+QITA L  YG+IEGKNVFYWFQNHKAR+
Sbjct  22   GSTRWCPTPEQLMILEEMYRGGLRTPSASQIQQITAHLACYGRIEGKNVFYWFQNHKARD  81

Query  580  RQKQKRNSLGLNH  542
            RQK +R  L ++H
Sbjct  82   RQKLRRR-LCMSH  93



>gb|ACA64094.1| WOX2 [Petunia x hybrida]
Length=256

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            P G+RWNPT+EQI +LE LYR G+RTP+A+QI+QIT +L  +G IEGKNVFYWFQNHKAR
Sbjct  15   PTGSRWNPTKEQIDLLESLYRQGIRTPSAEQIQQITGRLRAFGHIEGKNVFYWFQNHKAR  74

Query  583  ERQKQKRN  560
            +RQKQK++
Sbjct  75   QRQKQKQD  82



>ref|XP_009356043.1| PREDICTED: WUSCHEL-related homeobox 1 [Pyrus x bretschneideri]
Length=382

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 80/139 (58%), Gaps = 19/139 (14%)
 Frame = -3

Query  937  SLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSF--------------IKPESSPRSP  800
            S   ++ R L P+       T++   TPP  +  +                  E + RS 
Sbjct  19   SFNGRKLRTLIPRQLPSVNNTSSTITTPPCLNRSAIHGSHDFLTQYHQLAAMAEQNKRS-  77

Query  799  DEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGK  620
             E  ++PQ       +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL KYGKIEGK
Sbjct  78   -EFLNTPQVVV---SSRWNPTPEQLRALEELYRRGTRTPSAEQIQHITAQLRKYGKIEGK  133

Query  619  NVFYWFQNHKARERQKQKR  563
            NVFYWFQNHKARERQK++R
Sbjct  134  NVFYWFQNHKARERQKRRR  152



>ref|XP_002532820.1| hypothetical protein RCOM_1264090 [Ricinus communis]
 gb|EEF29577.1| hypothetical protein RCOM_1264090 [Ricinus communis]
Length=163

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              +RW PT EQ+ ILE LYR G+RTPNA QI++ITA L  YGKIEGKNVFYWFQNHKAR+
Sbjct  5    ASSRWCPTPEQLMILEELYRNGIRTPNASQIQRITAHLSLYGKIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>gb|AEL30892.1| STENOFOLIA [Medicago truncatula]
Length=358

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = -3

Query  820  ESSPRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGK  641
            + S RS     ++P A      +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL K
Sbjct  74   DHSKRSELNNNNNPSAAV-VVSSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRK  132

Query  640  YGKIEGKNVFYWFQNHKARERQKQKR  563
            +GKIEGKNVFYWFQNHKARERQK++R
Sbjct  133  FGKIEGKNVFYWFQNHKARERQKRRR  158



>emb|CAT02902.2| putative wuschel homeobox protein WOX2 [Ginkgo biloba]
Length=349

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT+EQI +LE LYR G+RTP AQQI+QIT++L  +G IEGKNVFYWFQNHKAR+RQK
Sbjct  49   RWNPTKEQIAVLEGLYRQGIRTPTAQQIQQITSRLRMFGNIEGKNVFYWFQNHKARQRQK  108

Query  571  QKRNSL  554
            QK++++
Sbjct  109  QKQHNI  114



>ref|XP_010909262.1| PREDICTED: WUSCHEL-related homeobox 3-like [Elaeis guineensis]
Length=197

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            TRW PT EQ+ ILE +YR G+RTPNA QI+QITA L  YGKIEGKNVFYWFQNHKARERQ
Sbjct  7    TRWCPTPEQLMILEEMYRSGVRTPNAAQIQQITAHLSYYGKIEGKNVFYWFQNHKARERQ  66

Query  574  KQKR  563
            K +R
Sbjct  67   KLRR  70



>ref|XP_006424705.1| hypothetical protein CICLE_v10030293mg [Citrus clementina]
 gb|ESR37945.1| hypothetical protein CICLE_v10030293mg [Citrus clementina]
Length=208

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRW PT EQ+ ILE +YR G+RTPNA QI+ ITA L  +GKIEGKNVFYWFQNHKARE
Sbjct  5    GSTRWCPTPEQLMILEEMYRSGVRTPNASQIQHITAHLSHFGKIEGKNVFYWFQNHKARE  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>gb|KDO73034.1| hypothetical protein CISIN_1g039144mg [Citrus sinensis]
Length=208

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRW PT EQ+ ILE +YR G+RTPNA QI+ ITA L  +GKIEGKNVFYWFQNHKARE
Sbjct  5    GSTRWCPTPEQLMILEEMYRSGVRTPNASQIQHITAHLSHFGKIEGKNVFYWFQNHKARE  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>ref|XP_006488654.1| PREDICTED: WUSCHEL-related homeobox 3-like [Citrus sinensis]
Length=208

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G TRW PT EQ+ ILE +YR G+RTPNA QI+ ITA L  +GKIEGKNVFYWFQNHKARE
Sbjct  5    GSTRWCPTPEQLMILEEMYRSGVRTPNASQIQHITAHLSHFGKIEGKNVFYWFQNHKARE  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>ref|XP_004235799.1| PREDICTED: WUSCHEL-related homeobox 1 isoform X1 [Solanum lycopersicum]
Length=393

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 78/127 (61%), Gaps = 2/127 (2%)
 Frame = -3

Query  943  SLSLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETH  764
            S S   ++ RPL P++    A TA  +     F  ++FI       +  E+         
Sbjct  15   SDSCNGRKLRPLMPRVP--HAPTANPTNCLRNFHGENFIALNHHQLAMSEQNKRDFNTQL  72

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
               +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL +YGKIEGKNVFYWFQNHKAR
Sbjct  73   VVSSRWNPTPEQLQTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHKAR  132

Query  583  ERQKQKR  563
            ERQK++R
Sbjct  133  ERQKRRR  139



>ref|XP_009388641.1| PREDICTED: WUSCHEL-related homeobox 3-like [Musa acuminata subsp. 
malaccensis]
Length=194

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            TRW PT EQ+ ILE +YR G+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKARERQ
Sbjct  7    TRWCPTPEQLMILEEMYRSGVRTPNASQIQQITAHLSLYGRIEGKNVFYWFQNHKARERQ  66

Query  574  KQKRNSLGLNH  542
            K +R  LG  H
Sbjct  67   KLRRR-LGRQH  76



>ref|XP_010922460.1| PREDICTED: WUSCHEL-related homeobox 3B-like [Elaeis guineensis]
Length=191

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             TRW PT EQ+ ILE +YR G+RTPNA QI+QITA L  YGKIEGKNVFYWFQNHKAR+R
Sbjct  6    STRWCPTPEQLMILEEMYRSGVRTPNAAQIQQITAHLSYYGKIEGKNVFYWFQNHKARDR  65

Query  577  QKQKR  563
            QK +R
Sbjct  66   QKLRR  70



>ref|XP_009804164.1| PREDICTED: WUSCHEL-related homeobox 1 [Nicotiana sylvestris]
Length=399

 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 80/129 (62%), Gaps = 6/129 (5%)
 Frame = -3

Query  937  SLGCKRFRPLAPKLGGGDAATAAISVTPP---AFDLKSFIKPESSPRSPDEK-KDSPQAE  770
            S   ++ RPL P++      TA IS  P    +   ++F+       +  E+ K     +
Sbjct  17   SFNGRKLRPLMPRVP--HLPTANISTNPTCLRSIHGENFVALNHHQLAMSEQNKRDFNTQ  74

Query  769  THPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHK  590
                 +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL +YGKIEGKNVFYWFQNHK
Sbjct  75   QLVVSSRWNPTPEQLQTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHK  134

Query  589  ARERQKQKR  563
            ARERQK++R
Sbjct  135  ARERQKRRR  143



>emb|CDP08964.1| unnamed protein product [Coffea canephora]
Length=215

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              TRW PT E + ILE +YRGG+RTPNA QI++ITA L  YGKIEGKNVFYWFQNHKARE
Sbjct  5    NSTRWCPTPEHLMILEEMYRGGIRTPNASQIQKITAHLSFYGKIEGKNVFYWFQNHKARE  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>ref|XP_009412983.1| PREDICTED: WUSCHEL-related homeobox 3B-like [Musa acuminata subsp. 
malaccensis]
Length=216

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RW PT EQ+ ILE +YR G+RTP+AQQI+Q+TA L  YG+IEGKNVFYWFQNHKARER
Sbjct  35   SSRWCPTPEQLMILEEMYRSGVRTPSAQQIQQVTAHLSNYGRIEGKNVFYWFQNHKARER  94

Query  577  QKQKR  563
            QK +R
Sbjct  95   QKLRR  99



>ref|XP_006846122.1| hypothetical protein AMTR_s00012p00149750 [Amborella trichopoda]
 gb|ERN07797.1| hypothetical protein AMTR_s00012p00149750 [Amborella trichopoda]
Length=235

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -3

Query  796  EKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKN  617
            E    P   T    +RWNPT+EQI +LE LYR G+RTP A+QI+QIT +L  YG IEGKN
Sbjct  13   EANGPPSPGTAAVSSRWNPTKEQIEVLEGLYRQGIRTPTAEQIQQITRRLRVYGHIEGKN  72

Query  616  VFYWFQNHKARERQKQKRNSL  554
            VFYWFQNHKAR+RQKQ+++SL
Sbjct  73   VFYWFQNHKARQRQKQRQDSL  93



>emb|CDX92182.1| BnaA05g22250D [Brassica napus]
Length=351

 Score =   108 bits (269),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 75/123 (61%), Gaps = 0/123 (0%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDEKKDSPQAETHPGGT  752
            G ++ RPL P+L    +A A  +       + + +  E + R         Q       +
Sbjct  16   GGRKLRPLIPRLSSCPSAAANTNSDHRFNMVMTTLTAEQNKRELMMLNSEHQHPPMMVSS  75

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT +Q+  LE LY+ G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARERQK
Sbjct  76   RWNPTPDQLKALEELYQQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQK  135

Query  571  QKR  563
            ++R
Sbjct  136  RRR  138



>gb|AEL30893.1| STENOFOLIA 1 [Nicotiana sylvestris]
Length=399

 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 80/129 (62%), Gaps = 6/129 (5%)
 Frame = -3

Query  937  SLGCKRFRPLAPKLGGGDAATAAISVTPP---AFDLKSFIKPESSPRSPDEK-KDSPQAE  770
            S   ++ RPL P++      TA IS  P    +   ++F+       +  E+ K     +
Sbjct  17   SFNGRKLRPLMPRVP--HLPTANISTNPTCLRSIHGENFVALNHHQLAMSEQNKRDFNTQ  74

Query  769  THPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHK  590
                 +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL +YGKIEGKNVFYWFQNHK
Sbjct  75   QLVVSSRWNPTPEQLQTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHK  134

Query  589  ARERQKQKR  563
            ARERQK++R
Sbjct  135  ARERQKRRR  143



>ref|XP_008453687.1| PREDICTED: WUSCHEL-related homeobox 1 [Cucumis melo]
Length=200

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            +RWNPT EQ+ ILE LYR G RTP+A QI+ ITAQL ++GKIEGKNVFYWFQNHKARERQ
Sbjct  92   SRWNPTVEQLRILEELYRRGTRTPSADQIQHITAQLRRFGKIEGKNVFYWFQNHKARERQ  151

Query  574  KQKRNS  557
            K++R +
Sbjct  152  KRRRQT  157



>ref|XP_002281161.1| PREDICTED: WUSCHEL-related homeobox 2 [Vitis vinifera]
Length=236

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            P  +RWNPT+EQI +LE LY  G+RTP+A+QI+QIT +L  YG IEGKNVFYWFQNHKAR
Sbjct  11   PASSRWNPTKEQISMLESLYMQGIRTPSAEQIQQITGRLKAYGHIEGKNVFYWFQNHKAR  70

Query  583  ERQKQKRNSL  554
            +RQKQK+ ++
Sbjct  71   QRQKQKQENM  80



>gb|KCW85646.1| hypothetical protein EUGRSUZ_B02435 [Eucalyptus grandis]
Length=231

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              TRW PT EQ+ ILE +YR G+RTPNA  I+QITA L  YGKIEGKNVFYWFQNHKAR+
Sbjct  5    ASTRWCPTPEQLMILEEMYRSGVRTPNAAHIQQITAHLSLYGKIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>gb|AGQ04538.1| WUS, partial [Oryza punctata]
 gb|AGQ04539.1| WUS, partial [Oryza officinalis]
Length=141

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRG-GMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKA  587
            P GTRW PT EQI IL  LY G G+R+PN++QI++I A L +YG+IEGKNVFYWFQNHKA
Sbjct  7    PSGTRWTPTTEQIKILRELYYGCGIRSPNSEQIQRIAAMLRQYGRIEGKNVFYWFQNHKA  66

Query  586  RERQKQKRNSLGLNHS  539
            RERQK++  +L +  +
Sbjct  67   RERQKKRLTTLDVTTT  82



>ref|XP_006602580.1| PREDICTED: WUSCHEL-related homeobox 3-like [Glycine max]
Length=210

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G +RW+PT EQ+ ILE LYR G+RTP+A QI+QIT  L  YG+IEGKNVFYWFQNHKAR+
Sbjct  5    GSSRWSPTTEQLMILEELYRSGIRTPSASQIQQITTHLSFYGRIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>ref|XP_010487711.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X1 [Camelina 
sativa]
Length=351

 Score =   107 bits (268),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 77/124 (62%), Gaps = 2/124 (2%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSF-IKPESSPRSPDEKKDSPQAETHPGG  755
            G ++ RPL P+L     A+   + +   F++    +  E + R        PQ       
Sbjct  16   GGRKLRPLIPRLSSCPTASPNTN-SDHRFNMAVMTMTAEQNKRELMMLNSEPQHPPVMVS  74

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            +RWNPT +Q+ +LE LY  G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARERQ
Sbjct  75   SRWNPTPDQLRVLEELYGQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQ  134

Query  574  KQKR  563
            K++R
Sbjct  135  KRRR  138



>ref|XP_008224295.1| PREDICTED: WUSCHEL-related homeobox 5 [Prunus mume]
Length=224

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = -3

Query  763  PGGT-RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKA  587
            PG T RWNPT+EQI +LE  YR G+RTP+A+QI+Q+T++L  YG IEGKNVFYWFQNHKA
Sbjct  23   PGSTSRWNPTKEQINMLENFYRQGIRTPSAEQIQQLTSRLRAYGHIEGKNVFYWFQNHKA  82

Query  586  RERQKQKRNSLGL  548
            R+RQKQK+ S+  
Sbjct  83   RQRQKQKQESVAY  95



>gb|KHN16235.1| WUSCHEL-related homeobox 3 [Glycine soja]
Length=210

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G +RW+PT EQ+ ILE LYR G+RTP+A QI+QIT  L  YG+IEGKNVFYWFQNHKAR+
Sbjct  5    GSSRWSPTTEQLMILEELYRSGIRTPSASQIQQITTHLSFYGRIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>dbj|BAJ14112.1| PRESSED FLOWER b [Juncus wallichianus]
Length=190

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            TRW PT EQ+ ILE +YR G+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+RQ
Sbjct  7    TRWCPTPEQLMILEEMYRNGLRTPNAPQIQQITAHLSCYGRIEGKNVFYWFQNHKARDRQ  66

Query  574  KQKR  563
            K +R
Sbjct  67   KMRR  70



>ref|XP_008222596.1| PREDICTED: WUSCHEL-related homeobox 3 [Prunus mume]
Length=229

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              +RW PT EQ+ ILE +YR G+RTPNA QI+ ITAQL  YGKIEGKNVFYWFQNHKAR+
Sbjct  7    SSSRWCPTPEQLMILEEMYRAGIRTPNASQIQHITAQLSLYGKIEGKNVFYWFQNHKARD  66

Query  580  RQKQKR  563
            RQK +R
Sbjct  67   RQKLRR  72



>ref|XP_007140303.1| hypothetical protein PHAVU_008G100800g [Phaseolus vulgaris]
 gb|ESW12297.1| hypothetical protein PHAVU_008G100800g [Phaseolus vulgaris]
Length=203

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G +RW+PT EQ+ ILE LYR G+RTP+A QI+QIT  L  YG+IEGKNVFYWFQNHKAR+
Sbjct  5    GSSRWSPTTEQLMILEELYRSGIRTPSASQIQQITTHLSFYGRIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>ref|XP_010465873.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X1 [Camelina 
sativa]
Length=350

 Score =   107 bits (268),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 77/124 (62%), Gaps = 2/124 (2%)
 Frame = -3

Query  931  GCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSF-IKPESSPRSPDEKKDSPQAETHPGG  755
            G ++ RPL P+L     A+   + +   F++    +  E + R        PQ       
Sbjct  16   GGRKLRPLIPRLSSCPTASPNTN-SDHRFNMAVMTMTAEQNKRELMMLNSEPQHPPVMVS  74

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            +RWNPT +Q+ +LE LY  G RTP+A  I+QITAQL +YGKIEGKNVFYWFQNHKARERQ
Sbjct  75   SRWNPTPDQLRVLEELYGQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQ  134

Query  574  KQKR  563
            K++R
Sbjct  135  KRRR  138



>ref|XP_006350912.1| PREDICTED: WUSCHEL-related homeobox 2-like [Solanum tuberosum]
Length=236

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            P G RWNPT+EQI +LE LY+ G+RTP+A+QI+QIT +L  +G IEGKNVFYWFQNHKAR
Sbjct  17   PVGCRWNPTKEQIDLLESLYKQGIRTPSAEQIQQITGRLRAFGHIEGKNVFYWFQNHKAR  76

Query  583  ERQKQKRNSLG  551
            +RQKQK++   
Sbjct  77   QRQKQKQDKFA  87



>ref|XP_004301251.1| PREDICTED: WUSCHEL-related homeobox 1-like [Fragaria vesca subsp. 
vesca]
Length=393

 Score =   107 bits (268),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 80/140 (57%), Gaps = 12/140 (9%)
 Frame = -3

Query  955  DQVPSLSLGCKRFRPLAPKLGGGDAATAAISV--TPPAF-------DLKSFIKPESSPRS  803
            + +P  +   ++ RPL P+    +    + +    PP F       D  +        R 
Sbjct  13   NMIPDSAFNGRKIRPLVPRTHNNNNNNNSSTSTHVPPCFSRIHAASDFLAQYHQLGEQRG  72

Query  802  PDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEG  623
              E    PQ       +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL ++GKIEG
Sbjct  73   MREFNTVPQVVV---SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEG  129

Query  622  KNVFYWFQNHKARERQKQKR  563
            KNVFYWFQNHKARERQK++R
Sbjct  130  KNVFYWFQNHKARERQKRRR  149



>emb|CAJ84141.1| WOX2 protein [Oryza sativa]
Length=65

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
               RW PT+EQI +LE LYR G+RTP A+QI+QITA+L ++G IEGKNVFYWFQNHKAR+
Sbjct  2    ANARWTPTKEQIAVLEGLYRQGLRTPTAEQIQQITARLREHGHIEGKNVFYWFQNHKARQ  61

Query  580  RQKQ  569
            RQKQ
Sbjct  62   RQKQ  65



>ref|XP_006490833.1| PREDICTED: WUSCHEL-related homeobox 1-like [Citrus sinensis]
Length=190

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 76/131 (58%), Gaps = 12/131 (9%)
 Frame = -3

Query  937  SLGCKRFRPLAPKLGGGDAATAAISVTPPA------FDLKSFIKPESSPRSPDEKKDSPQ  776
            S   ++ RPL P+       T AI+  P        F L   +      ++  E   +P 
Sbjct  12   SFNGRKLRPLIPR---PLPTTTAINNNPSRIHGADFFGLNHHLGSHFGEQNKREFSSTPP  68

Query  775  AETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQN  596
                   +RWNPT EQ+  LE LYR G RTP+A QI+ ITAQL ++GKIEGKNVFYWFQN
Sbjct  69   VVV---SSRWNPTPEQLRTLEDLYRRGTRTPSADQIQHITAQLRRFGKIEGKNVFYWFQN  125

Query  595  HKARERQKQKR  563
            HKARERQK++R
Sbjct  126  HKARERQKRRR  136



>ref|XP_007207641.1| hypothetical protein PRUPE_ppa021063mg [Prunus persica]
 gb|EMJ08840.1| hypothetical protein PRUPE_ppa021063mg [Prunus persica]
Length=263

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = -3

Query  763  PGGT-RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKA  587
            PG T RWNPT+EQI +LE  YR G+RTP+A+QI+Q+T++L  YG IEGKNVFYWFQNHKA
Sbjct  23   PGSTSRWNPTKEQINMLENFYRQGIRTPSAEQIQQLTSRLRAYGHIEGKNVFYWFQNHKA  82

Query  586  RERQKQKRNSL  554
            R+RQKQK+ S+
Sbjct  83   RQRQKQKQESV  93



>ref|XP_010106446.1| WUSCHEL-related homeobox 2 [Morus notabilis]
 gb|EXC10622.1| WUSCHEL-related homeobox 2 [Morus notabilis]
Length=290

 Score =   106 bits (264),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -3

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT+EQI ILE LYR G+RTP+A+QI+QIT++L  +G IEGKNVFYWFQNHKAR+RQK
Sbjct  26   RWNPTKEQINILEGLYRQGIRTPSAEQIKQITSRLRTFGHIEGKNVFYWFQNHKARQRQK  85

Query  571  QKRNSLG  551
            QK+ ++ 
Sbjct  86   QKQENMA  92



>ref|XP_003530958.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform 1 [Glycine 
max]
Length=364

 Score =   107 bits (267),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL ++GKIEGKNVFYWFQNHKARER
Sbjct  81   SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARER  140

Query  577  QKQKR  563
            QK++R
Sbjct  141  QKRRR  145



>ref|XP_010558083.1| PREDICTED: WUSCHEL-related homeobox 5 [Tarenaya hassleriana]
Length=206

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  751  RWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQK  572
            RWNPT EQ+ +L  L+R G+RTP+  QI++I+ QL  YGKIE KNVFYWFQNHKARERQK
Sbjct  33   RWNPTAEQVKVLTDLFRAGLRTPSTDQIQKISTQLSFYGKIESKNVFYWFQNHKARERQK  92

Query  571  QKRNSLGLNH  542
            +++ SL  +H
Sbjct  93   RRKISLDFDH  102



>ref|XP_004242075.2| PREDICTED: WUSCHEL-related homeobox 2 [Solanum lycopersicum]
Length=230

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKAR  584
            P G RWNPT+EQI +LE LY+ G+RTP+A QI+QIT +L  +G IEGKNVFYWFQNHKAR
Sbjct  8    PVGCRWNPTKEQIDLLESLYKQGIRTPSADQIQQITGRLRAFGHIEGKNVFYWFQNHKAR  67

Query  583  ERQKQKRNSLG  551
            +RQKQK++   
Sbjct  68   QRQKQKQDKFA  78



>ref|XP_009353812.1| PREDICTED: WUSCHEL-related homeobox 2 [Pyrus x bretschneideri]
Length=271

 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            +RWNPT+EQI +LE  Y+ G+RTP+A+QI+QIT++L  +G IEGKNVFYWFQNHKAR+RQ
Sbjct  31   SRWNPTKEQIDMLENFYKQGVRTPSAEQIQQITSRLKAFGHIEGKNVFYWFQNHKARQRQ  90

Query  574  KQKRNSLGLN  545
            KQK+ S+  N
Sbjct  91   KQKQESIAYN  100



>sp|A2XZR3.1|WOX2_ORYSI RecName: Full=Putative WUSCHEL-related homeobox 2; AltName: Full=OsWOX2 
[Oryza sativa Indica Group]
 gb|EAY96323.1| hypothetical protein OsI_18225 [Oryza sativa Indica Group]
Length=286

 Score =   106 bits (264),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            TRW PT EQ+ +LE +YRGG+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+RQ
Sbjct  26   TRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQ  85

Query  574  KQKR  563
            K +R
Sbjct  86   KLRR  89



>ref|XP_009354530.1| PREDICTED: WUSCHEL-related homeobox 3-like [Pyrus x bretschneideri]
Length=237

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 2/74 (3%)
 Frame = -3

Query  784  SPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYW  605
            SP A +    +RW PT EQ+ +LE +YR G+RTPNA QI+ ITAQL  YGKIEGKNVFYW
Sbjct  2    SPAANS--SSSRWCPTPEQLMLLEEMYRAGIRTPNASQIQHITAQLSFYGKIEGKNVFYW  59

Query  604  FQNHKARERQKQKR  563
            FQNHKAR+RQK +R
Sbjct  60   FQNHKARDRQKLRR  73



>ref|XP_008385208.1| PREDICTED: WUSCHEL-related homeobox 3-like [Malus domestica]
Length=237

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 2/74 (3%)
 Frame = -3

Query  784  SPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYW  605
            SP A +    +RW PT EQ+ +LE +YR G+RTPNA QI+ ITAQL  YGKIEGKNVFYW
Sbjct  2    SPAANS--SSSRWCPTPEQLMLLEEMYRAGIRTPNASQIQHITAQLSFYGKIEGKNVFYW  59

Query  604  FQNHKARERQKQKR  563
            FQNHKAR+RQK +R
Sbjct  60   FQNHKARDRQKLRR  73



>gb|KDP38065.1| hypothetical protein JCGZ_04708 [Jatropha curcas]
Length=322

 Score =   106 bits (265),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G +RWNPT EQ+  LE +YR G+RTP A+QI+QI AQL ++GKIEGKNVFYWFQNHKARE
Sbjct  57   GSSRWNPTPEQLLALEEMYRRGIRTPTAEQIQQIAAQLSRFGKIEGKNVFYWFQNHKARE  116

Query  580  RQKQKR  563
            RQK++R
Sbjct  117  RQKRRR  122



>gb|EYU24133.1| hypothetical protein MIMGU_mgv1a021220mg [Erythranthe guttata]
Length=353

 Score =   107 bits (266),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL +YGKIEGKNVFYWFQNHKARER
Sbjct  74   SSRWNPTPEQLQTLEELYRRGTRTPSAEQIQQITAQLRRYGKIEGKNVFYWFQNHKARER  133

Query  577  QKQKRN  560
            QK++R+
Sbjct  134  QKRRRH  139



>sp|Q5W7C3.1|WOX2_ORYSJ RecName: Full=Putative WUSCHEL-related homeobox 2; AltName: Full=OsWOX2 
[Oryza sativa Japonica Group]
 gb|AAV44211.1| hypothetical protein [Oryza sativa Japonica Group]
 emb|CAM32354.1| putative wuschel homeobox protein [Oryza sativa]
Length=286

 Score =   105 bits (263),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            TRW PT EQ+ +LE +YRGG+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+RQ
Sbjct  26   TRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQ  85

Query  574  KQKR  563
            K +R
Sbjct  86   KLRR  89



>ref|XP_010918397.1| PREDICTED: WUSCHEL-related homeobox 2-like [Elaeis guineensis]
Length=373

 Score =   107 bits (266),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
            G+RW+PT+EQI +LE  YR GMRTP+A+QI+QIT  L +YG IEGKNVFYWFQNHKAR+R
Sbjct  17   GSRWSPTKEQIAMLEGFYRQGMRTPSAEQIQQITGMLREYGSIEGKNVFYWFQNHKARQR  76

Query  577  QKQKRNSLG  551
            QKQK  S  
Sbjct  77   QKQKEESFA  85



>ref|XP_010318647.1| PREDICTED: WUSCHEL-related homeobox 1 isoform X2 [Solanum lycopersicum]
 ref|XP_010318648.1| PREDICTED: WUSCHEL-related homeobox 1 isoform X2 [Solanum lycopersicum]
Length=334

 Score =   106 bits (265),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL +YGKIEGKNVFYWFQNHKARER
Sbjct  16   SSRWNPTPEQLQTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHKARER  75

Query  577  QKQKR  563
            QK++R
Sbjct  76   QKRRR  80



>emb|CAJ84140.1| NS protein [Oryza sativa]
Length=65

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             TRW PT EQ+ ILE +YR G+RTPNA +I+QITA L  YG+IEGKNVFYWFQNHKARER
Sbjct  3    STRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARER  62

Query  577  QK  572
            Q+
Sbjct  63   QR  64



>ref|XP_008385223.1| PREDICTED: WUSCHEL-related homeobox 2 [Malus domestica]
Length=271

 Score =   105 bits (262),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  754  TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQ  575
            +RWNPT+EQI +LE  Y+ G+RTP+A+QI+QIT+ L  +G IEGKNVFYWFQNHKAR+RQ
Sbjct  31   SRWNPTKEQIDMLENFYKQGVRTPSAEQIQQITSSLKAFGHIEGKNVFYWFQNHKARQRQ  90

Query  574  KQKRNSLGLN  545
            KQK+ S+  N
Sbjct  91   KQKQESIAYN  100



>ref|XP_007160532.1| hypothetical protein PHAVU_002G329500g [Phaseolus vulgaris]
 gb|ESW32526.1| hypothetical protein PHAVU_002G329500g [Phaseolus vulgaris]
Length=359

 Score =   107 bits (266),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL ++GKIEGKNVFYWFQNHKARER
Sbjct  81   SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARER  140

Query  577  QKQKR  563
            QK++R
Sbjct  141  QKRRR  145



>ref|XP_004166032.1| PREDICTED: WUSCHEL-related homeobox 6-like [Cucumis sativus]
 gb|KGN63872.1| hypothetical protein Csa_1G025040 [Cucumis sativus]
Length=334

 Score =   106 bits (265),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              +RWNPT EQ+ ILE LYR G RTP+A QI+ ITAQL ++GKIEGKNVFYWFQNHKARE
Sbjct  89   SSSRWNPTVEQLRILEELYRRGTRTPSADQIQHITAQLRRFGKIEGKNVFYWFQNHKARE  148

Query  580  RQKQKRNS  557
            RQK++R +
Sbjct  149  RQKRRRQT  156



>ref|XP_007208702.1| hypothetical protein PRUPE_ppa019793mg [Prunus persica]
 gb|EMJ09901.1| hypothetical protein PRUPE_ppa019793mg [Prunus persica]
Length=249

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 58/74 (78%), Gaps = 3/74 (4%)
 Frame = -3

Query  784  SPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYW  605
            SP A +    +RW PT EQ+ ILE +YR G+RTPNA QI+ ITAQL  YGKIEGKNVFYW
Sbjct  2    SPAANS---SSRWCPTPEQLMILEEMYRAGIRTPNASQIQHITAQLSLYGKIEGKNVFYW  58

Query  604  FQNHKARERQKQKR  563
            FQNHKAR+RQK +R
Sbjct  59   FQNHKARDRQKLRR  72



>ref|XP_010092997.1| WUSCHEL-related homeobox 3 [Morus notabilis]
 gb|EXB53235.1| WUSCHEL-related homeobox 3 [Morus notabilis]
Length=226

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              +RW PT EQ+ ILE +YR G RTPNA QI+QITA L  YGKIEGKNVFYWFQNHKAR+
Sbjct  6    NSSRWCPTPEQLMILEEMYRAGTRTPNASQIQQITAHLSFYGKIEGKNVFYWFQNHKARD  65

Query  580  RQKQKR  563
            RQK +R
Sbjct  66   RQKLRR  71



>ref|XP_007016457.1| WUSCHEL related homeobox 2, putative [Theobroma cacao]
 gb|EOY34076.1| WUSCHEL related homeobox 2, putative [Theobroma cacao]
Length=259

 Score =   105 bits (262),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G +RWNPT+EQI +LE LY  G+RTP+A QI+QIT++L  YG IEGKNVFYWFQNHKAR+
Sbjct  18   GNSRWNPTKEQISLLESLYMQGIRTPSADQIQQITSRLKVYGTIEGKNVFYWFQNHKARQ  77

Query  580  RQKQKRNSL  554
            RQKQK+ ++
Sbjct  78   RQKQKQENM  86



>gb|AEL30895.1| STENOFOLIA-like 2 protein [Medicago sativa]
Length=383

 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = -3

Query  820  ESSPRSPDEKKDSPQAETHPGGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGK  641
            + S RS     ++P A      +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL +
Sbjct  74   DHSKRSELNNNNNPSAAV-VVSSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRE  132

Query  640  YGKIEGKNVFYWFQNHKARERQKQKR  563
            +GKIEGKNVFYWFQNHKARERQK++R
Sbjct  133  FGKIEGKNVFYWFQNHKARERQKRRR  158



>gb|AGQ04540.1| WUS, partial [Oryza australiensis]
Length=140

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -3

Query  763  PGGTRWNPTQEQIGIL-EMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKA  587
            P GTRW PT EQI IL E+ Y  G+R+PN++QI++I A L +YG+IEGKNVFYWFQNHKA
Sbjct  7    PSGTRWTPTTEQIKILRELYYSCGIRSPNSEQIQRIAAMLRQYGRIEGKNVFYWFQNHKA  66

Query  586  RERQKQKRNSLGLNHS  539
            RERQK++  +L +  +
Sbjct  67   RERQKKRLTTLDVTTT  82



>ref|XP_010474004.1| PREDICTED: WUSCHEL-related homeobox 3-like [Camelina sativa]
Length=211

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              TRW PT EQ+ ILE +YR G+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+
Sbjct  5    ASTRWCPTPEQLMILEEMYRSGIRTPNAVQIQQITAHLAFYGRIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK ++
Sbjct  65   RQKLRK  70



>ref|XP_007132075.1| hypothetical protein PHAVU_011G064900g [Phaseolus vulgaris]
 gb|ESW04069.1| hypothetical protein PHAVU_011G064900g [Phaseolus vulgaris]
Length=263

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              +RWNPT+EQI +LE LY+ G++TP+A++I+QITA+L  YG IEGKNVFYWFQNHKAR+
Sbjct  18   ASSRWNPTKEQISMLENLYKQGIKTPSAEEIQQITARLRAYGHIEGKNVFYWFQNHKARQ  77

Query  580  RQKQKRNSLG  551
            RQKQK+ ++ 
Sbjct  78   RQKQKQETIA  87



>gb|KHN00156.1| WUSCHEL-related homeobox 1 [Glycine soja]
Length=363

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL ++GKIEGKNVFYWFQNHKARER
Sbjct  81   SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARER  140

Query  577  QKQKR  563
            QK++R
Sbjct  141  QKRRR  145



>gb|ACA64093.1| MAEWEST protein [Petunia x hybrida]
Length=376

 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 77/126 (61%), Gaps = 2/126 (2%)
 Frame = -3

Query  937  SLGCKRFRPLAPKLGGGDAATAAISVTPPAFDLKSFIKPESSPRSPDE-KKDSPQAETHP  761
            S   ++ RPL P++     AT++ +    +    +FI          E  K     +   
Sbjct  17   SFNGRKLRPLMPRIPHVPTATSSTNCLR-SIHGDNFIALNHHQLGMSEPNKRDYNTQQLV  75

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              +RWNPT EQ+  LE LYR G RTP+A+QI+ ITAQL +YGKIEGKNVFYWFQNHKARE
Sbjct  76   VSSRWNPTPEQLQTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHKARE  135

Query  580  RQKQKR  563
            RQK++R
Sbjct  136  RQKRRR  141



>ref|XP_002280774.2| PREDICTED: WUSCHEL-related homeobox 1 [Vitis vinifera]
 emb|CBI26893.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 81/139 (58%), Gaps = 9/139 (6%)
 Frame = -3

Query  955  DQVPSLSLGCKRFRPLAPKLGGGD----AATAAISVTPPAFDLKS---FIKPESSPRSPD  797
            D   S S   ++ RPL P+            + ++++P    L     F        + D
Sbjct  11   DLTMSDSFHGRKLRPLVPRPNASVLPKITVNSTVAISPCISHLHGTDLFALNHHLGGTSD  70

Query  796  EKKDSPQAETHP-GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGK  620
            +++ +    T P G +RWNPT EQ+  LE LYR G RTP A+QI+QI AQL  +GKIEGK
Sbjct  71   QQRKT-DFNTQPFGSSRWNPTPEQLQALEELYRRGTRTPTAEQIQQIAAQLRLFGKIEGK  129

Query  619  NVFYWFQNHKARERQKQKR  563
            NVFYWFQNHKARERQK++R
Sbjct  130  NVFYWFQNHKARERQKRRR  148



>emb|CDX95764.1| BnaC03g26450D [Brassica napus]
Length=222

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              TRW PT EQ+ ILE +YR G+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+
Sbjct  5    ASTRWCPTTEQLMILEEMYRTGIRTPNAVQIQQITAHLALYGRIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK ++
Sbjct  65   RQKLRK  70



>ref|XP_003525189.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X1 [Glycine 
max]
 gb|KHN10543.1| WUSCHEL-related homeobox 1 [Glycine soja]
Length=359

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL ++GKIEGKNVFYWFQNHKARER
Sbjct  81   SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARER  140

Query  577  QKQKR  563
            QK++R
Sbjct  141  QKRRR  145



>ref|XP_009133866.1| PREDICTED: WUSCHEL-related homeobox 3-like [Brassica rapa]
 emb|CDX83299.1| BnaA03g22070D [Brassica napus]
Length=226

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
              TRW PT EQ+ ILE +YR G+RTPNA QI+QITA L  YG+IEGKNVFYWFQNHKAR+
Sbjct  5    ASTRWCPTTEQLMILEEMYRTGIRTPNAVQIQQITAHLAFYGRIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK ++
Sbjct  65   RQKLRK  70



>ref|XP_004503282.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X3 [Cicer 
arietinum]
Length=368

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL ++GKIEGKNVFYWFQNHKARER
Sbjct  89   SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARER  148

Query  577  QKQKR  563
            QK++R
Sbjct  149  QKRRR  153



>ref|XP_006580400.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X2 [Glycine 
max]
Length=357

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL ++GKIEGKNVFYWFQNHKARER
Sbjct  79   SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARER  138

Query  577  QKQKR  563
            QK++R
Sbjct  139  QKRRR  143



>ref|XP_006583586.1| PREDICTED: WUSCHEL-related homeobox 3-like [Glycine max]
 gb|KHN40312.1| Putative WUSCHEL-related homeobox 2 [Glycine soja]
Length=210

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -3

Query  760  GGTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARE  581
            G  RW+PT EQ+ ILE LYR G+RTP+A QI+QIT  L  YG+IEGKNVFYWFQNHKAR+
Sbjct  5    GSPRWSPTTEQLMILEELYRSGIRTPSASQIQQITTHLSFYGRIEGKNVFYWFQNHKARD  64

Query  580  RQKQKR  563
            RQK +R
Sbjct  65   RQKLRR  70



>ref|XP_004503283.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X4 [Cicer 
arietinum]
Length=366

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL ++GKIEGKNVFYWFQNHKARER
Sbjct  87   SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARER  146

Query  577  QKQKR  563
            QK++R
Sbjct  147  QKRRR  151



>ref|XP_006580401.1| PREDICTED: WUSCHEL-related homeobox 1-like isoform X3 [Glycine 
max]
Length=355

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  757  GTRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARER  578
             +RWNPT EQ+  LE LYR G RTP+A+QI+QITAQL ++GKIEGKNVFYWFQNHKARER
Sbjct  77   SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARER  136

Query  577  QKQKR  563
            QK++R
Sbjct  137  QKRRR  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5181126621110