BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17199_g2_i1 len=1450 path=[1285:0-582 1284:583-633 1918:634-1449]

Length=1450
                                                                      Score     E

ref|XP_011076489.1|  PREDICTED: WD repeat-containing protein RUP2...    471   5e-160   
ref|XP_006351197.1|  PREDICTED: WD repeat-containing protein RUP2...    468   3e-159   
ref|XP_009628702.1|  PREDICTED: WD repeat-containing protein RUP2       466   6e-158   
ref|XP_004249856.1|  PREDICTED: WD repeat-containing protein RUP2...    464   7e-158   
ref|XP_009781093.1|  PREDICTED: WD repeat-containing protein RUP2       464   7e-157   
ref|XP_006421902.1|  hypothetical protein CICLE_v10005222mg             457   1e-154   
ref|XP_006490375.1|  PREDICTED: WD repeat-containing protein RUP2...    455   5e-154   
gb|EYU25084.1|  hypothetical protein MIMGU_mgv1a008622mg                454   1e-153   
ref|XP_010107434.1|  E3 ubiquitin-protein ligase COP1                   451   3e-152   
ref|XP_011048706.1|  PREDICTED: WD repeat-containing protein RUP2...    444   1e-148   
ref|XP_011030101.1|  PREDICTED: WD repeat-containing protein RUP2       442   1e-148   
ref|XP_007036830.1|  Transducin/WD40 repeat-like superfamily protein    442   2e-148   
ref|XP_011084728.1|  PREDICTED: WD repeat-containing protein RUP2...    442   2e-148   
ref|XP_002318819.2|  hypothetical protein POPTR_0012s13290g             441   5e-148   Populus trichocarpa [western balsam poplar]
gb|KDP22292.1|  hypothetical protein JCGZ_26123                         440   6e-148   
ref|XP_008376565.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    438   9e-147   
ref|XP_004309213.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    436   4e-146   
ref|XP_010255450.1|  PREDICTED: WD repeat-containing protein RUP2       437   5e-146   
ref|XP_009340009.1|  PREDICTED: WD repeat-containing protein RUP2...    435   9e-146   
ref|XP_009371342.1|  PREDICTED: WD repeat-containing protein RUP2       435   1e-145   
ref|XP_008377410.1|  PREDICTED: WD repeat-containing protein RUP2...    432   1e-144   
ref|XP_002267663.1|  PREDICTED: WD repeat-containing protein RUP2...    431   2e-144   Vitis vinifera
ref|XP_008234259.1|  PREDICTED: WD repeat-containing protein RUP2       428   3e-143   
ref|XP_002528808.1|  ubiquitin ligase protein cop1, putative            429   4e-143   Ricinus communis
ref|XP_010273115.1|  PREDICTED: WD repeat-containing protein RUP2...    429   6e-143   
ref|XP_010038432.1|  PREDICTED: WD repeat-containing protein RUP2       427   2e-142   
gb|KCW46417.1|  hypothetical protein EUGRSUZ_K00249                     429   2e-141   
ref|XP_007219483.1|  hypothetical protein PRUPE_ppa022067mg             417   4e-139   
ref|XP_002321910.2|  hypothetical protein POPTR_0015s13210g             416   1e-138   Populus trichocarpa [western balsam poplar]
ref|XP_002267709.1|  PREDICTED: WD repeat-containing protein RUP2...    412   9e-137   Vitis vinifera
ref|XP_004165765.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    406   1e-134   
gb|KGN60479.1|  Ubiquitin ligase protein cop1                           405   2e-134   
ref|XP_004148378.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    404   1e-133   
gb|EYU19540.1|  hypothetical protein MIMGU_mgv1a007834mg                389   7e-128   
ref|NP_568435.2|  WD repeat-containing protein RUP2                     387   1e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872071.1|  nucleotide binding protein                         387   2e-127   
ref|XP_010421182.1|  PREDICTED: WD repeat-containing protein RUP2       385   2e-126   
emb|CDY38909.1|  BnaA03g12700D                                          382   1e-125   
ref|XP_006394637.1|  hypothetical protein EUTSA_v10005519mg             381   5e-125   
gb|KFK27669.1|  hypothetical protein AALP_AA8G413400                    380   1e-124   
ref|XP_010493496.1|  PREDICTED: WD repeat-containing protein RUP2...    380   1e-124   
ref|XP_006287966.1|  hypothetical protein CARUB_v10001208mg             377   1e-123   
emb|CDY32590.1|  BnaC03g15580D                                          374   2e-122   
ref|XP_009132544.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    374   7e-122   
gb|KFK26834.1|  hypothetical protein AALP_AA8G299900                    371   4e-121   
ref|XP_010521333.1|  PREDICTED: WD repeat-containing protein RUP1...    371   7e-121   
emb|CDX87159.1|  BnaC09g04740D                                          370   1e-120   
ref|XP_009141697.1|  PREDICTED: WD repeat-containing protein RUP2       370   2e-120   
emb|CDY16865.1|  BnaA09g05170D                                          369   3e-120   
ref|XP_010456659.1|  PREDICTED: WD repeat-containing protein RUP2...    374   5e-120   
ref|XP_010521332.1|  PREDICTED: WD repeat-containing protein RUP1...    366   4e-118   
ref|XP_010519483.1|  PREDICTED: WD repeat-containing protein RUP2       363   8e-118   
ref|XP_010444626.1|  PREDICTED: WD repeat-containing protein RUP1...    357   2e-115   
ref|NP_200038.1|  UV-B induced transducin protein                       357   2e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482576.1|  PREDICTED: WD repeat-containing protein RUP1       356   5e-115   
gb|EPS69049.1|  hypothetical protein M569_05710                         352   6e-114   
gb|AAM64761.1|  contains similarity to photomorphogenesis repress...    351   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442746.1|  PREDICTED: WD repeat-containing protein RUP1...    350   1e-112   
ref|XP_002864159.1|  hypothetical protein ARALYDRAFT_495294             348   7e-112   
ref|XP_006280618.1|  hypothetical protein CARUB_v10026582mg             343   6e-110   
ref|XP_009418639.1|  PREDICTED: WD repeat-containing protein RUP2...    342   1e-109   
ref|XP_006401846.1|  hypothetical protein EUTSA_v10015606mg             343   1e-109   
ref|XP_008806884.1|  PREDICTED: WD repeat-containing protein RUP2       327   5e-104   
ref|XP_010934729.1|  PREDICTED: WD repeat-containing protein RUP2       323   3e-102   
ref|XP_009396164.1|  PREDICTED: WD repeat-containing protein RUP2...    319   2e-100   
ref|XP_006827710.1|  hypothetical protein AMTR_s00009p00259660          310   1e-96    
gb|AAK64045.1|  unknown protein                                         287   4e-90    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ89763.1|  predicted protein                                      275   2e-83    
gb|AGT16185.1|  hypothetical protein SHCRBa_107_M24_R_260               276   3e-83    
dbj|BAD07933.1|  putative COP1                                          274   5e-83    Oryza sativa Japonica Group [Japonica rice]
gb|EAY84193.1|  hypothetical protein OsI_05571                          274   6e-83    Oryza sativa Indica Group [Indian rice]
ref|XP_003570811.1|  PREDICTED: WD repeat-containing protein RUP2...    263   9e-79    
ref|XP_008645165.1|  PREDICTED: WD repeat-containing protein RUP2...    258   7e-77    
ref|XP_004954763.1|  PREDICTED: WD repeat-containing protein RUP1...    256   1e-75    
ref|XP_008466641.1|  PREDICTED: WD repeat-containing protein RUP2       243   1e-73    
ref|XP_001782967.1|  predicted protein                                  237   2e-68    
ref|XP_001756425.1|  predicted protein                                  226   1e-65    
gb|AGT15884.1|  hypothetical protein SHCRBa_004_O05_R_50                225   2e-64    
ref|XP_002979241.1|  hypothetical protein SELMODRAFT_444188             213   1e-59    
ref|XP_002990312.1|  hypothetical protein SELMODRAFT_447996             211   8e-59    
gb|AAW28081.1|  COP1-like protein                                       177   1e-49    Solanum lycopersicum
emb|CBI22758.3|  unnamed protein product                                176   3e-47    
ref|XP_002970357.1|  hypothetical protein SELMODRAFT_147206             177   7e-46    
dbj|GAM19089.1|  hypothetical protein SAMD00019534_022640               179   2e-45    
ref|XP_002968121.1|  hypothetical protein SELMODRAFT_409247             175   4e-45    
ref|NP_001234047.1|  COP1 homolog                                       177   6e-45    
ref|XP_006351972.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    177   7e-45    
ref|XP_009762651.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    171   9e-45    
ref|XP_010646929.1|  PREDICTED: WD repeat-containing protein RUP2...    165   1e-44    
ref|XP_010688914.1|  PREDICTED: E3 ubiquitin-protein ligase COP1 ...    174   2e-44    
gb|EFA79727.1|  hypothetical protein PPL_07418                          176   2e-44    Polysphondylium pallidum PN500
ref|XP_010688913.1|  PREDICTED: E3 ubiquitin-protein ligase COP1 ...    174   4e-44    
ref|XP_009386714.1|  PREDICTED: WD repeat-containing protein RUP2...    170   5e-44    
gb|AAG31173.1|  COP1                                                    174   7e-44    Ipomoea nil [qian niu]
ref|XP_009767443.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    172   8e-44    
ref|XP_006352383.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    173   9e-44    
ref|XP_009614778.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    172   9e-44    
gb|KHG04242.1|  E3 ubiquitin-protein ligase COP1 -like protein          173   1e-43    
ref|XP_009767442.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    172   1e-43    
ref|XP_009614770.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    172   1e-43    
emb|CDP05681.1|  unnamed protein product                                173   1e-43    
ref|XP_002321154.1|  photoregulatory zinc-finger protein COP1           173   1e-43    Populus trichocarpa [western balsam poplar]
gb|EYU43138.1|  hypothetical protein MIMGU_mgv1a002549mg                172   2e-43    
ref|XP_003284680.1|  hypothetical protein DICPUDRAFT_45662              172   3e-43    
ref|XP_009614766.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    172   3e-43    
ref|XP_009767441.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    172   3e-43    
ref|XP_002271415.1|  PREDICTED: E3 ubiquitin-protein ligase COP1        172   3e-43    Vitis vinifera
emb|CAN71084.1|  hypothetical protein VITISV_028588                     171   5e-43    Vitis vinifera
gb|AHL58685.1|  E3 ubiquitin ligase                                     171   7e-43    
ref|XP_010099137.1|  E3 ubiquitin-protein ligase COP1                   171   8e-43    
ref|XP_007026213.1|  Transducin/WD40 repeat-like superfamily prot...    169   8e-43    
ref|XP_010270052.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    170   1e-42    
emb|CAN77887.1|  hypothetical protein VITISV_020525                     159   1e-42    Vitis vinifera
ref|XP_011007762.1|  PREDICTED: E3 ubiquitin-protein ligase COP1 ...    169   2e-42    
ref|XP_009570712.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   2e-42    
ref|XP_004250243.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    170   2e-42    
ref|XP_006447656.1|  hypothetical protein CICLE_v10014491mg             169   2e-42    
ref|XP_001774722.1|  predicted protein                                  169   2e-42    
gb|KFO30665.1|  E3 ubiquitin-protein ligase RFWD2                       165   2e-42    
ref|XP_009393690.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    169   2e-42    
ref|XP_002534127.1|  ubiquitin ligase protein cop1, putative            169   3e-42    Ricinus communis
ref|XP_001766062.1|  predicted protein                                  169   3e-42    
ref|XP_004165437.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    167   3e-42    
ref|XP_005651066.1|  WD40 repeat-like protein                           168   3e-42    
ref|XP_636746.1|  hypothetical protein DDB_G0288453                     171   3e-42    Dictyostelium discoideum AX4
ref|XP_011007761.1|  PREDICTED: E3 ubiquitin-protein ligase COP1 ...    169   3e-42    
ref|XP_010097907.1|  E3 ubiquitin-protein ligase COP1                   169   3e-42    
ref|XP_009631549.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    167   3e-42    
ref|XP_001772712.1|  predicted protein                                  169   3e-42    
gb|AGU91426.1|  COP1-like protein                                       165   3e-42    
ref|XP_010312734.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    168   4e-42    
ref|XP_009769729.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    167   4e-42    
gb|KEH28314.1|  E3 ubiquitin-protein ligase COP1                        167   5e-42    
ref|XP_007026210.1|  Transducin/WD40 repeat-like superfamily prot...    169   5e-42    
tpg|DAA57803.1|  TPA: hypothetical protein ZEAMMB73_989456              166   5e-42    
ref|XP_001771245.1|  predicted protein                                  168   6e-42    
ref|NP_192849.4|  protein SPA1-related 2                                171   6e-42    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010252572.1|  PREDICTED: E3 ubiquitin-protein ligase COP1        168   7e-42    
ref|XP_006410432.1|  hypothetical protein EUTSA_v10016348mg             167   7e-42    
ref|XP_010435520.1|  PREDICTED: protein SPA1-RELATED 2-like             170   7e-42    
gb|KGN50032.1|  hypothetical protein Csa_5G150990                       170   7e-42    
ref|XP_009769728.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    167   8e-42    
ref|XP_010422049.1|  PREDICTED: protein SPA1-RELATED 2                  170   8e-42    
ref|XP_004143877.1|  PREDICTED: protein SPA1-RELATED 2-like             170   8e-42    
gb|KEH28313.1|  E3 ubiquitin-protein ligase COP1                        167   8e-42    
ref|XP_009143916.1|  PREDICTED: E3 ubiquitin-protein ligase COP1 ...    167   8e-42    
ref|XP_006449823.1|  hypothetical protein CICLE_v10014775mg             167   9e-42    
ref|XP_010455512.1|  PREDICTED: protein SPA1-RELATED 2-like             170   9e-42    
ref|XP_011047015.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    166   9e-42    
ref|XP_005996897.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       167   9e-42    
ref|XP_009919899.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   9e-42    
dbj|BAF01052.1|  COP1 like protein                                      170   1e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872549.1|  hypothetical protein ARALYDRAFT_911432             170   1e-41    
ref|XP_001753935.1|  predicted protein                                  167   1e-41    
ref|XP_004143233.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    167   1e-41    
ref|XP_010541450.1|  PREDICTED: protein SPA1-RELATED 2 isoform X1       169   1e-41    
ref|XP_006348254.1|  PREDICTED: protein SPA1-RELATED 3-like isofo...    169   1e-41    
ref|XP_010541474.1|  PREDICTED: protein SPA1-RELATED 2 isoform X2       169   1e-41    
gb|KHN38497.1|  E3 ubiquitin-protein ligase COP1                        167   1e-41    
ref|XP_004361449.1|  hypothetical protein DFA_05732                     167   1e-41    
ref|XP_003519446.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    167   1e-41    
ref|XP_010509946.1|  PREDICTED: E3 ubiquitin-protein ligase COP1 ...    166   2e-41    
ref|XP_008805600.1|  PREDICTED: E3 ubiquitin-protein ligase COP1 ...    166   2e-41    
gb|AES99834.2|  E3 ubiquitin-protein ligase COP1                        167   2e-41    
emb|CAB89693.1|  constitutively photomorphogenic 1 protein              167   2e-41    Pisum sativum [garden pea]
gb|KHN44754.1|  E3 ubiquitin-protein ligase COP1                        167   2e-41    
ref|XP_003545597.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    167   2e-41    
ref|XP_007141658.1|  hypothetical protein PHAVU_008G214400g             167   2e-41    
gb|EMS63367.1|  E3 ubiquitin-protein ligase COP1                        166   2e-41    
ref|XP_006293448.1|  hypothetical protein CARUB_v10022726mg             167   2e-41    
ref|XP_009143915.1|  PREDICTED: E3 ubiquitin-protein ligase COP1 ...    166   2e-41    
ref|XP_010578948.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       165   2e-41    
emb|CDY52540.1|  BnaA05g34990D                                          166   2e-41    
ref|XP_008456402.1|  PREDICTED: E3 ubiquitin-protein ligase COP1 ...    166   2e-41    
ref|XP_009769726.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    167   2e-41    
ref|XP_009769727.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    166   2e-41    
gb|AEE81754.1|  constitutively photomorphogenic 1                       166   2e-41    
ref|XP_001690267.1|  predicted protein                                  160   2e-41    Chlamydomonas reinhardtii
ref|XP_004491092.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    166   2e-41    
ref|XP_006286352.1|  hypothetical protein CARUB_v10000091mg             169   2e-41    
emb|CDQ70546.1|  unnamed protein product                                166   2e-41    
ref|XP_006711552.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   3e-41    
ref|XP_004658824.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   3e-41    
ref|XP_006410433.1|  hypothetical protein EUTSA_v10016348mg             166   3e-41    
ref|XP_006496924.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   3e-41    
dbj|BAK06015.1|  predicted protein                                      166   3e-41    
ref|XP_011047014.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    166   4e-41    
ref|XP_007049189.1|  Transducin/WD40 repeat-like superfamily prot...    164   4e-41    
gb|KDP30815.1|  hypothetical protein JCGZ_13758                         166   4e-41    
gb|AFW73661.1|  ubiquitin ligase protein COP1                           166   4e-41    
ref|XP_010469530.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    165   4e-41    
ref|NP_001020297.1|  E3 ubiquitin-protein ligase RFWD2                  163   4e-41    Rattus norvegicus [brown rat]
ref|XP_010413924.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    165   4e-41    
gb|ADR72985.1|  COP1 protein                                            166   4e-41    
ref|XP_010404622.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    165   4e-41    
ref|XP_010509945.1|  PREDICTED: E3 ubiquitin-protein ligase COP1 ...    166   4e-41    
ref|XP_003616876.1|  E3 ubiquitin-protein ligase COP1                   166   4e-41    
ref|XP_006496923.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   4e-41    
emb|CBI41056.3|  unnamed protein product                                165   4e-41    
ref|XP_010404621.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    165   4e-41    
ref|XP_006859027.1|  hypothetical protein AMTR_s00068p00174010          167   4e-41    
emb|CAQ15481.1|  novel protein similar to vertebrate ring finger ...    166   4e-41    Danio rerio [leopard danio]
ref|XP_008805599.1|  PREDICTED: E3 ubiquitin-protein ligase COP1 ...    166   4e-41    
ref|XP_001759457.1|  predicted protein                                  166   5e-41    
ref|XP_010714112.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    165   5e-41    
ref|XP_003767505.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   5e-41    
ref|XP_009086657.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       165   5e-41    
emb|CDM84202.1|  unnamed protein product                                166   5e-41    
ref|XP_004244232.1|  PREDICTED: protein SPA1-RELATED 4-like             167   5e-41    
ref|XP_009604688.1|  PREDICTED: protein SPA1-RELATED 4-like isofo...    167   5e-41    
ref|XP_009784585.1|  PREDICTED: protein SPA1-RELATED 4-like isofo...    167   5e-41    
ref|XP_007061227.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    165   5e-41    
ref|XP_010714111.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    165   5e-41    
ref|XP_006187343.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   6e-41    
ref|XP_008333059.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       166   6e-41    
ref|XP_006829490.1|  hypothetical protein AMTR_s00074p00101590          165   6e-41    
ref|XP_010487353.1|  PREDICTED: protein SPA1-RELATED 3-like             167   6e-41    
ref|XP_004476732.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   6e-41    
ref|XP_007061226.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   6e-41    
ref|XP_009671007.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   6e-41    
ref|XP_009437065.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   6e-41    
ref|XP_005019367.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       165   6e-41    
ref|XP_008932171.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   6e-41    
ref|XP_005490281.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   6e-41    
ref|NP_001273573.1|  E3 ubiquitin-protein ligase RFWD2 isoform c ...    163   7e-41    
ref|XP_007901206.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       165   7e-41    
ref|XP_006406987.1|  hypothetical protein EUTSA_v10020057mg             166   7e-41    
ref|XP_010035503.1|  PREDICTED: E3 ubiquitin-protein ligase COP1        165   7e-41    
ref|NP_001145835.1|  uncharacterized protein LOC100279342               165   7e-41    Zea mays [maize]
gb|ADL59932.1|  constitutively photomorphogenic 1                       165   7e-41    
ref|XP_008634343.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       165   7e-41    
gb|KFK31097.1|  e3 ubiquitin-protein ligase cop1                        165   7e-41    
ref|XP_007451425.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   7e-41    
ref|XP_002270330.2|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    165   7e-41    Vitis vinifera
ref|XP_005429687.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   7e-41    
ref|XP_008493077.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   7e-41    
ref|XP_010226923.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   7e-41    
ref|XP_010365697.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   7e-41    
ref|NP_001016199.1|  ring finger and WD repeat domain 2, E3 ubiqu...    165   7e-41    Xenopus tropicalis [western clawed frog]
gb|KFP90040.1|  E3 ubiquitin-protein ligase RFWD2                       164   7e-41    
ref|XP_006017764.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   8e-41    
ref|XP_004658823.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   8e-41    
ref|XP_008677082.1|  PREDICTED: uncharacterized protein LOC100279...    165   8e-41    
gb|AAK49415.1|AF261992_1  COP1                                          164   8e-41    Oryza sativa Indica Group [Indian rice]
ref|XP_005867753.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       163   8e-41    
emb|CDQ56465.1|  unnamed protein product                                165   8e-41    
ref|NP_180854.1|  E3 ubiquitin-protein ligase COP1                      165   8e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007667111.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   8e-41    
ref|XP_005501212.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   9e-41    
ref|XP_006139401.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   9e-41    
ref|XP_005071388.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   9e-41    
ref|XP_010413925.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    164   9e-41    
ref|XP_008520323.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   9e-41    
ref|XP_010469527.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    164   9e-41    
ref|XP_006139402.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   9e-41    
ref|XP_005528810.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   9e-41    
ref|XP_007945277.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   1e-40    
ref|XP_010865366.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    165   1e-40    
ref|XP_005319831.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   1e-40    
ref|XP_010865365.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    165   1e-40    
ref|XP_009640982.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   1e-40    
ref|XP_004954056.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    164   1e-40    
sp|P93471.1|COP1_PEA  RecName: Full=E3 ubiquitin-protein ligase C...    164   1e-40    Pisum sativum [garden pea]
ref|XP_006867134.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   1e-40    
ref|XP_008053408.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   1e-40    
ref|XP_007639842.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   1e-40    
ref|XP_005150517.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   1e-40    
ref|XP_002879425.1|  hypothetical protein ARALYDRAFT_902362             164   1e-40    
ref|XP_004688565.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   1e-40    
ref|XP_009193248.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   1e-40    
ref|XP_004145465.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    164   1e-40    
ref|XP_007987593.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   1e-40    
ref|XP_005905582.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   1e-40    
ref|XP_002192026.2|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   1e-40    Taeniopygia guttata
ref|XP_007165426.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   1e-40    
gb|EGV96157.1|  E3 ubiquitin-protein ligase RFWD2                       163   1e-40    
ref|XP_004079103.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   1e-40    
ref|XP_005797106.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   1e-40    
ref|XP_005937052.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   1e-40    
ref|XP_004565139.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   1e-40    
sp|Q9LJR3.1|SPA3_ARATH  RecName: Full=Protein SPA1-RELATED 3            166   1e-40    
ref|XP_005363991.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       163   1e-40    
ref|XP_005737615.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   1e-40    
ref|XP_004565140.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   1e-40    
ref|XP_006187342.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   1e-40    
ref|XP_007667110.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   1e-40    
ref|XP_005304274.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   1e-40    
ref|XP_008164761.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   1e-40    
ref|XP_003453204.2|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   1e-40    
ref|XP_007552569.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   1e-40    
ref|XP_006767091.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    161   2e-40    
gb|EEC74080.1|  hypothetical protein OsI_09100                          164   2e-40    
ref|XP_008277070.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   2e-40    
dbj|BAD16847.1|  putative COP1, constitutive photomorphogenesis 1       164   2e-40    
gb|EPZ32266.1|  hypothetical protein O9G_003410                         167   2e-40    
ref|XP_003078394.1|  COP1-like protein (ISS)                            164   2e-40    
ref|XP_005049943.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   2e-40    
ref|XP_007049187.1|  Transducin/WD40 repeat-like superfamily prot...    164   2e-40    
gb|EAW91002.1|  ring finger and WD repeat domain 2, isoform CRA_d       163   2e-40    
ref|XP_004613874.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       163   2e-40    
emb|CDP04460.1|  unnamed protein product                                163   2e-40    
ref|XP_010741916.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   2e-40    
ref|XP_007667108.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   2e-40    
ref|XP_002963783.1|  hypothetical protein SELMODRAFT_141846             163   2e-40    
ref|XP_001779768.1|  predicted protein                                  164   2e-40    
gb|KGN66833.1|  hypothetical protein Csa_1G699620                       164   2e-40    
dbj|BAB15239.1|  unnamed protein product                                162   2e-40    
ref|XP_006767090.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   2e-40    
ref|XP_004164350.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    164   2e-40    
ref|NP_001152482.1|  ubiquitin ligase protein COP1                      164   2e-40    
gb|ADE77676.1|  unknown                                                 159   2e-40    
ref|XP_006088999.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   2e-40    
ref|XP_004425067.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       163   2e-40    
ref|XP_007165425.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   2e-40    
ref|XP_004688563.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   2e-40    
ref|XP_008675092.1|  PREDICTED: LOW QUALITY PROTEIN: protein SPA1...    164   2e-40    
ref|XP_005966377.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   2e-40    
ref|XP_006973882.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       164   2e-40    
ref|XP_007117871.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   2e-40    
ref|XP_004688564.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   2e-40    
ref|XP_007117872.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   2e-40    
ref|XP_010848408.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   2e-40    
ref|XP_004013871.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   2e-40    
ref|XP_006942779.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       163   2e-40    
ref|XP_005071387.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   3e-40    
ref|XP_008431140.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    163   3e-40    
ref|XP_006089001.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   3e-40    
ref|XP_006089000.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   3e-40    
ref|XP_007480895.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   3e-40    
ref|XP_006060418.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       163   3e-40    
gb|AAK81856.1|AF394913_1  photoregulatory zinc-finger protein COP1      163   3e-40    
ref|XP_001766701.1|  predicted protein                                  163   3e-40    
ref|XP_005319830.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   3e-40    
ref|XP_005374960.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   3e-40    
ref|XP_004565138.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    164   3e-40    
gb|EAZ24764.1|  hypothetical protein OsJ_08537                          163   3e-40    
ref|XP_005690966.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   3e-40    
gb|AAI61699.1|  LOC100158422 protein                                    163   3e-40    
ref|XP_010913400.1|  PREDICTED: E3 ubiquitin-protein ligase COP1        163   3e-40    
ref|NP_001048254.1|  Os02g0771100                                       163   3e-40    
dbj|BAA94422.1|  COP1                                                   163   3e-40    
gb|EMT21108.1|  hypothetical protein F775_19991                         163   3e-40    
ref|XP_006250175.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   3e-40    
ref|XP_001493699.4|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   3e-40    
ref|XP_004894139.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   3e-40    
ref|XP_007480894.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   3e-40    
ref|XP_011085493.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    162   3e-40    
ref|XP_004706872.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   3e-40    
ref|XP_006250178.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   3e-40    
gb|AAA32772.1|  regulatory protein                                      163   4e-40    
ref|XP_008940814.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       157   4e-40    
ref|XP_010260211.1|  PREDICTED: protein SPA1-RELATED 3-like isofo...    165   4e-40    
ref|XP_006711550.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   4e-40    
ref|XP_006496922.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   4e-40    
ref|XP_006250176.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   4e-40    
ref|XP_006250177.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   4e-40    
ref|XP_003975590.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   4e-40    
ref|NP_036061.1|  E3 ubiquitin-protein ligase RFWD2                     163   4e-40    
ref|XP_010628599.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   4e-40    
ref|XP_010260210.1|  PREDICTED: protein SPA1-RELATED 3-like isofo...    165   4e-40    
ref|XP_009869978.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       163   4e-40    
gb|AHW56569.1|  ring finger and WD repeat domain 2 isoform F            162   4e-40    
ref|XP_009108197.1|  PREDICTED: protein SPA1-RELATED 2                  165   4e-40    
ref|XP_010953332.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   4e-40    
gb|AHW56573.1|  ring finger and WD repeat domain 2 isoform H            162   4e-40    
gb|AAI58003.1|  Ring finger and WD repeat domain 2                      163   4e-40    
ref|XP_005245505.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   4e-40    
ref|XP_010272439.1|  PREDICTED: protein SPA1-RELATED 4-like isofo...    164   4e-40    
ref|XP_004805478.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   4e-40    
ref|XP_010991220.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       163   4e-40    
ref|XP_007525270.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   4e-40    
ref|XP_011098307.1|  PREDICTED: protein SPA1-RELATED 4-like isofo...    162   4e-40    
ref|XP_011085492.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    162   5e-40    
ref|XP_009238948.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       163   5e-40    
gb|AHW56572.1|  ring finger and WD repeat domain 2 isoform B            163   5e-40    
ref|XP_010589292.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   5e-40    
ref|XP_008976599.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    163   5e-40    
ref|XP_005245504.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   5e-40    
ref|XP_010522372.1|  PREDICTED: E3 ubiquitin-protein ligase COP1        162   5e-40    
ref|XP_010589293.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   5e-40    
ref|XP_006634725.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   5e-40    
ref|XP_011086216.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    162   5e-40    
ref|XP_005966376.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   5e-40    
gb|EHH50833.1|  hypothetical protein EGM_01718                          162   5e-40    
ref|NP_071902.2|  E3 ubiquitin-protein ligase RFWD2 isoform a           163   5e-40    
ref|NP_001001740.1|  E3 ubiquitin-protein ligase RFWD2 isoform b        162   5e-40    
ref|XP_004476729.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   5e-40    
ref|XP_002972851.1|  hypothetical protein SELMODRAFT_98534              163   5e-40    
ref|XP_008144251.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   6e-40    
ref|XP_537181.2|  PREDICTED: E3 ubiquitin-protein ligase RFWD2          162   6e-40    
gb|EHH15841.1|  hypothetical protein EGK_01992                          162   6e-40    
ref|XP_010465487.1|  PREDICTED: protein SPA1-RELATED 3                  164   6e-40    
ref|XP_008983213.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   6e-40    
ref|XP_003735239.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   6e-40    
ref|XP_004476728.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   6e-40    
ref|XP_003258975.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   6e-40    
ref|XP_010479848.1|  PREDICTED: protein SPA1-RELATED 4-like isofo...    162   6e-40    
ref|NP_175717.1|  SPA1-related 4 protein                                163   6e-40    
ref|XP_009702858.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   6e-40    
ref|XP_007987592.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   7e-40    
ref|XP_006647974.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    162   7e-40    
ref|XP_010365692.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   7e-40    
ref|NP_001083011.1|  E3 ubiquitin-protein ligase RFWD2                  162   7e-40    
emb|CAB94800.1|  COP1 regulatory protein                                164   7e-40    
ref|XP_002760382.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   7e-40    
ref|XP_009193225.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    161   7e-40    
ref|XP_008983211.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   7e-40    
ref|XP_004245539.1|  PREDICTED: protein SPA1-RELATED 2                  164   7e-40    
ref|XP_003258976.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   7e-40    
ref|XP_009763310.1|  PREDICTED: protein SPA1-RELATED 2 isoform X1       164   7e-40    
ref|XP_008983212.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   7e-40    
ref|XP_004398188.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   7e-40    
ref|XP_008107155.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   7e-40    
ref|XP_006396956.1|  hypothetical protein EUTSA_v10028383mg             164   7e-40    
ref|XP_008262031.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    162   7e-40    
ref|XP_004853448.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   7e-40    
ref|XP_003219915.2|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    163   7e-40    
ref|XP_010365693.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   7e-40    
ref|XP_005217144.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   7e-40    
ref|XP_005217145.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_010365695.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_003785735.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_004398189.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_004372902.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_010365694.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_003893660.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|NP_001253194.1|  E3 ubiquitin-protein ligase RFWD2                  162   8e-40    
tpg|DAA21111.1|  TPA: ring finger and WD repeat domain 2                162   8e-40    
ref|XP_002920790.1|  PREDICTED: e3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_003785734.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_004626837.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_009193212.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_010053168.1|  PREDICTED: protein SPA1-RELATED 2                  164   8e-40    
ref|XP_004269836.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_004269837.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_008824332.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_004626836.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_009193205.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_006867133.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_007945275.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|NP_001096726.1|  E3 ubiquitin-protein ligase RFWD2                  162   8e-40    
ref|XP_002984423.1|  hypothetical protein SELMODRAFT_181056             162   8e-40    
ref|XP_007987591.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   8e-40    
ref|XP_008824331.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   9e-40    
ref|XP_007211377.1|  hypothetical protein PRUPE_ppa002635mg             162   9e-40    
ref|XP_006867132.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   9e-40    
ref|XP_004372903.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   9e-40    
ref|XP_007987586.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   9e-40    
gb|KHG27191.1|  E3 ubiquitin-protein ligase COP1 -like protein          162   9e-40    
ref|XP_007987589.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   9e-40    
ref|XP_005713952.1|  E3 ubiquitin-protein ligase                        162   9e-40    
ref|XP_007945276.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   9e-40    
ref|XP_007987590.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   9e-40    
ref|XP_006296973.1|  hypothetical protein CARUB_v10012967mg             163   9e-40    
ref|XP_010686759.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    161   9e-40    
ref|XP_004300230.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    161   1e-39    
ref|XP_007987588.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   1e-39    
ref|XP_007987584.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   1e-39    
ref|XP_006343887.1|  PREDICTED: protein SPA1-RELATED 2-like isofo...    164   1e-39    
ref|XP_006343889.1|  PREDICTED: protein SPA1-RELATED 2-like isofo...    164   1e-39    
ref|XP_007987585.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   1e-39    
ref|XP_004296508.1|  PREDICTED: protein SPA1-RELATED 3-like             163   1e-39    
ref|XP_006646280.1|  PREDICTED: protein SPA1-RELATED 4-like             161   1e-39    
gb|EHB09017.1|  E3 ubiquitin-protein ligase RFWD2                       162   1e-39    
ref|XP_004762074.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   1e-39    
gb|EAW90999.1|  ring finger and WD repeat domain 2, isoform CRA_a       162   1e-39    
emb|CDY20122.1|  BnaA01g28800D                                          162   1e-39    
gb|KFH67420.1|  hypothetical protein MVEG_06152                         163   1e-39    
ref|XP_008458987.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    161   1e-39    
gb|EYU26380.1|  hypothetical protein MIMGU_mgv1a001366mg                162   1e-39    
ref|XP_009626945.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    160   1e-39    
ref|XP_010334475.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   1e-39    
ref|XP_009146265.1|  PREDICTED: protein SPA1-RELATED 3                  162   2e-39    
ref|XP_005540119.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   2e-39    
gb|AAC35546.1|  contains similarity to WB domains, G-beta repeats...    159   2e-39    
ref|XP_005540118.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    162   2e-39    
ref|XP_005540122.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    161   2e-39    
ref|XP_006887826.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       161   2e-39    
gb|EYU27741.1|  hypothetical protein MIMGU_mgv1a002368mg                161   2e-39    
ref|XP_005540120.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    161   2e-39    
ref|XP_010236060.1|  PREDICTED: E3 ubiquitin-protein ligase COP1        161   2e-39    
ref|XP_010479845.1|  PREDICTED: protein SPA1-RELATED 4-like isofo...    162   2e-39    
ref|XP_009461869.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       160   2e-39    
ref|XP_009626944.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    160   2e-39    
ref|XP_011098304.1|  PREDICTED: protein SPA1-RELATED 4-like isofo...    162   2e-39    
ref|XP_005647782.1|  WD40 repeat-like protein                           154   2e-39    
ref|XP_011098303.1|  PREDICTED: protein SPA1-RELATED 4-like isofo...    162   3e-39    
gb|EPQ08684.1|  E3 ubiquitin-protein ligase RFWD2                       160   3e-39    
ref|XP_006199736.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       161   3e-39    
ref|XP_011098302.1|  PREDICTED: protein SPA1-RELATED 4-like isofo...    162   3e-39    
ref|XP_011000702.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    159   3e-39    
gb|EMS56979.1|  Protein SPA1-RELATED 3                                  160   3e-39    
ref|XP_010138659.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       159   3e-39    
ref|XP_003474683.2|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       162   3e-39    
ref|XP_007084086.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2       161   3e-39    
gb|KFO85013.1|  E3 ubiquitin-protein ligase RFWD2                       159   4e-39    
ref|XP_006392834.1|  hypothetical protein EUTSA_v10011249mg             161   4e-39    
ref|XP_008437378.1|  PREDICTED: protein SPA1-RELATED 2                  162   4e-39    
ref|XP_009626943.1|  PREDICTED: E3 ubiquitin-protein ligase COP1-...    159   5e-39    
gb|KFK31891.1|  ubiquitin ligase protein                                162   5e-39    



>ref|XP_011076489.1| PREDICTED: WD repeat-containing protein RUP2-like [Sesamum indicum]
Length=386

 Score =   471 bits (1212),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 243/387 (63%), Positives = 302/387 (78%), Gaps = 15/387 (4%)
 Frame = +2

Query  68    MKNFSS-SPTSAAETSQTIQ--------QEEDDGEKARCDWDFRISAVVSSPTSAVGAVS  220
             MKNFSS SP    + S T          +E+++ +KARC+WDF +SAV+SS + A    S
Sbjct  1     MKNFSSHSPLQNPQPSTTPLNPETGRGGEEKEEDQKARCEWDFNLSAVISS-SDAGSTPS  59

Query  221   DALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICT  400
             DA+GV+EF+ +D+FLATGGIARKIR+YS+   ++     + G     LDH++AC++YICT
Sbjct  60    DAIGVVEFNQNDSFLATGGIARKIRIYSLEKSLESCQKVETG--VKFLDHAAACEFYICT  117

Query  401   PAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsv  580
             PAKLSS++WKPG  SRV+GSGDYDGVVMEYDLE+RVPVFERDEHGGRRVWS+DYSH D  
Sbjct  118   PAKLSSIKWKPGSGSRVIGSGDYDGVVMEYDLEKRVPVFERDEHGGRRVWSMDYSHWDPT  177

Query  581   vgasgsddgTMQTWDPRCPNGNCLATVQPSK-ARSAVCCVQFSPFA-PSIAAGCADRKTY  754
             +GASGSDDGTMQ WDPRC  G CLA VQP++ ARS VCCV+F+PF  P +A GCADR+ Y
Sbjct  178   IGASGSDDGTMQMWDPRCDGGKCLAVVQPNRVARSPVCCVEFNPFGRPLVAVGCADRRIY  237

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YD+RN   P+ +LDGH +AVTY +FLD RT+++S++DGC+ MWDT+ +  +RTY+GH+N
Sbjct  238   GYDVRNLENPVLLLDGHQQAVTYTKFLDSRTIVSSAIDGCLMMWDTEDQRPIRTYRGHVN  297

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCW  1114
             T RFVGLSVW+NGGL+SCGSENNQVFVYD RWGEPIWV G   A  QP SE GF+S VCW
Sbjct  298   TRRFVGLSVWRNGGLLSCGSENNQVFVYDKRWGEPIWVRGFAPAV-QPRSEPGFVSGVCW  356

Query  1115  MQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
              Q GD+ C LVAGGSDGVL+VF G+R+
Sbjct  357   RQAGDERCMLVAGGSDGVLQVFEGERK  383



>ref|XP_006351197.1| PREDICTED: WD repeat-containing protein RUP2-like [Solanum tuberosum]
Length=370

 Score =   468 bits (1205),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 237/369 (64%), Positives = 291/369 (79%), Gaps = 13/369 (4%)
 Frame = +2

Query  116   TIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIR  295
             +I  ++ + EKARC+WDF +S ++SS  S  G+  D +GVLEFDP  NFLA+GGIARKIR
Sbjct  6     SILHQDQEEEKARCEWDFHLSTIISSCNSLSGSGCDTIGVLEFDPCGNFLASGGIARKIR  65

Query  296   VYSVNSLVDPFWDQDEGSDAVS------LDHSSACDYYICTPAKLSSLRWKPGWNSRVLG  457
             +Y+V SL+    +++EG    S      LDH +ACD+++CTPAKL SL+WKPG   RVLG
Sbjct  66    IYAVKSLLQ---EREEGEKRTSTGAPLALDHGNACDFFMCTPAKLGSLKWKPGLGGRVLG  122

Query  458   SGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRC-  634
             SGDYDGVVMEYDLE+++PVFERDEHGGRRVWS+DY HSD V+GASGSDDGTMQ WDPRC 
Sbjct  123   SGDYDGVVMEYDLEKKMPVFERDEHGGRRVWSIDYCHSDPVLGASGSDDGTMQMWDPRCG  182

Query  635   PNGNCLATVQPSKARSA-VCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHL  808
              NG CLA VQP+K  S  VCCV+F+PF  P +A GCADR+ Y YD+R   +PLFILDGH 
Sbjct  183   DNGKCLAMVQPTKEYSTPVCCVEFNPFKGPIVAVGCADRRVYAYDMRKMVDPLFILDGHQ  242

Query  809   KAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISC  988
             KAVTY RF+D RT+++SS+DGC+KMW+ + + ++RTYKGH N+ RFVGLS+WK GGLI C
Sbjct  243   KAVTYIRFIDERTIISSSIDGCLKMWNAEDQKVLRTYKGHNNSRRFVGLSIWKPGGLICC  302

Query  989   GSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGV  1168
             GSE+NQVFVYD RWGEPIWVYG +   G  G E+GF+SSVCW Q+ ++ CTLVAG SDGV
Sbjct  303   GSESNQVFVYDKRWGEPIWVYG-REPIGLTGIEHGFVSSVCWQQKDENQCTLVAGDSDGV  361

Query  1169  LRVFAGKRR  1195
             LRVF GKRR
Sbjct  362   LRVFNGKRR  370



>ref|XP_009628702.1| PREDICTED: WD repeat-containing protein RUP2 [Nicotiana tomentosiformis]
Length=386

 Score =   466 bits (1198),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 234/349 (67%), Positives = 286/349 (82%), Gaps = 8/349 (2%)
 Frame = +2

Query  161   WDFRISAVVSSP--TSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWD  334
             WDF +S  +S+    S  G+  D LGVLEFDPS NFLA+GGIARKIR+Y+VNSL+    +
Sbjct  42    WDFHLSTFISNSCNNSINGSACDTLGVLEFDPSGNFLASGGIARKIRIYNVNSLLQ---E  98

Query  335   QDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPV  514
             + EG   VSLDH +AC++Y+CTPAKLSSL+WKPGW SRVLGSGDYDGVVMEYDLE+++PV
Sbjct  99    EREGGRLVSLDHGNACNFYMCTPAKLSSLKWKPGWGSRVLGSGDYDGVVMEYDLEKKMPV  158

Query  515   FERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRC-PNGNCLATVQPSKARSAVC  691
             FERDEHGGRRVWS+DY HSD V+GASGSDDGTMQ WDPRC  +G CLA VQPSK  + VC
Sbjct  159   FERDEHGGRRVWSIDYCHSDPVLGASGSDDGTMQMWDPRCGDDGKCLAKVQPSKQCNPVC  218

Query  692   CVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVD  868
             CV+F+PF  P +A GCADR+ Y YD+R   +PLF+LDGH KAVTY RF D RT+++SS+D
Sbjct  219   CVEFNPFKGPIVAVGCADRRVYAYDIRKMTDPLFVLDGHQKAVTYIRFFDERTIVSSSID  278

Query  869   GCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWV  1048
             GC+KMWD ++++++RTYKGH N+ RFVGLSVW+ GGLI CGSE+NQV+VYD RWGEPIWV
Sbjct  279   GCLKMWDAENQHVIRTYKGHDNSRRFVGLSVWRPGGLICCGSESNQVYVYDKRWGEPIWV  338

Query  1049  YGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             YG +  T   G ++GF+SSVCW Q+ ++ CTLVAG SDGVLRVF+GKRR
Sbjct  339   YG-REPTSLTGFDHGFVSSVCWQQKEENRCTLVAGDSDGVLRVFSGKRR  386



>ref|XP_004249856.1| PREDICTED: WD repeat-containing protein RUP2-like [Solanum lycopersicum]
Length=360

 Score =   464 bits (1195),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 234/367 (64%), Positives = 291/367 (79%), Gaps = 12/367 (3%)
 Frame = +2

Query  104   ETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIA  283
             + S  + QEE + EKARC+WDF +S ++SS  +  G+  D +GVLEFDP  NFLA+GGIA
Sbjct  3     DISSILHQEEKE-EKARCEWDFHLSTIISSCNNLSGSGCDTIGVLEFDPCGNFLASGGIA  61

Query  284   RKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSG  463
             RKIR+Y+V S+     ++  G   ++LDHS+ACD++ICTPAKL S++WKPG  SRVLGSG
Sbjct  62    RKIRIYTVKSVQG---ERRIGDAPLALDHSNACDFFICTPAKLGSIKWKPGLGSRVLGSG  118

Query  464   DYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPN-  640
             DYDGVVMEYDLE+++PVFERDEHGGRRVWS+DY  SD V+GASGSDDGTMQ WDPRC + 
Sbjct  119   DYDGVVMEYDLEKKMPVFERDEHGGRRVWSIDYCQSDPVLGASGSDDGTMQMWDPRCGDS  178

Query  641   GNCLATVQPSKARSA-VCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKA  814
             G CLA VQP+K  S  VCCV+F+PF  P +A GCADR+ Y YD+R   +PLF+LDGH KA
Sbjct  179   GKCLAMVQPTKGYSTPVCCVEFNPFKGPIVAVGCADRRVYAYDMRKMLDPLFVLDGHEKA  238

Query  815   VTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGS  994
             VTY RF+D RT+++SS+DGC+KMW+ + + ++RTYKGH N+ RFVGLSVWK GGLI CGS
Sbjct  239   VTYIRFVDERTIISSSIDGCLKMWNAEDQKVLRTYKGHSNSRRFVGLSVWKPGGLICCGS  298

Query  995   ENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLR  1174
             ENNQVFVYD RWGEPIW+YG      +P  E+GF+SSVCW Q+ ++ CTLVAG SDGVLR
Sbjct  299   ENNQVFVYDKRWGEPIWMYG-----REPRHEHGFVSSVCWQQKDENQCTLVAGDSDGVLR  353

Query  1175  VFAGKRR  1195
             VF GKR+
Sbjct  354   VFNGKRK  360



>ref|XP_009781093.1| PREDICTED: WD repeat-containing protein RUP2 [Nicotiana sylvestris]
Length=400

 Score =   464 bits (1193),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 236/356 (66%), Positives = 288/356 (81%), Gaps = 8/356 (2%)
 Frame = +2

Query  149   ARCDWDFRISAVVSSP--TSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVD  322
             ARC+WDF +S  +S+    S  G+  D LGVLEFD S NFLA+GGIARKIR+Y+VNSL+ 
Sbjct  47    ARCEWDFHLSTFISNSCNNSLNGSACDTLGVLEFDASGNFLASGGIARKIRIYNVNSLLQ  106

Query  323   PFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLER  502
                ++ EG   VSLDH +AC++Y+CTPAKLSSL+WKPGW SRV+GSGDYDGVV+EYDLE+
Sbjct  107   ---EEREGGGLVSLDHGNACNFYMCTPAKLSSLKWKPGWGSRVIGSGDYDGVVLEYDLEK  163

Query  503   RVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRC-PNGNCLATVQPSKAR  679
             ++PVFERDEHGGRR+WS+DYSHSD V+GASGSDDGTMQ WDPRC  +G  LA VQPSK  
Sbjct  164   KMPVFERDEHGGRRIWSIDYSHSDPVLGASGSDDGTMQMWDPRCGDDGKYLAKVQPSKQC  223

Query  680   SAVCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLT  856
             + VCCV+F+PF  P +A GCADR+ Y YD+R   +PLF+LDGH KAVTY RFLD  T+++
Sbjct  224   NPVCCVEFNPFKGPIVAVGCADRRVYAYDVRRMTDPLFVLDGHQKAVTYIRFLDEHTIVS  283

Query  857   SSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGE  1036
             SSVDGC+KMWD ++++++RTYKGH N+ RFVGLSVW+ GGLI CGSE+NQV+VYD RWGE
Sbjct  284   SSVDGCLKMWDAENQHVIRTYKGHDNSRRFVGLSVWRPGGLICCGSESNQVYVYDKRWGE  343

Query  1037  PIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRRKAA  1204
             PIWVYG +   G  G   GFISSVCW Q+ ++ CTLVAG SDGVLRVF+GKRR  A
Sbjct  344   PIWVYG-REPMGVTGYNPGFISSVCWQQKEENRCTLVAGDSDGVLRVFSGKRRCLA  398



>ref|XP_006421902.1| hypothetical protein CICLE_v10005222mg [Citrus clementina]
 gb|ESR35142.1| hypothetical protein CICLE_v10005222mg [Citrus clementina]
 gb|KDO60021.1| hypothetical protein CISIN_1g017773mg [Citrus sinensis]
Length=366

 Score =   457 bits (1175),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 231/377 (61%), Positives = 284/377 (75%), Gaps = 17/377 (5%)
 Frame = +2

Query  68    MKNFSSSPTSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFD  247
             M NF       AET+          E+ARC+WDF +   VSS +S   AVSD++GV+EFD
Sbjct  1     MSNFHDHQQPQAETTN---------ERARCEWDFNLRTTVSSSSSPNAAVSDSIGVIEFD  51

Query  248   PSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRW  427
             PSD+  ATGGIARKIR+Y++ S++      D    AV +DHS  CDYYICTPAKLSSL+W
Sbjct  52    PSDSVFATGGIARKIRIYNIKSVL-----VDHPVVAV-VDHSKVCDYYICTPAKLSSLKW  105

Query  428   KPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddg  607
             KPG + RVLGSGDYDGVVMEYDLE++VP+FERDEHGGRRVWSVDYS  D V+GASGSDDG
Sbjct  106   KPGTSGRVLGSGDYDGVVMEYDLEKKVPIFERDEHGGRRVWSVDYSKGDPVLGASGSDDG  165

Query  608   TMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTYTYDLRNTAEP  784
             TMQ WDPRC  G C++TVQPS +RSAVCCV+F PF  S +AAGCAD+K Y YD+R   +P
Sbjct  166   TMQMWDPRCDGGKCVSTVQPSASRSAVCCVEFHPFGSSLVAAGCADKKAYAYDVRKMVDP  225

Query  785   LFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVW  964
             + + DGH K VTY RFLD  T++T+  DGC+K+W+ +   ++RTYKGH+N   FVGLSVW
Sbjct  226   VLVFDGHRKTVTYIRFLDVDTLVTAGTDGCLKLWNVNDSRVIRTYKGHVNNRNFVGLSVW  285

Query  965   KNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTL  1144
             ++GGL+ CGSE NQVFVYD RWGEP+WV+  +  T   GSE GF+SSVCW + G+D CTL
Sbjct  286   RHGGLLGCGSETNQVFVYDVRWGEPVWVHDFEPVTAA-GSERGFVSSVCWRRVGEDECTL  344

Query  1145  VAGGSDGVLRVFAGKRR  1195
             VAGGSDG+L VF GK++
Sbjct  345   VAGGSDGLLHVFVGKKK  361



>ref|XP_006490375.1| PREDICTED: WD repeat-containing protein RUP2-like [Citrus sinensis]
Length=366

 Score =   455 bits (1171),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 230/377 (61%), Positives = 283/377 (75%), Gaps = 17/377 (5%)
 Frame = +2

Query  68    MKNFSSSPTSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFD  247
             M NF       AET+          E+ARC+WDF +   VSS +S   AVSD++GV+EFD
Sbjct  1     MSNFHDHQQPQAETTN---------ERARCEWDFNLRTTVSSSSSPNAAVSDSIGVIEFD  51

Query  248   PSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRW  427
             PSD+  ATGGIARKIR+Y++ S++      D    AV +DHS  CDYYICTPAKLSSL+W
Sbjct  52    PSDSVFATGGIARKIRIYNIKSVL-----VDHPVVAV-VDHSKVCDYYICTPAKLSSLKW  105

Query  428   KPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddg  607
             KPG + RVLGSGDYDGVVMEYDLE++VP+FERDEHGGRRVWSVDYS  D V+GASGSDDG
Sbjct  106   KPGTSGRVLGSGDYDGVVMEYDLEKKVPIFERDEHGGRRVWSVDYSKGDPVLGASGSDDG  165

Query  608   TMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTYTYDLRNTAEP  784
             TMQ WDPRC  G C++ VQPS +RSAVCCV+F PF  S +AAGCAD+K Y YD+R   +P
Sbjct  166   TMQMWDPRCDGGKCVSMVQPSASRSAVCCVEFHPFGSSLVAAGCADKKAYAYDVRKMVDP  225

Query  785   LFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVW  964
             + + DGH K VTY RFLD  T++T+  DGC+K+W+ +   ++RTYKGH+N   FVGLSVW
Sbjct  226   VLVFDGHRKTVTYIRFLDVDTLVTAGTDGCLKLWNVNDSRVIRTYKGHVNNRNFVGLSVW  285

Query  965   KNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTL  1144
             ++GGL+ CGSE NQVFVYD RWGEP+WV+  +  T   GSE GF+SSVCW + G+D CTL
Sbjct  286   RHGGLLGCGSETNQVFVYDVRWGEPVWVHDFEPVTAA-GSERGFVSSVCWRRVGEDECTL  344

Query  1145  VAGGSDGVLRVFAGKRR  1195
             VAGGSDG+L VF GK++
Sbjct  345   VAGGSDGLLHVFVGKKK  361



>gb|EYU25084.1| hypothetical protein MIMGU_mgv1a008622mg [Erythranthe guttata]
Length=368

 Score =   454 bits (1168),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 233/366 (64%), Positives = 284/366 (78%), Gaps = 4/366 (1%)
 Frame = +2

Query  104   ETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGA-VSDALGVLEFDPSDNFLATGGI  280
             +TSQ       + E+AR +WDF +S V+SS     GA VSDA+GV+EFD S  FLATGGI
Sbjct  3     QTSQIPDHTRKEEERARFEWDFNLSTVISSAAGDAGATVSDAIGVVEFDQSGGFLATGGI  62

Query  281   ARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGS  460
             ARKIR+YS    +       E S    LDH++AC++Y+CTPAKLSSL+W+PG  SRV+GS
Sbjct  63    ARKIRIYSTEKSLKSEEIDGERSGVRFLDHTAACEFYMCTPAKLSSLKWRPGSGSRVIGS  122

Query  461   GDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPN  640
             GDYDGVVMEYDLE+RVPVFERDEHGGRRVWSVDYSH D ++GASGSDDGTMQ WDPRC  
Sbjct  123   GDYDGVVMEYDLEKRVPVFERDEHGGRRVWSVDYSHWDPIIGASGSDDGTMQMWDPRCEG  182

Query  641   GNCLATVQPSKA-RSAVCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKA  814
             G CLA+VQP++A RS VC V+F+PF  P +A GC+DR+ Y YDLR  ++P+F+LDGH KA
Sbjct  183   GKCLASVQPNRAIRSPVCSVEFNPFGGPVVAVGCSDRRIYGYDLRGMSDPVFVLDGHQKA  242

Query  815   VTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGS  994
             VTY RFLD +T+++SSVDGC+ MW T+ R +VRTY+GH+N+ RFVGLSVW +GGL+SCGS
Sbjct  243   VTYTRFLDSQTIVSSSVDGCLMMWHTEERRVVRTYRGHVNSRRFVGLSVWSDGGLLSCGS  302

Query  995   ENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLR  1174
             ENNQVFVYD RW +PIWV G +S  G+   E GF+S VCW Q GD  C LVAGGSDGVL+
Sbjct  303   ENNQVFVYDKRWAQPIWVRGLES-MGRVQCEPGFVSGVCWRQTGDGRCMLVAGGSDGVLQ  361

Query  1175  VFAGKR  1192
              F G+R
Sbjct  362   AFEGQR  367



>ref|XP_010107434.1| E3 ubiquitin-protein ligase COP1 [Morus notabilis]
 gb|EXC15972.1| E3 ubiquitin-protein ligase COP1 [Morus notabilis]
Length=396

 Score =   451 bits (1161),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 242/399 (61%), Positives = 286/399 (72%), Gaps = 28/399 (7%)
 Frame = +2

Query  68    MKNFSSSPTSAAE-----------------TSQTIQQEEDDGEKARCDWDFRISAVVSSP  196
             MKN SS+ T   E                  +   + +++  E+ARC+WDF +  VVSS 
Sbjct  1     MKNLSSNVTERTERRKGEEEQENTEERERLENNRFEDQDETTERARCEWDFHLRTVVSSA  60

Query  197   TSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGS-DAVSLDHS  373
             T+A    SDALGV+EF PS   LATGGIARKIR+Y  +SLV    D D G  D   LDH+
Sbjct  61    TAA----SDALGVIEFGPSGELLATGGIARKIRIYRFSSLVAAASDADGGGGDVALLDHA  116

Query  374   SACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWS  553
             SA DYYICTPAKLSSLRW+PG   R++GSGDYDGVV EYDLERR PVFERDEHGGRRVWS
Sbjct  117   SAYDYYICTPAKLSSLRWRPGAGGRIIGSGDYDGVVTEYDLERRTPVFERDEHGGRRVWS  176

Query  554   VDYs--hsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKAR-SAVCCVQFSPFA-PS  721
             VDYS     SV+ ASGSDDGTMQ WDPRC  G C+ATV+PS  + S+VCCV+F+PF  P 
Sbjct  177   VDYSHWEGCSVMAASGSDDGTMQMWDPRCDGGECVATVRPSATKTSSVCCVEFNPFGGPL  236

Query  722   IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHR  901
             +A GCADRK Y YD+R  ++P+ ILDGH K VTY RFLD RT+++S  DGC+K+W+ D  
Sbjct  237   VAVGCADRKAYGYDVRKLSDPVLILDGHQKTVTYVRFLDDRTMVSSGTDGCLKLWNIDDA  296

Query  902   NLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPG  1081
               VRTYKGH+N   FVGLSVW+ GGL+ CGSENNQVFVYD RWGEPIWV G +  TG+ G
Sbjct  297   RAVRTYKGHVNNRSFVGLSVWRKGGLLGCGSENNQVFVYDKRWGEPIWVRGFE-PTGESG  355

Query  1082  SENGFISSVCWMQRG-DDHCTLVAGGSDGVLRVFAGKRR  1195
              E GF+SSVCW Q G +D CTLVAGGSDG L+VF G R+
Sbjct  356   CERGFVSSVCWRQVGEEDECTLVAGGSDGALQVFVGTRK  394



>ref|XP_011048706.1| PREDICTED: WD repeat-containing protein RUP2-like [Populus euphratica]
Length=421

 Score =   444 bits (1141),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 241/411 (59%), Positives = 302/411 (73%), Gaps = 18/411 (4%)
 Frame = +2

Query  8     SRKSNSLIFPITT*YGTIWAMKNFSSS--PTSAAETSQTIQQE-----------EDDGEK  148
             S++ N  I+ I+T Y   W MKNFS+   P S   T ++  QE           E++ E+
Sbjct  10    SQRQNLQIY-ISTRYPE-WKMKNFSTKFHPCSHHHTQESQNQETRKQKETIEKEEEEEER  67

Query  149   ARCDWDFRISAVVSSPTSAVGAVS-DALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDP  325
             ARC+WDF +S +VSS +S   A   DALGV+EFD +++ +ATGG+ARKIR+YS+ SL+  
Sbjct  68    ARCEWDFSLSTIVSSSSSNNTASISDALGVIEFDQTNSIIATGGMARKIRIYSLESLLPH  127

Query  326   FWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERR  505
                     D + LDH+ A DYYICTPAKLSS RWKP  + RVLGSGDYDGVVMEY+LERR
Sbjct  128   ESSSQNVHDTIFLDHARARDYYICTPAKLSSFRWKPRSDGRVLGSGDYDGVVMEYNLERR  187

Query  506   VPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSA  685
             +P+FERDEHGGRRVWSVDYSH D  +GAS SDDGTMQ WD R  NG C+ATVQPS  RSA
Sbjct  188   IPIFERDEHGGRRVWSVDYSHCDPTMGASASDDGTMQMWDTRSENGECVATVQPSVRRSA  247

Query  686   VCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSS  862
             VCCV+F+PF  P +A GCAD K Y YDLR  A P+F+LDGH K VTY +FLD  T++++S
Sbjct  248   VCCVEFNPFGGPIVAIGCADSKVYGYDLRMMASPVFVLDGHRKTVTYIKFLDNVTLVSAS  307

Query  863   VDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI  1042
             +DGC+K+W++D+ NL+RTY GH+N   FVGLSVW+N GL+ CGSENN+VFVYD RW EP+
Sbjct  308   IDGCLKLWNSDNSNLIRTYHGHVNNRNFVGLSVWRNAGLLGCGSENNKVFVYDKRWSEPV  367

Query  1043  WVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             WV+   S  G+ G  +GF+SSVCW Q G+D CTLV GGSDG+L+VF GKR+
Sbjct  368   WVHE-SSPMGKDGFGSGFVSSVCWRQVGEDQCTLVTGGSDGILQVFRGKRK  417



>ref|XP_011030101.1| PREDICTED: WD repeat-containing protein RUP2 [Populus euphratica]
Length=390

 Score =   442 bits (1137),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 219/352 (62%), Positives = 279/352 (79%), Gaps = 5/352 (1%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPT---SAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVD  322
             RC+WDF ++ +VSS     S+  A+SDALGV+EFD +++ +ATGGIARKIR+Y+  SL+ 
Sbjct  39    RCEWDFSLTTIVSSGNNNFSSTPAISDALGVIEFDHTNSIIATGGIARKIRIYNFKSLIA  98

Query  323   PFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLER  502
                      + + LDH+ ACDYYICTPAKLSS+RWKP  + RVLGSGDYDGVVMEY+LER
Sbjct  99    HENTSQNAHEIICLDHARACDYYICTPAKLSSIRWKPRSDGRVLGSGDYDGVVMEYNLER  158

Query  503   RVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARS  682
             R+P+FERDEHGGRRVWSVDYSH D V+GASGSDDGTMQ WD RC +G  +ATV P   RS
Sbjct  159   RIPIFERDEHGGRRVWSVDYSHWDPVLGASGSDDGTMQMWDTRCDSGEGVATVHPGVGRS  218

Query  683   AVCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTS  859
             AVCCV+F+PF  P +A GCADR+ Y YD+R T +P+F+LDGH K VTY +FLD  T++++
Sbjct  219   AVCCVEFNPFGGPIVAVGCADRRVYGYDIRMTVDPVFVLDGHRKTVTYIKFLDNVTLVSA  278

Query  860   SVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
             S+DGC+K+WD+D+ NL+R+YKGH+N+  F+GLSVW+NGGL+ CGSENN+VFVYD RWGEP
Sbjct  279   SIDGCLKLWDSDNSNLIRSYKGHVNSRSFIGLSVWRNGGLLGCGSENNKVFVYDRRWGEP  338

Query  1040  IWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             IWV+   +  G+ G   GF++SVCW Q  +D CTLVAGGS+G L+VF GKR+
Sbjct  339   IWVHE-SNPLGRDGFGGGFVNSVCWRQAEEDQCTLVAGGSNGDLQVFQGKRK  389



>ref|XP_007036830.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY21331.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=414

 Score =   442 bits (1138),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 240/394 (61%), Positives = 297/394 (75%), Gaps = 19/394 (5%)
 Frame = +2

Query  62    WAMKNFSS-----SPTSAAE----TSQTIQQE----EDDGEKARCDWDFRISAVVSSPTS  202
             WAMKN SS      P    E      ++I ++    E+D E+ARC+WDF +S VVS  TS
Sbjct  23    WAMKNLSSRLHLPDPVPGRERRDYAKESIAKDKPEGEEDQERARCEWDFSLSTVVS--TS  80

Query  203   AVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVS-LDHSSA  379
             A  AVSD LGV+EFDPS+  +ATGGIARKIR+Y++NSL+ P     +G   ++ LDH +A
Sbjct  81    AEAAVSDTLGVIEFDPSNTVVATGGIARKIRIYTLNSLL-PQDQSTQGEQNITFLDHVNA  139

Query  380   CDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVD  559
             C+YYICTPAKLSSLRWKPG   R+LGSGDYDGVVMEYDLER++P+FERDEHGGRRVWSVD
Sbjct  140   CEYYICTPAKLSSLRWKPGSGGRLLGSGDYDGVVMEYDLERKLPIFERDEHGGRRVWSVD  199

Query  560   YshsdsvvgasgsddgTMQTWDPRC-PNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAG  733
             YSH D  VGASGS+DGTMQ WDPRC   G C+A VQP+ ARS+VCCV+F PF  + IAAG
Sbjct  200   YSHWDPFVGASGSEDGTMQMWDPRCGEGGGCVAKVQPALARSSVCCVEFDPFGEALIAAG  259

Query  734   CADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVR  913
             CADRK YTYD+R   EPL + DGH K VTY RFLD +T++++  DG +K+W+     L+R
Sbjct  260   CADRKAYTYDVRKMVEPLHVYDGHTKTVTYVRFLDAQTMVSAGTDGYLKLWNISDSRLIR  319

Query  914   TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG  1093
             TYKGH+N+  FVGLSVW++GGL+  GSENNQVFVYD RWGEPIWV+G +      G ++G
Sbjct  320   TYKGHVNSRSFVGLSVWRHGGLLGSGSENNQVFVYDKRWGEPIWVHGFEPLGRAGGRDHG  379

Query  1094  FISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             F+SSV W Q  ++ CTLVAGGS+GVL+VF G+R+
Sbjct  380   FVSSVSWRQVHEEQCTLVAGGSNGVLQVFVGRRK  413



>ref|XP_011084728.1| PREDICTED: WD repeat-containing protein RUP2-like [Sesamum indicum]
Length=392

 Score =   442 bits (1136),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 231/390 (59%), Positives = 291/390 (75%), Gaps = 17/390 (4%)
 Frame = +2

Query  68    MKNFSS-----SPTSAAE-TSQTIQQEEDDGEKA------RCDWDFRISAVVSSPTSAVG  211
             M+NFSS      P S    T +  Q EE +  +A      RC+WDF +SAV+SS  +   
Sbjct  1     MRNFSSHFRLQQPGSVIPYTIRGRQNEEGEQPRAAVDDQPRCEWDFNLSAVISSAAAGCA  60

Query  212   AVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY  391
               SDA+GV+EFD S++F ATGGIARKIR+Y+   L+    + D   +A  LDHS+AC+YY
Sbjct  61    VGSDAIGVVEFDRSNSFFATGGIARKIRIYNAQKLLLSRENGD--GNAAFLDHSAACEYY  118

Query  392   ICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshs  571
             +CTPAKLSSL+WKPG  SRV+GSGDYDGVVMEYDLE+RVPVFERDEHGGRRVWS+DYS+ 
Sbjct  119   MCTPAKLSSLKWKPGSGSRVIGSGDYDGVVMEYDLEKRVPVFERDEHGGRRVWSMDYSNW  178

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSK-ARSAVCCVQFSPFAP-SIAAGCADR  745
             +  +G SGSDDGTMQ WD RC  G  LA+V+P +   S VC V+F+PF    +A GC+D 
Sbjct  179   NPTLGGSGSDDGTMQVWDTRCDMGKTLASVEPDRYGCSPVCSVEFNPFGGFLVAVGCSDH  238

Query  746   KTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKG  925
             K Y YD+R   +P+FILDGH KAVTY RFLD++ +++SS DGC+KMWD ++++L+RTYKG
Sbjct  239   KIYGYDVRRMVDPVFILDGHRKAVTYTRFLDQQKIVSSSTDGCLKMWDAENQHLIRTYKG  298

Query  926   HINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISS  1105
             H+N+ RFVGLSVW+ GGL SCGSENNQV+VYD RWG+PIWV G + A  QP  E GF+S 
Sbjct  299   HVNSRRFVGLSVWRTGGLFSCGSENNQVYVYDMRWGKPIWVGGFEQAA-QPRCEPGFVSG  357

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             VCW + G + CTLVAGGSDGVL+VF G++R
Sbjct  358   VCWRETGGERCTLVAGGSDGVLQVFEGEKR  387



>ref|XP_002318819.2| hypothetical protein POPTR_0012s13290g [Populus trichocarpa]
 gb|EEE97039.2| hypothetical protein POPTR_0012s13290g [Populus trichocarpa]
Length=390

 Score =   441 bits (1133),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 277/352 (79%), Gaps = 5/352 (1%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPT---SAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVD  322
             RC+WDF ++ +VSS     S+  A+SDALGV+EFD +++ +ATGGIARKIR+Y+  SL  
Sbjct  39    RCEWDFSLTTIVSSGNNNISSTPAISDALGVIEFDQTNSIIATGGIARKIRIYNFKSLFA  98

Query  323   PFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLER  502
                      +   LDH+ ACDYYICTPAKLSS+RWKP  + RVLGSGDYDGVVMEY LER
Sbjct  99    HENTSQNAHEITCLDHARACDYYICTPAKLSSIRWKPSSDGRVLGSGDYDGVVMEYCLER  158

Query  503   RVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARS  682
             R+P+FERDEHGGRRVWSVDYSH D V+GASGSDDGTMQ WD RC +G  +ATVQP   RS
Sbjct  159   RIPIFERDEHGGRRVWSVDYSHWDPVLGASGSDDGTMQMWDTRCESGEGVATVQPGVGRS  218

Query  683   AVCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTS  859
             AVCCV+F+PF  P +A GCADR+ Y YD+R T +P+F+LDGH K VTY +FLD  T++++
Sbjct  219   AVCCVEFNPFGGPIVAVGCADRRVYGYDIRMTGDPVFVLDGHRKTVTYIKFLDNVTLVSA  278

Query  860   SVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
             S+DGC+K+WD+D+ N++R+YKGH+N+  F+GLSVW+NGGL+ CGSENN+VFVYD RWGEP
Sbjct  279   SIDGCLKLWDSDNSNVIRSYKGHVNSRSFIGLSVWRNGGLLGCGSENNKVFVYDRRWGEP  338

Query  1040  IWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             IWV+   +  G+ G   GF+SSVCW Q  +D CTLVAGGSDG L+VF G+R+
Sbjct  339   IWVHE-SNPVGRDGCGGGFVSSVCWRQVEEDQCTLVAGGSDGDLQVFQGRRK  389



>gb|KDP22292.1| hypothetical protein JCGZ_26123 [Jatropha curcas]
Length=390

 Score =   440 bits (1132),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 232/390 (59%), Positives = 295/390 (76%), Gaps = 20/390 (5%)
 Frame = +2

Query  68    MKNFSSS---------PTSAAETSQTIQQEEDDGE----KARCDWDFRISAVVSSPTSAV  208
             MKNFS           P    E ++ I+  +++      +ARC+WDF +  VVSS  S  
Sbjct  1     MKNFSEKLHNITTLEPPKQEEEKTKAIKHHKEEEGEEEERARCEWDFNLETVVSSSNSQ-  59

Query  209   GAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDY  388
              +VS ALG +EFD S+NF+ATGGIARKIR+YS+ SL+     Q E    +SLDH++ACDY
Sbjct  60    -SVSHALGAIEFDQSENFVATGGIARKIRIYSIKSLLPHKGSQYE--HILSLDHANACDY  116

Query  389   YICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYsh  568
             Y+CTPAKLSSLRWKPG++SR++GSGDYDGVV EYDLERR+PVFERDEHGG RVWSVDYS+
Sbjct  117   YMCTPAKLSSLRWKPGFDSRIIGSGDYDGVVTEYDLERRLPVFERDEHGGHRVWSVDYSN  176

Query  569   sdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADR  745
              + VVGASGSDDGTMQ WDPRC +G+ +AT+QPS  RSAVCCV+F+PF  S IA GCADR
Sbjct  177   WNPVVGASGSDDGTMQMWDPRCEDGD-VATIQPSVTRSAVCCVEFNPFGGSMIAIGCADR  235

Query  746   KTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKG  925
             K Y YD+R   +P+ +LDGH K VTY +F+D  T++++S+DGC+K+W+ +   ++RTYKG
Sbjct  236   KAYGYDIRMMVKPVIMLDGHRKTVTYVKFVDANTLVSASIDGCLKLWNLNESKMIRTYKG  295

Query  926   HINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISS  1105
             H+N   FVGLSVW+NG L++CGSENN++FVYD RWGEPIW+ G  +A G       F+SS
Sbjct  296   HVNNRNFVGLSVWRNGSLLACGSENNRIFVYDKRWGEPIWMQGFDTA-GSSMENQEFVSS  354

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             VCW Q G+D CTL+AGGSDGVL+VF GKR+
Sbjct  355   VCWRQVGEDKCTLIAGGSDGVLKVFQGKRK  384



>ref|XP_008376565.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
RUP2 [Malus domestica]
Length=404

 Score =   438 bits (1126),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 240/404 (59%), Positives = 289/404 (72%), Gaps = 25/404 (6%)
 Frame = +2

Query  68    MKNFSSSPTSAAE-----------TSQTIQQEEDDG-EKARCDWDFRISAVVSSPTSAVG  211
             M NFSS     A+               +Q+EE  G E   CDWDF +S VVSS T+  G
Sbjct  1     MNNFSSGFHFPAQQRISEEERESTEEDKLQEEEGKGSEFNNCDWDFSLSTVVSS-TACRG  59

Query  212   AVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSL----DHSSA  379
             A S+ LGV+EFDPS+  LATGGIARKIR YS+ SL+  + +Q  GS + S+    DH  A
Sbjct  60    AASNTLGVIEFDPSNTVLATGGIARKIRGYSLKSLLPNYDNQICGSSSDSMADLIDHVDA  119

Query  380   CDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVD  559
             CDY ICTPAKLSSLRW+PG + RVL SGDYDGVV EYDLE ++P+FERDEHGGRRVWSVD
Sbjct  120   CDYTICTPAKLSSLRWRPGSDGRVLASGDYDGVVTEYDLETKLPIFERDEHGGRRVWSVD  179

Query  560   YshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGC  736
             YSHSD V+GAS SDDGT+Q WDPR   GNC+A+VQPS AR+ VCCV+F PF  + +A GC
Sbjct  180   YSHSDPVLGASASDDGTLQLWDPRHEGGNCVASVQPSDARNPVCCVEFDPFGGALLAVGC  239

Query  737   ADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRT  916
             ADRK Y YD+R    P+ + DGH K VTY RFL+ RTV+T+  DGC+K+WDT+    +RT
Sbjct  240   ADRKAYGYDVRKMVSPVSVFDGHRKTVTYVRFLNGRTVVTAGTDGCLKLWDTEDSRAIRT  299

Query  917   YKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGC------KSATGQP  1078
             YKGH N+  FVGLSVW+NG LI CGSENN+VFVYD RWGEPIWV+G        S +G  
Sbjct  300   YKGHANSRSFVGLSVWRNGELIGCGSENNRVFVYDKRWGEPIWVHGFGEVGAGSSNSGGC  359

Query  1079  GSENG-FISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRRKAAV  1207
             G + G F+SSVCW Q G++ CTLVAGGSDGVL+VF G+R+   V
Sbjct  360   GEDLGAFVSSVCWRQVGEEQCTLVAGGSDGVLQVFLGRRKSILV  403



>ref|XP_004309213.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Fragaria vesca 
subsp. vesca]
Length=385

 Score =   436 bits (1120),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 223/363 (61%), Positives = 269/363 (74%), Gaps = 6/363 (2%)
 Frame = +2

Query  122   QQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVY  301
              Q  D     R +WDF +S VVSS T A GAVS+ LGV+EFDPS+  LATGGIARKIR+Y
Sbjct  26    NQPTDHHRLTRSEWDFTLSTVVSSST-ATGAVSNTLGVIEFDPSETLLATGGIARKIRIY  84

Query  302   SVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVV  481
             SV+SL+    + +   D VSLDH++ACDYYICTPAKLSSLRW+PG   RVLGSGDYDGVV
Sbjct  85    SVSSLIP---NNNNYDDVVSLDHAAACDYYICTPAKLSSLRWRPGSGGRVLGSGDYDGVV  141

Query  482   MEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATV  661
              EYDLE R+PVFERDEHGGRRVWS+DY+     +GASGSDDGT+Q WDPRC  G C+A V
Sbjct  142   TEYDLESRLPVFERDEHGGRRVWSLDYNSDPGCLGASGSDDGTLQMWDPRCEAGECVARV  201

Query  662   QPSKARSAVCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLD  838
              PS+A + VCCV+F+PF  P +A GCADRK Y YD R  + P+   DGH K VTY RFLD
Sbjct  202   VPSEAGNPVCCVEFNPFGGPLLAVGCADRKAYVYDARRMSGPVLSFDGHDKTVTYVRFLD  261

Query  839   RRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVY  1018
              R +++S  DGC+KMW  +    +RTY GH N   FVGLSVW++GGL+ CGSENNQV+VY
Sbjct  262   SRRMVSSGTDGCLKMWSVEDAREIRTYSGHANNRSFVGLSVWRSGGLLGCGSENNQVYVY  321

Query  1019  DTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQR-GDDHCTLVAGGSDGVLRVFAGKRR  1195
             D RWGEP+WV+G      +   +  F+SSVCW Q+ G+D CTLVAGGSDGVL+VF G+R+
Sbjct  322   DVRWGEPVWVHGFGPMGSEGCDDRWFVSSVCWRQKDGEDQCTLVAGGSDGVLQVFVGRRK  381

Query  1196  KAA  1204
               A
Sbjct  382   SLA  384



>ref|XP_010255450.1| PREDICTED: WD repeat-containing protein RUP2 [Nelumbo nucifera]
Length=420

 Score =   437 bits (1123),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 230/389 (59%), Positives = 274/389 (70%), Gaps = 12/389 (3%)
 Frame = +2

Query  62    WAMKNFSSSPTSAAETSQTIQQ--------EEDDGEKARCDWDFRISAVVSSPTSAVGAV  217
             W M+N S+      +     +Q        E++D EKARC+WDF +  VVSS T  VGAV
Sbjct  25    WTMRNCSTDSDRPIQFQSHQEQREAVSREVEDNDEEKARCEWDFNLVTVVSSST--VGAV  82

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             SD LGV+EFDPSD  LATGGIARKIRVYS+ SL+     Q    D   LDH+SACDYYI 
Sbjct  83    SDTLGVIEFDPSDYLLATGGIARKIRVYSLGSLLPHETCQGAEDDTTYLDHTSACDYYIY  142

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             TPAKLSSLRWKP   SRVLGSGDYDGVV EYDLE +VP+FERDEHGGRRVWSVDYSH   
Sbjct  143   TPAKLSSLRWKPDTGSRVLGSGDYDGVVTEYDLEHQVPIFERDEHGGRRVWSVDYSHWSP  202

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +GAS SDDGT Q WD RC  G C+A+ QPS +RS+VCCV+F P+  S IA GCADR+ Y
Sbjct  203   ALGASASDDGTAQIWDTRCGGGTCVASAQPSASRSSVCCVEFDPYGGSMIAVGCADRRAY  262

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YD R  + PL +  GH K VTY RF+    + T+  DGC+K+WD      +RTY+GH+N
Sbjct  263   AYDARKMSAPLLVFHGHRKTVTYVRFVKDGMIATAGTDGCLKLWDMGDARSIRTYEGHVN  322

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCW  1114
                FVGLSVW+NGGL+ CGSE+NQVFVYD RW +PIWV G +  + +P  +NGF+SSVCW
Sbjct  323   RRSFVGLSVWRNGGLLGCGSESNQVFVYDKRWRDPIWVCGFQPNS-RPEYDNGFVSSVCW  381

Query  1115  MQRGDDHCTLVAGGSDGVLRVFAGKRRKA  1201
              Q G D   LVAGG DGVL+VF GKR+ +
Sbjct  382   RQVGVDQSMLVAGGPDGVLQVFVGKRKSS  410



>ref|XP_009340009.1| PREDICTED: WD repeat-containing protein RUP2-like [Pyrus x bretschneideri]
Length=403

 Score =   435 bits (1119),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 284/399 (71%), Gaps = 24/399 (6%)
 Frame = +2

Query  68    MKNFSS-----------SPTSAAETSQTIQQE-EDDGEKARCDWDFRISAVVSSPTSAVG  211
             MKNFSS               + E  +  QQE E   E   C+WDF +S VVSS     G
Sbjct  1     MKNFSSGIHFPDQPRISEERESTEEGKLPQQEVEKRSEFNNCEWDFSLSTVVSS-KDCRG  59

Query  212   AVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSL----DHSSA  379
             A S+ LGV+EFDPS+  LATGGIARKIRVYS+ SL+  + +Q  GS + ++    DH  A
Sbjct  60    AASNTLGVIEFDPSNTVLATGGIARKIRVYSLKSLLPNYDNQSCGSSSDTMADLIDHVDA  119

Query  380   CDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVD  559
             CDY ICTPAKLSSLRW+PG + RV+ SGDYDGVV EYDL+ ++P+FERDEHGGRRVWSVD
Sbjct  120   CDYTICTPAKLSSLRWRPGSDGRVMASGDYDGVVTEYDLKTKLPIFERDEHGGRRVWSVD  179

Query  560   YshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGC  736
             YSHSD V+GASGSDDGT+Q WDPRC  G+C+A+VQPS ARS VCCV+F PF  + +A GC
Sbjct  180   YSHSDPVLGASGSDDGTLQMWDPRCEGGDCVASVQPSDARSPVCCVEFDPFGGALLAVGC  239

Query  737   ADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRT  916
             ADRK Y YD+R  A P+ +  GH K VTY RFLD RTV+T+  DGC+K+WDT+    + T
Sbjct  240   ADRKAYAYDVRKMAGPVMVFYGHRKTVTYVRFLDSRTVVTAGTDGCLKLWDTEDSRAIET  299

Query  917   YKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPG-----  1081
             YKGH N+  FVGLSVW+NGGLI CGSENN++FVYD RWGEPIWV+   +           
Sbjct  300   YKGHANSRSFVGLSVWRNGGLIGCGSENNRLFVYDKRWGEPIWVHEFGAVAAGGSSGGCG  359

Query  1082  -SENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
               E  F+SSVCW Q G++ CTLVAGGSDGVL+VF G+R+
Sbjct  360   DEEGAFVSSVCWRQVGEEQCTLVAGGSDGVLQVFLGRRK  398



>ref|XP_009371342.1| PREDICTED: WD repeat-containing protein RUP2 [Pyrus x bretschneideri]
Length=403

 Score =   435 bits (1119),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 236/404 (58%), Positives = 283/404 (70%), Gaps = 26/404 (6%)
 Frame = +2

Query  68    MKNFSSSPTSAAE-----------TSQTIQQEEDDG-EKARCDWDFRISAVVSSPTSAVG  211
             M NFSS     A+               +Q+EE  G E   CDWDF +S VVSS T+  G
Sbjct  1     MNNFSSGFHFPAQKRISEEERESTEEDKLQEEEGKGSEFNNCDWDFSLSTVVSS-TACRG  59

Query  212   AVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVS---LDHSSAC  382
             + S+ LGV+EFDPS+   ATGGIARKIR YS+ SL+  + +Q  GS +     +DH  AC
Sbjct  60    SASNTLGVIEFDPSNTVFATGGIARKIRGYSLKSLLPNYDNQICGSSSSMVDLIDHVDAC  119

Query  383   DYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDY  562
             DY ICTPAKLSSLRW+PG + RVL SGDYDGVV EYDLE ++P+FERDEHGGRRVWSVDY
Sbjct  120   DYTICTPAKLSSLRWRPGSDGRVLASGDYDGVVTEYDLETKLPIFERDEHGGRRVWSVDY  179

Query  563   shsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCA  739
             SHS+ V+GAS SDDGT+Q WDPR   GNC+A+VQPS AR+ VCCV+F PF    +A GCA
Sbjct  180   SHSNPVLGASASDDGTLQLWDPRHEGGNCVASVQPSDARNPVCCVEFDPFGGELLAVGCA  239

Query  740   DRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTY  919
             DRK Y YD+R    P+ + DGH K VTY RFLD R+V+T+  DGC+K+WDT+    +RTY
Sbjct  240   DRKAYGYDVRKMVSPVLVFDGHRKTVTYVRFLDGRSVVTAGTDGCLKLWDTEDSRAIRTY  299

Query  920   KGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG--  1093
             KGH N   FVGLSVW+NGGLI CGSENN+VFVYD RWGEPIW +G     G  GS  G  
Sbjct  300   KGHANCRSFVGLSVWRNGGLIGCGSENNRVFVYDKRWGEPIWGHGV-GEVGAGGSNRGGC  358

Query  1094  ------FISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRRKAAV  1207
                   F+SSVCW Q G++ CTLVAGGSDGVL+VF G+R+   V
Sbjct  359   GEDLGAFVSSVCWRQVGEEQCTLVAGGSDGVLQVFLGRRKSNLV  402



>ref|XP_008377410.1| PREDICTED: WD repeat-containing protein RUP2-like [Malus domestica]
Length=403

 Score =   432 bits (1112),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 230/383 (60%), Positives = 283/383 (74%), Gaps = 13/383 (3%)
 Frame = +2

Query  83    SSPTSAAETSQTIQQE-EDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDN  259
             S    + E  + +QQE E   E   C+WDF +S VVSS     GA S+ LGV+EF+PS+ 
Sbjct  17    SGERESTEEGKLLQQEVEKRSEFNNCEWDFSLSTVVSS-NDCRGAASNTLGVIEFNPSNT  75

Query  260   FLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSL----DHSSACDYYICTPAKLSSLRW  427
              LATGGIARKIRVYS+ SL+  + +Q  GS + ++    DH  ACDY ICTPAKLSSLRW
Sbjct  76    VLATGGIARKIRVYSLKSLLPNYDNQTCGSSSDTMADLIDHVDACDYTICTPAKLSSLRW  135

Query  428   KPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddg  607
             +PG + RV+ SGDYDGVV EYD++ ++P+FERDEHGGRRVWSVDYSHSD V+GASGSDDG
Sbjct  136   RPGSDGRVMASGDYDGVVTEYDIKTKLPIFERDEHGGRRVWSVDYSHSDPVLGASGSDDG  195

Query  608   TMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTYTYDLRNTAEP  784
             T+Q WDPRC  G C+A+VQPS ARS VCCV+F PF  + +A GCADRK Y YD+R  A P
Sbjct  196   TLQMWDPRCEGGECVASVQPSDARSPVCCVEFDPFGGALLAVGCADRKAYAYDVRKVAGP  255

Query  785   LFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVW  964
             + + DGH K VTY RFLD RTV+T++ DGC+K+WDT+    + TYKGH N+  FVGLSVW
Sbjct  256   VMVFDGHRKTVTYVRFLDSRTVVTAATDGCLKLWDTEDSRAIETYKGHANSRSFVGLSVW  315

Query  965   KNGGLISCGSENNQVFVYDTRWGEPIWVY------GCKSATGQPGSENGFISSVCWMQRG  1126
             +NGGLI CGSENN++FVYD RWGEPIWV+         S+ G    E  F+SSVCW Q G
Sbjct  316   RNGGLIGCGSENNRLFVYDKRWGEPIWVHEFGAVAAGGSSGGCGEEEGAFVSSVCWRQVG  375

Query  1127  DDHCTLVAGGSDGVLRVFAGKRR  1195
             ++ CTLVAGGSDGVL+VF G+R+
Sbjct  376   EEQCTLVAGGSDGVLQVFLGRRK  398



>ref|XP_002267663.1| PREDICTED: WD repeat-containing protein RUP2-like [Vitis vinifera]
Length=382

 Score =   431 bits (1108),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 227/384 (59%), Positives = 279/384 (73%), Gaps = 12/384 (3%)
 Frame = +2

Query  68    MKNFSS--SPTSAAETSQTIQQEEDDG----EKARCDWDFRISAVVSSPTSAVGAVSDAL  229
             MKNFS+  +P S    +  IQ+E+ +     E+ARCDW+F +S VV+S  S+ GA +D +
Sbjct  1     MKNFSTQFNPQSPEVENPNIQEEKAEQHIEEERARCDWEFNLSTVVTS--SSTGASTDTI  58

Query  230   GVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSL-DHSSACDYYICTPA  406
             GV+EFDPSDN +ATGGIARKIRVYSV SL+ P  +   G   V L  H++ACDYYI TPA
Sbjct  59    GVIEFDPSDNLVATGGIARKIRVYSVKSLL-PGENHSHGEHNVKLLQHNNACDYYIWTPA  117

Query  407   KLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvg  586
             KLSSLRWKPG + RVLGSGDYDGVV EYDL+R++P+FERDEHGGRR+WSVDYSH +  VG
Sbjct  118   KLSSLRWKPGSSGRVLGSGDYDGVVTEYDLDRKIPIFERDEHGGRRIWSVDYSHWNPFVG  177

Query  587   asgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPF-APSIAAGCADRKTYTYD  763
             ASGSDDGT+Q WDPRC     +A V+PS    AVCCV+F+PF  P +A GCADR+ Y YD
Sbjct  178   ASGSDDGTIQMWDPRCEGTTNVAKVRPSAGGGAVCCVEFNPFGGPLVAVGCADRRAYGYD  237

Query  764   LRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTR  943
             +R   +P+ I DGH K VTY RFLD   ++TS  DGC+++W      ++R Y GH+NT  
Sbjct  238   VRKMVDPVLIFDGHQKPVTYVRFLDEHMMVTSGTDGCLRLWSMHDARMIRVYMGHMNTRN  297

Query  944   FVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQR  1123
             FVGLSVW+ GGL+ CGSENN VFVYD RW EPIWV+     + + G +  F+SSVCW Q 
Sbjct  298   FVGLSVWRTGGLLGCGSENNHVFVYDKRWSEPIWVHEFGGGS-RDGCDPKFVSSVCWRQV  356

Query  1124  GDDHCTLVAGGSDGVLRVFAGKRR  1195
             G D CTLVAGGSDG L+V  GKRR
Sbjct  357   GKDVCTLVAGGSDGSLQVILGKRR  380



>ref|XP_008234259.1| PREDICTED: WD repeat-containing protein RUP2 [Prunus mume]
Length=380

 Score =   428 bits (1100),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 228/391 (58%), Positives = 284/391 (73%), Gaps = 20/391 (5%)
 Frame = +2

Query  68    MKNFSSS---PTSAAETSQTIQQEEDDGEKARCDWDFRISAVVSS-PTSAVGAVSDALGV  235
             MKN SS    PT  A        E++      C+WDF +S +VSS   S  GAVS+ +GV
Sbjct  1     MKNVSSQFNFPTQEA-------NEKERSSSGTCEWDFNLSTIVSSRGGSTGGAVSNTIGV  53

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFDPS+  +ATGGIARKIRVYS NSL+      D    A  LDH +AC Y +CTPAKLS
Sbjct  54    IEFDPSNAVVATGGIARKIRVYSFNSLLP----SDRFCQANLLDHVTACAYTLCTPAKLS  109

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasg  595
             SLRW+PG + RVL SGDYDGVV EYDLE R+PVFERDEHGGRRVWSVDYSHSD V+GASG
Sbjct  110   SLRWRPGSDGRVLCSGDYDGVVTEYDLETRLPVFERDEHGGRRVWSVDYSHSDPVLGASG  169

Query  596   sddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTYTYDLRN  772
             SDDGT+Q WDPRC  G C+A+VQPS+AR+ VCCV+F PF  + +A GCADR+ Y YD+R 
Sbjct  170   SDDGTLQMWDPRCDGGECVASVQPSEARNPVCCVEFDPFGGALVAVGCADRRAYGYDMRK  229

Query  773   TAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVG  952
               +P+ + DGH K VTY RF+D  +V+T+  DGC+K+WDT+    +RTYKGH N   FVG
Sbjct  230   MVDPVLVFDGHRKTVTYVRFIDGCSVVTAGTDGCLKLWDTEDSREIRTYKGHTNNRSFVG  289

Query  953   LSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGC----KSATGQPGSENGFISSVCWMQ  1120
             LSVW+NG LI CGSE+N+V+VYD RWGEPIW++G     + ++G    E GF+SSVCW Q
Sbjct  290   LSVWRNGELIGCGSEDNRVYVYDKRWGEPIWLHGFGAVGEGSSGGCDEELGFVSSVCWRQ  349

Query  1121  RGDDHCTLVAGGSDGVLRVFAGKRRKAAVTY  1213
              G++ CTL+AGGSDG L+VF+G+R+   + Y
Sbjct  350   VGEEQCTLIAGGSDGDLQVFSGRRKPLMLDY  380



>ref|XP_002528808.1| ubiquitin ligase protein cop1, putative [Ricinus communis]
 gb|EEF33581.1| ubiquitin ligase protein cop1, putative [Ricinus communis]
Length=426

 Score =   429 bits (1104),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 229/407 (56%), Positives = 289/407 (71%), Gaps = 29/407 (7%)
 Frame = +2

Query  62    WAMKNFS-------SSPTSAAETSQTIQQEEDDGEK----------ARCDWDFRISAVVS  190
             WAMKNFS       ++   A E ++ +Q+ +   EK          ARC+W F +  VVS
Sbjct  24    WAMKNFSDDQIHHPANRIEAPEAAKQLQESQARQEKQPEEEEEEERARCEWGFSLKTVVS  83

Query  191   SPTSAVGAVS----DALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAV  358
             S +S+         DALGV+EFD S+N +ATGGIARKIR+YS+ SL+      + G+D  
Sbjct  84    SSSSSTSGGGAVSPDALGVIEFDQSENIVATGGIARKIRIYSIKSLLPQEQQHENGNDIA  143

Query  359   SLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGG  538
              +DH +AC+++ICTPAKLSSLRWKP    RV+GSGDYDGVVMEYD+E R+P+FERDEHGG
Sbjct  144   LMDHVNACEFFICTPAKLSSLRWKPCSGGRVIGSGDYDGVVMEYDVETRIPIFERDEHGG  203

Query  539   RRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARS--AVCCVQFSPF  712
             RR+WSVDYSH   VVGASGSDDGTMQ WDPR   G C+ATV+PS   S  AVC V+F+PF
Sbjct  204   RRIWSVDYSHWSPVVGASGSDDGTMQMWDPRHEGGGCVATVKPSVTSSCRAVCSVEFNPF  263

Query  713   APS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWD  889
               S IA GCADR+ Y YD+R    P+F+LDGH K VTY RF+D  T+ ++ +DGC+K+W+
Sbjct  264   GGSIIAVGCADRRVYGYDVRMITNPVFVLDGHKKTVTYVRFMDNGTLASAGIDGCLKLWN  323

Query  890   TDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSAT  1069
                  L+RTYKGH+N+  FVGLSVW+NGGL+ CGSENNQVFVYD RW EPIW YG     
Sbjct  324   LQDSQLLRTYKGHLNSRNFVGLSVWRNGGLLGCGSENNQVFVYDKRWSEPIWAYGSG---  380

Query  1070  GQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRRKAAVT  1210
               P +++GF++SVCW Q G+D CTLV GGS+GVL+VF GKR+   +T
Sbjct  381   --PAADHGFVNSVCWSQVGEDRCTLVTGGSNGVLQVFEGKRKPCIIT  425



>ref|XP_010273115.1| PREDICTED: WD repeat-containing protein RUP2-like [Nelumbo nucifera]
Length=431

 Score =   429 bits (1103),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 224/395 (57%), Positives = 279/395 (71%), Gaps = 21/395 (5%)
 Frame = +2

Query  62    WAMKNFSSSPTSAAETSQTIQQEEDDGE-------------KARCDWDFRISAVVSSPTS  202
             W M+NFS+      +     ++++ D +             KAR +WDF +  VVSS T 
Sbjct  34    WTMRNFSTDFDRPIQFQSHEEEQKQDVQPEGGGGGEEEGEEKARYEWDFNLVTVVSSST-  92

Query  203   AVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSAC  382
              VGA+SD LGV+EFDPSD  LATGGIARKIRVYS  SL+ P     +  D   LDH+ AC
Sbjct  93    -VGAISDTLGVIEFDPSDYLLATGGIARKIRVYSFGSLL-PHESSHDTQDTTYLDHTRAC  150

Query  383   DYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDY  562
             DYYICTPAKLSSLRWKP   SRVLGSGDYDGVV EYDLERRVP+FERDEHGGRRVWSVDY
Sbjct  151   DYYICTPAKLSSLRWKPNTGSRVLGSGDYDGVVTEYDLERRVPIFERDEHGGRRVWSVDY  210

Query  563   shsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPSI-AAGCA  739
             SH   V+GASGSDDG++Q WD RC  G C++  QPS +RS+VCCV+F P   S+ A GCA
Sbjct  211   SHWVPVLGASGSDDGSVQMWDTRCGGGMCVSAAQPSASRSSVCCVEFDPNGGSLFAVGCA  270

Query  740   DRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTY  919
             DR+ Y YD+R  + P+ +  GH + VTY RFL+   ++T+  DGC+K+WD      +RTY
Sbjct  271   DRRAYAYDVRKMSAPVLVFHGHRRTVTYVRFLEESMIVTAGTDGCLKLWDMGDARAIRTY  330

Query  920   KGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFI  1099
             +GH+N+  FVGLSVW+NGGL+ CGSE+N+VFVYD RW +PIWV G  S +     +NGF+
Sbjct  331   EGHLNSRSFVGLSVWRNGGLLGCGSESNEVFVYDKRWRDPIWVRGFGSIS----HDNGFV  386

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRRKAA  1204
             SSVCW Q G++  TL+AGG DGVL+VF GKR+  +
Sbjct  387   SSVCWRQVGENEATLLAGGPDGVLQVFVGKRKSPS  421



>ref|XP_010038432.1| PREDICTED: WD repeat-containing protein RUP2, partial [Eucalyptus 
grandis]
Length=417

 Score =   427 bits (1098),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 223/364 (61%), Positives = 280/364 (77%), Gaps = 21/364 (6%)
 Frame = +2

Query  125   QEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYS  304
             QEE+  E+ARC+WDF +SAVVS+   A  + SD LGV+EFD     +ATGGIARKIR+YS
Sbjct  68    QEEE--ERARCEWDFHLSAVVST---AAASSSDTLGVIEFDSPGALIATGGIARKIRIYS  122

Query  305   VNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVM  484
             ++SLV    + D+ + A S +HSSAC YYICTPAKLSSLRW+PG  SRV+GSGDYDGV+ 
Sbjct  123   LSSLVSQ--ESDQTTTAFS-EHSSACSYYICTPAKLSSLRWRPGSGSRVIGSGDYDGVIT  179

Query  485   EYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPN-GNCLATV  661
             EYDLERRVPVFERDEHGGRRVWSVDYS S   VGASGSDDGTMQ WDPRC + G CL+TV
Sbjct  180   EYDLERRVPVFERDEHGGRRVWSVDYSSSGPAVGASGSDDGTMQLWDPRCSDSGGCLSTV  239

Query  662   QPSKA--RSAVCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARF  832
             +P +    +AVC V+FSPF + ++A GCADR+ YTYDLRN + P+ + DGH KAVTYA+F
Sbjct  240   RPGEVGRSTAVCSVEFSPFDSTTVAVGCADRRAYTYDLRNMSGPVRVFDGHAKAVTYAKF  299

Query  833   LDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVF  1012
             L  + ++++S+D C+K+W+     +VRTY+GH+N   FVGLSVW++GGLI+CGSE++QVF
Sbjct  300   LGAQALVSASIDSCLKLWNVADACVVRTYRGHVNARNFVGLSVWRDGGLIACGSESDQVF  359

Query  1013  VYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKR  1192
             VYD +WGEPIW +           E GF+SSVCW Q G D CTLVAGGSDGVL++F G R
Sbjct  360   VYDAKWGEPIWAHRF---------ERGFVSSVCWRQAGSDRCTLVAGGSDGVLQLFVGTR  410

Query  1193  RKAA  1204
             + ++
Sbjct  411   KASS  414



>gb|KCW46417.1| hypothetical protein EUGRSUZ_K00249 [Eucalyptus grandis]
Length=531

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 223/364 (61%), Positives = 280/364 (77%), Gaps = 21/364 (6%)
 Frame = +2

Query  125   QEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYS  304
             QEE+  E+ARC+WDF +SAVVS+   A  + SD LGV+EFD     +ATGGIARKIR+YS
Sbjct  182   QEEE--ERARCEWDFHLSAVVST---AAASSSDTLGVIEFDSPGALIATGGIARKIRIYS  236

Query  305   VNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVM  484
             ++SLV    + D+ + A S +HSSAC YYICTPAKLSSLRW+PG  SRV+GSGDYDGV+ 
Sbjct  237   LSSLVSQ--ESDQTTTAFS-EHSSACSYYICTPAKLSSLRWRPGSGSRVIGSGDYDGVIT  293

Query  485   EYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPN-GNCLATV  661
             EYDLERRVPVFERDEHGGRRVWSVDYS S   VGASGSDDGTMQ WDPRC + G CL+TV
Sbjct  294   EYDLERRVPVFERDEHGGRRVWSVDYSSSGPAVGASGSDDGTMQLWDPRCSDSGGCLSTV  353

Query  662   QPSKA--RSAVCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARF  832
             +P +    +AVC V+FSPF + ++A GCADR+ YTYDLRN + P+ + DGH KAVTYA+F
Sbjct  354   RPGEVGRSTAVCSVEFSPFDSTTVAVGCADRRAYTYDLRNMSGPVRVFDGHAKAVTYAKF  413

Query  833   LDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVF  1012
             L  + ++++S+D C+K+W+     +VRTY+GH+N   FVGLSVW++GGLI+CGSE++QVF
Sbjct  414   LGAQALVSASIDSCLKLWNVADACVVRTYRGHVNARNFVGLSVWRDGGLIACGSESDQVF  473

Query  1013  VYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKR  1192
             VYD +WGEPIW +           E GF+SSVCW Q G D CTLVAGGSDGVL++F G R
Sbjct  474   VYDAKWGEPIWAHRF---------ERGFVSSVCWRQAGSDRCTLVAGGSDGVLQLFVGTR  524

Query  1193  RKAA  1204
             + ++
Sbjct  525   KASS  528



>ref|XP_007219483.1| hypothetical protein PRUPE_ppa022067mg [Prunus persica]
 gb|EMJ20682.1| hypothetical protein PRUPE_ppa022067mg [Prunus persica]
Length=380

 Score =   417 bits (1073),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 224/391 (57%), Positives = 281/391 (72%), Gaps = 20/391 (5%)
 Frame = +2

Query  68    MKNFSSS---PTSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVG-AVSDALGV  235
             MKN SS    PT  A        E++      C+WDF +S +VSS   + G AVS+ +GV
Sbjct  1     MKNVSSQFNFPTQGA-------NEKERSSSGTCEWDFNLSTIVSSSGGSTGGAVSNTIGV  53

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFDPS+  +ATGGIARKIRVYS NSL+      D    A  LDH +AC Y +CTPAKLS
Sbjct  54    IEFDPSNAVVATGGIARKIRVYSFNSLLP----SDRFCQANLLDHVTACAYTLCTPAKLS  109

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasg  595
             SLRW+PG + RVL SGDYDGVV EYDLE R+P+FERDEHGGRRVWSVDYSHSD  +GASG
Sbjct  110   SLRWRPGSDGRVLCSGDYDGVVTEYDLETRLPIFERDEHGGRRVWSVDYSHSDPFLGASG  169

Query  596   sddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTYTYDLRN  772
             SDDGT+Q WDPRC  G C+A+VQPSKA + VCC++F PF  + +A GCADR+ Y YD+R 
Sbjct  170   SDDGTLQMWDPRCDGGECVASVQPSKAGNPVCCLEFDPFGGALVAVGCADRRAYGYDMRK  229

Query  773   TAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVG  952
               +P+ + DGH K VTY RF+D  TV+T+  DGC+K+W T+    +RTYKGH N   FVG
Sbjct  230   MVDPVLVFDGHRKTVTYVRFIDGCTVVTAGTDGCLKLWGTEDSREIRTYKGHTNNRSFVG  289

Query  953   LSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGC----KSATGQPGSENGFISSVCWMQ  1120
             LSVW+NG LI CGSE+N+V+VYD RWGEPIW++G     + ++G    E GF+SSVCW Q
Sbjct  290   LSVWRNGKLIGCGSEDNRVYVYDKRWGEPIWLHGFGAVGEGSSGGCDEELGFVSSVCWRQ  349

Query  1121  RGDDHCTLVAGGSDGVLRVFAGKRRKAAVTY  1213
              G++ CTL+AGGSDG L+VF+G+R+   + Y
Sbjct  350   VGEEQCTLIAGGSDGDLQVFSGRRKPLMLDY  380



>ref|XP_002321910.2| hypothetical protein POPTR_0015s13210g, partial [Populus trichocarpa]
 gb|EEF06037.2| hypothetical protein POPTR_0015s13210g, partial [Populus trichocarpa]
Length=382

 Score =   416 bits (1070),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 220/373 (59%), Positives = 281/373 (75%), Gaps = 19/373 (5%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEE----DDGEKARCDWDFRISAVVSSPTSAVGAVS-DALGVLE  241
             +S   T  ++  +T +Q+E    ++ E+ARC+WDF +S +VSS  +   A   DALGV+E
Sbjct  5     YSHQHTQESQNQETRKQKETIEEEEEERARCEWDFSLSTIVSSSNNNNTASISDALGVIE  64

Query  242   FDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSL  421
             FD +++ +ATGGIARKIR+YS+ SL+               +H+ A DYYICTPAKLSS 
Sbjct  65    FDQTNSIIATGGIARKIRIYSLESLLP------------HENHARARDYYICTPAKLSSF  112

Query  422   RWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsd  601
             RWKP  + RVLGS DYDGVVMEY+LERR+P+FERDEHGGRRVWSVDYSH D  +GASGSD
Sbjct  113   RWKPRSDGRVLGSEDYDGVVMEYNLERRIPIFERDEHGGRRVWSVDYSHCDPTMGASGSD  172

Query  602   dgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFA-PSIAAGCADRKTYTYDLRNTA  778
             DGTMQ WD R  +G C+ATVQPS  RSAVCCV+F+PF  P +A GCADRK Y YDLR  A
Sbjct  173   DGTMQMWDTRSESGECVATVQPSVRRSAVCCVEFNPFGGPIVAIGCADRKVYGYDLRMMA  232

Query  779   EPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLS  958
             +P+F+LDGH K VTY +FLD  T++++S+DGC+K+W++D+ N++RTY GH+N   FVGLS
Sbjct  233   DPVFVLDGHRKTVTYIKFLDNATLVSASIDGCLKLWNSDNSNVIRTYHGHVNNRNFVGLS  292

Query  959   VWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS-ATGQPGSENGFISSVCWMQRGDDH  1135
             VW+NGGL+ CGSENN+VFVYD RW EP+WV+   S   G+ G  +GF+SSVCW Q G+D 
Sbjct  293   VWRNGGLLGCGSENNKVFVYDKRWSEPVWVHESSSPIMGKDGRGSGFVSSVCWRQVGEDQ  352

Query  1136  CTLVAGGSDGVLR  1174
             CTLV GGSDG+L+
Sbjct  353   CTLVTGGSDGILQ  365



>ref|XP_002267709.1| PREDICTED: WD repeat-containing protein RUP2-like [Vitis vinifera]
Length=383

 Score =   412 bits (1058),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 223/385 (58%), Positives = 279/385 (72%), Gaps = 13/385 (3%)
 Frame = +2

Query  68    MKNFSS--SPTSAAETSQTIQQEEDDG----EKARCDWDFRISAVVSSPTSAVGAVSDAL  229
             MKNFS+  +P  +   +  IQ+E+ +     E+AR DW+F +S VVSS +   GA +D +
Sbjct  1     MKNFSTRFNPQGSEVENPNIQEEKREQHIEEERARRDWEFSLSTVVSSSSD--GASTDTI  58

Query  230   GVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVS-LDHSSACDYYICTPA  406
             G++EFDPSDN + TGGIARKIRVYS+ S +    +   G   V+ L H+ ACDYY+CTPA
Sbjct  59    GIIEFDPSDNLVVTGGIARKIRVYSIKSFLSDE-NHSHGERKVTWLQHNDACDYYVCTPA  117

Query  407   KLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvg  586
             KLSSLRWKPG   RVLGSGDYDGVV EYDL++++P+FERDEHGGRR+WSVDYSH D  VG
Sbjct  118   KLSSLRWKPGSAGRVLGSGDYDGVVTEYDLDQKIPIFERDEHGGRRIWSVDYSHWDPFVG  177

Query  587   asgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPF-APSIAAGCADRKTYTYD  763
             ASGSDDGTMQ WDPRC     +A V+PS   SAVCCV+F+PF  P IA GCADR+ Y YD
Sbjct  178   ASGSDDGTMQMWDPRCEGIKNVAKVRPSGGGSAVCCVEFNPFGGPLIAVGCADRRAYGYD  237

Query  764   LRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTR  943
             +R   +P+ I DGH K VTY RFLD+ T++TS  DGC+++W      ++R Y GH+NT  
Sbjct  238   VRKMVDPVLIFDGHQKTVTYVRFLDQHTMVTSGTDGCLRLWSMHDARMIRVYMGHMNTRS  297

Query  944   FVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQ-  1120
             FVGLSVW+ GGL+ CGSENN VFVYD RWGEPIWV+     + + G +  F+SSVCW Q 
Sbjct  298   FVGLSVWRTGGLLGCGSENNHVFVYDKRWGEPIWVHEFGVGS-RDGRDPNFVSSVCWRQV  356

Query  1121  RGDDHCTLVAGGSDGVLRVFAGKRR  1195
              G+D CTLVAGGSDG+L V  GK++
Sbjct  357   GGEDGCTLVAGGSDGILEVIVGKKK  381



>ref|XP_004165765.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase COP1-like 
[Cucumis sativus]
Length=384

 Score =   406 bits (1043),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 215/358 (60%), Positives = 263/358 (73%), Gaps = 12/358 (3%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             RC+WDF +++VVSSPT+   A SD LGV+EFDPSD+ +AT GIARKIR Y +++L+    
Sbjct  30    RCEWDFTLASVVSSPTNC--AASDTLGVVEFDPSDSLIATAGIARKIRGYRLHNLLPQ--  85

Query  332   DQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVP  511
             D D  +    LDH+ A D+ ICTPAKLSSLRWKP  N R+LGSGDYDGVVMEYDLE +VP
Sbjct  86    DIDHNATITQLDHTRASDFCICTPAKLSSLRWKPNANGRILGSGDYDGVVMEYDLEMKVP  145

Query  512   VFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVC  691
             +FERDEHGGRRVWSVDYS  + VVGASGSDDGT+Q WD RC +G C+A VQPS  RSAVC
Sbjct  146   IFERDEHGGRRVWSVDYSTVEPVVGASGSDDGTVQVWDTRCESGECVAVVQPSVVRSAVC  205

Query  692   CVQFSPFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVD  868
             CV+F+PF    +A GCADRK Y YD R   EP+ + +GH K VTY +F+D  TV+++S D
Sbjct  206   CVEFNPFGGGLVAVGCADRKAYGYDRRKMREPVVVFEGHGKTVTYVKFVDGGTVVSASTD  265

Query  869   GCIKMWDTDH---RNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
             G +KMW T+      +VRTY+GH+N   FVGLSVW+ GGLI CGSE+ +VFVYD RWGEP
Sbjct  266   GSLKMWKTEEGGGARVVRTYEGHVNGRSFVGLSVWREGGLIGCGSEDKRVFVYDKRWGEP  325

Query  1040  IWV----YGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRRKA  1201
             IWV              GS  G +SSVCW Q G+  CTLVAGGSDGVL+VF G ++++
Sbjct  326   IWVKEFDGSGGGVGVGMGSGYGLVSSVCWRQVGEQECTLVAGGSDGVLQVFVGHKKRS  383



>gb|KGN60479.1| Ubiquitin ligase protein cop1 [Cucumis sativus]
Length=385

 Score =   405 bits (1042),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 215/359 (60%), Positives = 263/359 (73%), Gaps = 13/359 (4%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             RC+WDF +++VVSSPT+   A SD LGV+EFDPSD+ +AT GIARKIR Y +++L+    
Sbjct  30    RCEWDFTLASVVSSPTNC--AASDTLGVVEFDPSDSLIATAGIARKIRGYRLHNLLPQ--  85

Query  332   DQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVP  511
             D D  +    LDH+ A D+ ICTPAKLSSLRWKP  N R+LGSGDYDGVVMEYDLE +VP
Sbjct  86    DIDHNATITQLDHTRASDFCICTPAKLSSLRWKPNANGRILGSGDYDGVVMEYDLEMKVP  145

Query  512   VFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVC  691
             +FERDEHGGRRVWSVDYS  + VVGASGSDDGT+Q WD RC +G C+A VQPS  RSAVC
Sbjct  146   IFERDEHGGRRVWSVDYSTVEPVVGASGSDDGTVQVWDTRCESGECVAVVQPSVVRSAVC  205

Query  692   CVQFSPFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVD  868
             CV+F+PF    +A GCADRK Y YD R   EP+ + +GH K VTY +F+D  TV+++S D
Sbjct  206   CVEFNPFGGGLVAVGCADRKAYGYDRRKMREPVVVFEGHGKTVTYVKFVDGGTVVSASTD  265

Query  869   GCIKMWDTDH---RNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
             G +KMW T+      +VRTY+GH+N   FVGLSVW+ GGLI CGSE+ +VFVYD RWGEP
Sbjct  266   GSLKMWKTEEGGGARVVRTYEGHVNGRSFVGLSVWREGGLIGCGSEDKRVFVYDKRWGEP  325

Query  1040  IWV-----YGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRRKA  1201
             IWV               GS  G +SSVCW Q G+  CTLVAGGSDGVL+VF G ++++
Sbjct  326   IWVKEFDGGVGVGVGVGMGSGYGLVSSVCWRQVGEQECTLVAGGSDGVLQVFVGHKKRS  384



>ref|XP_004148378.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Cucumis sativus]
Length=383

 Score =   404 bits (1037),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 215/357 (60%), Positives = 264/357 (74%), Gaps = 11/357 (3%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             RC+WDF +++VVSSPT+   A SD LGV+EFDPSD+ +AT GIARKIR Y +++L+    
Sbjct  30    RCEWDFTLASVVSSPTNC--AASDTLGVVEFDPSDSLIATAGIARKIRGYRLHNLLPQ--  85

Query  332   DQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVP  511
             D D  +    LDH+ A D+ ICTPAKLSSLRWKP  N R+LGSGDYDGVVMEYDLE +VP
Sbjct  86    DIDHNATITQLDHTRASDFCICTPAKLSSLRWKPNANGRILGSGDYDGVVMEYDLEMKVP  145

Query  512   VFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVC  691
             +FERDEHGGRRVWSVDYS  + VVGASGSDDGT+Q WD RC +G C+A VQPS  RSAVC
Sbjct  146   IFERDEHGGRRVWSVDYSTVEPVVGASGSDDGTVQVWDTRCESGECVAVVQPSVVRSAVC  205

Query  692   CVQFSPFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVD  868
             CV+F+PF    +A GCADRK Y YD R   EP+ + +GH K VTY +F+D  TV+++S D
Sbjct  206   CVEFNPFGGGLVAVGCADRKAYGYDRRKMREPVVVFEGHGKTVTYVKFVDGGTVVSASTD  265

Query  869   GCIKMWDTDH---RNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
             G +KMW T+      +VRTY+GH+N   FVGLSVW+ GGLI CGSE+ +VFVYD RWGEP
Sbjct  266   GSLKMWKTEEGGGARVVRTYEGHVNGRSFVGLSVWREGGLIGCGSEDKRVFVYDKRWGEP  325

Query  1040  IWVY---GCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRRKA  1201
             IWV    G        G+  G +SSVCW Q G+  CTLVAGGSDGVL+VF G ++++
Sbjct  326   IWVKEFDGGVGVGVGGGAGYGLVSSVCWRQVGEQECTLVAGGSDGVLQVFVGHKKRS  382



>gb|EYU19540.1| hypothetical protein MIMGU_mgv1a007834mg [Erythranthe guttata]
Length=394

 Score =   389 bits (1000),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 234/377 (62%), Positives = 285/377 (76%), Gaps = 16/377 (4%)
 Frame = +2

Query  98    AAETSQTIQQEEDDG---EKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLA  268
             A E  Q+     DD    E ARCDWDF +SAVVSS  S     SDA+GV+EFD S++FLA
Sbjct  20    APEREQSPPAAADDDHPPETARCDWDFSLSAVVSSAASTS---SDAIGVVEFDQSNSFLA  76

Query  269   TGGIARKIRVYSVNSLVDPFWDQDEG--SDAVSLDHSSACDYYICTPAKLSSLRWKPGWN  442
             TGGIARKIR+Y+   L+ P  DQ+ G  + A  LDH++ACDYY+CTPAKLSSL+WKPG  
Sbjct  77    TGGIARKIRIYTARKLL-PSSDQNGGRTAAAAFLDHAAACDYYMCTPAKLSSLKWKPGSG  135

Query  443   SRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTW  622
             SRV+GSGDYDG VMEYDLE+RVPVFERDEHGGRRVWS+DYSHSD  +GASGSDDGTMQ W
Sbjct  136   SRVIGSGDYDGAVMEYDLEKRVPVFERDEHGGRRVWSMDYSHSDPNLGASGSDDGTMQMW  195

Query  623   DPRCPNGNCLATVQPSK-ARSAVCCVQFSPFA-PSIAAGCADRKTYTYDLRNTAEPLFIL  796
             D R   GN +A+V+P++ A S VCCV+F+PF  P I  GCADRK Y YD+R TA+P+F+L
Sbjct  196   DTRSDGGNSVASVRPNRLASSPVCCVEFNPFGGPLIGVGCADRKIYGYDVRRTADPVFVL  255

Query  797   DGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGG  976
             DGH KAVTY RFLD RT+++SSVDGC+ MW T+ R ++RTY GH+N  RFVGLSVW++GG
Sbjct  256   DGHRKAVTYTRFLDLRTIVSSSVDGCLMMWATEDRRVIRTYSGHLNGRRFVGLSVWRSGG  315

Query  977   LISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGS---ENGFISSVCWMQRGDDH-CTL  1144
             L+SCGSENN+VFVY+ + G      G +           E GF+SSVCW Q G++  CTL
Sbjct  316   LLSCGSENNRVFVYE-KMGRTDLGSGFEPPAAAAQPPRCEGGFVSSVCWRQSGEEERCTL  374

Query  1145  VAGGSDGVLRVFAGKRR  1195
             VAGGSDGVL+VF G++R
Sbjct  375   VAGGSDGVLQVFNGEKR  391



>ref|NP_568435.2| WD repeat-containing protein RUP2 [Arabidopsis thaliana]
 sp|Q9FFA7.1|RUP2_ARATH RecName: Full=WD repeat-containing protein RUP2; AltName: Full=Protein 
EARLY FLOWERING BY OVEREXPRESSION 2; AltName: Full=Protein 
EPRESSOR OF UV-B PHOTOMORPHOGENESIS 2 [Arabidopsis 
thaliana]
 dbj|BAB10046.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED93205.1| WD repeat-containing protein RUP2 [Arabidopsis thaliana]
Length=368

 Score =   387 bits (995),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/329 (57%), Positives = 234/329 (71%), Gaps = 6/329 (2%)
 Frame = +2

Query  221   DALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICT  400
             D +G +EFDP+DN +AT GI+RKIR Y + SL+    +   G+    +D ++AC+YYICT
Sbjct  41    DVIGAIEFDPTDNIVATAGISRKIRFYGLPSLLRN--NAVSGTGVSFVDQATACEYYICT  98

Query  401   PAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsv  580
             PAKLSSLRW+PG   RV+GSGDYDGVVMEYDLE+R PVFERDEHGGRRVWSVDY+     
Sbjct  99    PAKLSSLRWRPGSGGRVIGSGDYDGVVMEYDLEKRTPVFERDEHGGRRVWSVDYTRHGGA  158

Query  581   vgasgsdd--gTMQTWDPRCPNGNCLATVQPSK-ARSAVCCVQFSPFA-PSIAAGCADRK  748
                  S    GTMQ WDPRCP    +  V+P+   RSAVCCV+F P   P++A GCADRK
Sbjct  159   STVGASGSDDGTMQVWDPRCPPEESVGVVRPAGICRSAVCCVEFDPSGGPAVAVGCADRK  218

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              Y YD+R   +P   L GH K V+Y RFLD  TV+T+  DGC+K+W  +   ++RTY+GH
Sbjct  219   GYVYDIRKLVDPALTLQGHTKTVSYVRFLDGGTVVTAGTDGCLKLWSVEDGRVIRTYEGH  278

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSV  1108
             +N   FVGLSVW+NG L  CGSENN+VFVYD RWG+P+WV G +      GS+  F+SSV
Sbjct  279   VNNRNFVGLSVWRNGALFGCGSENNRVFVYDRRWGKPVWVDGFEPVGMNSGSDKRFVSSV  338

Query  1109  CWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             CW Q G D CTLVAGGSDGVL+V+ GKR+
Sbjct  339   CWRQSGVDQCTLVAGGSDGVLQVYVGKRK  367



>ref|XP_002872071.1| nucleotide binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48330.1| nucleotide binding protein [Arabidopsis lyrata subsp. lyrata]
Length=365

 Score =   387 bits (995),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/329 (58%), Positives = 235/329 (71%), Gaps = 6/329 (2%)
 Frame = +2

Query  221   DALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICT  400
             D +G +EFDP+DN +AT GI+RKIR Y + SL+    +   G+    +D ++AC+YYICT
Sbjct  38    DVIGAIEFDPTDNIVATAGISRKIRFYGLPSLLRT--NAVSGTGVSFVDQATACEYYICT  95

Query  401   PAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsv  580
             PAKLSSLRW+PG  SRV+GSGDYDGVV EYDLE+R PVFERDEHGGRRVWSVDY+     
Sbjct  96    PAKLSSLRWRPGSGSRVIGSGDYDGVVTEYDLEKRTPVFERDEHGGRRVWSVDYTRHGDA  155

Query  581   vgasgsdd--gTMQTWDPRCPNGNCLATVQPSK-ARSAVCCVQFSPFA-PSIAAGCADRK  748
                  S    GTMQ WDPRCP    ++ V+PS   RSAVCCV+F P   P++A GCADRK
Sbjct  156   SAVGASGSDDGTMQVWDPRCPPEESVSVVRPSGICRSAVCCVEFDPSGGPTVAVGCADRK  215

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              Y YD+R   +P   L GH K V+Y RFLD  TV+T+  DGC+K+W  +   ++RTY+GH
Sbjct  216   GYVYDIRKLVDPALTLQGHTKTVSYVRFLDGCTVVTAGTDGCLKLWSVEDGRVIRTYEGH  275

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSV  1108
             +N   FVGLSVW+NG L  CGSENN+VFVYD RWG+P+WV G +      GS+  F+SSV
Sbjct  276   VNNRNFVGLSVWRNGALFGCGSENNRVFVYDRRWGKPVWVDGFEPVGMNSGSDKRFVSSV  335

Query  1109  CWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             CW Q G D CTLVAGGSDGVL+V+ GKR+
Sbjct  336   CWRQSGVDQCTLVAGGSDGVLQVYVGKRK  364



>ref|XP_010421182.1| PREDICTED: WD repeat-containing protein RUP2 [Camelina sativa]
Length=366

 Score =   385 bits (988),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/334 (57%), Positives = 235/334 (70%), Gaps = 16/334 (5%)
 Frame = +2

Query  221   DALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVS-----LDHSSACD  385
             D +G +EFDP+DN +AT GI+RKIR Y + SL+         S AVS     +D ++AC+
Sbjct  39    DVIGAIEFDPTDNIVATAGISRKIRFYGLPSLL-------RTSAAVSGGVSFVDQATACE  91

Query  386   YYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYs  565
             YYICTPAKLSSLRW+PG   RV+GSGDYDGVV EYDLE+R PVFERDEHGGRRVWSVDY+
Sbjct  92    YYICTPAKLSSLRWRPGSGGRVIGSGDYDGVVTEYDLEKRTPVFERDEHGGRRVWSVDYT  151

Query  566   hsdsvvgasgsdd--gTMQTWDPRCPNGNCLATVQPSK-ARSAVCCVQFSPFA-PSIAAG  733
                       S    GTMQ WDPRCP    L  V+P+   RSAVCCV+F P   P++A G
Sbjct  152   RHGGSSAIGASGSDDGTMQVWDPRCPPEESLGVVRPAGICRSAVCCVEFDPSGGPAVAVG  211

Query  734   CADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVR  913
             CADRK Y YD+R   +P   L GH K V+Y RFLD  TV+T+  DGC+K+W  +  +++R
Sbjct  212   CADRKGYIYDMRKLVDPALTLQGHNKTVSYVRFLDGGTVVTAGTDGCLKLWSVEDGSVIR  271

Query  914   TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG  1093
             TY+GH+N   FVGLSVW+NG L  CGSENN+VFVYD RWG+P+WV G +      GS+  
Sbjct  272   TYEGHVNGRNFVGLSVWRNGALFGCGSENNKVFVYDKRWGKPVWVDGFEPVGMNSGSDKR  331

Query  1094  FISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             F+SSVCW Q G D CTLVAGGSDGVL+V+ GKR+
Sbjct  332   FVSSVCWRQSGVDQCTLVAGGSDGVLQVYVGKRK  365



>emb|CDY38909.1| BnaA03g12700D [Brassica napus]
Length=352

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 200/378 (53%), Positives = 257/378 (68%), Gaps = 30/378 (8%)
 Frame = +2

Query  68    MKNFSSSPTSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFD  247
             M + SSSPT+           + D    R DWD   SA+VSSP++     +DA+G +EFD
Sbjct  1     MISSSSSPTTM----------DRDNNIPRFDWDLSFSALVSSPSTG----TDAIGAIEFD  46

Query  248   PSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRW  427
             PS   LATGGIARKIR+Y +NSL+    D D        DH  +C   ICTPAKLSSL+W
Sbjct  47    PSGEILATGGIARKIRIYRLNSLLGTSRDDD--------DHVESC---ICTPAKLSSLKW  95

Query  428   KPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsdd-  604
             +P    RV+GSGDYDGVV EYD+E+ VPVFERDEHGGR++WSVDY+  +  V  +     
Sbjct  96    RPDLTGRVIGSGDYDGVVTEYDVEKGVPVFERDEHGGRKIWSVDYTLRNGSVLGASGSHD  155

Query  605   gTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTYTYDLRNTAE  781
             GT+Q WDPR  NG    TV+P    +A+C V+F PF  + +A GCADR  Y YD+R   +
Sbjct  156   GTVQMWDPR--NGGLDETVRPGGGTAAICSVEFDPFGGNFLAVGCADRNAYVYDVRRLVD  213

Query  782   PLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWD-TDHRNLVRTYKGHINTTRFVGLS  958
             P+F+LDGH K VTYARF+D+ T++T S DG +K+WD  + + +VRT +GH+N+  FVGLS
Sbjct  214   PIFVLDGHTKTVTYARFMDQHTIVTGSTDGSLKLWDIANGQRVVRTCRGHVNSRNFVGLS  273

Query  959   VWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHC  1138
             VW++GGL+  GSENN+VFVYD RWGEP+WV G    T + GS+  F+SSVCW Q  +D C
Sbjct  274   VWRHGGLVVSGSENNEVFVYDKRWGEPVWVRGLGGQTDRFGSDRRFVSSVCWRQADEDWC  333

Query  1139  TLVAGGSDGVLRVFAGKR  1192
             TLVAGGSDGVL +F+G R
Sbjct  334   TLVAGGSDGVLEIFSGIR  351



>ref|XP_006394637.1| hypothetical protein EUTSA_v10005519mg [Eutrema salsugineum]
 gb|ESQ31923.1| hypothetical protein EUTSA_v10005519mg [Eutrema salsugineum]
Length=374

 Score =   381 bits (979),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 190/328 (58%), Positives = 233/328 (71%), Gaps = 5/328 (2%)
 Frame = +2

Query  227   LGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVS-LDHSSACDYYICTP  403
             +G +EFDP+DN LAT GI+RKIR Y + SL+        G   VS +DH++AC+YYICTP
Sbjct  46    IGAIEFDPTDNILATAGISRKIRFYGLPSLLRANAGISGGGGGVSFVDHTTACEYYICTP  105

Query  404   AKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvv  583
             AKLSSLRW+PG   RV+GSGDYDGVV EYDLE+R PVFERDEHGGRRVWSVDY+      
Sbjct  106   AKLSSLRWRPGSGGRVIGSGDYDGVVTEYDLEKRTPVFERDEHGGRRVWSVDYTRHGGAA  165

Query  584   gasgsdd--gTMQTWDPRCPNGNCLATVQPS-KARSAVCCVQFSPFA-PSIAAGCADRKT  751
                 S    GTMQ WDPRCP    +  V+P+   RSAVCCV+F P   P++A GCADR+ 
Sbjct  166   AVGASGSDDGTMQVWDPRCPPEETVGVVRPAGHCRSAVCCVEFDPSGGPAVAVGCADRRG  225

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             Y YD+R   +P   L GH K V+Y RFLD  TV+T+  DGC+KMW  +   ++RTY+GH+
Sbjct  226   YVYDMRKLVDPALTLQGHSKTVSYVRFLDGGTVVTAGTDGCLKMWSVEDGCVIRTYEGHV  285

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVC  1111
             N+  FVGLSVW+NG L  CGSENN+VFVYD RWG+P+WV G +      GS+  F+SSVC
Sbjct  286   NSRNFVGLSVWRNGALFGCGSENNRVFVYDKRWGKPVWVDGYEPVGISSGSDKRFVSSVC  345

Query  1112  WMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             W Q G D CTLVA GSDGVL+V+ GKR+
Sbjct  346   WRQSGVDQCTLVAAGSDGVLQVYVGKRK  373



>gb|KFK27669.1| hypothetical protein AALP_AA8G413400 [Arabis alpina]
Length=361

 Score =   380 bits (975),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/360 (53%), Positives = 249/360 (69%), Gaps = 12/360 (3%)
 Frame = +2

Query  125   QEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYS  304
             +++ + E+AR +WD    ++ +  +S+  +  D +G +EFDP+D  +AT GI+RKIR Y 
Sbjct  10    EQDQEQEEARYEWD---LSLSTVVSSSSSSACDVIGAIEFDPTDTVVATAGISRKIRFYG  66

Query  305   VNSLVDPFWDQDEG-SDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVV  481
             + SL+      + G S   S+D ++AC+YYICTPAKLSSLRW+PG   RV+GSGDYDGVV
Sbjct  67    LPSLLR----TNAGISGVTSVDQATACEYYICTPAKLSSLRWRPGSGGRVIGSGDYDGVV  122

Query  482   MEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATV  661
              EYDLE+R PVFERDEHGGRRVWSVDY+        S     T+Q WDPRCP    +  V
Sbjct  123   TEYDLEKRTPVFERDEHGGRRVWSVDYTRHGVGASGSDDG--TVQVWDPRCPPEESVGVV  180

Query  662   QPSK-ARSAVCCVQFSPFA-PSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFL  835
             +P+   RSAVCCV+F P   P++A GCADR+ Y YD+R   +P   L GH K V+Y RFL
Sbjct  181   RPAGICRSAVCCVEFDPCGGPAVAVGCADRRGYVYDMRKLVDPALTLKGHSKTVSYVRFL  240

Query  836   DRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFV  1015
             D  TV+T+  DGC+K+W  +   ++RTY+GH+N   FVGLSVW+NG L  CGSENN+VFV
Sbjct  241   DGGTVVTAGTDGCLKLWSVEDGRVIRTYEGHVNNRNFVGLSVWRNGALFGCGSENNRVFV  300

Query  1016  YDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             YD RWG+P+WV G +      G +  F+SSVCW Q G D CTLVAGGSDGVL+V+ GKR+
Sbjct  301   YDKRWGKPVWVDGFEPVGVSSGLDKRFVSSVCWRQSGVDQCTLVAGGSDGVLQVYVGKRK  360



>ref|XP_010493496.1| PREDICTED: WD repeat-containing protein RUP2-like [Camelina sativa]
Length=378

 Score =   380 bits (976),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 190/330 (58%), Positives = 234/330 (71%), Gaps = 5/330 (2%)
 Frame = +2

Query  221   DALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVS-LDHSSACDYYIC  397
             D +G +EFDP+DN +AT GI+RKIR Y + SL+            VS +D ++AC+YYIC
Sbjct  43    DVIGAIEFDPTDNIVATAGISRKIRFYGLPSLLRNSATVVVVGGGVSFVDQATACEYYIC  102

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             TPAKLSSLRW+PG   RV+GSGDYDGVV EYDLE+R PVFERDEHGGRRVWSVDY+    
Sbjct  103   TPAKLSSLRWRPGSGGRVIGSGDYDGVVTEYDLEKRTPVFERDEHGGRRVWSVDYTRHGG  162

Query  578   vvgasgsdd--gTMQTWDPRCPNGNCLATVQPSK-ARSAVCCVQFSPFA-PSIAAGCADR  745
             V     S    GTMQ WDPRCP    L  V+P+   RSAVCCV+F P   P++A GCADR
Sbjct  163   VSAIGASGSDDGTMQVWDPRCPPEESLGVVRPAGICRSAVCCVEFDPSGGPAVAVGCADR  222

Query  746   KTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKG  925
             K Y YD+R   +P   L GH K V+Y RFLD  TV+T+  DGC+K+W  +  +++RTY+G
Sbjct  223   KGYIYDMRKLVDPALTLQGHNKTVSYVRFLDGGTVVTAGTDGCLKLWSVEDGSVIRTYEG  282

Query  926   HINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISS  1105
             H+N+  FVGLSVW+NG L  C SENN+VFVYD RWG+P+WV G +      GS+  F+SS
Sbjct  283   HVNSRNFVGLSVWRNGALFGCRSENNKVFVYDKRWGKPVWVDGFEPVGMNSGSDKRFVSS  342

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             VCW Q G D CTLVAGGSDGVL+V+ GKR+
Sbjct  343   VCWRQSGVDQCTLVAGGSDGVLQVYVGKRK  372



>ref|XP_006287966.1| hypothetical protein CARUB_v10001208mg [Capsella rubella]
 gb|EOA20864.1| hypothetical protein CARUB_v10001208mg [Capsella rubella]
Length=371

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 188/330 (57%), Positives = 234/330 (71%), Gaps = 5/330 (2%)
 Frame = +2

Query  221   DALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVS-LDHSSACDYYIC  397
             D +G +EFDP+DN +AT GI+RKIR Y + SL+        G   VS +D ++AC+YYIC
Sbjct  41    DVIGAIEFDPTDNIVATAGISRKIRFYGLPSLLRTSAAVSGGGGGVSFVDQATACEYYIC  100

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             TPAKLSSLRW+PG   RV+GSGDYDGVV EYDLE+R PVFERDEHGGRRVWSVDY+ +  
Sbjct  101   TPAKLSSLRWRPGSGGRVIGSGDYDGVVTEYDLEKRTPVFERDEHGGRRVWSVDYTRNGG  160

Query  578   vvgasgsdd--gTMQTWDPRCPNGNCLATVQPSK-ARSAVCCVQFSPFA-PSIAAGCADR  745
                   S    GTMQ WDPRCP    +  V+P+   RSAVCCV+F P   P++A GCADR
Sbjct  161   GSVVGASGSDDGTMQVWDPRCPPEESVGVVRPAGICRSAVCCVEFDPSGGPAVAVGCADR  220

Query  746   KTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKG  925
             K Y YD+R   +P   L+GH K V+Y RFLD  TV+T+  DGC+K+W  +   ++RTY+G
Sbjct  221   KGYVYDMRKLVDPALTLEGHTKTVSYVRFLDGGTVVTAGTDGCLKLWSVEDGRVIRTYEG  280

Query  926   HINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISS  1105
             H+N   FVGLSVW+NG L  CGSENN+VFVYD RWG+P+W+ G +      GS+  F+SS
Sbjct  281   HVNNRNFVGLSVWRNGALFGCGSENNKVFVYDKRWGKPVWIDGFEPVGMNSGSDKRFVSS  340

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             VCW Q G D CTLVAGGSDGVL+V+ GK +
Sbjct  341   VCWRQSGVDQCTLVAGGSDGVLQVYVGKTK  370



>emb|CDY32590.1| BnaC03g15580D [Brassica napus]
Length=354

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 255/378 (67%), Gaps = 28/378 (7%)
 Frame = +2

Query  68    MKNFSSSPTSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFD  247
             M + SSSPT+           + D    R DWD   SAVVSSP++     +DA+G +EFD
Sbjct  1     MISSSSSPTTM----------DRDNNIPRFDWDLSFSAVVSSPSTG----TDAIGAIEFD  46

Query  248   PSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRW  427
             PS   LATGGIARKIR+Y +NSL+          D    DH  +C   ICTPAKLSSL+W
Sbjct  47    PSGEILATGGIARKIRIYRLNSLLG------TSRDDDDDDHVESC---ICTPAKLSSLKW  97

Query  428   KPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsdd-  604
             +P  + RV+GSGDYDGVV EYD+E+ VPVFERDEHGGR++WSVDY+  +     +   D 
Sbjct  98    RPDLSGRVIGSGDYDGVVTEYDVEKGVPVFERDEHGGRKIWSVDYTLRNGSALGASGSDD  157

Query  605   gTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPSI-AAGCADRKTYTYDLRNTAE  781
             GT+Q WDPR  NG    TV+P    +A+C V+F P   ++ A GCADR  Y YD+R   +
Sbjct  158   GTVQMWDPR--NGGLEETVRPGGGAAAICSVEFDPLGGNLLAVGCADRNAYVYDIRRLVD  215

Query  782   PLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLV-RTYKGHINTTRFVGLS  958
             P+F+LDGH K VTYARF+D+ T++T S DG +K+WD  +  LV RT++GH+N+  FVGLS
Sbjct  216   PIFVLDGHTKTVTYARFMDQHTIVTGSTDGSLKLWDIANGQLVVRTFRGHVNSRNFVGLS  275

Query  959   VWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHC  1138
             VW++GGL+  GSEN++VFVYD RWGEP+WV G    T +  S+  F+SSVCW Q  +D C
Sbjct  276   VWRHGGLVVSGSENDEVFVYDKRWGEPVWVRGLGGQTDRFRSDRRFVSSVCWRQTDEDWC  335

Query  1139  TLVAGGSDGVLRVFAGKR  1192
             TLVAGGSDGVL +F+G R
Sbjct  336   TLVAGGSDGVLEIFSGIR  353



>ref|XP_009132544.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
RUP1 [Brassica rapa]
Length=385

 Score =   374 bits (959),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 194/355 (55%), Positives = 246/355 (69%), Gaps = 18/355 (5%)
 Frame = +2

Query  137   DGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSL  316
             D    R DWD   S VVSSP++     +DA+G +EFDPS   LATGGIARKIR+Y +NSL
Sbjct  45    DNNIPRFDWDLSFSTVVSSPSTG----TDAIGAIEFDPSGEILATGGIARKIRIYRLNSL  100

Query  317   VDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDL  496
             +          D    DH   C   ICTPAKLSSL+W+P    RV+GSGDYDGVV EYD+
Sbjct  101   LG------TSRDDDDDDHVERC---ICTPAKLSSLKWRPDLTGRVIGSGDYDGVVSEYDV  151

Query  497   ERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsdd-gTMQTWDPRCPNGNCLATVQPSK  673
             E+ VPVFERDEHGGR++WSVDY+     V  +   D GT+Q WDPR  NG    TV+P  
Sbjct  152   EKGVPVFERDEHGGRKIWSVDYTLRSGSVLGASGSDDGTVQMWDPR--NGGLDETVRPGG  209

Query  674   ARSAVCCVQFSPFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTV  850
               +A+C V+F PF  + +A GCADR  Y YD+R   +P+F+LDGH K VTYARF+D+ T+
Sbjct  210   GTAAICSVEFDPFGGNFLAVGCADRNAYVYDVRRLVDPIFVLDGHTKTVTYARFMDQHTI  269

Query  851   LTSSVDGCIKMWD-TDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTR  1027
             +T S DG +K+WD  + + +VRT++GH+N+  FVGLSVW++GGL+  GSENN+VFVYD R
Sbjct  270   VTGSTDGSLKLWDIANGQRVVRTFRGHVNSRNFVGLSVWRHGGLVVSGSENNEVFVYDKR  329

Query  1028  WGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKR  1192
             WGEP+WV G    T + GS+  F+SSVCW Q  +D CTLVAGGSDGVL +F+G R
Sbjct  330   WGEPVWVRGLGGQTDRFGSDRRFVSSVCWRQADEDWCTLVAGGSDGVLEIFSGIR  384



>gb|KFK26834.1| hypothetical protein AALP_AA8G299900 [Arabis alpina]
Length=376

 Score =   371 bits (953),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/350 (55%), Positives = 246/350 (70%), Gaps = 22/350 (6%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             RCDWD  +SAVVSS  +     SDA+G +EFDPS   LATGGIARKIR Y ++SL+    
Sbjct  45    RCDWDLSLSAVVSSAPTG----SDAIGAIEFDPSGEILATGGIARKIRSYRLSSLL----  96

Query  332   DQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVP  511
                 GS     DH +  +  ICTPAKLSSL+W+P    RV+GSGDYDGVV EYD+E++VP
Sbjct  97    ----GSRD---DHVTTSESCICTPAKLSSLKWRPDLAGRVIGSGDYDGVVTEYDVEKQVP  149

Query  512   VFERDEHGGRRVWSVDYshsdsvvgasgsd-dgTMQTWDPRCPNGNCLATVQPSKARSAV  688
             VFERDEHGGRR+WSVDY+  +     +    DGT+Q WDP+   G    TV+P    +A+
Sbjct  150   VFERDEHGGRRIWSVDYTLYNGSTVGASGSDDGTVQMWDPQA--GGLEETVRPGSG-AAI  206

Query  689   CCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSV  865
             C V+F P   PS+A GCADR  Y YD+R   +P+ +LDGH K VTYA+F+D  T++T S 
Sbjct  207   CSVEFDPLGGPSLAVGCADRNAYVYDIRRLVDPIVVLDGHAKTVTYAKFMDPHTIVTGST  266

Query  866   DGCIKMWDT-DHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI  1042
             DG +K+WD  + R +VRTY+GH+N+  FVGLSVW++GGL+  GSENNQVF+YD RWGEP+
Sbjct  267   DGSLKLWDILNERRVVRTYRGHVNSRNFVGLSVWRHGGLVVSGSENNQVFLYDKRWGEPV  326

Query  1043  WVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKR  1192
             WV G      + GS+  F+SSVCW Q  +D CTLVAGGSDGVL++F+GKR
Sbjct  327   WVRGLGEVD-RLGSDRRFVSSVCWRQVDEDWCTLVAGGSDGVLQIFSGKR  375



>ref|XP_010521333.1| PREDICTED: WD repeat-containing protein RUP1 isoform X2 [Tarenaya 
hassleriana]
Length=397

 Score =   371 bits (953),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 207/387 (53%), Positives = 272/387 (70%), Gaps = 28/387 (7%)
 Frame = +2

Query  62    WAMKNFSS-SPTSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVL  238
             W MK+ SS +P  +++      + + D +K RC+W+  +SA + +  SA  A SDA+G +
Sbjct  26    WPMKSLSSLAPMESSD------KGDKDVDKPRCEWNLSLSAAIVASGSAKTAPSDAIGAI  79

Query  239   EFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSS  418
             EFD +   LATGGI+RKIR Y ++S  D        S  V LDH     + ICTPAKLSS
Sbjct  80    EFDSTGEILATGGISRKIRFYRMSSFPD--------SPTVVLDHGEVLQFCICTPAKLSS  131

Query  419   LRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYsh-sdsvvgasg  595
             LRW+P  ++RV+GSGDYDGVV EYD E+RVPVFERDEHGGRRVWSVDY+  + SV+GASG
Sbjct  132   LRWRPDSSNRVIGSGDYDGVVTEYDAEKRVPVFERDEHGGRRVWSVDYTRYTGSVIGASG  191

Query  596   sddgTMQTWDPRCPNGNCLATVQPSKAR----SAVCCVQFSPF-APSIAAGCADRKTYTY  760
             SDDGT+Q WD R        + +PSK R    SA+C V+F P   PS+A GCADR  Y Y
Sbjct  192   SDDGTVQMWDSRAAES---GSAEPSKIRPGGGSAICSVEFDPTGGPSLAVGCADRCAYVY  248

Query  761   DLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWD-TDHRNLVRTYKGHINT  937
             D+R   +P+  L+GH K V+YARFLD RTV+T+S DG +K WD ++ R +VRTY+GH+N+
Sbjct  249   DIRRLVDPVVALEGHSKTVSYARFLDPRTVVTASTDGSLKTWDVSEGRRVVRTYRGHVNS  308

Query  938   TRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWV--YGCKSA-TGQPGSENGFISSV  1108
               FVGLSVW++GGL++ GSE++ V VYDTRWG+P+W+  +G  S  TG+ G++  F+SSV
Sbjct  309   RNFVGLSVWRHGGLLASGSEDDNVVVYDTRWGDPVWIHRFGVGSGHTGRVGTDRQFVSSV  368

Query  1109  CWMQRGDDHCTLVAGGSDGVLRVFAGK  1189
             CW Q G+D C LVAGGSDGVL VF+G+
Sbjct  369   CWRQVGEDGCVLVAGGSDGVLEVFSGQ  395



>emb|CDX87159.1| BnaC09g04740D [Brassica napus]
Length=370

 Score =   370 bits (950),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 186/328 (57%), Positives = 228/328 (70%), Gaps = 6/328 (2%)
 Frame = +2

Query  230   GVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVS--LDHSSACDYYICTP  403
             G +EFDP+DN LAT GI+RKIR Y + SL+        G+      +D ++AC+YYICTP
Sbjct  42    GAIEFDPTDNILATAGISRKIRFYGLTSLLRTTAGICGGAGGGVNFVDQTNACEYYICTP  101

Query  404   AKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvv  583
             AKLSSLRW+PG   RV+GSGDYDGVV EYDLE+R PVFERDEHGGRRVWSVDY+      
Sbjct  102   AKLSSLRWRPGACGRVIGSGDYDGVVTEYDLEKRTPVFERDEHGGRRVWSVDYTRHGGAA  161

Query  584   gasgsdd--gTMQTWDPRCPNGNCLATVQPSK-ARSAVCCVQFSPFA-PSIAAGCADRKT  751
                 S    GTMQ WDPRCP    +  V+P+   RSAVCCV+F P    ++A GCADR+ 
Sbjct  162   AVGASGSDDGTMQVWDPRCPPEESVGVVRPAGLCRSAVCCVEFDPSGGHAVAVGCADRRG  221

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             Y YD+R   +P   L GH K V+Y RFLD  TV+T+  DGC+K+W  +   ++RTY+GH+
Sbjct  222   YVYDMRKLVDPALTLQGHTKTVSYVRFLDGGTVVTAGTDGCLKLWSVEDGRVIRTYEGHV  281

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVC  1111
             N   FVGLSVW+NG L  CGSENN+VFVYD RW +P+WV G +      GSE  F+SSVC
Sbjct  282   NNRNFVGLSVWRNGALFGCGSENNRVFVYDRRWRKPVWVDGFEPVGMTSGSEKRFVSSVC  341

Query  1112  WMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             W Q G D CTLVAGGSDGVL+V+ GKR+
Sbjct  342   WRQSGVDQCTLVAGGSDGVLQVYVGKRK  369



>ref|XP_009141697.1| PREDICTED: WD repeat-containing protein RUP2 [Brassica rapa]
Length=390

 Score =   370 bits (950),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 186/328 (57%), Positives = 228/328 (70%), Gaps = 6/328 (2%)
 Frame = +2

Query  230   GVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVS--LDHSSACDYYICTP  403
             G +EFDP+DN LAT GI+RKIR Y + SL+        G+      +D  +AC+YYICTP
Sbjct  62    GAIEFDPTDNILATAGISRKIRFYGLASLLRNTAGVCGGAGGGVSFVDQVTACEYYICTP  121

Query  404   AKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvv  583
             AKLSSLRW+PG  SRV+GSGDYDGVV EYDLE+R PVFERDEHGGRRVWSVDY+      
Sbjct  122   AKLSSLRWRPGSCSRVIGSGDYDGVVTEYDLEKRTPVFERDEHGGRRVWSVDYTRHGGAA  181

Query  584   gasgsdd--gTMQTWDPRCPNGNCLATVQPSK-ARSAVCCVQFSPFA-PSIAAGCADRKT  751
                 S    GTMQ WDPRCP    +  V+P+   RSAVCCV+F P    ++A GCADR+ 
Sbjct  182   TVGASGSDDGTMQVWDPRCPPEESVGVVRPAGLCRSAVCCVEFDPSGGHAVAVGCADRRG  241

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             Y YD+R   +P   L GH K V+Y RFLD  TV+T+  DGC+K+W  +   ++RTY+GH+
Sbjct  242   YVYDMRKLVDPALTLQGHTKTVSYVRFLDGGTVVTAGTDGCLKLWSVEDGRVIRTYEGHV  301

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVC  1111
             N   FVGLSVW+NG L  CGSENN+VFVYD RW +P+WV G +      GS+  F+SSVC
Sbjct  302   NNRNFVGLSVWRNGALFGCGSENNRVFVYDRRWRKPVWVDGFEPVGMTSGSDKRFVSSVC  361

Query  1112  WMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             W Q G D CTLVAGGSDGVL+V+ GKR+
Sbjct  362   WRQSGVDQCTLVAGGSDGVLQVYVGKRK  389



>emb|CDY16865.1| BnaA09g05170D [Brassica napus]
Length=371

 Score =   369 bits (946),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 186/328 (57%), Positives = 228/328 (70%), Gaps = 6/328 (2%)
 Frame = +2

Query  230   GVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVS--LDHSSACDYYICTP  403
             G +EFDP+DN LAT GI+RKIR Y + SL+        G+      +D  +AC+YYICTP
Sbjct  43    GAIEFDPTDNILATAGISRKIRFYGLASLLRNTAGVCGGAGGGVSFVDQVTACEYYICTP  102

Query  404   AKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvv  583
             AKLSSLRW+PG  SRV+GSGDYDGVV EYDLE+R PVFERDEHGGRRVWSVDY+      
Sbjct  103   AKLSSLRWRPGSCSRVIGSGDYDGVVTEYDLEKRTPVFERDEHGGRRVWSVDYTRHGGAA  162

Query  584   gasgsdd--gTMQTWDPRCPNGNCLATVQPSK-ARSAVCCVQFSPFA-PSIAAGCADRKT  751
                 S    GTMQ WDPRCP    +  V+P+   RSAVCCV+F P    ++A GCADR+ 
Sbjct  163   AVGASGSDDGTMQVWDPRCPPEESVGVVRPAGLCRSAVCCVEFDPSGGHAVAVGCADRRG  222

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             Y YD+R   +P   L GH K V+Y RFLD  TV+T+  DGC+K+W  +   ++RTY+GH+
Sbjct  223   YVYDMRKLVDPALTLQGHTKTVSYVRFLDGGTVVTAGTDGCLKLWSVEDGRVIRTYEGHV  282

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVC  1111
             N   FVGLSVW+NG L  CGSENN+VFVYD RW +P+WV G +      GS+  F+SSVC
Sbjct  283   NNRNFVGLSVWRNGALFGCGSENNRVFVYDRRWRKPVWVDGFEPVGMTSGSDKRFVSSVC  342

Query  1112  WMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
             W Q G D CTLVAGGSDGVL+V+ GKR+
Sbjct  343   WRQSGVDQCTLVAGGSDGVLQVYVGKRK  370



>ref|XP_010456659.1| PREDICTED: WD repeat-containing protein RUP2-like [Camelina sativa]
Length=547

 Score =   374 bits (961),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 186/323 (58%), Positives = 227/323 (70%), Gaps = 6/323 (2%)
 Frame = +2

Query  221   DALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICT  400
             D +G +EFDP+DN +AT GI+RKIR Y + SL+        G   V  D ++AC+YYICT
Sbjct  43    DVIGAIEFDPTDNIVATAGISRKIRFYGLPSLLRTSAAVSGGVSFV--DQATACEYYICT  100

Query  401   PAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsv  580
             PAKLSSLRW+PG   RV+GSGDYDGVV EYDLE+R PVFERDEHGGRRVWSVDY+     
Sbjct  101   PAKLSSLRWRPGSGGRVIGSGDYDGVVTEYDLEKRTPVFERDEHGGRRVWSVDYTRHGDS  160

Query  581   vgasgsdd--gTMQTWDPRCPNGNCLATVQPSK-ARSAVCCVQFSPFA-PSIAAGCADRK  748
                  S    GTMQ WDPRCP    L  V+P+   RSAVCCV+F P   P++A GCADRK
Sbjct  161   SAIGASGSDDGTMQVWDPRCPPEESLGLVRPAGICRSAVCCVEFDPSGGPAVAVGCADRK  220

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              Y YD+R   +P   L GH K V+Y RFLD  TV+T+  DGC+K+W  +  +++RTY+GH
Sbjct  221   GYIYDMRKLVDPALTLQGHNKTVSYVRFLDGGTVVTAGTDGCLKLWSVEDGSVIRTYEGH  280

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSV  1108
             +N   FVGLSVW+NG L  CGSENN+VFVYD RWG+P+WV G +      GS+  F+SSV
Sbjct  281   VNGRNFVGLSVWRNGALFGCGSENNKVFVYDKRWGKPVWVDGFEPVGMNSGSDKRFVSSV  340

Query  1109  CWMQRGDDHCTLVAGGSDGVLRV  1177
             CW Q G D CTLVAGGSDGVL++
Sbjct  341   CWRQSGVDQCTLVAGGSDGVLQL  363


 Score =   222 bits (566),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 132/184 (72%), Gaps = 2/184 (1%)
 Frame = +2

Query  650   LATVQPSK-ARSAVCCVQFSPFA-PSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTY  823
             L  V+P+   RSAVCCV+F P   P++A GCADRK Y YD+R   +P   L GH K V+Y
Sbjct  363   LGLVRPAGICRSAVCCVEFDPSGGPAVAVGCADRKGYIYDMRKLVDPALTLQGHNKTVSY  422

Query  824   ARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENN  1003
              RFLD  TV+T+  DGC+K+W  +  +++RTY+GH+N   FVGLSVW+NG L  CGSENN
Sbjct  423   VRFLDGGTVVTAGTDGCLKLWSVEDGSVIRTYEGHVNGRNFVGLSVWRNGALFGCGSENN  482

Query  1004  QVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFA  1183
             +VFVYD RWG+P+WV G +      GS+  F+SSVCW Q G D CTLVAGGSDGVL+V+ 
Sbjct  483   KVFVYDKRWGKPVWVDGFEPVGMNSGSDKRFVSSVCWRQSGVDQCTLVAGGSDGVLQVYV  542

Query  1184  GKRR  1195
             GKR+
Sbjct  543   GKRK  546



>ref|XP_010521332.1| PREDICTED: WD repeat-containing protein RUP1 isoform X1 [Tarenaya 
hassleriana]
Length=444

 Score =   366 bits (939),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 198/383 (52%), Positives = 260/383 (68%), Gaps = 28/383 (7%)
 Frame = +2

Query  62    WAMKNFSS-SPTSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVL  238
             W MK+ SS +P  +++      + + D +K RC+W+  +SA + +  SA  A SDA+G +
Sbjct  26    WPMKSLSSLAPMESSD------KGDKDVDKPRCEWNLSLSAAIVASGSAKTAPSDAIGAI  79

Query  239   EFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSS  418
             EFD +   LATGGI+RKIR Y ++S  D        S  V LDH     + ICTPAKLSS
Sbjct  80    EFDSTGEILATGGISRKIRFYRMSSFPD--------SPTVVLDHGEVLQFCICTPAKLSS  131

Query  419   LRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgs  598
             LRW+P  ++RV+GSGDYDGVV EYD E+RVPVFERDEHGGRRVWSVDY+     V  +  
Sbjct  132   LRWRPDSSNRVIGSGDYDGVVTEYDAEKRVPVFERDEHGGRRVWSVDYTRYTGSVIGASG  191

Query  599   d-dgTMQTWDPRCPNGNCLATVQPSKAR----SAVCCVQFSPF-APSIAAGCADRKTYTY  760
               DGT+Q WD R        + +PSK R    SA+C V+F P   PS+A GCADR  Y Y
Sbjct  192   SDDGTVQMWDSRAAES---GSAEPSKIRPGGGSAICSVEFDPTGGPSLAVGCADRCAYVY  248

Query  761   DLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWD-TDHRNLVRTYKGHINT  937
             D+R   +P+  L+GH K V+YARFLD RTV+T+S DG +K WD ++ R +VRTY+GH+N+
Sbjct  249   DIRRLVDPVVALEGHSKTVSYARFLDPRTVVTASTDGSLKTWDVSEGRRVVRTYRGHVNS  308

Query  938   TRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWV--YGCKSA-TGQPGSENGFISSV  1108
               FVGLSVW++GGL++ GSE++ V VYDTRWG+P+W+  +G  S  TG+ G++  F+SSV
Sbjct  309   RNFVGLSVWRHGGLLASGSEDDNVVVYDTRWGDPVWIHRFGVGSGHTGRVGTDRQFVSSV  368

Query  1109  CWMQRGDDHCTLVAGGSDGVLRV  1177
             CW Q G+D C LVAGGSDGVL V
Sbjct  369   CWRQVGEDGCVLVAGGSDGVLEV  391



>ref|XP_010519483.1| PREDICTED: WD repeat-containing protein RUP2 [Tarenaya hassleriana]
Length=381

 Score =   363 bits (931),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 199/354 (56%), Positives = 247/354 (70%), Gaps = 19/354 (5%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             RC WD  +SAV+SS + +V A SD +G +EFDP+D  +ATGGI+RKIR Y ++SL     
Sbjct  37    RCGWDLSLSAVLSSSSPSV-AASDVIGAIEFDPTDKIIATGGISRKIRFYGLDSL-----  90

Query  332   DQDEGSDAVSLD-HSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRV  508
                  S  +S D  ++AC+YYICTPAKLSSLRW+P  + RV+GSGDYDGVV EYDLE+R 
Sbjct  91    -----SHKISGDGDAAACEYYICTPAKLSSLRWRPRSDGRVIGSGDYDGVVTEYDLEKRS  145

Query  509   PVFERDEHGGRRVWSVDYshsdsvvgasgsdd--gTMQTWDPRCPNGNCLATVQPSKARS  682
             PVFERDEHGGRRVWSVDY+          S    GT+  WDPR    N +A V+P ++ S
Sbjct  146   PVFERDEHGGRRVWSVDYTRLAGASVVGASGSDDGTVHVWDPRSRPENSIAIVRPGRS-S  204

Query  683   AVCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTS  859
             AVCCV+F P    +IA GCADR+ Y YD+R   EP   L+GH K V+Y RFLD  TV+T+
Sbjct  205   AVCCVEFEPSGGATIAVGCADRRGYVYDVRKLVEPALTLEGHAKTVSYVRFLDVHTVVTA  264

Query  860   SVDGCIKMWDTDHRN--LVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWG  1033
               DGC+K+W  D     + RTY+GH+N+  FVGLSVW+NGGL  CGSENN+VFVYD RW 
Sbjct  265   GTDGCLKLWKIDGGGGRVGRTYEGHVNSRNFVGLSVWRNGGLFGCGSENNRVFVYDRRWS  324

Query  1034  EPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRR  1195
              P+WV+  + A G  G E  F+SSVCW Q G D CTLVAGGSDGVL+V+ GKR+
Sbjct  325   RPVWVHEFEPA-GMTGLEQRFVSSVCWRQSGVDQCTLVAGGSDGVLQVYVGKRK  377



>ref|XP_010444626.1| PREDICTED: WD repeat-containing protein RUP1-like [Camelina sativa]
Length=389

 Score =   357 bits (917),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 200/370 (54%), Positives = 255/370 (69%), Gaps = 23/370 (6%)
 Frame = +2

Query  92    TSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLAT  271
             TS++  S TI   E D    RCDWD  +SAVVSS ++     SDA+G +EFDP+   +AT
Sbjct  39    TSSSSLSHTIM--ETDNNIPRCDWDLSLSAVVSSASTG----SDAIGTIEFDPTGEIIAT  92

Query  272   GGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRV  451
             GGIARKIR Y ++SL+     +D        DH +A +  ICTPAKLSSLRW+P  + RV
Sbjct  93    GGIARKIRTYRLSSLLRS---RD--------DHVTASESCICTPAKLSSLRWRPDLSGRV  141

Query  452   LGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsd-dgTMQTWDP  628
             +GSGDYDGVV EYD+E++VPVFERDEHGGRR+ S+DY+  +  +  +    DGT+Q WDP
Sbjct  142   IGSGDYDGVVTEYDVEKQVPVFERDEHGGRRIGSMDYTLHNGSLIGASGSDDGTVQMWDP  201

Query  629   RCPNGNCLATVQPSKARSAVCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGH  805
             R  NG  L  +      +AVC V+F PF   S+A GCADR  Y YD+R   +PL +LDGH
Sbjct  202   R--NGGSLEEMVRPGGGAAVCSVEFDPFGGASLAVGCADRNAYVYDIRRLVDPLIVLDGH  259

Query  806   LKAVTYARFLDRRTVLTSSVDGCIKMWDTDH-RNLVRTYKGHINTTRFVGLSVWKNGGLI  982
              K VTYARF+D  T++T S DG +K WD ++ R +VRTY+GH+N+  FVGLSVW++GGL+
Sbjct  260   TKTVTYARFMDPHTIVTGSTDGSLKQWDINNGRRVVRTYRGHVNSRNFVGLSVWRHGGLV  319

Query  983   SCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSD  1162
               GSENNQVFVYD RW EP+WV G    T + GS+  F+SSVC  Q  +D CTLVAGGSD
Sbjct  320   VSGSENNQVFVYDKRWEEPVWVCGL-GQTDRFGSDRRFVSSVCLRQVDEDWCTLVAGGSD  378

Query  1163  GVLRVFAGKR  1192
             GVL +F+GKR
Sbjct  379   GVLEIFSGKR  388



>ref|NP_200038.1| UV-B induced transducin protein [Arabidopsis thaliana]
 sp|Q9LTJ6.1|RUP1_ARATH RecName: Full=WD repeat-containing protein RUP1; AltName: Full=Protein 
EARLY FLOWERING BY OVEREXPRESSION 1; AltName: Full=Protein 
REPRESSOR OF UV-B PHOTOMORPHOGENESIS 1 [Arabidopsis 
thaliana]
 dbj|BAA97468.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO24582.1| At5g52250 [Arabidopsis thaliana]
 dbj|BAF00070.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96192.1| UV-B induced transducin protein [Arabidopsis thaliana]
Length=385

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 250/351 (71%), Gaps = 23/351 (7%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             RCDWD  +SAVVSS ++     SDA+G +EFDP+   +ATGGIARKIR Y ++SL+    
Sbjct  53    RCDWDLSLSAVVSSASTG----SDAIGAIEFDPTGEIIATGGIARKIRSYRLSSLL----  104

Query  332   DQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVP  511
                E  D    DH +A + YICTPAKLSSL+W+P ++ RV+GSGDYDGVV EYD+E++VP
Sbjct  105   ---ESRD----DHVTASESYICTPAKLSSLKWRPDFSGRVIGSGDYDGVVTEYDVEKQVP  157

Query  512   VFERDEHGGRRVWSVDYshsdsvvgasgsd-dgTMQTWDPRCPNGNCL-ATVQPSKARSA  685
             V ERDEHGGRR+WSVDY+  +  +  +    DGT+Q WDPR  NG  L  TV+P    +A
Sbjct  158   VSERDEHGGRRIWSVDYTLYNGSLIGASGSDDGTVQMWDPR--NGGTLEETVRPGGG-AA  214

Query  686   VCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSS  862
             +C V+F PF   SIA GCADR  Y YD+R   +PL +LDGH K VTYARF+D  T++T S
Sbjct  215   ICSVEFDPFGGSSIAVGCADRNAYVYDIRRLVDPLIVLDGHTKTVTYARFMDSHTIVTGS  274

Query  863   VDGCIKMWDTDH-RNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
              DG +K WD D+ R +VRTY+GH+N+  FVGLSVW++GGL+  GSENNQVFVYD RW EP
Sbjct  275   TDGSLKQWDIDNGRRVVRTYRGHVNSRNFVGLSVWRHGGLVVSGSENNQVFVYDKRWEEP  334

Query  1040  IWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKR  1192
             +WV G    T + GS+  F+SSVC  Q  +D CTLVAGGSDG L +F+GK+
Sbjct  335   VWVCGL-GHTNRFGSDRRFVSSVCLRQVDEDWCTLVAGGSDGALEIFSGKQ  384



>ref|XP_010482576.1| PREDICTED: WD repeat-containing protein RUP1 [Camelina sativa]
Length=382

 Score =   356 bits (913),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 254/373 (68%), Gaps = 29/373 (8%)
 Frame = +2

Query  89    PTSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLA  268
             PT    +S  +  E       RCDWD  +SAVVSS ++     SDA+G +EFDPS   +A
Sbjct  33    PTIMTSSSTVMNTEN----IPRCDWDLSLSAVVSSASTG----SDAIGAIEFDPSGETIA  84

Query  269   TGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSR  448
             TGGIARKIR Y ++SL+               DH +A +  ICTPAKLSSLRW+P  + R
Sbjct  85    TGGIARKIRTYHLSSLL-----------GSRDDHVTASESCICTPAKLSSLRWRPDLSGR  133

Query  449   VLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsd-dgTMQTWD  625
              +GSGDYDGVV EYD+E++VPVFERDEHGGRR+WSVDY+  +  +  +    DGT+Q WD
Sbjct  134   AIGSGDYDGVVTEYDVEKQVPVFERDEHGGRRIWSVDYTLHNGSLIGASGSDDGTVQMWD  193

Query  626   PRCPNGNCL-ATVQPSKARSAVCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILD  799
             PR  NG  L  TV+P    +AVC V+F PF   S+A GCADR  Y YD+R   +PL +LD
Sbjct  194   PR--NGRTLEETVRPGGG-AAVCSVEFDPFGGSSLAVGCADRNAYVYDIRRLVDPLIVLD  250

Query  800   GHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDH-RNLVRTYKGHINTTRFVGLSVWKNGG  976
             GH K VTYARF+D  T++T S DG +K WD D+ R +VRTY+GH+N+  FVGLSVW++GG
Sbjct  251   GHTKTVTYARFMDPHTIVTGSTDGSLKQWDIDNGRRVVRTYRGHVNSRNFVGLSVWRHGG  310

Query  977   LISCGSENNQVFVYDTRWGEPIWVYGCK-SATGQPGSENGFISSVCWMQRGDDHCTLVAG  1153
             L+  GSENNQVFVYD RW EP+WV  C+   T + GS+  F+SSVC  Q  +D CTLVAG
Sbjct  311   LVVSGSENNQVFVYDKRWEEPVWV--CELGQTDRFGSDRRFVSSVCLRQVDEDWCTLVAG  368

Query  1154  GSDGVLRVFAGKR  1192
             GSDGVL +F+GKR
Sbjct  369   GSDGVLEIFSGKR  381



>gb|EPS69049.1| hypothetical protein M569_05710, partial [Genlisea aurea]
Length=357

 Score =   352 bits (903),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 196/360 (54%), Positives = 250/360 (69%), Gaps = 32/360 (9%)
 Frame = +2

Query  149   ARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPF  328
             AR +WDF ++AVVSS +SA    SDA+GV+EFD +D+ LATGGIAR+IR+Y V  L    
Sbjct  19    ARYEWDFTLTAVVSSSSSA----SDAIGVIEFDQTDSLLATGGIARRIRIYVVEKLA---  71

Query  329   WDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRV  508
                  GSDA       AC++Y+CTPAKLSSL+WKPG  SR+LGSGDYDGVV+E+DLERR 
Sbjct  72    -----GSDA-------ACEFYMCTPAKLSSLKWKPGSGSRILGSGDYDGVVLEHDLERRF  119

Query  509   PVFERDEHGGRRVWSVDYshsdsvvgasgsdd--gTMQTWDPRCPNGNCLATVQPSK-AR  679
             PV+ERDEH GRRVWS+DY+   S +    S    GT Q WD RC + + +A ++P    R
Sbjct  120   PVYERDEHSGRRVWSIDYASEYSSLSVGASASDDGTAQMWDARCDSCDSVAVLKPDPLTR  179

Query  680   SAVCCVQFSPFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLT  856
             +A+C V+F+PF    +  G ADR+ Y YD+R  A P+F LDGH K VTYA+FLD RT+++
Sbjct  180   TAICSVEFNPFGGHLVVVGSADRRVYGYDVRRMAAPVFKLDGHQKPVTYAKFLDGRTIVS  239

Query  857   SSVDGCIKMW---DTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTR  1027
             SS DGC+KMW   D DH   +RTY GH N  RFVGLSVW++GGL+ CGSE+N VFVYD R
Sbjct  240   SSTDGCLKMWRPEDLDHP--IRTYSGHTNARRFVGLSVWRSGGLLCCGSEDNNVFVYDNR  297

Query  1028  WGEPIWVYGCKSATGQPGSENG---FISSVCWMQRG-DDHCTLVAGGSDGVLRVFAGKRR  1195
             W  PIW+ G +  +     ++G   F+S VCW Q    +  TLVAGGSDGVL+VF G++R
Sbjct  298   WSNPIWIRGFEETSNGAQRQSGSDPFVSGVCWRQSSCGETSTLVAGGSDGVLKVFGGRKR  357



>gb|AAM64761.1| contains similarity to photomorphogenesis repressor protein [Arabidopsis 
thaliana]
Length=385

 Score =   351 bits (901),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 195/351 (56%), Positives = 249/351 (71%), Gaps = 23/351 (7%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             RCDWD  +SAVVSS ++     SDA+G +EFDP+   +ATGGIARKIR Y ++SL+    
Sbjct  53    RCDWDLSLSAVVSSASTG----SDAIGAIEFDPTGEIIATGGIARKIRSYRLSSLL----  104

Query  332   DQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVP  511
                E  D    DH +A +  ICTPAKLSSL+W+P ++ RV+GSGDYDGVV EYD+E++VP
Sbjct  105   ---ESRD----DHVTASESCICTPAKLSSLKWRPDFSGRVIGSGDYDGVVTEYDVEKQVP  157

Query  512   VFERDEHGGRRVWSVDYshsdsvvgasgsd-dgTMQTWDPRCPNGNCL-ATVQPSKARSA  685
             V ERDEHGGRR+WSVDY+  +  +  +    DGT+Q WDPR  NG  L  TV+P    +A
Sbjct  158   VSERDEHGGRRIWSVDYTLYNGSLLGASGSDDGTVQMWDPR--NGGTLEETVRPGGG-AA  214

Query  686   VCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSS  862
             +C V+F PF   SIA GCAD+  Y YD+R   +PL +LDGH K VTYARF+D  T++T S
Sbjct  215   ICSVEFDPFGGSSIAVGCADQNAYVYDIRRLVDPLIVLDGHTKTVTYARFMDSHTIVTGS  274

Query  863   VDGCIKMWDTDH-RNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
              DG +K WD D+ R +VRTY+GH+N+  FVGLSVW++GGL+  GSENNQVFVYD RW EP
Sbjct  275   TDGSLKQWDIDNGRRVVRTYRGHVNSRNFVGLSVWRHGGLVVSGSENNQVFVYDKRWEEP  334

Query  1040  IWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKR  1192
             +WV G    T + GS+  F+SSVC  Q  +D CTLVAGGSDG L +F+GK+
Sbjct  335   VWVCGL-GHTNRFGSDRRFVSSVCLRQVDEDWCTLVAGGSDGALEIFSGKQ  384



>ref|XP_010442746.1| PREDICTED: WD repeat-containing protein RUP1-like [Camelina sativa]
Length=381

 Score =   350 bits (897),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 250/352 (71%), Gaps = 25/352 (7%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             RCDWD  +SAVVSS ++     SDA+G +EFDPS   +ATGGIARKIR Y ++SL+    
Sbjct  49    RCDWDLSLSAVVSSASTG----SDAIGTIEFDPSGEIIATGGIARKIRTYRLSSLLRS--  102

Query  332   DQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVP  511
              +D        DH +A +  ICTPAKLSSLRW+P  + RV+GSGDYDGVV EYD+E++VP
Sbjct  103   -RD--------DHVTASESCICTPAKLSSLRWRPDLSGRVIGSGDYDGVVTEYDVEKQVP  153

Query  512   VFERDEHGGRRVWSVDYshsdsvvgasgsd-dgTMQTWDPRCPNGNCL-ATVQPSKARSA  685
             VFERDEHGGRR+WS+DY+  +  +  +    DGT+Q WDPR  NG  L  TV+P    +A
Sbjct  154   VFERDEHGGRRIWSMDYTLHNGSLIGASGSDDGTVQMWDPR--NGGSLEGTVRPGGG-AA  210

Query  686   VCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSS  862
             +C V+F PF   S+A GCADR  Y YD+R   +PL +LDGH K VTYARF++  T++T S
Sbjct  211   ICSVEFDPFGGSSLAVGCADRNAYVYDIRRLVDPLIVLDGHTKTVTYARFMNSHTIVTGS  270

Query  863   VDGCIKMWDTDH-RNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
              DG +K WD ++ R +VRTY+GH+N+  FVGLSVW++GGL+  GSENNQVFVYD RW EP
Sbjct  271   TDGSLKQWDINNGRRVVRTYRGHVNSRNFVGLSVWRHGGLVVSGSENNQVFVYDKRWEEP  330

Query  1040  IWVYGCK-SATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKR  1192
             +WV  C+   T + GS+  F+SSVC  Q  +D CTLVAGGSDGVL +F+G R
Sbjct  331   VWV--CELGQTDRFGSDRRFVSSVCLRQVDEDWCTLVAGGSDGVLEIFSGIR  380



>ref|XP_002864159.1| hypothetical protein ARALYDRAFT_495294 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40418.1| hypothetical protein ARALYDRAFT_495294 [Arabidopsis lyrata subsp. 
lyrata]
Length=384

 Score =   348 bits (892),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 196/354 (55%), Positives = 247/354 (70%), Gaps = 29/354 (8%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             RCDWD  +SAVVSS ++     SDA+G +EFDP+   +ATGGIARKIR Y ++SL+    
Sbjct  52    RCDWDLSLSAVVSSASTG----SDAIGAIEFDPTGEIIATGGIARKIRSYRLSSLL----  103

Query  332   DQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVP  511
                E  D    DH +A D  I TPAKLSSL+W+P  + RV+GSGDYDGVV EYD+E++VP
Sbjct  104   ---ESRD----DHVTASDSCIYTPAKLSSLKWRPDLSGRVIGSGDYDGVVTEYDVEKQVP  156

Query  512   VFERDEHGGRRVWSVDYshsdsvvgasgsd-dgTMQTWDPRCPNGNCL-ATVQPSKARSA  685
             V ERDEHGGRR+WSVDY+  +  +  +    DGT+Q WDPR  NG  L  TV+P    +A
Sbjct  157   VSERDEHGGRRIWSVDYTLYNGSLIGASGSDDGTVQMWDPR--NGGTLEETVRPGGG-AA  213

Query  686   VCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSS  862
             +C V+F PF   SIA GCADR  Y YD+R   +PL +LDGH K VTYARF+D  T++T S
Sbjct  214   ICSVEFDPFGGSSIAVGCADRNAYVYDIRRLVDPLIVLDGHTKTVTYARFMDSHTIVTGS  273

Query  863   VDGCIKMWDTDH-RNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
              DG +K W+ D+ R +VRTY+GH+N+  FVGLSVW++GGL+  GSENNQVFVYD RW EP
Sbjct  274   TDGSLKQWNIDNGRRVVRTYRGHVNSRNFVGLSVWRHGGLVVSGSENNQVFVYDKRWEEP  333

Query  1040  IWVYGCKSATGQP---GSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKR  1192
             +WV G     GQP   G++  F+SSVC  Q  +D CTL AGGSDG L +F+GKR
Sbjct  334   VWVCGL----GQPDRFGADRRFVSSVCLRQVDEDWCTLAAGGSDGALEIFSGKR  383



>ref|XP_006280618.1| hypothetical protein CARUB_v10026582mg [Capsella rubella]
 gb|EOA13516.1| hypothetical protein CARUB_v10026582mg [Capsella rubella]
Length=385

 Score =   343 bits (879),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 196/354 (55%), Positives = 251/354 (71%), Gaps = 27/354 (8%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             RCDWD  +SAVVSS ++     SD++G +EFDP+ + +ATGGIARKIR Y ++SL+    
Sbjct  51    RCDWDLSLSAVVSSASTG----SDSIGAIEFDPTGDIIATGGIARKIRSYRLSSLL----  102

Query  332   DQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVP  511
                    +   DH+ A +  ICTPAKLSSL+W+P  + RV+GSGDYDGVV EYD+E++VP
Sbjct  103   -----RSSSRDDHARASESCICTPAKLSSLKWRPDLSGRVIGSGDYDGVVTEYDVEKQVP  157

Query  512   VFERDEHGGRRVWSVDYshsdsvvgasgsd-dgTMQTWDPRCPNGNCL-ATVQPSKARSA  685
             +FERDEHGGRR+WSVDY+  +  + A+    DGT+Q WDPR  NG  L  TV+P    +A
Sbjct  158   IFERDEHGGRRIWSVDYTLHNGSLVAASGSDDGTVQMWDPR--NGGSLEETVRPGGG-AA  214

Query  686   VCCVQFSPF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSS  862
             VC V+F P    S+A GCADR  Y YD+R   +PL +LDGH K VTYARF+D RT++T S
Sbjct  215   VCSVEFDPLGGSSLAVGCADRNAYVYDIRRLVDPLLVLDGHTKTVTYARFMDPRTIVTGS  274

Query  863   VDGCIKMWDTDH-RNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
              DG +K WD D+ R +VRTY+GH+N+  FVGLSVW++GGL+  GSENNQVFVYD RW EP
Sbjct  275   TDGSLKQWDIDNGRRVVRTYRGHVNSRNFVGLSVWRHGGLVVSGSENNQVFVYDKRWEEP  334

Query  1040  IWVYGCKSATGQP---GSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKR  1192
             +W  G     GQP   GS+  F+SSVC  Q  +D CTLVAGGSDGVL +F+G+R
Sbjct  335   VWTCGL----GQPDRFGSDRRFVSSVCLRQVDEDWCTLVAGGSDGVLEIFSGQR  384



>ref|XP_009418639.1| PREDICTED: WD repeat-containing protein RUP2-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 189/355 (53%), Positives = 238/355 (67%), Gaps = 15/355 (4%)
 Frame = +2

Query  143   EKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVD  322
             E+ARC+W+FR+SA VS   +A GA+SDA+G +EFDP+D  LA GGIARKIR+Y + SL+ 
Sbjct  25    ERARCEWNFRLSAAVS--PAATGAISDAIGTVEFDPTDRLLAAGGIARKIRIYGLRSLLP  82

Query  323   PFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLER  502
                 ++ G      DHS+AC   ICTPAKLSSLRW+P  + R++GSGDYDGVV EYD+ER
Sbjct  83    ----EERGPSPTFSDHSTACRLCICTPAKLSSLRWRPDSSGRIIGSGDYDGVVTEYDVER  138

Query  503   RVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARS  682
               PVFERDEH GRRVW VDY   D  +GASGSDDGT+Q WD RC +G C A    ++A  
Sbjct  139   GFPVFERDEHAGRRVWCVDY-SVDGALGASGSDDGTVQLWDSRCADGGCTAV---ARADG  194

Query  683   AVCCVQFSP-FAPSIAAGCADRKTYTYDLRN-TAEPLFILDGHLKAVTYARFL-DRRTVL  853
             AVC V+F P   P +  G ADR  Y +DLR  +A P+  L GH + VTY RF    R V+
Sbjct  195   AVCSVEFDPEGGPWVGVGSADRHAYVFDLRAVSAGPVAALSGHGRTVTYVRFAPGGRRVV  254

Query  854   TSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWG  1033
             TS +DG  ++WD      VR Y+GH N+  F+G+SVW+  GLI  GSE+N+VFVYD RWG
Sbjct  255   TSGIDGSHRLWDWAEGRQVRAYRGHANSRNFIGMSVWRGAGLIGSGSESNEVFVYDLRWG  314

Query  1034  EPIWVYGCKSATGQPGSENGFISSVCWMQR--GDDHCTLVAGGSDGVLRVFAGKR  1192
             EPIWV G  +   +  S +GF+    W Q   GD    L AGGSDGVL+VF G++
Sbjct  315   EPIWVQGFGNRGEEGQSRDGFVGVASWRQSAAGDGEGALAAGGSDGVLQVFVGRK  369



>ref|XP_006401846.1| hypothetical protein EUTSA_v10015606mg [Eutrema salsugineum]
 gb|ESQ43299.1| hypothetical protein EUTSA_v10015606mg [Eutrema salsugineum]
Length=400

 Score =   343 bits (879),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 192/350 (55%), Positives = 242/350 (69%), Gaps = 21/350 (6%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             R DWD  +SAVVSS ++     SDA+G +EFDPS   LATGGIARKIR Y + SL+    
Sbjct  68    RLDWDLSLSAVVSSSSTG----SDAIGAIEFDPSGEILATGGIARKIRSYRLASLL----  119

Query  332   DQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVP  511
              +++  D V      +C   ICTPAKLSSL+W+P  + RV+GSGDYDGVV EYD+E+ VP
Sbjct  120   -RNDDDDHVV---EESC---ICTPAKLSSLKWRPDLSGRVIGSGDYDGVVTEYDVEKGVP  172

Query  512   VFERDEHGGRRVWSVDYshsdsvvgasgsd-dgTMQTWDPRCPNGNCLATVQPSKARSAV  688
             VFERDEHGGRR+WSVDY+  +  V  +    DGT Q WDPR  NG    TV+P    +A+
Sbjct  173   VFERDEHGGRRIWSVDYTLQNGSVIGASGSDDGTFQMWDPR--NGGSEETVRPGGGTAAI  230

Query  689   CCVQFSPFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSV  865
             C V+F PF    +A GCADR  Y YD+R   +P+ +LDGH K VTYARF+D+RT++T S 
Sbjct  231   CSVEFDPFGGYFLAVGCADRNAYVYDIRRLVDPVVVLDGHTKTVTYARFMDQRTIVTGST  290

Query  866   DGCIKMWDT-DHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI  1042
             DG +K+WD  +   +VRT +GH+N+  FVGLSVW  GGL+  GSENNQVFVYD RW EP+
Sbjct  291   DGSLKLWDVANGGRVVRTCRGHVNSRNFVGLSVWGQGGLVVSGSENNQVFVYDKRWEEPV  350

Query  1043  WVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKR  1192
             WVYG    T +  S+  F+SSVCW Q  +D CTLVAGGSDGVL +F+ +R
Sbjct  351   WVYGL-GQTDRFESDRRFVSSVCWRQVDEDLCTLVAGGSDGVLEIFSVQR  399



>ref|XP_008806884.1| PREDICTED: WD repeat-containing protein RUP2 [Phoenix dactylifera]
Length=375

 Score =   327 bits (839),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 188/386 (49%), Positives = 251/386 (65%), Gaps = 24/386 (6%)
 Frame = +2

Query  74    NFSSSPTSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPS  253
             N +S  +++   S    +EE   ++ARC+WDF ++ ++S  T+    VSD +G +EFDP+
Sbjct  2     NINSRISNSNNDSNQEDEEETAEDRARCEWDFHLATIISPSTTR--EVSDVIGAIEFDPT  59

Query  254   DNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSL--DHSSACDYYICTPAKLSSLRW  427
              + LATGGI+RKIR+Y+++SL  P      G +  +   DHS+AC +YICTPAKLSSLRW
Sbjct  60    GHLLATGGISRKIRIYALSSLPSP-----HGCNLTTSFSDHSTACKFYICTPAKLSSLRW  114

Query  428   KPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddg  607
             +P    R++GSGDYDGVV EYD+ERRV +FERDEH GRRVWS+DY   +  + ASGSDDG
Sbjct  115   QPDSGGRIIGSGDYDGVVTEYDVERRVAIFERDEHDGRRVWSIDY-SINGELCASGSDDG  173

Query  608   TMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSP-FAPSIAAGCADRKTYTYDLRNTAE-  781
             T   WD RC  G+  A    +KA  AVC V+F P   P I  G ADR  Y YD+R TA  
Sbjct  174   TAHIWDRRCNGGSVWA----AKAGGAVCGVEFDPGGGPWIGVGSADRHAYVYDIRATAAA  229

Query  782   --PLFILDGHLKAVTYARFLDR---RTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
               P+ +L GH +AVTY RF        V+TS  DG  ++W  +    VR ++GH+N   F
Sbjct  230   AGPVAVLGGHGRAVTYVRFATAGGGGRVVTSGTDGTHRLWSWEEGREVRVFRGHVNKRSF  289

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQR-  1123
             VGLSVW+ GGL+  GSE+ +VFVYD RWGEP+WV   + A  +  ++ GF+S+V W Q  
Sbjct  290   VGLSVWREGGLVGSGSESGEVFVYDLRWGEPVWV--SRWAGDRADADWGFVSAVSWRQTP  347

Query  1124  GDDHCTLVAGGSDGVLRVFAGKRRKA  1201
             G+    LVAGGSDGVL+ F  KR++A
Sbjct  348   GEREGMLVAGGSDGVLKAFVSKRKEA  373



>ref|XP_010934729.1| PREDICTED: WD repeat-containing protein RUP2 [Elaeis guineensis]
Length=382

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 181/358 (51%), Positives = 234/358 (65%), Gaps = 16/358 (4%)
 Frame = +2

Query  143   EKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVD  322
             ++ARC+WDF +++++S  T+    VSD +G +EFDP+ + LATGGI+RKIR+Y+++SLV 
Sbjct  30    DRARCEWDFHLASIISPSTTR--EVSDVIGAIEFDPTGHLLATGGISRKIRIYALSSLVS  87

Query  323   PFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLER  502
             P    +        DHS+ C +YICTPAKLSSLRW+P    RV+GSGDYDGVV EYD+E 
Sbjct  88    PHGYNNINPTTNFSDHSTTCKFYICTPAKLSSLRWQPNSGGRVIGSGDYDGVVTEYDVES  147

Query  503   RVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARS  682
              V +FERDEH GRRVWS+DY   D  +G SGSDDGT   WD RC  G+  A    +KA  
Sbjct  148   HVAIFERDEHDGRRVWSIDY-SIDGELGVSGSDDGTAHIWDRRCNGGSVWA----AKAGG  202

Query  683   AVCCVQFSP-FAPSIAAGCADRKTYTYDLRNTAE--PLFILDGHLKAVTYARFLDR---R  844
             AVC V+F P   P I  G ADR  Y YD+R  A   P+ +L GH +AVTY RF       
Sbjct  203   AVCGVEFDPGGGPWIGVGSADRHAYVYDIRAGAAGGPVAVLGGHGRAVTYVRFATAGGGG  262

Query  845   TVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDT  1024
              V+TS  DG  ++W  +    VR Y+GH N   FVGLSVW+ GGL+  GSE+ +VFVYD 
Sbjct  263   RVVTSGTDGSHRLWSWEEGREVRVYRGHANKRSFVGLSVWREGGLVGSGSESGEVFVYDL  322

Query  1025  RWGEPIWVYGCKSATGQPGSENGFISSVCWMQR-GDDHCTLVAGGSDGVLRVFAGKRR  1195
             RWGEP+WV   + A  +  ++ GF+S+V W Q  G+    LVAGGSDGVL+ F  KR+
Sbjct  323   RWGEPVWV--NRWAGDRADADRGFVSAVSWRQTPGEREGLLVAGGSDGVLQAFVSKRK  378



>ref|XP_009396164.1| PREDICTED: WD repeat-containing protein RUP2-like [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 189/354 (53%), Positives = 239/354 (68%), Gaps = 17/354 (5%)
 Frame = +2

Query  149   ARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPF  328
             ARC+WDF +S VVS P++A G VSDA+G +EFDP+D  LATGGIARKIR+YS+ +L+   
Sbjct  67    ARCEWDFWLSTVVS-PSTAAGEVSDAIGAIEFDPTDRLLATGGIARKIRIYSLGTLLP--  123

Query  329   WDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRV  508
               +   S     DHS+AC   ICTPAKLSSLRW+P  + R +GSGDYDGVV EYD+ER V
Sbjct  124   --ESRDSSLTFSDHSTACLLCICTPAKLSSLRWRPDSSGRTVGSGDYDGVVTEYDVERNV  181

Query  509   PVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAV  688
              VFERDEH GRRVWSVDY      +GASGSDDGT+Q WD RC NG  +A    ++A  AV
Sbjct  182   AVFERDEHAGRRVWSVDY-SVSGDLGASGSDDGTVQLWDSRCANGGRVAA---ARAGGAV  237

Query  689   CCVQFSP-FAPSIAAGCADRKTYTYDLRN-TAEPLFILDGHLKAVTYARFLDR-RTVLTS  859
             C V+F P   P + AG ADR  Y +D+R  +A P+  L GH +AVTY RF    R+V+TS
Sbjct  238   CSVEFDPEGGPWVGAGSADRHAYVFDVRAVSAGPVTALGGHGRAVTYVRFAQSGRSVVTS  297

Query  860   SVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
               DG  ++W+      VR Y+GH+N+  FVG+SVW+  GL+  GSE+N+VFVYD RW EP
Sbjct  298   GTDGSHRLWEWADGREVRAYRGHVNSRSFVGMSVWRGAGLVGSGSESNEVFVYDLRWQEP  357

Query  1040  IWVYGCKSATGQPGSENGFISSVCWMQ--RGDDHCTLVAGGSDGVLRVFAGKRR  1195
             IWV G      + G+   F+ +V W Q   G     LVAGGSDGVL+VF G+++
Sbjct  358   IWVRGFGPRREEGGA---FVGAVSWRQAVSGPGEGALVAGGSDGVLQVFVGRKK  408



>ref|XP_006827710.1| hypothetical protein AMTR_s00009p00259660 [Amborella trichopoda]
 gb|ERM95126.1| hypothetical protein AMTR_s00009p00259660 [Amborella trichopoda]
Length=433

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 187/409 (46%), Positives = 247/409 (60%), Gaps = 59/409 (14%)
 Frame = +2

Query  146   KARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDP  325
             KARC+WDF +SA++S   S +   SD +  +EFD S  F+AT G ARKIR+YS+++L   
Sbjct  27    KARCEWDFTLSALISP--SHLADYSDTIAAIEFDHSHCFIATAGKARKIRIYSLSTLCGT  84

Query  326   FWDQDEGSDAVSL-----DHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEY  490
               +  + +    L     DH+SA D+Y+CTPAKLSSL+W+   +   +G GDYDGVV EY
Sbjct  85    QENHHQQNQGQQLRTRHWDHNSAGDFYLCTPAKLSSLKWRQDTSPSRVGCGDYDGVVTEY  144

Query  491   DLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNC-LATVQP  667
             DLE+RVPV ERD+HGGRRVWS+DYS     +GASG DDG    WD R    N  +A+++P
Sbjct  145   DLEQRVPVGERDDHGGRRVWSMDYSSHTPALGASGGDDGAAHLWDTRLGTSNPPVASLRP  204

Query  668   SKAR---------------SAVCCVQFSPFA-PSIAAGCADRKTYTYDLRNT-AEPLFIL  796
                                + VC ++FSP   P IA G AD+  Y YD+R   A PL IL
Sbjct  205   GIGIGTGTGTGTGTGIVTYAPVCSIEFSPACHPLIAIGSADKNVYLYDVRALGAGPLAIL  264

Query  797   DGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGG  976
              GH +AV+Y RFL   +V+++ VDGC+K+WD     +VRT++GH NT  FVGLSVW+ GG
Sbjct  265   KGHARAVSYVRFLGEGSVVSAGVDGCLKLWDISELRVVRTFEGHSNTKNFVGLSVWRTGG  324

Query  977   LISCGSENNQVFVYDTRWGEPIWVY----------------GCKSATGQP--------GS  1084
             L+ CGSE+N+V+VYD RWGEP+WV                 GC++A G          G 
Sbjct  325   LLGCGSESNEVYVYDRRWGEPVWVQGLRPDGGEWVPPHQPSGCETACGHEPSGCQRARGH  384

Query  1085  ENG---------FISSVCWMQ-RGDDHCTLVAGGSDGVLRVFAGKRRKA  1201
             E           F+SSVCW Q R +++CTLV G S GVL+VF G +R A
Sbjct  385   EPSGCQRARGARFVSSVCWRQTRDEEYCTLVVGASYGVLQVFTGNKRLA  433



>gb|AAK64045.1| unknown protein [Arabidopsis thaliana]
 gb|AAT71991.1| At5g23730 [Arabidopsis thaliana]
Length=243

 Score =   287 bits (734),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 169/242 (70%), Gaps = 4/242 (2%)
 Frame = +2

Query  482   MEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsdd--gTMQTWDPRCPNGNCLA  655
             MEYDLE+R PVFERDEHGGRRVWSVDY+          S    GTMQ WDPRCP    + 
Sbjct  1     MEYDLEKRTPVFERDEHGGRRVWSVDYTRHGGASTVGASGSDDGTMQVWDPRCPPEESVG  60

Query  656   TVQPSK-ARSAVCCVQFSPFA-PSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYAR  829
              V+P+   RSAVCCV+F P   P++A GCADRK Y YD+R   +P   L GH K V+Y R
Sbjct  61    VVRPAGICRSAVCCVEFDPSGGPAVAVGCADRKGYVYDIRKLVDPALTLQGHTKTVSYVR  120

Query  830   FLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQV  1009
             FLD  TV+T+  DGC+K+W  +   ++RTY+GH+N   FVGLSVW+NG L  CGSENN+V
Sbjct  121   FLDGGTVVTAGTDGCLKLWSVEDGRVIRTYEGHVNNRNFVGLSVWRNGALFGCGSENNRV  180

Query  1010  FVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGK  1189
             FVYD RWG+P+WV G +      GS+  F+SSVCW Q G D CTLVAGGSDGVL+V+ GK
Sbjct  181   FVYDRRWGKPVWVDGFEPVGMNSGSDKRFVSSVCWRQSGVDQCTLVAGGSDGVLQVYVGK  240

Query  1190  RR  1195
             R+
Sbjct  241   RK  242



>dbj|BAJ89763.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=412

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 156/371 (42%), Positives = 218/371 (59%), Gaps = 37/371 (10%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             RC+W+FR++A V SP+ A    S+A+G ++FDP+   LATGGIARK+R+Y V  L     
Sbjct  61    RCEWEFRLAATVPSPSLA--GASEAIGSVDFDPAGRLLATGGIARKVRIYGVAGLP----  114

Query  332   DQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPG-WNSRVLGSGDYDGVVMEYDLERRV  508
                      S    +AC   IC PAKLSS+RW+P     R +G GDYDGVV EYD+ER V
Sbjct  115   ---------SSPSPAAC---ICVPAKLSSVRWRPEEGGGRAVGCGDYDGVVTEYDVERGV  162

Query  509   PVFERDEHGGRRVWSVDYshsdsvvgasgsdd--gTMQTWDPRCPNGNCLATVQPSKARS  682
               +ERDEH GRRVW++DY+   +    + S     T   WDPR P+G+       ++A  
Sbjct  163   AAWERDEHAGRRVWALDYAPRGAPTSMAASGSDDRTAHVWDPRAPSGSWAT----ARAGG  218

Query  683   AVCCVQFSPFA-PSIAAGCADRKTYTYDLRNTAE-PLFILDGHLKAVTYARFLDRRTVLT  856
             AV CV+F P   P +A G ADR+   YD+R      +  +DGH +AVTY R+   R V+T
Sbjct  219   AVLCVEFDPSGGPQLAVGSADRRAAVYDVRALGHGAVACMDGHARAVTYVRWAPARRVVT  278

Query  857   SSVDGCIKMWD---TDHRNL------VRTYKGHINTTRFVGLSVWKNGGLISCGSENNQV  1009
             S  DG  ++W+      R L      VR+Y GH++   FVG+ +W+  GL++ GSE+N V
Sbjct  279   SGADGTHRLWEWPAAPARELSGPAREVRSYSGHVSGRSFVGMGLWRGAGLVASGSESNHV  338

Query  1010  FVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQ-RGDDHCTLVAGGSDGVLRVFAG  1186
             FVYD RWG+P+WV+    A+       GF+S+V W+Q   D    LVAG SDGVL++F  
Sbjct  339   FVYDLRWGKPVWVHPFDVASDSSSDAGGFVSAVTWLQGDADGGGALVAGRSDGVLKMFTC  398

Query  1187  KRRKAAVTYKL  1219
             + R+    +++
Sbjct  399   QPRRGDTHHQV  409



>gb|AGT16185.1| hypothetical protein SHCRBa_107_M24_R_260 [Saccharum hybrid cultivar 
R570]
Length=458

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 170/415 (41%), Positives = 234/415 (56%), Gaps = 56/415 (13%)
 Frame = +2

Query  89    PTSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLA  268
             P S +E  Q    ++ +    RC+W+FR++A V  PT+A+   SDA+G ++FDP+   LA
Sbjct  47    PPSNSEADQAHDDKDAELSPPRCEWEFRLAATV--PTTALPGASDAIGSVDFDPTGRLLA  104

Query  269   TGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGW--N  442
             TGGIARKIR+Y V S++    D    S       ++     IC PAKLSS+RW+PG   +
Sbjct  105   TGGIARKIRMYDVASML--LLD----STGSGGARAAGPAACICVPAKLSSVRWRPGGVAS  158

Query  443   SRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTW  622
             + V+G GDYDGVV EYD+ER V  +ERDEH GRRVWS+DY+   ++  +   D  T   W
Sbjct  159   ASVVGCGDYDGVVTEYDVERGVASWERDEHAGRRVWSLDYAPGAAMAASGSDDR-TAHVW  217

Query  623   DPRCPNGNCLATVQPSKARSAVCCVQFSPF-APSIAAGCADRKTYTYDLRNTAE-PLFIL  796
             DPR P+G        ++A  AV CV+F P  AP +A G ADR+   YD+R      +  +
Sbjct  218   DPRAPSGGWAT----ARAGGAVLCVEFDPSGAPHLAVGSADRRAVVYDVRALGRGAVARM  273

Query  797   DGHLKAVTYARFLD---RRTVLTSSVDGCIKMWD-------------TDHRNLVRTYKGH  928
             DGH +AVTY R+      R V+TS+ DG  ++W+                   VR+Y GH
Sbjct  274   DGHARAVTYVRWAGPEPARRVVTSAADGTHRLWEWVGASAAGAEVVEAGAAREVRSYSGH  333

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE-------  1087
              +   FVG+ VW+  GL++ GSE+N VFVYD RW +PIWV+   ++ G  G+        
Sbjct  334   ASARSFVGMGVWRGAGLVASGSESNHVFVYDLRWAKPIWVHPFFASHGHGGAHGPVTTGL  393

Query  1088  ---------NGFISSVCWMQR------GD-DHCTLVAGGSDGVLRVFAGKRRKAA  1204
                       GF+S+V W Q       GD D   LVAGGSDGVL+VF  +RR+ A
Sbjct  394   GQVDTGGAGGGFVSAVAWRQGSHNDDVGDLDGGALVAGGSDGVLKVFTCRRRREA  448



>dbj|BAD07933.1| putative COP1 [Oryza sativa Japonica Group]
 dbj|BAD07708.1| putative COP1 [Oryza sativa Japonica Group]
Length=404

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 174/415 (42%), Positives = 224/415 (54%), Gaps = 68/415 (16%)
 Frame = +2

Query  68    MKNFSSSPTSAAETSQ-----------TIQQE----------EDDGEKARCDWDFRISAV  184
             M N SS  TS A   Q            +QQE          ED     RC+W+FR++A 
Sbjct  1     MSNPSSPATSTAAGEQQLHDQDHRDEAALQQEHAAAGIIPDDEDKLSPPRCEWEFRLAAT  60

Query  185   VSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSL  364
             V SP  A+   SD++G L+FDP+   LATGGIARKIR+Y V     P             
Sbjct  61    VPSP--ALAGASDSIGSLDFDPTGRHLATGGIARKIRIYRVAEPSSP-------------  105

Query  365   DHSSACDYYICTPAKLSSLRWKPGWNSRV----LGSGDYDGVVMEYDLERRVPVFERDEH  532
                +AC   IC PAKLSS+RW+PG    V    +G GDYDGVV EYD+ER VPV+ERDEH
Sbjct  106   ---AAC---ICVPAKLSSVRWRPGGGEAVAASHVGCGDYDGVVTEYDVERGVPVWERDEH  159

Query  533   GGRRVWSVDYshsdsvvgasgsdd--gTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFS  706
              GRRVW++DY+          S     T   WDPR P G    +   ++A  AV CV+F 
Sbjct  160   EGRRVWALDYARGGGAATMVASGSDDRTAHVWDPRAPAG-AAGSWATARAGGAVLCVEFD  218

Query  707   PFA-PSIAAGCADRKTYTYDLRNTAE-PLFILDGHLKAVTYARFL-DRRTVLTSSVDGCI  877
             P   P +A G ADR+   +D+R      +  +DGH +AVTY R+    R V+TS+ DG  
Sbjct  219   PAGGPQLAVGSADRRAAVHDVRALGRGAVASMDGHGRAVTYVRWAATARRVVTSAADGTH  278

Query  878   KMWDTDHRNL-------VRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGE  1036
             ++W              VR+Y GH++   FVG+ VW+  GLI+ GSE+  VFVYD RW +
Sbjct  279   RLWALPAPAAAETAAREVRSYSGHVSGRSFVGMGVWRGAGLIASGSESGHVFVYDLRWSK  338

Query  1037  PIWVYGCKSATGQPGSENGFISSVCWMQ-RGDDH-CTLVAGGSDGVLRVFAGKRR  1195
             PIWV+    A       + F+S+V W Q  GDD    LVAGGSDGVL++F   RR
Sbjct  339   PIWVHPFSHA-------DAFVSAVAWRQLAGDDSDGQLVAGGSDGVLKLFTTHRR  386



>gb|EAY84193.1| hypothetical protein OsI_05571 [Oryza sativa Indica Group]
Length=404

 Score =   274 bits (700),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 174/415 (42%), Positives = 224/415 (54%), Gaps = 68/415 (16%)
 Frame = +2

Query  68    MKNFSSSPTSAAETSQ-----------TIQQE----------EDDGEKARCDWDFRISAV  184
             M N SS  TS A   Q            +QQE          ED     RC+W+FR++A 
Sbjct  1     MSNPSSPATSTAAGEQQLHDQDHRDEAALQQEHAAAGIIPDDEDKLSPPRCEWEFRLAAT  60

Query  185   VSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSL  364
             V SP  A+   SD++G L+FDP+   LATGGIARKIR+Y V     P             
Sbjct  61    VPSP--ALAGASDSIGSLDFDPTGRHLATGGIARKIRIYRVAEPSSP-------------  105

Query  365   DHSSACDYYICTPAKLSSLRWKPGWNSRV----LGSGDYDGVVMEYDLERRVPVFERDEH  532
                +AC   IC PAKLSS+RW+PG    V    +G GDYDGVV EYD+ER VPV+ERDEH
Sbjct  106   ---AAC---ICVPAKLSSVRWRPGGGEAVAASHVGCGDYDGVVTEYDVERGVPVWERDEH  159

Query  533   GGRRVWSVDYshsdsvvgasgsdd--gTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFS  706
              GRRVW++DY+          S     T   WDPR P G    +   ++A  AV CV+F 
Sbjct  160   EGRRVWALDYARGGGAATMVASGSDDRTAHVWDPRAPAG-AAGSWATARAGGAVLCVEFD  218

Query  707   PFA-PSIAAGCADRKTYTYDLRNTAE-PLFILDGHLKAVTYARFLDR-RTVLTSSVDGCI  877
             P   P +A G ADR+   +D+R      +  +DGH +AVTY R+    R V+TS+ DG  
Sbjct  219   PAGGPQLAVGSADRRAAVHDVRALGRGAVASMDGHGRAVTYVRWAAAARRVVTSAADGTH  278

Query  878   KMWDTDHRNL-------VRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGE  1036
             ++W              VR+Y GH++   FVG+ VW+  GLI+ GSE+  VFVYD RW +
Sbjct  279   RLWALPAPAAPETAAREVRSYSGHVSGRSFVGMGVWRGAGLIASGSESGHVFVYDLRWSK  338

Query  1037  PIWVYGCKSATGQPGSENGFISSVCWMQ-RGDDH-CTLVAGGSDGVLRVFAGKRR  1195
             PIWV+    A       + F+S+V W Q  GDD    LVAGGSDGVL++F   RR
Sbjct  339   PIWVHPFSHA-------DAFVSAVAWRQLAGDDSDGQLVAGGSDGVLKLFTTHRR  386



>ref|XP_003570811.1| PREDICTED: WD repeat-containing protein RUP2-like [Brachypodium 
distachyon]
Length=421

 Score =   263 bits (673),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 166/371 (45%), Positives = 221/371 (60%), Gaps = 41/371 (11%)
 Frame = +2

Query  125   QEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYS  304
              E D+     C+W+FR++A V SP + VGA SDA+G ++FDPS + LAT GIARK+R+Y+
Sbjct  45    NEADELSPRGCEWEFRLAATVPSP-AMVGA-SDAIGSVDFDPSGSLLATAGIARKVRIYN  102

Query  305   VNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNS--RVLGSGDYDGV  478
               +L     DQ   S A       AC   IC PAKLSS+RW+P  +S  R +G GDYDGV
Sbjct  103   AATL---LLDQQSSSPA-------AC---ICVPAKLSSVRWRPDSSSSGRFVGCGDYDGV  149

Query  479   VMEYDLERR-VPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLA  655
             V EYDL+R     +ERDEH GRRVW++DYS S S+  +   D  T   WDPR P     A
Sbjct  150   VTEYDLDRGGAATWERDEHSGRRVWALDYSPSSSMAASGSDDR-TAHVWDPRSP----AA  204

Query  656   TVQPSKARSAVCCVQFSPF-APSIAAGCADRKTYTYDLRNTAE-PLFILDGHLKAVTYAR  829
                 +KA   V CV+F P  AP +A G ADR+   YD+RN    P+   +GH +AVTY R
Sbjct  205   GWATAKASGPVLCVEFDPSGAPRLAVGSADRRAALYDVRNMGRGPVATAEGHARAVTYVR  264

Query  830   FLDRRTVLTSSVDGCIKMWD---------TDHRNLVRTYKGHINTTRFVGLSVWKNGGLI  982
             +     ++TS+ DG  ++WD               VR Y GH++   FVG+ +W+  GL+
Sbjct  265   WAPGDRLVTSAADGTHRLWDWAAAGAQGMVGPGREVRAYSGHVSGRSFVGMGLWRGPGLV  324

Query  983   SCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQR-----GDDHCTLV  1147
             +CGSE+N VFVYD RW +P+WV+     +G  G   GF+S+V W Q+     G D   LV
Sbjct  325   ACGSESNHVFVYDLRWPKPVWVHPFFVPSGDGG--GGFVSAVAWRQQAEDGGGGDAGVLV  382

Query  1148  AGGSDGVLRVF  1180
             AGGSDGVL++F
Sbjct  383   AGGSDGVLKLF  393



>ref|XP_008645165.1| PREDICTED: WD repeat-containing protein RUP2-like [Zea mays]
 gb|AFW69795.1| hypothetical protein ZEAMMB73_177863 [Zea mays]
Length=416

 Score =   258 bits (660),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 168/418 (40%), Positives = 230/418 (55%), Gaps = 66/418 (16%)
 Frame = +2

Query  92    TSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLAT  271
              + A +S   Q  +D     RC+WDFR++A V  PT+A+   SDA+G ++ DP+   LAT
Sbjct  2     NATASSSSNSQAHDDADLPPRCEWDFRLAATV--PTTALPGASDAIGSVDLDPTGRLLAT  59

Query  272   GGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRV  451
             GGIARKIR+Y V S+        + +        +AC   IC PAKLSS+RW+P   + V
Sbjct  60    GGIARKIRMYDVPSM---LLPPPDSAGPAPAPAPAAC---ICVPAKLSSVRWRPDGGAAV  113

Query  452   LGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsdd--gTMQTWD  625
              G GDYDGVV EYD ER V  +ERDEHGGRRVWS+DY+   +    + S     T   WD
Sbjct  114   -GCGDYDGVVTEYDAERGVASWERDEHGGRRVWSLDYAPPGAPAAMAASGSDDRTAHVWD  172

Query  626   PRCPNGNCLATVQPSKARSAVCCVQFSPF-APSIAAGCADRKTYTYDLR---NTAEPLFI  793
             PR P+         ++A +AV CV+F P  AP +A G ADR+ + YD+R     A  +  
Sbjct  173   PRAPSCGWAT----ARAGAAVLCVEFDPSGAPHLAVGSADRRAHVYDVRALGRGAVHVAR  228

Query  794   LDGHLKAVTYARFL-----DRRTVLTSSVDGCIKMWD----TDHRNL----VRTYKGHIN  934
             ++GH +AVTY R+      +RR V+TS+ DG  ++W+    T  +      VR+Y GH +
Sbjct  229   MEGHARAVTYVRWAGPGPAERRRVVTSAADGTHRLWEWPPGTSEQGAAAREVRSYSGHAS  288

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG-------  1093
                FVG+ VW+  GL++ GSE+N VFVYD RW +PIWV        QP + +G       
Sbjct  289   ARSFVGMGVWRGAGLVASGSESNHVFVYDLRWAKPIWV--------QPFASHGPVTIGPE  340

Query  1094  ---------------FISSVCWMQRGD----DHCTLVAGGSDGVLRVFAGKRRKAAVT  1210
                            F+S+V W Q       D   LVAGGSDGVL+VF  +RR+  + 
Sbjct  341   QVDAHAPAAGAGAGGFVSAVAWRQGSHSDDPDGGALVAGGSDGVLKVFTCRRRRGVMA  398



>ref|XP_004954763.1| PREDICTED: WD repeat-containing protein RUP1-like [Setaria italica]
Length=444

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 165/383 (43%), Positives = 224/383 (58%), Gaps = 46/383 (12%)
 Frame = +2

Query  152   RCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFW  331
             RC+W+FR++A V  P++A+   SDA+G ++FDP+   LATGGIAR+IR+Y V SL+    
Sbjct  65    RCEWEFRLAATV--PSTALPGASDAIGSVDFDPTGCLLATGGIARRIRMYDVASLLA---  119

Query  332   DQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKP--GWNSRVLGSGDYDGVVMEYDLERR  505
             D D G         ++C   IC PAKLSS+RW+P    +  V+G GDYDGVV EYD+ER 
Sbjct  120   DVDSGGGGSVTGVPASC---ICVPAKLSSVRWRPCGAPSPPVVGCGDYDGVVTEYDVERG  176

Query  506   VPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSA  685
             V  +ERDEH GRRVWS+DY+   ++  +   D  T   WDPR P+    A    ++A  A
Sbjct  177   VAAWERDEHAGRRVWSLDYAPGAAMAASGSDDR-TAHVWDPRAPS----AGWATARAGGA  231

Query  686   VCCVQFSPF-APSIAAGCADRKTYTYDLRNTAE-PLFILDGHLKAVTYARFL---DRRTV  850
             V CV+F P  AP +A G ADR+   YD+R      +  +DGH +AVTY R+      R V
Sbjct  232   VLCVEFDPSGAPQLAVGSADRRAVVYDVRALGRGAVAWMDGHGRAVTYVRWAGAAPARRV  291

Query  851   LTSSVDGCIKMWDTDHRNL------VRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVF  1012
             +TS+ DG  ++W+ +          VR+Y GH +   FVG+ VW+  GL++ GSE+N VF
Sbjct  292   VTSAADGTHRLWEWESAAAAAAAREVRSYSGHASARSFVGMGVWRAAGLVASGSESNHVF  351

Query  1013  VYDTRWGEPIWVY----------------GCKSATGQPGSENGFISSVCWMQRGDDH---  1135
             VYD RW +PIWV+                   S      +  GF+S+V W Q G DH   
Sbjct  352   VYDLRWAKPIWVHPFVVGGAHSPVTTTSTSPSSVGEAAAAAGGFVSAVAWRQ-GSDHDGG  410

Query  1136  CTLVAGGSDGVLRVFAGKRRKAA  1204
               LVAGGSDGVL++F   RR+AA
Sbjct  411   GALVAGGSDGVLKMFTCHRRRAA  433



>ref|XP_008466641.1| PREDICTED: WD repeat-containing protein RUP2, partial [Cucumis 
melo]
Length=230

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 158/206 (77%), Gaps = 4/206 (2%)
 Frame = +2

Query  155  CDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWD  334
            C+WDF +++VVSSPT+   A SD LGVLEFDPSD+ +AT GIARKIR Y +++L+ P   
Sbjct  28   CEWDFTLASVVSSPTNC--AASDTLGVLEFDPSDSLIATAGIARKIRGYRLHNLL-PQDI  84

Query  335  QDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPV  514
                +    LDHS A D+ ICTPAKLSSLRWKP  N+R+LGSGDYDGVV EYDLE +VP+
Sbjct  85   HHNATTITQLDHSRASDFCICTPAKLSSLRWKPNANARILGSGDYDGVVTEYDLEMKVPI  144

Query  515  FERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCC  694
            FERDEHGGRRVWSVDYS  + VVGASGSDDGT+Q WD RC +G C+A VQPS  RS VCC
Sbjct  145  FERDEHGGRRVWSVDYSTVEPVVGASGSDDGTVQVWDTRCESGECVAVVQPSVVRSPVCC  204

Query  695  VQFSPFAPS-IAAGCADRKTYTYDLR  769
            V+F+P+    +A GCADRK Y YD R
Sbjct  205  VEFNPYGGGLVAVGCADRKAYGYDRR  230



>ref|XP_001782967.1| predicted protein [Physcomitrella patens]
 gb|EDQ52213.1| predicted protein [Physcomitrella patens]
Length=469

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 156/412 (38%), Positives = 219/412 (53%), Gaps = 56/412 (14%)
 Frame = +2

Query  104   ETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIA  283
             E S  + ++   GE  R  WDF++ A V S    + + +D +G + F+ ++ + ATGGIA
Sbjct  64    EGSVIVSRQHCHGEDHRSSWDFKVVASVKSQNRNLTS-TDVIGTIAFEKTNEYFATGGIA  122

Query  284   RKIRVYSVNSLVDPFWD-----------------------QDEGSDAVSLDHSSACDYYI  394
             RKIRVYS + LV                            +   +    +DH+  C   +
Sbjct  123   RKIRVYSYSQLVSGVSSTYEDEDEDEDEEESLDYLKQRRLRKRRASTSEIDHARCCVQEV  182

Query  395   CTPAKLSSLRW---KPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYs  565
             CTPAKLSSL+W   +P     ++  GDYDGVV E+DLER   + ERDE+GG+R+WS+DYS
Sbjct  183   CTPAKLSSLQWYQERPN----LIACGDYDGVVAEWDLERNCTISERDENGGQRIWSIDYS  238

Query  566   hsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCAD  742
                  + AS SDDGT++ WD    N    A +      S +CC +F P + S IA   AD
Sbjct  239   KDFPNLIASASDDGTVRIWD---RNSEQSAAILSHPTYSPICCAEFGPVSSSLIALASAD  295

Query  743   RKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWD------TDHR-  901
                Y YD R  + PL  L  H +A +Y RFL R ++++SS+D  +K+WD      T  R 
Sbjct  296   SNVYLYDTRWLSTPLLTLAHHKRAASYVRFLTRHSLVSSSIDSSVKLWDITSLSSTSERA  355

Query  902   ---------NLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWV--  1048
                       LV+++  H N   F GLSV   GGLI+CGSE NQ FVYD++   PI +  
Sbjct  356   ASVIYQHCDTLVKSFGSHYNVRNFTGLSVRSEGGLIACGSETNQAFVYDSQTSNPILMHS  415

Query  1049  --YGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKRRK  1198
               Y   S+   P   +  +S+VCW  + +D CTLVA  SDGVLRV +G + +
Sbjct  416   FDYKPTSSNMNPILGSLIVSAVCWRTKSND-CTLVAANSDGVLRVLSGSQSR  466



>ref|XP_001756425.1| predicted protein [Physcomitrella patens]
 gb|EDQ78821.1| predicted protein [Physcomitrella patens]
Length=329

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 136/342 (40%), Positives = 188/342 (55%), Gaps = 32/342 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             +D +G + F+ +  + ATGGIARKIRVY+ + LV         + A+ +DH+  C   +C
Sbjct  3     TDIIGTIAFEKTHEYFATGGIARKIRVYAYSPLVSGL------TSAIDIDHARCCVQEVC  56

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             TPAKLSSL+W       V+  GDYDGVV E+D+ER   + ERDE+GG+R+WS+DYS    
Sbjct  57    TPAKLSSLQWHQE-RPNVIACGDYDGVVAEWDVERMCAICERDENGGQRIWSIDYSKDFP  115

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              + AS SDDGT++ WD           +      S +CC +F P + S IA   AD   Y
Sbjct  116   DLIASASDDGTVRMWDQSSEQS---VAIIFHSTFSPICCAEFGPASSSLIALASADSNVY  172

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNL---------  907
              YD R  + PL  L  H +A +Y RFLD   +++SS+D  +K+WD    +          
Sbjct  173   LYDTRWLSTPLLTLAHHKRATSYVRFLDSHRLVSSSIDSSVKLWDVQSMSCSSCRTAPVA  232

Query  908   -------VRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSA  1066
                    V+++  H N   F GLSV    GLI+CGSE NQ FVYD++   PI  +    +
Sbjct  233   SQRCNAPVKSFDSHYNVRNFTGLSVRGEDGLIACGSETNQAFVYDSQKCSPILSH----S  288

Query  1067  TGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGKR  1192
                       +S+VCW  + DD CTLVA  SDGVLR+ +G R
Sbjct  289   FDYYNPAVLIVSAVCWRAKPDD-CTLVAANSDGVLRLLSGNR  329



>gb|AGT15884.1| hypothetical protein SHCRBa_004_O05_R_50 [Saccharum hybrid cultivar 
R570]
Length=392

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 150/408 (37%), Positives = 204/408 (50%), Gaps = 111/408 (27%)
 Frame = +2

Query  89    PTSAAETSQTIQQEEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLA  268
             P S +E  Q    ++ +    RC+W+FR++A V  PT+A+   SDA+G ++FDP+   LA
Sbjct  46    PPSNSEADQAHDDKDAELSPPRCEWEFRLAATV--PTTALPGASDAIGSVDFDPTGRLLA  103

Query  269   TGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGW--N  442
             TGGIARKIR+Y V S++    D   GS   ++   +AC   IC PAKLSS+RW+PG   +
Sbjct  104   TGGIARKIRMYDVASML--LLDS-AGSGGGAVPGPAAC---ICVPAKLSSVRWRPGGAAS  157

Query  443   SRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTW  622
             + V+G GDYDGVV EYD+ER V  +ERDEH GRRVWS+DY                    
Sbjct  158   ASVVGCGDYDGVVTEYDVERGVASWERDEHAGRRVWSLDY--------------------  197

Query  623   DPRCPNGNCLATVQPSKARSAVCCVQFSPFAPSIAAGCADRKTYTYDLRNTAEPLFILDG  802
                                        +P A   A+G  DR  +                
Sbjct  198   ---------------------------APGAAMAASGSDDRTAHV---------------  215

Query  803   HLKAVTYARFLD---RRTVLTSSVDGCIKMW-------------DTDHRNLVRTYKGHIN  934
                AVTY R+      R V+TS+ DG  ++W             +      VR+Y GH +
Sbjct  216   ---AVTYVRWAGPGPARRVVTSAADGTHRLWEWGGASAAGAEVVEAGAAREVRSYSGHAS  272

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE---------  1087
                FVG+ VW+  GL++ GSE+N VFVYD RW +PIWV+   ++ G  G+          
Sbjct  273   ARSFVGMGVWRGAGLVASGSESNHVFVYDLRWAKPIWVHPFFASHGHGGAHGPVTTGPGQ  332

Query  1088  ----NGFISSVCWMQ------RGD-DHCTLVAGGSDGVLRVFAGKRRK  1198
                  GF+S+V W Q       GD D   LVAGGSDGVL+VF  +RR+
Sbjct  333   VDAGGGFVSAVAWRQGSHNDDAGDLDGGALVAGGSDGVLKVFTSRRRR  380



>ref|XP_002979241.1| hypothetical protein SELMODRAFT_444188 [Selaginella moellendorffii]
 gb|EFJ19649.1| hypothetical protein SELMODRAFT_444188 [Selaginella moellendorffii]
Length=432

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 140/397 (35%), Positives = 202/397 (51%), Gaps = 56/397 (14%)
 Frame = +2

Query  128   EEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSV  307
             E + G  +R  W FR+ A +    S     ++ +G + FD S+  +ATGGIARKIRVY +
Sbjct  45    EMEQGSSSR--WAFRVRATIKPFASHA---TETIGSVAFDSSNELMATGGIARKIRVYDI  99

Query  308   NSLVDP---------------------------FWDQDEGSDAVSLDHSSACDYYICTPA  406
             ++++D                               +    +    D SS     IC P+
Sbjct  100   SAILDSEDKQQQDQAADEDDEDGLEDEDEEGRFVSSRRRARNTFDTDRSSLS--VICAPS  157

Query  407   KLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvg  586
             +LSSL+W+PG  +  +  GDYDGVV E+ +ER++P+ ERDEHGGR VWSVDY+   S V 
Sbjct  158   RLSSLQWRPG-KTGTIACGDYDGVVTEWSVERQIPLVERDEHGGRHVWSVDYATDMSGVC  216

Query  587   asgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTYTYD  763
              S SDDGT + W               SK     CC +F P + + +A  CAD K Y +D
Sbjct  217   VSASDDGTARVWQGGMERSALTIRAPDSK---PFCCAEFDPLSSTLLALACADGKVYVHD  273

Query  764   LRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDT---DHRNLVRTYKGHIN  934
             LR    P++ L  H +A +YARFLDR  ++T+SVD  I +WD        +V ++  H N
Sbjct  274   LRRPECPVWTLAHHRRAASYARFLDRERLVTASVDSTICVWDLAAPPAPRVVESFSQHQN  333

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDT------------RWGEPIWVYGCKSATGQP  1078
                FVGLSVW+ G +++CGSE NQ +VY              R       +   + +   
Sbjct  334   VRNFVGLSVWRKGEMVACGSETNQAYVYQVGSGGGGDQSFVLRHQFSSSSWSSSTDSSSA  393

Query  1079  GSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGK  1189
                +   S+VCWM+  D  CTL A  S+GVL++ +G+
Sbjct  394   RRNSSLASAVCWME--DCSCTLAAANSEGVLQILSGE  428



>ref|XP_002990312.1| hypothetical protein SELMODRAFT_447996 [Selaginella moellendorffii]
 gb|EFJ08581.1| hypothetical protein SELMODRAFT_447996 [Selaginella moellendorffii]
Length=436

 Score =   211 bits (537),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 140/401 (35%), Positives = 202/401 (50%), Gaps = 60/401 (15%)
 Frame = +2

Query  128   EEDDGEKARCDWDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSV  307
             E + G  +R  W FR+ A +    S     ++ +G + FD S+  +ATGGIARKIRVY +
Sbjct  45    EMEQGSSSR--WAFRVRATIKPFASHA---TETIGSVAFDSSNELMATGGIARKIRVYDI  99

Query  308   NSLVDP---------------------------FWDQDEGSDAVSLDHSSACDYYICTPA  406
             ++++D                               +    +    D SS     IC P+
Sbjct  100   SAILDSEEKQQQDQAADEDDEDGLEDEDEEGRFVSSRRRARNTFDTDRSSLS--VICAPS  157

Query  407   KLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvg  586
             +LSSL+W+PG  +  +  GDYDGVV E+ +ER++P+ ERDEHGGR VWSVDY+   S V 
Sbjct  158   RLSSLQWRPG-KTGTITCGDYDGVVTEWSVERQIPLVERDEHGGRHVWSVDYATGMSDVC  216

Query  587   asgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTYTYD  763
              S SDDGT + W               SK     CC +F P + + +A  CAD K Y +D
Sbjct  217   VSASDDGTARVWQGGMERSALTIRAPDSK---PFCCAEFDPLSSTLLALACADGKVYVHD  273

Query  764   LRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDT---DHRNLVRTYKGHIN  934
             LR    P++ L  H +A +YARFLDR  ++T+SVD  I +WD        +V ++  H N
Sbjct  274   LRRPECPVWTLAHHRRAASYARFLDRERLVTASVDSTICVWDLAAPPAPRVVESFSQHQN  333

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDT----------------RWGEPIWVYGCKSA  1066
                FVGLSVW+ G +++CGSE NQ +VY                  R       +   + 
Sbjct  334   VRNFVGLSVWRKGEMVACGSETNQAYVYQVGSGGGGGGGGDQSFVLRHQFSSSSWSSSTD  393

Query  1067  TGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFAGK  1189
             +      +   S+VCWM+  D  CTL A  S+GVL++ +G+
Sbjct  394   SSSARRNSSLASAVCWME--DCSCTLAAANSEGVLQILSGE  432



>gb|AAW28081.1| COP1-like protein [Solanum lycopersicum]
Length=120

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 101/125 (81%), Gaps = 5/125 (4%)
 Frame = +2

Query  821   YARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSEN  1000
             Y RF+D RT+++ S+DGC+KMW+ + + ++RTYKGH N+ RFVGLSVWK GGLI CGSEN
Sbjct  1     YIRFVDERTIISLSIDGCLKMWNAEDQKVLRTYKGHSNSRRFVGLSVWKPGGLICCGSEN  60

Query  1001  NQVFVYDTRWGEPIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             NQVFVYD RWGEPIW+YG      +P  E+GF+SSVCW Q+ ++ CTLVAG SDGVLRVF
Sbjct  61    NQVFVYDKRWGEPIWMYG-----REPRHEHGFVSSVCWQQKDENQCTLVAGDSDGVLRVF  115

Query  1181  AGKRR  1195
              GKR+
Sbjct  116   NGKRK  120



>emb|CBI22758.3| unnamed protein product [Vitis vinifera]
Length=282

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 119/172 (69%), Gaps = 25/172 (15%)
 Frame = +2

Query  68   MKNFSS--SPTSAAETSQTIQQEEDDG----EKARCDWDFRISAVVSSPTSAVGAVSDAL  229
            MKNFS+  +P S    +  IQ+E+ +     E+ARCDW+F +S VV+S  S+ GA +D +
Sbjct  1    MKNFSTQFNPQSPEVENPNIQEEKAEQHIEEERARCDWEFNLSTVVTS--SSTGASTDTI  58

Query  230  GVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAK  409
            GV+EFDPSDN +ATGGIARKIRVYS                   L H+ ACDYY+CTPAK
Sbjct  59   GVIEFDPSDNLVATGGIARKIRVYS--------------RKVTWLQHNDACDYYVCTPAK  104

Query  410  LSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGG---RRVWSV  556
            LSSLRWKPG   RVLGSGDYDGVV EYDL++++P+FERDEHG     R+WS+
Sbjct  105  LSSLRWKPGSAGRVLGSGDYDGVVTEYDLDQKIPIFERDEHGTDGCLRLWSM  156


 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +2

Query  866   DGCIKMWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIW  1045
             DGC+++W      ++R Y GH+NT  FVGLSVW+ GGL+ CGSENN VFVYD RWGEPIW
Sbjct  148   DGCLRLWSMHDARMIRVYMGHMNTRSFVGLSVWRTGGLLGCGSENNHVFVYDKRWGEPIW  207

Query  1046  VYGCKSATGQPGSENGFISSVCWMQ-RGDDHCTL  1144
             V+     + + G +  F+SSVCW Q  G+D CTL
Sbjct  208   VHEFGVGS-RDGRDPNFVSSVCWRQVGGEDGCTL  240



>ref|XP_002970357.1| hypothetical protein SELMODRAFT_147206 [Selaginella moellendorffii]
 gb|EFJ28487.1| hypothetical protein SELMODRAFT_147206 [Selaginella moellendorffii]
Length=467

 Score =   177 bits (448),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 192/363 (53%), Gaps = 36/363 (10%)
 Frame = +2

Query  161   WDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQD  340
             W+F      S  T ++ + SD +  +++D +   +ATGG+ARKIR+ S   LV+      
Sbjct  107   WEFETLVPFSCETPSLLS-SDVISTIDYDETGQLIATGGLARKIRICSYQELVNGM----  161

Query  341   EGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFE  520
              G +     +       IC PAKLSSL+W+PG  S V+  GDYDG V E+D+E  V V E
Sbjct  162   -GRECFQGRNVKNLFTTICMPAKLSSLKWRPG-GSEVIACGDYDGSVTEWDVEHGVTVSE  219

Query  521   RDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQ  700
             R EH GR VWS+DYS     + AS S D T++ W            +  S  R+++CCV+
Sbjct  220   RYEHTGRTVWSIDYSRDFRGLLASASSDSTVRFWSRNVERS---VGIIKSLKRNSMCCVE  276

Query  701   FSPFAPS---IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDG  871
             F   +     +A  CAD   Y YD+R+   P+  L GH ++V+Y R+L   ++++SS DG
Sbjct  277   FGRSSGPCCYVAVACADASVYLYDMRSLGSPVATLRGHERSVSYVRWLGENSLVSSSPDG  336

Query  872   CIKMWD---------------TDHRNLVRTYKGHINTTRFV----GLSVWKNGGLISCGS  994
              I++WD                D   + RT+  H NT  FV      S   +GGLI+ GS
Sbjct  337   TIRLWDIASTVTGTGESWHARNDELPIARTFGCHSNTRNFVGLSVASSGGGSGGLIASGS  396

Query  995   ENNQVFVYDTRWGE-PIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVL  1171
             ENN+VFVY +   E P++ +    A      +  F+ SVCW ++  DH +L++  S+G++
Sbjct  397   ENNEVFVYSSSVSERPVFRHKFNDAVVL--DDKAFVGSVCWTKQ-QDHLSLISANSEGIV  453

Query  1172  RVF  1180
             +V 
Sbjct  454   QVI  456



>dbj|GAM19089.1| hypothetical protein SAMD00019534_022640 [Acytostelium subglobosum 
LB1]
Length=768

 Score =   179 bits (453),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 119/344 (35%), Positives = 185/344 (54%), Gaps = 30/344 (9%)
 Frame = +2

Query  164   DFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDE  343
             DFR+  V +     +   S  +  +EFD  D F AT G+ +KI+V+    L     D   
Sbjct  447   DFRV--VTTLKYGDLYNTSSIVSSIEFDKDDEFFATAGVTKKIKVFEYAQL--SLRDH--  500

Query  344   GSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFER  523
                   +D         C  +K+S L W     S++  S DY+G++  +D+     +   
Sbjct  501   ------VDVHVPVKEMTC-HSKISCLSWNTYIKSQI-ASSDYEGIITLWDVNTGQNIMSM  552

Query  524   DEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQF  703
             +EH  +RVWSVD+S +D    ASGSDD  ++ W         +AT++   +++ +CCV+F
Sbjct  553   EEHE-KRVWSVDFSRTDPTQLASGSDDTRVKLWSTTARRS--IATIE---SKANICCVKF  606

Query  704   SPFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIK  880
             +P +   IA G AD   + YDLR+T +PLFI  GH KAV+Y +F++R  ++++S D  +K
Sbjct  607   NPSSSHLIAFGSADHHIHYYDLRHTKDPLFIFKGHRKAVSYVKFMNRDEIISASTDSTLK  666

Query  881   MWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWV--YG  1054
             +W+    + VRTY GH N   FVGL+V  +G  I CGSENN V+ Y     +PI    +G
Sbjct  667   LWNVSQSDCVRTYVGHANEKNFVGLTV--SGDYICCGSENNGVYTYYKTLSKPIVTHRFG  724

Query  1055  CKSATGQPGSENG--FISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
               S +G+   ++G  F+SSVCW +  +    L+A  S G ++V 
Sbjct  725   ATSGSGEETDDDGSQFVSSVCWKKNSN---ILLAANSQGNIKVL  765



>ref|XP_002968121.1| hypothetical protein SELMODRAFT_409247 [Selaginella moellendorffii]
 gb|EFJ30375.1| hypothetical protein SELMODRAFT_409247 [Selaginella moellendorffii]
Length=499

 Score =   175 bits (444),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 126/361 (35%), Positives = 192/361 (53%), Gaps = 36/361 (10%)
 Frame = +2

Query  161   WDFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQD  340
             W+F      S  T ++ + SD +  +++D +   +ATGG+ARKIR+ S   LV+      
Sbjct  146   WEFETLVPFSCETPSLLS-SDVISTIDYDETGQLIATGGLARKIRICSYQELVNGM----  200

Query  341   EGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFE  520
              G +     +       IC PAKLSSL+W+PG +S V+  GDYDG V E+D+E  V V E
Sbjct  201   -GRECFQGRNVKNLFTTICMPAKLSSLKWRPG-SSEVIACGDYDGSVTEWDVEHGVTVSE  258

Query  521   RDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQ  700
             R EH GR VWS+DY      + AS S D T++ W            +  S  R+++CCV+
Sbjct  259   RYEHTGRTVWSIDYCRDFRGLLASASSDSTVRFWSRNVERS---VGIIKSLKRNSMCCVE  315

Query  701   FSPFAPS---IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDG  871
             F   +     +A  CAD   Y YD+R+   P+  L GH ++V+Y R+L   ++++SS DG
Sbjct  316   FGRSSGPCCYVAVACADASVYLYDMRSLGSPVANLRGHERSVSYVRWLGENSLVSSSPDG  375

Query  872   CIKMWD---------------TDHRNLVRTYKGHINTTRFV----GLSVWKNGGLISCGS  994
              I++WD                D   + RT+  H NT  FV      S   +GGLI+ GS
Sbjct  376   TIRLWDIASTLTGTGESWHARNDELPIARTFGCHSNTRNFVGLSVASSGGGSGGLIASGS  435

Query  995   ENNQVFVYDTRWGE-PIWVYGCKSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVL  1171
             ENN+VFVY +   E P++ +    A      +  F+ SVCW ++ +DH +L++  S+G++
Sbjct  436   ENNEVFVYSSSVSERPVFRHKFNDAVVL--DDKAFVGSVCWTKQ-EDHLSLISANSEGIV  492

Query  1172  R  1174
             +
Sbjct  493   Q  493



>ref|NP_001234047.1| COP1 homolog [Solanum lycopersicum]
 gb|AAC98912.1| COP1 homolog [Solanum lycopersicum]
Length=677

 Score =   177 bits (448),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 116/325 (36%), Positives = 177/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +DA    H    +  + 
Sbjct  373   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVN------EPADA----HCPVVE--MS  420

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DYDG+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  421   TRSKLSCLSWNK-YTKNHIASSDYDGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTEP  478

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  479   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSSVHIAVGSADHHIH  533

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT++P+ I  GH KAV+Y +FL    + ++S D  +++WD      VRT +GH N
Sbjct  534   YYDLRNTSQPVHIFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTLRGHTN  593

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGLSV  N   +SCGSE N+VFVY     +P+  +   S       E+    FIS+
Sbjct  594   EKNFVGLSV--NNEFLSCGSETNEVFVYHKAISKPVTWHRFGSPDIDEADEDAGSYFISA  651

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++A  S G ++V 
Sbjct  652   VCW---KSDSPTMLAANSQGTIKVL  673



>ref|XP_006351972.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Solanum tuberosum]
Length=675

 Score =   177 bits (448),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 116/325 (36%), Positives = 177/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +DA    H    +  + 
Sbjct  371   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVN------EPADA----HCPVVE--MS  418

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DYDG+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  419   TRSKLSCLSWNK-YTKNHIASSDYDGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTEP  476

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  477   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSSVHIAVGSADHHIH  531

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT++P+ I  GH KAV+Y +FL    + ++S D  +++WD      VRT +GH N
Sbjct  532   YYDLRNTSQPVHIFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTLRGHTN  591

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGLSV  N   +SCGSE N+VFVY     +P+  +   S       E+    FIS+
Sbjct  592   EKNFVGLSV--NNEFLSCGSETNEVFVYHKAISKPVTWHRFGSPDIDEADEDAGSYFISA  649

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++A  S G ++V 
Sbjct  650   VCW---KSDSPTMLAANSQGTIKVL  671



>ref|XP_009762651.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Nicotiana sylvestris]
Length=333

 Score =   171 bits (432),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 113/323 (35%), Positives = 172/323 (53%), Gaps = 27/323 (8%)
 Frame = +2

Query  221   DALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICT  400
             + L  +EFD  D F AT G++R+I+V+  +S+V+   D       +S            +
Sbjct  31    EVLFCIEFDRDDEFFATAGVSRRIKVFDFSSVVNEPADAQRPVVEMS------------S  78

Query  401   PAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsv  580
              +KLS L W   +    + S DY+G+V  +D+  R  V E +EH  +R WSVD+SH+D  
Sbjct  79    RSKLSCLSWN-KYAKNHIASSDYEGIVTIWDVSSRQSVMEYEEHE-KRAWSVDFSHTDPS  136

Query  581   vgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYT  757
             +  SGSDD  ++ W   C      A+V     ++ +C V+++P +   IA G AD   + 
Sbjct  137   MLVSGSDDCKVKVW---CTKQE--ASVISIDMKANICSVKYNPQSSFYIAVGSADNHIHY  191

Query  758   YDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINT  937
             YDLRN  +PL I  GH K+V+Y +FL    + ++S DG +++WD      +R Y+GH N 
Sbjct  192   YDLRNIKQPLHIFCGHHKSVSYVKFLSNNELASASTDGTLRLWDVKENIPLRNYRGHTNE  251

Query  938   TRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG--FISSVC  1111
               FVGL+V  N   I+CGSE N+VFVY     +P   +   S    P  + G  FISSVC
Sbjct  252   KNFVGLAV--NSEYIACGSETNEVFVYHKAISKPAASHKFDSDQNDPDEDMGSHFISSVC  309

Query  1112  WMQRGDDHCTLVAGGSDGVLRVF  1180
             W +      T++   S G+++V 
Sbjct  310   WKRESP---TILTANSQGIVQVL  329



>ref|XP_010646929.1| PREDICTED: WD repeat-containing protein RUP2-like [Vitis vinifera]
Length=151

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 111/150 (74%), Gaps = 10/150 (7%)
 Frame = +2

Query  68   MKNFSS--SPTSAAETSQTIQQEEDDG----EKARCDWDFRISAVVSSPTSAVGAVSDAL  229
            MKNFS+  +P S    +  IQ+E+ +     E+ARCDW+F +S VV+S  S+VGA +D +
Sbjct  1    MKNFSTQFNPQSPEVENPNIQEEKAEQHIEEERARCDWEFNLSTVVTS--SSVGASTDTI  58

Query  230  GVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSL-DHSSACDYYICTPA  406
            GV+EFDPSD+ +ATGGIARKIRVYSV SL+ P  +   G   V L  H++ACDYYI TPA
Sbjct  59   GVIEFDPSDSLVATGGIARKIRVYSVKSLL-PGENHSHGEHNVKLLQHNNACDYYIWTPA  117

Query  407  KLSSLRWKPGWNSRVLGSGDYDGVVMEYDL  496
            KLSSLRWKPG + RVLGSGDYDGVV EYDL
Sbjct  118  KLSSLRWKPGSSGRVLGSGDYDGVVTEYDL  147



>ref|XP_010688914.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010688915.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=558

 Score =   174 bits (442),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 176/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +DA    H    +  I 
Sbjct  254   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVN------EPADA----HCPVVE--IS  301

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  302   TLSKLSCLSWNK-FTKNQIASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSCTEP  359

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  360   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSSYHIAVGSADHHIH  414

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  415   YYDLRNISQPVHVFGGHKKAVSYVKFLSTYELASASTDSTLRLWDVKESLPVRTFRGHTN  474

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGLSV  N   I+CGSE N+VFVY      P+  +   S   +   E+    FIS+
Sbjct  475   EKNFVGLSV--NSEYIACGSETNEVFVYHKEISRPVTCHKFGSPDVEDADEDAGAYFISA  532

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  TL+   S G ++V 
Sbjct  533   VCW---KSDSPTLLTANSQGTIKVL  554



>gb|EFA79727.1| hypothetical protein PPL_07418 [Polysphondylium pallidum PN500]
Length=829

 Score =   176 bits (447),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 119/344 (35%), Positives = 183/344 (53%), Gaps = 30/344 (9%)
 Frame = +2

Query  164   DFRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDE  343
             DFR+  + +     +   S  +  +EFD  D F AT G+ +KI+V+         + Q  
Sbjct  508   DFRV--ITTLKYGDLNNTSSIVSSIEFDKDDEFFATAGVTKKIKVFE--------YAQLN  557

Query  344   GSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFER  523
               D V  D         C  +K+S L W     S++  S DY+G++  +D+     V   
Sbjct  558   IRDHV--DIHVPIKEMTCR-SKISCLSWNTYIKSQI-ASSDYEGIITLWDVNTGQDVMSM  613

Query  524   DEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQF  703
             +EH  +RVWSVD+S +D    ASGSDD  ++ W         + T++   +++ +CCV+F
Sbjct  614   EEHE-KRVWSVDFSRTDPTQLASGSDDTRVKLWSTTSKRA--ITTIE---SKANICCVKF  667

Query  704   SPFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIK  880
             +P +   IA G AD   + YDLR+  EPL I  GH KAV+Y +F++R  ++++S D  +K
Sbjct  668   NPSSSHLIAFGSADHHIHYYDLRHPKEPLSIFKGHRKAVSYVKFMNREEIISASTDSTLK  727

Query  881   MWDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWV--YG  1054
             +W+ +    VRTY GH N   FVGL+V  +G  I CGSENN V+ Y     +PI    +G
Sbjct  728   LWNVNQNECVRTYVGHANEKNFVGLTV--SGDYICCGSENNGVYTYYKTLSKPIVTHRFG  785

Query  1055  CKSATGQPGSENG--FISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
               S +G+   ++G  F+SSVCW +   D   L+A  S G ++V 
Sbjct  786   ANSGSGEETDDDGSQFVSSVCWKK---DSNILLAANSQGNIKVL  826



>ref|XP_010688913.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=668

 Score =   174 bits (442),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 176/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +DA    H    +  I 
Sbjct  364   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVN------EPADA----HCPVVE--IS  411

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  412   TLSKLSCLSWN-KFTKNQIASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSCTEP  469

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  470   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSSYHIAVGSADHHIH  524

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  525   YYDLRNISQPVHVFGGHKKAVSYVKFLSTYELASASTDSTLRLWDVKESLPVRTFRGHTN  584

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGLSV  N   I+CGSE N+VFVY      P+  +   S   +   E+    FIS+
Sbjct  585   EKNFVGLSV--NSEYIACGSETNEVFVYHKEISRPVTCHKFGSPDVEDADEDAGAYFISA  642

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  TL+   S G ++V 
Sbjct  643   VCW---KSDSPTLLTANSQGTIKVL  664



>ref|XP_009386714.1| PREDICTED: WD repeat-containing protein RUP2-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   170 bits (431),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 113/276 (41%), Positives = 143/276 (52%), Gaps = 47/276 (17%)
 Frame = +2

Query  275   GIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVL  454
             GIARKIR+YS+ +L+ P  +   G  A    HS+ACD+YICTPAKL SLR  P    RVL
Sbjct  85    GIARKIRIYSLRTLLPP--EGHAGGAAAFYGHSTACDFYICTPAKLGSLRRLPASGGRVL  142

Query  455   GSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRC  634
             GSGDYDGVV EYD ER V VFERDEH GR V                      ++W+ R 
Sbjct  143   GSGDYDGVVTEYDEERGVEVFERDEHAGRHV----------------------RSWNTRR  180

Query  635   PNGNCLATVQPSKARSAVCCVQF-SPFAPSIAAGCADRKTYTYDLRN-TAEPLFILDGHL  808
                 C+   +P    +AVC V+F     P +  G ADR  Y YD+R  +A P+ +   H 
Sbjct  181   GGKGCVGVARPG---AAVCGVEFDPGGGPWVGVGSADRHAYVYDVRAVSAGPVAVFAVHG  237

Query  809   KAVTYARFL--DRRTVLTSSVDGCIKM------WDTDHRNLVRTYKGHINTTRFVGLSVW  964
             +AVTY RF     R V++S  DG  ++              VR Y GH N  RFVG+SVW
Sbjct  238   RAVTYVRFARGPGRAVVSSGTDGSHRLWVWVGGGGGGGVEEVRAYSGHANALRFVGMSVW  297

Query  965   KNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATG  1072
             + GG +          VYD R  E  +  G  ++TG
Sbjct  298   RTGGGL----------VYDLRLEESQFGCGASTSTG  323



>gb|AAG31173.1| COP1 [Ipomoea nil]
Length=677

 Score =   174 bits (440),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 117/325 (36%), Positives = 175/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +DA    H    +  + 
Sbjct  373   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVN------EPADA----HCPVVE--MS  420

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DYDG+V  +D+  R  V E +EH  +R WSVD+S +D 
Sbjct  421   TRSKLSCLSWNK-YTKNHIASSDYDGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTDP  478

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A     KA   +CCV+++P +   +A G AD   +
Sbjct  479   SMLVSGSDDCKVKVW---CTKQEASALNIDMKAN--ICCVKYNPGSSFHVAVGSADHHIH  533

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT+ PL I  GH KAV+Y +FL    + ++S D  +++WD    + VR ++GH N
Sbjct  534   YYDLRNTSAPLHIFSGHKKAVSYVKFLSSHELASASTDSTLRLWDVKDNSPVRVFRGHTN  593

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSEN---GFISS  1105
                FVGLSV  +   ISCGSE N+VFVY     +P+  +   S       E+    FIS+
Sbjct  594   EKNFVGLSV--SNEFISCGSETNEVFVYHKAISKPVTWHRFGSPDVDEADEDVTSFFISA  651

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++A  S G ++V 
Sbjct  652   VCW---KSDSPTMLAANSQGTIKVL  673



>ref|XP_009767443.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009767444.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009767445.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X3 [Nicotiana 
sylvestris]
Length=532

 Score =   172 bits (436),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 176/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  228   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVN------EPADV----HCPVVE--MS  275

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DYDG+V  +D+  R  V E +EH  +R WSVD+S +D 
Sbjct  276   TRSKLSCLSWNK-YTKNHIASSDYDGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTDP  333

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFA-PSIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  334   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSGVHIAVGSADHHIH  388

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT++P+ I  GH KAV+Y +FL    + ++S D  +++WD      +RT +GH N
Sbjct  389   YYDLRNTSQPVHIFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENLPIRTLRGHTN  448

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   ++CGSE N+VFVY     +P+  +   S       E+    FIS+
Sbjct  449   EKNFVGLTV--NNEFLACGSETNEVFVYHKAISKPVTWHRFGSPDVDDADEDAGSYFISA  506

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++A  S G ++V 
Sbjct  507   VCW---KSDSPTMLAANSQGTIKVL  528



>ref|XP_006352383.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Solanum tuberosum]
Length=623

 Score =   173 bits (439),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 113/326 (35%), Positives = 176/326 (54%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +DA        C    +
Sbjct  319   ANIVSSIEFDRDDELFATAGVSRRIKVFEFSSVVN------EPADA-------QCPIVEM  365

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W   +    L S DY+G+V  +D+  R  V E +EH  +R WSVD+  ++
Sbjct  366   STRSKLSCLSWN-NYTKNHLASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFCRTE  423

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W   C N    A+V     ++ +C V+++P + + IA G AD   
Sbjct  424   PSMLVSGSDDCKVKVW---CTNQE--ASVLTIDMKANICSVKYNPGSSAHIAVGSADHHV  478

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL+I  GH KAV+Y +FL    + ++S D  +++WD +    +RT+KGH 
Sbjct  479   HYYDLRNISQPLYIFSGHRKAVSYVKFLSNYELASASTDSTLRLWDVNENVPLRTFKGHT  538

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP-IWVYGCKSATGQPGSENG--FIS  1102
             N   FVGL+V  N   ++CGSE N+VFVY     +P  W          P  + G  FIS
Sbjct  539   NEKNFVGLTV--NSEYLACGSETNEVFVYHKAISKPAAWHRFVSDDQNDPDGDMGSFFIS  596

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW +   D  T+V   S G ++  
Sbjct  597   AVCWKR---DSPTIVTANSQGTIKAL  619



>ref|XP_009614778.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009614784.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009614792.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=532

 Score =   172 bits (436),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 176/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  228   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVN------EPADV----HCPVVE--MS  275

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DYDG+V  +D+  R  V E +EH  +R WSVD+S +D 
Sbjct  276   TRSKLSCLSWNK-YTKNHIASSDYDGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTDP  333

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFA-PSIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  334   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSGVHIAVGSADHHIH  388

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT++P+ I  GH KAV+Y +FL    + ++S D  +++WD      +RT +GH N
Sbjct  389   YYDLRNTSQPVHIFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENLPIRTLRGHTN  448

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   ++CGSE N+VFVY     +P+  +   S       E+    FIS+
Sbjct  449   EKNFVGLTV--NNEFLACGSETNEVFVYHKAISKPVTWHRFGSPDVDDADEDAGSYFISA  506

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++A  S G ++V 
Sbjct  507   VCW---KSDSPTMLAANSQGTIKVL  528



>gb|KHG04242.1| E3 ubiquitin-protein ligase COP1 -like protein [Gossypium arboreum]
Length=674

 Score =   173 bits (439),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/326 (34%), Positives = 177/326 (54%), Gaps = 29/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+ ++ +++      E +D     H    +  + 
Sbjct  369   ANIVSSIEFDRDDELFATAGVSRRIKVFDLSMVLN------EPADV----HCPVVE--MS  416

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   W + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S +D 
Sbjct  417   TRSKLSCLSWNKHWKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTDP  474

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  475   SMLVSGSDDCKVKVW---CTKQE--ASVINIDMKANICCVKYNPGSSDFIAVGSADHHIH  529

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + PL +  GH KAV+Y +FL    + ++S D  +++WD      +RT+KGH N
Sbjct  530   YYDLRNISSPLHVFSGHKKAVSYVKFLSENELASASTDSTLRLWDVKENLPLRTFKGHTN  589

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG----FIS  1102
                FVGL+V  N   I+CGSE N+V+VY     +P+  +   S   +   E+G    FIS
Sbjct  590   EKNFVGLTV--NSEYIACGSETNEVYVYHKEISKPVTWHRFGSQEMEDADEDGGGSHFIS  647

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  648   AVCW---KSDSPTMLTANSQGTIKVL  670



>ref|XP_009767442.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X2 [Nicotiana 
sylvestris]
Length=551

 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 176/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  247   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVN------EPADV----HCPVVE--MS  294

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DYDG+V  +D+  R  V E +EH  +R WSVD+S +D 
Sbjct  295   TRSKLSCLSWNK-YTKNHIASSDYDGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTDP  352

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFA-PSIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  353   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSGVHIAVGSADHHIH  407

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT++P+ I  GH KAV+Y +FL    + ++S D  +++WD      +RT +GH N
Sbjct  408   YYDLRNTSQPVHIFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENLPIRTLRGHTN  467

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   ++CGSE N+VFVY     +P+  +   S       E+    FIS+
Sbjct  468   EKNFVGLTV--NNEFLACGSETNEVFVYHKAISKPVTWHRFGSPDVDDADEDAGSYFISA  525

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++A  S G ++V 
Sbjct  526   VCW---KSDSPTMLAANSQGTIKVL  547



>ref|XP_009614770.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=551

 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 176/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  247   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVN------EPADV----HCPVVE--MS  294

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DYDG+V  +D+  R  V E +EH  +R WSVD+S +D 
Sbjct  295   TRSKLSCLSWNK-YTKNHIASSDYDGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTDP  352

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFA-PSIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  353   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSGVHIAVGSADHHIH  407

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT++P+ I  GH KAV+Y +FL    + ++S D  +++WD      +RT +GH N
Sbjct  408   YYDLRNTSQPVHIFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENLPIRTLRGHTN  467

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   ++CGSE N+VFVY     +P+  +   S       E+    FIS+
Sbjct  468   EKNFVGLTV--NNEFLACGSETNEVFVYHKAISKPVTWHRFGSPDVDDADEDAGSYFISA  525

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++A  S G ++V 
Sbjct  526   VCW---KSDSPTMLAANSQGTIKVL  547



>emb|CDP05681.1| unnamed protein product [Coffea canephora]
Length=682

 Score =   173 bits (439),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 174/326 (53%), Gaps = 28/326 (9%)
 Frame = +2

Query  215   VSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYI  394
             V++ +  +EFD  D   AT G++R+I+V+  +S+++      E +D     H    +  +
Sbjct  377   VANIVSSIEFDRDDELFATAGVSRRIKVFDFSSIIN------EPADV----HCPVVE--M  424

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W   +    + S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  425   ATRSKLSCLSWNK-YTKNHIASSDYEGIVTVWDVMTRQSIMEYEEHE-KRAWSVDFSRTE  482

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKT  751
               +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   +A G AD   
Sbjct  483   PSMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSSVHVAVGSADHHI  537

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRNT+ PL I  GH K V+Y +FL    + ++S D  +++WD      VRT +GH 
Sbjct  538   HYYDLRNTSNPLHIFSGHKKTVSYVKFLSTNELASASTDSTLRLWDVKENLPVRTLRGHT  597

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   I+CGSE N+VFVY      P+  +   S       E+    FIS
Sbjct  598   NEKNFVGLTV--NNEFIACGSETNEVFVYHKAIARPVTWHKFGSPEMDDADEDAGSYFIS  655

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++A  S G ++V 
Sbjct  656   AVCW---KSDSPTMLAANSQGTIKVL  678



>ref|XP_002321154.1| photoregulatory zinc-finger protein COP1 [Populus trichocarpa]
 gb|EEE99469.1| photoregulatory zinc-finger protein COP1 [Populus trichocarpa]
Length=672

 Score =   173 bits (438),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 177/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D F AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  368   ANIVSSIEFDRDDEFFATAGVSRRIKVFDFSSVVN------EPADV----HCPVVE--MS  415

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  416   TRSKLSCLSWN-KFTKNQIASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTEP  473

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P + + IA G AD + +
Sbjct  474   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSSNYIAVGSADHQIH  528

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN   PL++  GH K V+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  529   YYDLRNVTNPLYVFSGHRKTVSYVKFLSNSELASASTDSTLRLWDVKENLPVRTFRGHTN  588

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGLSV  +   I+CGSE N+VFVY     +P+  +   S       E+    FIS+
Sbjct  589   EKNFVGLSV--SSEYIACGSETNEVFVYHKEISKPVTWHRFGSPEMDDADEDAGSYFISA  646

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T+++  S G ++V 
Sbjct  647   VCW---KSDSPTMLSANSQGTIKVL  668



>gb|EYU43138.1| hypothetical protein MIMGU_mgv1a002549mg [Erythranthe guttata]
Length=660

 Score =   172 bits (436),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 114/330 (35%), Positives = 175/330 (53%), Gaps = 37/330 (11%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  355   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVN------EPTDV----HCPVVE--MA  402

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DYDG+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  403   TRSKLSCLSWNK-FTKNHIASSDYDGIVTIWDVSTRQSVMEYEEHE-KRAWSVDFSRTEP  460

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P +   +A G AD   +
Sbjct  461   SMLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPDSSKFVAVGSADHHIH  515

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT  PL++  GH K V+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  516   YYDLRNTCHPLYVFSGHKKTVSYVKFLSSNELASASTDSTLRLWDVKKNLPVRTFRGHTN  575

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG-------  1093
                FVGL+V  N   +SCGSE N+VFVY     + I         G P  E+        
Sbjct  576   EKNFVGLTV--NSEFLSCGSETNEVFVYH----KAISKQATSHKFGSPDVEDDNEEELGS  629

Query  1094  -FISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
              FIS+VCW     D  T++A  S G ++V 
Sbjct  630   YFISAVCW---KSDSPTMLAANSRGTIKVM  656



>ref|XP_003284680.1| hypothetical protein DICPUDRAFT_45662 [Dictyostelium purpureum]
 gb|EGC38786.1| hypothetical protein DICPUDRAFT_45662 [Dictyostelium purpureum]
Length=629

 Score =   172 bits (435),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 110/326 (34%), Positives = 177/326 (54%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD    F AT G+ +KI+V+  + + D            ++D  +     IC
Sbjct  326   SSIVSSIEFDRDQEFFATAGVTKKIKVFEFSQIRD------------NVDVHTPVREMIC  373

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
               +K+S L W     S++  S DY+G++  +D      +   +EH  +RVWSVD+S +D 
Sbjct  374   R-SKISCLSWNTYIKSQI-ASSDYEGIISLWDSNTGQSIMTFEEHE-KRVWSVDFSRTDP  430

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
                ASGSDD  ++ W     +   + T++   +++ +CCV+F+P + + IA G AD   +
Sbjct  431   TQLASGSDDTKVKLWSTNTDHA--ITTIE---SKANICCVKFNPSSSNLIAFGSADHHIH  485

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLR   +PL +  GH KAV+Y +F+++  ++++S D  +K+W+ +    +RT+ GH N
Sbjct  486   YYDLRQYKDPLVVFKGHRKAVSYVKFMNKDELISASTDSTLKLWNVNSNECIRTFTGHSN  545

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWV--YGCKSATGQPGSENG--FIS  1102
                FVGL+V  NG  I CGSENN V+ Y     +PI    +G  S TG    E+G  F+S
Sbjct  546   EKNFVGLTV--NGDYICCGSENNGVYTYYKTLSKPIVTHKFGANSGTGDETDEDGSQFVS  603

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             SVCW +   D   L+A  S G +++ 
Sbjct  604   SVCWKK---DSNILLAANSQGNIKIL  626



>ref|XP_009614766.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=671

 Score =   172 bits (435),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 113/326 (35%), Positives = 176/326 (54%), Gaps = 28/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  367   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVN------EPADV----HCPVVE--MS  414

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DYDG+V  +D+  R  V E +EH  +R WSVD+S +D 
Sbjct  415   TRSKLSCLSWNK-YTKNHIASSDYDGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTDP  472

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFA-PSIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  473   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSGVHIAVGSADHHIH  527

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT++P+ I  GH KAV+Y +FL    + ++S D  +++WD      +RT +GH N
Sbjct  528   YYDLRNTSQPVHIFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENLPIRTLRGHTN  587

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   ++CGSE N+VFVY     +P+  +   S       E+    FIS+
Sbjct  588   EKNFVGLTV--NNEFLACGSETNEVFVYHKAISKPVTWHRFGSPDVDDADEDAGSYFISA  645

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVFA  1183
             VCW     D  T++A  S G ++V  
Sbjct  646   VCW---KSDSPTMLAANSQGTIKVLV  668



>ref|XP_009767441.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X1 [Nicotiana 
sylvestris]
Length=671

 Score =   172 bits (435),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 176/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  367   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVN------EPADV----HCPVVE--MS  414

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DYDG+V  +D+  R  V E +EH  +R WSVD+S +D 
Sbjct  415   TRSKLSCLSWNK-YTKNHIASSDYDGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTDP  472

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFA-PSIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  473   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSGVHIAVGSADHHIH  527

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT++P+ I  GH KAV+Y +FL    + ++S D  +++WD      +RT +GH N
Sbjct  528   YYDLRNTSQPVHIFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENLPIRTLRGHTN  587

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   ++CGSE N+VFVY     +P+  +   S       E+    FIS+
Sbjct  588   EKNFVGLTV--NNEFLACGSETNEVFVYHKAISKPVTWHRFGSPDVDDADEDAGSYFISA  645

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++A  S G ++V 
Sbjct  646   VCW---KSDSPTMLAANSQGTIKVL  667



>ref|XP_002271415.1| PREDICTED: E3 ubiquitin-protein ligase COP1 [Vitis vinifera]
 emb|CBI28869.3| unnamed protein product [Vitis vinifera]
 gb|AGN75070.1| COP1 [Vitis vinifera]
Length=676

 Score =   172 bits (435),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 171/325 (53%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+   +           H    +  + 
Sbjct  372   ANIVSSIEFDCDDELFATAGVSRRIKVFDFSSVVNERAEM----------HCPVVE--MS  419

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W     + +  S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  420   TRSKLSCLSWNKCTKNHI-ASSDYEGIVTVWDVNTRQSVMEYEEHE-KRAWSVDFSRTEP  477

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
                 SGSDD  ++ W   C N    A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  478   SRLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSSIYIAVGSADHHIH  532

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT+ PL I  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  533   YYDLRNTSHPLHIFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKENLPVRTFRGHTN  592

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-WVYGCKSATGQPGSENG--FISS  1105
                FVGLSV  N   ISCGSE N VFVY     +P+ W             + G  FIS+
Sbjct  593   EKNFVGLSV--NSEYISCGSETNDVFVYHKEISKPVTWHKFGSPDVDDLDDDVGPYFISA  650

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  651   VCW---KSDSPTMLTANSQGTIKVL  672



>emb|CAN71084.1| hypothetical protein VITISV_028588 [Vitis vinifera]
Length=676

 Score =   171 bits (434),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 171/325 (53%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+   +           H    +  + 
Sbjct  372   ANIVSSIEFDCDDELFATAGVSRRIKVFDFSSVVNERAEX----------HCPVVE--MS  419

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W     + +  S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  420   TRSKLSCLSWNKCTKNHI-ASSDYEGIVTVWDVNTRQSVMEYEEHE-KRAWSVDFSRTEP  477

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
                 SGSDD  ++ W   C N    A+V     ++ +CCV+++P +   IA G AD   +
Sbjct  478   SRLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSSIYIAVGSADHHIH  532

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT+ PL I  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  533   YYDLRNTSHPLHIFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKENLPVRTFRGHTN  592

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-WVYGCKSATGQPGSENG--FISS  1105
                FVGLSV  N   ISCGSE N VFVY     +P+ W             + G  FIS+
Sbjct  593   EKNFVGLSV--NSEYISCGSETNDVFVYHKEISKPVTWHKFGSPDVDDLDDDVGPYFISA  650

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  651   VCW---KSDSPTMLTANSQGTIKVL  672



>gb|AHL58685.1| E3 ubiquitin ligase [Carya cathayensis]
Length=683

 Score =   171 bits (433),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 109/325 (34%), Positives = 174/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R I+V+  +++V+   D           H    +  + 
Sbjct  379   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSTVVNEPADM----------HYPVVE--MA  426

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  427   TRSKLSCLSWN-NFTKNHIASSDYEGIVTVWDVITRQSVMEYEEHE-KRAWSVDFSRTEP  484

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD + +
Sbjct  485   SMLVSGSDDYKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSSNYIAVGSADHQIH  539

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  540   YYDLRNVSHPLHVFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENLPVRTFRGHTN  599

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE---NGFISS  1105
                FVGL+V  N   I+CGSE N+V+VY      P+  +   S   Q   +   + FIS+
Sbjct  600   EKNFVGLTV--NSEYIACGSETNEVYVYHKEISRPVTWHKFSSPDSQDADDEVASYFISA  657

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  658   VCW---KSDSPTMLTANSQGTIKVL  679



>ref|XP_010099137.1| E3 ubiquitin-protein ligase COP1 [Morus notabilis]
 gb|EXB77009.1| E3 ubiquitin-protein ligase COP1 [Morus notabilis]
Length=673

 Score =   171 bits (432),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 176/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ L  +EFD  D F AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  369   ANILSSIEFDRDDEFFATAGVSRRIKVFEFSSVVN------EPADI----HCPIVE--MP  416

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T  KLS L W     S +  S DY+G+V  +D+  R  V E +EH  +R WSVD+S S+ 
Sbjct  417   TRCKLSCLSWNKYTKSHI-ASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRSEP  474

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W  R       A+V     ++ +C V+++P +   +A G ADR  +
Sbjct  475   AMLVSGSDDCKVKIWCTRQE-----ASVLNIDMKANICSVKYNPGSSIYVAVGSADRHIH  529

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++PL +  GH+KAV+Y +FL    + ++S D  +++WD      + TY+GH N
Sbjct  530   YYDLRNISQPLHVFSGHMKAVSYVKFLSNTELASASTDSTLRLWDVKDNLPLCTYRGHTN  589

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   ISCGSE N+VFVY     +P+  +   S+      ++    FIS+
Sbjct  590   EKNFVGLTV--NSEYISCGSETNEVFVYHKAISKPMACHKFSSSGSNENEDDAGSYFISA  647

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  648   VCW---KSDSPTMLTANSGGTIKVL  669



>ref|XP_007026213.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma 
cacao]
 ref|XP_007026214.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOY28835.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOY28836.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma 
cacao]
Length=521

 Score =   169 bits (428),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 110/324 (34%), Positives = 177/324 (55%), Gaps = 27/324 (8%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  218   ANIVSSIEFDHDDELFATAGVSRRIKVFEFSSVVN------EPADV----HCPIVE--MT  265

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DYDG+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  266   TRSKLSCLSWNK-YTKTHIASSDYDGIVTVWDITTRQSVMEYEEHE-KRAWSVDFSRTEP  323

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V      + +C V+++P +   +A G AD   +
Sbjct  324   SMLVSGSDDCKVKIW---CTKQE--ASVLNIDMIANICSVKYNPGSSVHVAVGSADHHIH  378

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++PL++  GH KAV+Y +FL    + ++S D  +++WD      +RT++GH+N
Sbjct  379   YYDLRNVSQPLYVFGGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENLPLRTFRGHMN  438

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP-IW-VYGCKSATGQPGSENGFISSV  1108
                FVGL+V  N   I+CGSE N+VFVY     +P  W  +G   A  +  + + FIS+V
Sbjct  439   EKNFVGLTV--NSEYIACGSETNEVFVYHKAISKPAAWHRFGSDMADAEEDAGSYFISAV  496

Query  1109  CWMQRGDDHCTLVAGGSDGVLRVF  1180
             CW     D  T++   S G ++V 
Sbjct  497   CW---KSDSPTMLTANSRGTIKVL  517



>ref|XP_010270052.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Nelumbo nucifera]
Length=687

 Score =   170 bits (431),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 175/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  383   ANIVSSIEFDRDDELFATAGVSRRIKVFEFSSVVN------EPTDV----HCPIVE--MS  430

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D++ R  V E +EH  +R WSVD+S ++ 
Sbjct  431   TRSKLSCLSWNK-YTKNHIASSDYEGIVTVWDVDTRQSVMEYEEHE-KRAWSVDFSRTEP  488

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   +A G AD   +
Sbjct  489   SMLVSGSDDCKVKIW---CTKQE--ASVLNIDMKANICCVKYNPGSSIYVAVGSADHHIH  543

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++PL + +GH KAV+Y +FL    + ++S D  +++WD     LVRT++GH N
Sbjct  544   YYDLRNISQPLHVFNGHKKAVSYVKFLSNNELASASTDSTLRLWDVKENLLVRTFRGHTN  603

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP-IW--VYGCKSATGQPGSENGFISS  1105
                FVGL+V  N   I+CGSE N+VFVY     +P  W                + FIS+
Sbjct  604   EKNFVGLTV--NSEYIACGSETNEVFVYHKAISKPAAWHRFGSSDLDDTDDDGGSYFISA  661

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  662   VCW---KSDSATMLTANSQGTIKVL  683



>emb|CAN77887.1| hypothetical protein VITISV_020525 [Vitis vinifera]
Length=151

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 108/150 (72%), Gaps = 10/150 (7%)
 Frame = +2

Query  68   MKNFSS--SPTSAAETSQTIQQEEDDG----EKARCDWDFRISAVVSSPTSAVGAVSDAL  229
            MKNFS+  +P S    +  IQ+E+ +     E+ARCDW+F +  VV+S  S+ GA +D +
Sbjct  1    MKNFSTQFNPQSPEVENPNIQEEKAEQHIEEERARCDWEFNLXTVVTS--SSXGASTDTI  58

Query  230  GVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSL-DHSSACDYYICTPA  406
            GV+EFDPSD+ +ATGGIAR IRVYSV SL+ P  +   G   V L  H++ACDYYI TPA
Sbjct  59   GVIEFDPSDSLVATGGIARXIRVYSVKSLL-PGENHSHGEHNVKLLQHNNACDYYIWTPA  117

Query  407  KLSSLRWKPGWNSRVLGSGDYDGVVMEYDL  496
            KLSSLRWKPG + RVLGSGDYDGVV EYDL
Sbjct  118  KLSSLRWKPGSSGRVLGSGDYDGVVTEYDL  147



>ref|XP_011007762.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X2 [Populus 
euphratica]
 ref|XP_011007763.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X2 [Populus 
euphratica]
Length=558

 Score =   169 bits (428),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 175/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D F AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  254   ANIVSSIEFDRDDEFFATAGVSRRIKVFDFSSVVN------EPADV----HCPVVE--MS  301

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  302   TRSKLSCLSWNK-FTKNHIASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTEP  359

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P + + IA G AD + +
Sbjct  360   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSSNYIAVGSADHQIH  414

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN   PL++  GH K V+Y +FL    + ++S D  +++WD      VRT +GH N
Sbjct  415   YYDLRNVTHPLYVFSGHRKTVSYVKFLSNSELASASTDSTLRLWDVKENLPVRTLRGHTN  474

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGLSV  +   I+CGSE N+VFVY     + +  +   S       E+    FIS+
Sbjct  475   EKNFVGLSV--SSEYIACGSETNEVFVYHKEISKHVTRHRFGSPEMDDADEDAGSYFISA  532

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T+++  S G ++V 
Sbjct  533   VCW---KSDSPTMLSANSQGTIKVL  554



>ref|XP_009570712.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2, partial [Fulmarus 
glacialis]
 ref|XP_010293357.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2, partial [Phaethon 
lepturus]
Length=305

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/325 (33%), Positives = 178/325 (55%), Gaps = 33/325 (10%)
 Frame = +2

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  +   +K+S
Sbjct  1     IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYP---ENEMTCNSKIS  48

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  49    CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  104

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  105   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  159

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  160   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  219

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  220   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  277

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  278   CWRALPDGESNVLIAANSQGTIKVL  302



>ref|XP_004250243.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010312733.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X1 [Solanum 
lycopersicum]
Length=672

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 114/342 (33%), Positives = 179/342 (52%), Gaps = 30/342 (9%)
 Frame = +2

Query  170   RISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGS  349
             R+  V     S +   ++ +  +EFD  D   AT G++R+I+V+  +S+V+   D     
Sbjct  352   RLRVVAELRHSDIFHSANIVSSIEFDRDDELFATAGVSRRIKVFEFSSVVNKPAD-----  406

Query  350   DAVSLDHSSACDYY-ICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERD  526
                     + C    + T +KLS L W   +    L S DY+G+V  +D+  R  V E +
Sbjct  407   --------AQCPVVEMSTRSKLSCLSWN-NYTKNHLASSDYEGIVTVWDVTTRQSVMEYE  457

Query  527   EHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFS  706
             EH  +R WSVD+  ++  +  SGSDD  ++ W   C      A+V     ++ +C V+++
Sbjct  458   EHE-KRAWSVDFCRTEPSMLVSGSDDCKVKVW---CTKQE--ASVLTIDMKANICSVKYN  511

Query  707   PFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKM  883
             P + + IA G AD   + YDLRN ++PL+I  GH KAV+Y +FL    + ++S D  +++
Sbjct  512   PGSSAHIAVGSADHHVHYYDLRNISQPLYIFSGHRKAVSYVKFLSNYELASASTDSTLRL  571

Query  884   WDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS  1063
             WD +    +RT+KGH N   FVGL+V  N   ++CGSE N+VFVY     +P   Y   S
Sbjct  572   WDVNENVPLRTFKGHTNEKNFVGLTV--NSEYLACGSETNEVFVYHKAISKPAARYRFVS  629

Query  1064  -ATGQPGSENG--FISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                  P  + G  FIS+VCW +   D  T+V   S G ++  
Sbjct  630   DDQNDPDGDMGSFFISAVCWKR---DSPTIVTANSRGTIKAL  668



>ref|XP_006447656.1| hypothetical protein CICLE_v10014491mg [Citrus clementina]
 ref|XP_006469604.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Citrus sinensis]
 gb|ESR60896.1| hypothetical protein CICLE_v10014491mg [Citrus clementina]
Length=680

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 178/325 (55%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+   S+V+      E +D     H    +  + 
Sbjct  376   ANIVSSIEFDRDDQLFATAGVSRRIKVFDFASVVN------EPADV----HCPVVE--MP  423

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W     +R+  S DY+G+V  +D+  +  V E +EH  +R WSVD+S ++ 
Sbjct  424   TRSKLSCLSWNKFSKNRI-ASSDYEGIVTVWDVTTQQSVMEYEEHE-KRAWSVDFSRTEP  481

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  482   SMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNYIAVGSADHHIH  536

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH+N
Sbjct  537   YYDLRNISQPLHVFTGHKKAVSYVKFLSNDELASASTDSTLRLWDVKENLPVRTFRGHMN  596

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   I+CGSE+N+V+VY     +P+  +   S       E+    FIS+
Sbjct  597   EKNFVGLTV--NSEYIACGSESNEVYVYHKEISKPVTWHRFSSPDMDDTDEDAGSYFISA  654

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  655   VCW---KSDSPTMLTANSQGTIKVL  676



>ref|XP_001774722.1| predicted protein [Physcomitrella patens]
 gb|EDQ60537.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/324 (34%), Positives = 175/324 (54%), Gaps = 27/324 (8%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  +EFD  D F AT G++R+I+++   ++++   D           H    +  I 
Sbjct  347   SNIVSSIEFDRDDEFFATAGVSRRIKIFDFATVINELTDV----------HCPVVE--IP  394

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +K+S L W       ++ S DY+G+V  +D+  R  V E +EH  +R WS+D+S +D 
Sbjct  395   TRSKMSCLSWNKCLKP-LIASSDYEGIVTVWDVNTRQSVMEYEEHE-KRAWSIDFSRTDP  452

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDDG M+ W   C      A     KA   +CCV+++P + + IA G AD + +
Sbjct  453   SMLVSGSDDGKMKVW---CTRQESSALSLDMKAN--ICCVKYNPGSSNHIAVGSADHQIH  507

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              +DLRN  +PL +  GH KAV+Y +F+    + ++S D  +++WD    + +RT +GH N
Sbjct  508   YFDLRNVRKPLNVFKGHRKAVSYVKFISPTELASASTDSTLRLWDVQRDSSIRTLRGHTN  567

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG--FISSV  1108
                FVGL+V  N   I+CGSE+N+V VY      P   +G  S   +   ++G  FIS+V
Sbjct  568   EKNFVGLTV--NNEYIACGSESNEVVVYHKAIPRPAACHGFGSQNPEGSDDDGSHFISAV  625

Query  1109  CWMQRGDDHCTLVAGGSDGVLRVF  1180
             CW   G    T++A  S G ++V 
Sbjct  626   CWKSEGP---TMLAANSQGTVKVL  646



>gb|KFO30665.1| E3 ubiquitin-protein ligase RFWD2 [Fukomys damarensis]
Length=363

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/331 (33%), Positives = 180/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  47    SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQ---------DAVDIHYP---ENEMT  94

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  95    CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  150

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  151   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  205

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  206   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  265

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  266   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  323

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++VF
Sbjct  324   EFVSAVCWRALPDGESNVLIAANSQGTIKVF  354



>ref|XP_009393690.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Musa acuminata 
subsp. malaccensis]
Length=700

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 176/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D F AT G++++I+V+  +++V+     D     V L           
Sbjct  396   ANIVSSIEFDRDDEFFATAGVSKRIKVFEFSTVVNE--PSDVNCPVVEL----------A  443

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   ++  ++ S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++ 
Sbjct  444   TRSKLSCLSWNK-YSKNIIASSDYEGIVTVWDVTTRQSMMEYEEHE-KRAWSVDFSRTEP  501

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   +A G AD   +
Sbjct  502   TMLVSGSDDCKVKVW---CTKQE--ASVINIDMKANICCVKYNPGSSVHVAVGSADHHIH  556

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              +DLRNT+ PL I  GH KAV+Y +FL    + ++S D  +++WD      VRT+KGH N
Sbjct  557   YFDLRNTSTPLRIFKGHWKAVSYVKFLSTNELASASTDSTLRLWDVKDTCPVRTFKGHTN  616

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   I+CGSE N+VFVY     +P   +   S+      ++    FIS+
Sbjct  617   EKNFVGLTV--NNEYIACGSETNEVFVYHKAISKPAAWHKFGSSDLDDAEDDAGSYFISA  674

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++A  S G ++V 
Sbjct  675   VCW---KSDSPTMLAANSQGTIKVL  696



>ref|XP_002534127.1| ubiquitin ligase protein cop1, putative [Ricinus communis]
 gb|EEF28255.1| ubiquitin ligase protein cop1, putative [Ricinus communis]
Length=677

 Score =   169 bits (428),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/325 (34%), Positives = 173/325 (53%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +++++   D     + +S            
Sbjct  373   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSTVLNDPADVHCPVEEMS------------  420

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  421   TRSKLSCLSWNK-YAKNQIASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTEP  478

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  479   SMLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSSNYIAVGSADHHIH  533

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  534   YYDLRNVSHPLHVFSGHRKAVSYVKFLSNSELASASTDSTLRLWDVKENLPVRTFRGHTN  593

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGLSV  N   I+CGSE N+V+VY      P+  +   S       E+    FIS+
Sbjct  594   EKNFVGLSV--NRDYIACGSETNEVYVYHKEISRPVTWHRFGSPEMDDADEDAGSYFISA  651

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  652   VCW---KSDSPTMLTANSQGTIKVL  673



>ref|XP_001766062.1| predicted protein [Physcomitrella patens]
 gb|EDQ69121.1| predicted protein [Physcomitrella patens]
Length=687

 Score =   169 bits (428),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/324 (34%), Positives = 173/324 (53%), Gaps = 27/324 (8%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  +EFD  D F AT G++R+I+V+  + +V+   D           H    +  I 
Sbjct  384   SNIVSSIEFDRDDEFFATAGVSRRIKVFDFSRVVNDVADV----------HCPVVE--IP  431

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W     S ++ S DY+G+V  +D+  R  V E +EH  RR WSVD+S ++ 
Sbjct  432   TRSKLSCLSWNKCEKS-LIASSDYEGIVTLWDVNTRQSVMEYEEHE-RRAWSVDFSRTEP  489

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDDG ++ W  R        +      R+ +CCV+++P + + IA G AD   +
Sbjct  490   SMLVSGSDDGKVKVWCTRQE-----TSALSLDMRANICCVKYNPGSSNHIAVGSADHHIH  544

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              +DLRN   PL++  GH KAV+Y +F+    + ++S D  +++WD     L RT +GH N
Sbjct  545   YFDLRNARIPLYVFKGHRKAVSYVKFISPTELASASTDSTLRLWDVQKDCLTRTLRGHTN  604

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI--WVYGCKSATGQPGSENGFISSV  1108
                FVGL+V  N   ++CGSE+N+VFVY     +P     +G ++        + FIS+V
Sbjct  605   EKNFVGLTV--NSEYVACGSESNEVFVYHKAMSKPAAWHRFGSQNPDDSDDDSSHFISAV  662

Query  1109  CWMQRGDDHCTLVAGGSDGVLRVF  1180
             CW        T++A  S G ++V 
Sbjct  663   CWKSESP---TMLAANSQGTIKVL  683



>ref|XP_004165437.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Cucumis sativus]
Length=494

 Score =   167 bits (423),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 176/328 (54%), Gaps = 34/328 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R I+V+  +S+V+      E  DA    H    +  + 
Sbjct  190   TNIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVN------EPPDA----HCPIVE--MS  237

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T AKLS L W    +  ++ S DY+G+V  +D+ R   V E +EH  +R WSVD+S ++ 
Sbjct  238   TRAKLSCLSWDKQ-SKNIIASSDYEGIVTVWDVNRGQSVMEYEEHE-KRAWSVDFSRTEP  295

Query  578   vvgasgsddgTMQTWDPRCPNGNCL---ATVQPSKARSAVCCVQFSPFAPS-IAAGCADR  745
                 SGSDD  ++ W        C+   A+V     ++ +CCV+F+P + + IA G AD 
Sbjct  296   SRLVSGSDDCKVKVW--------CMKQEASVLDIDMKANICCVKFNPGSGNHIAVGSADH  347

Query  746   KTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKG  925
               + YDLRN + PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++G
Sbjct  348   NIHYYDLRNISHPLHVFTGHKKAVSYVKFLSNSELASASTDSTLRLWDVKENLPVRTFRG  407

Query  926   HINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-W-VYGCKSATG-QPGSENGF  1096
             H N   FVGL+V  N   I+CGSE N+VFVY      P+ W  +G    T  +    + F
Sbjct  408   HTNEKNFVGLTV--NNEYIACGSETNEVFVYHKEISRPLTWHRFGSPDVTDVEDDVGSYF  465

Query  1097  ISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             IS+VCW     D  T++   S G ++V 
Sbjct  466   ISAVCW---KSDSPTILTANSQGTIKVL  490



>ref|XP_005651066.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26522.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=533

 Score =   168 bits (425),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 181/341 (53%), Gaps = 28/341 (8%)
 Frame = +2

Query  170   RISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYS-VNSLVDPFWDQDEG  346
             ++  V   P ++    +  L  +EFD      AT G++++I ++   N L  P   Q   
Sbjct  213   KLKVVAELPRASARQQAAILSSIEFDRDRAVFATAGVSKRISLFDYANVLAHPHVQQ---  269

Query  347   SDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERD  526
                    H  A +  + T +KLS L W     S ++ S DY+G V  +D++ +  V E +
Sbjct  270   -------HCPAAE--LVTRSKLSCLSWNKYVRSHIISS-DYEGCVTLWDVDTQATVNEYE  319

Query  527   EHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFS  706
              H  +R+WSVDYS +D ++  SGSDDG ++ W     + N  A       R+ VCCV+++
Sbjct  320   AHD-KRIWSVDYSTADPLLFVSGSDDGFIKVW-----STNQAAAAVAIDMRANVCCVKYN  373

Query  707   PF-APSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKM  883
             P  A  IA G AD   + YDLRN + P+ +  GH KAV+Y R+L    V+++S D  +++
Sbjct  374   PASAHEIAVGSADHSVHLYDLRNVSAPVHVFAGHRKAVSYVRYLSSTEVVSASTDSTLRL  433

Query  884   WDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIW--VYGC  1057
             W+T   +  R + GH+N   FVGLSV  +   I+CGSE ++V+VY     +PI   V+  
Sbjct  434   WNTQTLSQTRRFSGHVNEKNFVGLSV--DSEFIACGSETDEVYVYYRALAKPIAKRVFSG  491

Query  1058  KSATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
              +A+GQ    + FIS+VCW  +      L+A  S G +++ 
Sbjct  492   PTASGQASEGSQFISAVCWKPQAQ---VLLAANSQGCIKLM  529



>ref|XP_636746.1| hypothetical protein DDB_G0288453 [Dictyostelium discoideum AX4]
 gb|EAL63252.1| hypothetical protein DDB_G0288453 [Dictyostelium discoideum AX4]
Length=970

 Score =   171 bits (434),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/327 (33%), Positives = 179/327 (55%), Gaps = 30/327 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD  + + AT G+ +KI+++  + + D            +++  S      C
Sbjct  667   SSIVSSIEFDRDEEYFATAGVTKKIKIFEFSQIRD------------NVEVHSPVKEMTC  714

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
               +K+S L W     S++  S DY+G++  +D      +   +EH  +RVWSVD+S +D 
Sbjct  715   R-SKISCLSWNTYIKSQI-ASSDYEGIISLWDANTGQNIMTLEEHE-KRVWSVDFSRTDP  771

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
                ASGSDD  ++ W         + T++   +++ +CCV+F+P + + IA G AD   +
Sbjct  772   TQLASGSDDTRVKLWSTTTERA--ITTIE---SKANICCVKFNPCSSNLIAFGSADHHIH  826

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLR   +PL I  GH KAV+Y +F+++  ++++S D  +K+W+ +  + VRT+ GH N
Sbjct  827   YYDLRQYKDPLLIFKGHRKAVSYVKFMNKDEIISASTDSTLKLWNVNQNDCVRTFTGHSN  886

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWV--YGCKSATGQPGSENG--FIS  1102
                FVGL+V  NG  I CGSENN V+ Y     +PI    +G  S TG+   ++G  F+S
Sbjct  887   EKNFVGLTV--NGDYICCGSENNGVYTYYKTLSKPIVTHRFGANSGTGEETDDDGSQFVS  944

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVFA  1183
             SVCW +   D   L+A  S G +++ +
Sbjct  945   SVCWKK---DSNILLAANSQGNIKILS  968



>ref|XP_011007761.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X1 [Populus 
euphratica]
Length=672

 Score =   169 bits (428),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 175/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D F AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  368   ANIVSSIEFDRDDEFFATAGVSRRIKVFDFSSVVN------EPADV----HCPVVE--MS  415

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  416   TRSKLSCLSWN-KFTKNHIASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTEP  473

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P + + IA G AD + +
Sbjct  474   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSSNYIAVGSADHQIH  528

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN   PL++  GH K V+Y +FL    + ++S D  +++WD      VRT +GH N
Sbjct  529   YYDLRNVTHPLYVFSGHRKTVSYVKFLSNSELASASTDSTLRLWDVKENLPVRTLRGHTN  588

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGLSV  +   I+CGSE N+VFVY     + +  +   S       E+    FIS+
Sbjct  589   EKNFVGLSV--SSEYIACGSETNEVFVYHKEISKHVTRHRFGSPEMDDADEDAGSYFISA  646

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T+++  S G ++V 
Sbjct  647   VCW---KSDSPTMLSANSQGTIKVL  668



>ref|XP_010097907.1| E3 ubiquitin-protein ligase COP1 [Morus notabilis]
 gb|EXB72970.1| E3 ubiquitin-protein ligase COP1 [Morus notabilis]
Length=682

 Score =   169 bits (427),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/325 (34%), Positives = 178/325 (55%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  378   ANIVSSIEFDCDDELFATAGVSRRIKVFDFSSVVN------EPADL----HCPVVE--MS  425

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W     + +  S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  426   TRSKLSCLSWNKFVKNHI-ASSDYEGIVTVWDVNTRQSVMEYEEHE-KRAWSVDFSRTEP  483

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G A+   +
Sbjct  484   SMLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSSNYIAVGSANHHIH  538

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++PL +  GH K V+Y +FL    + ++S D  +++WD     LVRT++GH N
Sbjct  539   YYDLRNASQPLHVFSGHKKTVSYVKFLSNNELASASTDSTLRLWDVKENTLVRTFRGHSN  598

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI--WVYGCKSATG-QPGSENGFISS  1105
                FVGL+V  N   I+CGSE N+V+VY     +P+    +G       +  + + FIS+
Sbjct  599   EKNFVGLTV--NSEYIACGSETNEVYVYHKEISKPVTWHRFGSPDLDDVEDEAASYFISA  656

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  657   VCW---KSDSPTMLTANSQGTIKVL  678



>ref|XP_009631549.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Nicotiana tomentosiformis]
Length=520

 Score =   167 bits (424),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 174/325 (54%), Gaps = 29/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D F AT G++R+I+V+  +S+V+      E +DA        C    I
Sbjct  217   TNIVSSIEFDRDDEFFATAGVSRRIKVFDFSSVVN------EPADA-------QCPVVEI  263

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              + +KLS L W   +    + S DY+G+V  +D+  R  V E +EH  R  WSV +SH+D
Sbjct  264   SSRSKLSCLSWNK-YAKNHIASSDYEGIVTIWDVTSRQSVMEYEEHEIR-AWSVAFSHTD  321

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKT  751
               +  SGSDD  ++ W   C      A+V     ++ +C V+++P +   IA G AD   
Sbjct  322   PSMLVSGSDDCKVKVW---CMKQE--ASVISIDMKANICSVKYNPQSSFHIAVGSADNHI  376

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN  +PL I  GH K V+Y +F+    + ++S DG +++WD      +RT++GH 
Sbjct  377   HYYDLRNIKQPLHIFSGHHKTVSYVKFVSNNELASASTDGTLRLWDVKENIPLRTFRGHT  436

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG--FISS  1105
             N   FVGL+V  N   I+CGSE N+VFVY     +P   +   S    P  + G  FISS
Sbjct  437   NEKNFVGLAV--NSQYIACGSETNEVFVYHKAISKPAASHKFDSDQNDPDEDMGSHFISS  494

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW +      T++   S G+++V 
Sbjct  495   VCWKRESR---TILTANSQGIVQVL  516



>ref|XP_001772712.1| predicted protein [Physcomitrella patens]
 gb|EDQ62426.1| predicted protein [Physcomitrella patens]
Length=687

 Score =   169 bits (427),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 114/334 (34%), Positives = 179/334 (54%), Gaps = 45/334 (13%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  +EFD  D F AT G++R+++V++  ++V+   D           H    +  I 
Sbjct  384   SNIVSSIEFDRDDEFFATAGVSRRVKVFNFETVVNELADV----------HCPLVE--IA  431

Query  398   TPAKLSSLRW----KPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYs  565
             T +KLS L W    KP     ++ S DY+G V  +D+  R  V E +EH  +R WSVD+S
Sbjct  432   TRSKLSCLSWNKCAKP-----LIASSDYEGTVTVWDVNTRQAVMEYEEHE-KRAWSVDFS  485

Query  566   hsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKA-----RSAVCCVQFSPFAPS-IA  727
              ++  +  SGSDDG ++ W           T Q S A     R+ +CCV+++P + + IA
Sbjct  486   RTEPSMLVSGSDDGKVKVW----------CTRQESSALSLDMRANICCVKYNPGSSNHIA  535

Query  728   AGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNL  907
              G AD   + +DLRN + PL++  GH KAV+Y +F+    + ++S D  +++WD      
Sbjct  536   VGSADHCIHYFDLRNASTPLYVFKGHRKAVSYVKFISPTELASASTDSTLRLWDVQRDCS  595

Query  908   VRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-W-VYGCKSATGQPG  1081
             +RT +GH N   FVGL+V  N   I+CGSE+N+VFVY      P  W  +G  ++     
Sbjct  596   IRTLRGHTNEKNFVGLTV--NNEYIACGSESNEVFVYHKAMSRPASWHRFGSHNSEDNGD  653

Query  1082  SENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFA  1183
               + FIS+VCW  +     T++A  S G ++V A
Sbjct  654   DSSHFISAVCWKSQSP---TMLAANSQGTIKVLA  684



>gb|AGU91426.1| COP1-like protein, partial [Chrysanthemum boreale]
Length=402

 Score =   165 bits (418),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/326 (33%), Positives = 173/326 (53%), Gaps = 28/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V++ +++V+      E  +A    H    +  I 
Sbjct  98    ANIVSSIEFDRDDEMFATAGVSRRIKVFNFSTIVN------EPPEA----HCPVVE--IS  145

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W     + +  S DY+G V  +D+  R  V E +EH  +RVWSVDYS  + 
Sbjct  146   TRSKLSCLSWNKHTKNHI-ASSDYEGTVFVWDVNTRQSVMEYEEHE-KRVWSVDYSRQEP  203

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W  R       ++      ++ +CCV+F+P + + +A G  D   +
Sbjct  204   SMLVSGSDDCKVKIWSTRQE-----SSAMNIDMKANICCVKFNPGSSTHVAVGSVDHHIH  258

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRNT+ P+ I  GH K V+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  259   YYDLRNTSHPIHIFSGHQKTVSYVKFLSNDELASASTDSTLRLWDVKRYLPVRTFRGHTN  318

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-W-VYGCKSATGQPGSENG-FISS  1105
                FVGLSV  N   ++CGSE N+V+ Y     +P+ W  +G  +           FIS+
Sbjct  319   EKNFVGLSV--NNDFLACGSETNEVYGYHKAISKPLTWHRFGTPNVDDSDDDSGSYFISA  376

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVFA  1183
             VCW     D  T++A  S G ++V  
Sbjct  377   VCW---KSDSPTMLAANSLGTIKVLV  399



>ref|XP_010312734.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X2 [Solanum 
lycopersicum]
Length=663

 Score =   168 bits (426),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 174/326 (53%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+   D             + C    +
Sbjct  359   ANIVSSIEFDRDDELFATAGVSRRIKVFEFSSVVNKPAD-------------AQCPVVEM  405

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W   +    L S DY+G+V  +D+  R  V E +EH  +R WSVD+  ++
Sbjct  406   STRSKLSCLSWN-NYTKNHLASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFCRTE  463

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W   C      A+V     ++ +C V+++P + + IA G AD   
Sbjct  464   PSMLVSGSDDCKVKVW---CTKQE--ASVLTIDMKANICSVKYNPGSSAHIAVGSADHHV  518

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL+I  GH KAV+Y +FL    + ++S D  +++WD +    +RT+KGH 
Sbjct  519   HYYDLRNISQPLYIFSGHRKAVSYVKFLSNYELASASTDSTLRLWDVNENVPLRTFKGHT  578

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS-ATGQPGSENG--FIS  1102
             N   FVGL+V  N   ++CGSE N+VFVY     +P   Y   S     P  + G  FIS
Sbjct  579   NEKNFVGLTV--NSEYLACGSETNEVFVYHKAISKPAARYRFVSDDQNDPDGDMGSFFIS  636

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW +   D  T+V   S G ++  
Sbjct  637   AVCWKR---DSPTIVTANSRGTIKAL  659



>ref|XP_009769729.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X4 [Nicotiana 
sylvestris]
 ref|XP_009769730.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X4 [Nicotiana 
sylvestris]
Length=529

 Score =   167 bits (423),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 115/342 (34%), Positives = 177/342 (52%), Gaps = 30/342 (9%)
 Frame = +2

Query  170   RISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGS  349
             R+  V     S +  +++ +  +EFD  D   AT G++R+I+V+   S+V+      E +
Sbjct  209   RLRVVAELRHSDLFHMANIVSSIEFDRDDELFATAGVSRRIKVFEFASVVN------EPA  262

Query  350   DAVSLDHSSACDYY-ICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERD  526
             +A        C    + T +KLS L W     +  L S DY+G+V  +D+  R  V E +
Sbjct  263   EA-------QCPLVEMSTRSKLSCLSWNKCTKNH-LASSDYEGIVTVWDVTTRQSVMEYE  314

Query  527   EHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFS  706
             EH  +R WSVD+  ++  V  SGSDD  ++ W   C      A+V     ++  C V+++
Sbjct  315   EHE-KRAWSVDFCRTEPSVLVSGSDDCKVKVW---CTKQE--ASVLTIDMKANACSVKYN  368

Query  707   PFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKM  883
             P +   +A G AD   + YDLRN ++PL I  GH KAV+Y +FL    + ++S D  +++
Sbjct  369   PGSSVLVAVGSADHHIHYYDLRNVSQPLHIFSGHRKAVSYVKFLSNNELASASTDSTLRL  428

Query  884   WDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP-IWVYGCK  1060
             WD      +RT+KGH N   FVGL+V  N   ++CGSE N+VFVY     +P  W     
Sbjct  429   WDVKENVPLRTFKGHANEKNFVGLTV--NSEYLACGSETNEVFVYHKEISKPAAWHKFGS  486

Query  1061  SATGQPGSENG--FISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                  P  E G  FIS+VCW +   D  T++   S G ++V 
Sbjct  487   DDQNDPDGEMGSYFISAVCWKR---DSSTILTANSQGTIKVL  525



>gb|KEH28314.1| E3 ubiquitin-protein ligase COP1 [Medicago truncatula]
Length=540

 Score =   167 bits (424),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 177/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D+  AT G++R+I+V+  +++V+      E +DA    H    +  + 
Sbjct  236   ANIVSSIEFDRDDDLFATAGVSRRIKVFDFSAVVN------EPTDA----HCPVVE--MT  283

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  + E +EH  +R WSVD+S +D 
Sbjct  284   TRSKLSCLSWNK-YAKNQIASSDYEGIVTVWDVTTRKSLMEYEEHE-KRAWSVDFSRTDP  341

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  342   SMLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSGNYIAVGSADHHIH  396

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  397   YYDLRNISRPVHVFSGHKKAVSYVKFLSNDELASASTDSTLRLWDVKQNVPVRTFRGHAN  456

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-WVYGCKSATGQPGSENG--FISS  1105
                FVGL+V  +   I+CGSE N+VFVY     +P+ W             E G  FIS+
Sbjct  457   EKNFVGLTV--SSEYIACGSETNEVFVYHKEISKPLTWHRFSSPDMDDAEDEAGSYFISA  514

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  515   VCW---KSDRPTILTANSQGTIKVL  536



>ref|XP_007026210.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY28832.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=701

 Score =   169 bits (427),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 110/324 (34%), Positives = 177/324 (55%), Gaps = 27/324 (8%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  398   ANIVSSIEFDHDDELFATAGVSRRIKVFEFSSVVN------EPADV----HCPIVE--MT  445

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DYDG+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  446   TRSKLSCLSWNK-YTKTHIASSDYDGIVTVWDITTRQSVMEYEEHE-KRAWSVDFSRTEP  503

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V      + +C V+++P +   +A G AD   +
Sbjct  504   SMLVSGSDDCKVKIW---CTKQE--ASVLNIDMIANICSVKYNPGSSVHVAVGSADHHIH  558

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++PL++  GH KAV+Y +FL    + ++S D  +++WD      +RT++GH+N
Sbjct  559   YYDLRNVSQPLYVFGGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENLPLRTFRGHMN  618

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP-IW-VYGCKSATGQPGSENGFISSV  1108
                FVGL+V  N   I+CGSE N+VFVY     +P  W  +G   A  +  + + FIS+V
Sbjct  619   EKNFVGLTV--NSEYIACGSETNEVFVYHKAISKPAAWHRFGSDMADAEEDAGSYFISAV  676

Query  1109  CWMQRGDDHCTLVAGGSDGVLRVF  1180
             CW     D  T++   S G ++V 
Sbjct  677   CW---KSDSPTMLTANSRGTIKVL  697



>tpg|DAA57803.1| TPA: hypothetical protein ZEAMMB73_989456 [Zea mays]
Length=438

 Score =   166 bits (419),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 119/324 (37%), Positives = 167/324 (52%), Gaps = 35/324 (11%)
 Frame = +2

Query  242   FDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSL  421
             FD    F AT G+ +KI+V+  N +V+   D           H    +  +   +KLS +
Sbjct  136   FDRDREFFATAGVNKKIKVFEYNMIVNEHRDI----------HYPVVE--MSNRSKLSCI  183

Query  422   RWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsd  601
              W     S +  S D++G+V  +D+ R     E  EH  RRVWSVD+S  D     SGSD
Sbjct  184   SWNSYMKSHI-ASSDFEGIVQVWDVTRSQVFVEMREHE-RRVWSVDFSIVDPTKLVSGSD  241

Query  602   dgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSP-FAPSIAAGCADRKTYTYDLRNTA  778
             DG+++ WD      N   ++   K R+ VC VQF P  A SIA G AD K Y YDLR+  
Sbjct  242   DGSVKLWDM-----NQAGSIGTIKTRANVCSVQFQPDTARSIAIGSADHKIYCYDLRHIR  296

Query  779   EPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHR------NLVRTYKGHINTT  940
              P   L GH K V+Y ++LD  T++++S D  +K+WD          + V+T+KGH NT 
Sbjct  297   APYCTLVGHTKTVSYVKYLDASTIVSASTDNSLKLWDLSMSPGRIIDSPVQTFKGHTNTK  356

Query  941   RFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE----NGFISSV  1108
              FVGLS+  + G I+ GSE N+VFVY   +  P+  Y         G E    + FIS V
Sbjct  357   NFVGLSI--SDGYIATGSETNEVFVYHKEFPMPVLAYKFSVTDPISGQEIDDQSQFISCV  414

Query  1109  CWMQRGDDHCTLVAGGSDGVLRVF  1180
             CW  RG    TL++  S G +++ 
Sbjct  415   CW--RGQS-STLLSANSSGNIKIL  435



>ref|XP_001771245.1| predicted protein [Physcomitrella patens]
 gb|EDQ63956.1| predicted protein [Physcomitrella patens]
Length=670

 Score =   168 bits (426),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 108/324 (33%), Positives = 173/324 (53%), Gaps = 27/324 (8%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  +EFD  D   AT G++R+I+V+   ++V+   D           H    +  + 
Sbjct  367   SNIVSSIEFDRDDQLFATAGVSRRIKVFEFATVVNELADV----------HCPVVE--MS  414

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W    NS +  S DY+G++  +D+     + E +EH  +R WSVD+S +D 
Sbjct  415   TRSKLSCLSWNKYINSHI-ASSDYEGIITVWDVNTHQSIMEYEEHE-KRAWSVDFSRTDP  472

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDDG ++ W  R       ++V     ++ +CCV+++P + S +A G AD   +
Sbjct  473   TMLVSGSDDGKVKIWCTRQE-----SSVINIDMKANICCVKYNPGSSSYVAVGSADHHIH  527

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              +D+RN+  PL++ +GH KAV+Y +FL    + ++S D  +++WD       RT KGH N
Sbjct  528   YFDVRNSHMPLYMFNGHRKAVSYVKFLSPTELASASTDSTLRLWDVKDNCPTRTLKGHTN  587

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI--WVYGCKSATGQPGSENGFISSV  1108
                FVGL+V  N   I+CGSE N+VFVY     +P     +G + A       + FIS+V
Sbjct  588   EKNFVGLTV--NSEYIACGSETNEVFVYHKAMSKPASWHRFGSQDAEESDDDTSHFISAV  645

Query  1109  CWMQRGDDHCTLVAGGSDGVLRVF  1180
             CW        T++A  S G ++V 
Sbjct  646   CWKSESP---TMLAANSQGTIKVL  666



>ref|NP_192849.4| protein SPA1-related 2 [Arabidopsis thaliana]
 sp|Q9T014.2|SPA2_ARATH RecName: Full=Protein SPA1-RELATED 2 [Arabidopsis thaliana]
 gb|AEE82974.1| protein SPA1-related 2 [Arabidopsis thaliana]
Length=1036

 Score =   171 bits (432),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 126/342 (37%), Positives = 181/342 (53%), Gaps = 38/342 (11%)
 Frame = +2

Query  197   TSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSS  376
             TS +   S+ +  L FD  +++ AT G+++KI++Y  NSL +   D           H  
Sbjct  716   TSELNNTSNVICSLGFDRDEDYFATAGVSKKIKIYEFNSLFNESVDI----------HYP  765

Query  377   ACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSV  556
             A +  +   +KLS + W   +    L S DYDG+V  +D+     +    EH  +R WSV
Sbjct  766   AIE--MPNRSKLSGVCWN-NYIRNYLASSDYDGIVKLWDVTTGQAISHFIEHE-KRAWSV  821

Query  557   DYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPSIAA-G  733
             D+S +     ASGSDD +++ W+      NCL T+   +  + VCCVQFSP +  + A G
Sbjct  822   DFSEACPTKLASGSDDCSVKLWN--INERNCLGTI---RNIANVCCVQFSPQSSHLLAFG  876

Query  734   CADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWD---TDHRN  904
              +D +TY YDLRN   P  IL GH KAV+YA+FLD  T++T+S D  +K+WD   T H  
Sbjct  877   SSDFRTYCYDLRNLRTPWCILSGHNKAVSYAKFLDNETLVTASTDNTLKLWDLKKTTHGG  936

Query  905   LVR-----TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSAT  1069
             L       T+ GH N   FVGLS   + G I+CGSE N+V+ Y      PI  Y   S  
Sbjct  937   LSTNACSLTFGGHTNEKNFVGLST--SDGYIACGSETNEVYAYHRSLPMPITSYKFGSID  994

Query  1070  GQPGSE-----NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                G E     N F+SSVCW +R +    +V+  S+G ++V 
Sbjct  995   PISGKEIEEDNNLFVSSVCWRKRSN---MVVSASSNGSIKVL  1033



>ref|XP_010252572.1| PREDICTED: E3 ubiquitin-protein ligase COP1 [Nelumbo nucifera]
Length=685

 Score =   168 bits (425),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 108/325 (33%), Positives = 174/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  381   ANIVSSIEFDRDDELFATAGVSRRIKVFEFSSVVN------EPADV----HCPIVE--MS  428

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  429   TRSKLSCLSWNK-YTKNHIASSDYEGIVTVWDVNTRQSVMEYEEHE-KRAWSVDFSRTEP  486

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   +A G AD   +
Sbjct  487   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSSIQVAVGSADHHIH  541

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + PL +  GH KAV+Y +FL    + ++S D  +++WD      +RT++GH N
Sbjct  542   YYDLRNVSHPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKENMPLRTFRGHTN  601

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   I+CGSE N+VFVY     +P   +   S+      ++    FIS+
Sbjct  602   EKNFVGLTV--NSEYIACGSETNEVFVYHKAISKPAAGHRFGSSDVDDTEDDAGPYFISA  659

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  660   VCW---KSDSATMLTANSQGTIKVL  681



>ref|XP_006410432.1| hypothetical protein EUTSA_v10016348mg [Eutrema salsugineum]
 gb|ESQ51885.1| hypothetical protein EUTSA_v10016348mg [Eutrema salsugineum]
Length=521

 Score =   167 bits (422),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 171/326 (52%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+   D               C    +
Sbjct  217   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQ-------------CPIVEM  263

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  264   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  321

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   
Sbjct  322   PSMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNYIAVGSADHHI  376

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  377   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  436

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY      P+  +   S   +   E     FIS
Sbjct  437   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMEDAEEEAGSYFIS  494

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  495   AVCW---KSDSPTMLTANSQGTIKVL  517



>ref|XP_010435520.1| PREDICTED: protein SPA1-RELATED 2-like [Camelina sativa]
Length=1028

 Score =   170 bits (431),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 128/352 (36%), Positives = 186/352 (53%), Gaps = 40/352 (11%)
 Frame = +2

Query  167   FRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEG  346
             F   AV+   TS + + S+ +  L FD  +++ AT G+++KI+++  NSL +   D    
Sbjct  700   FETRAVLR--TSELNSTSNVICSLGFDRDEDYFATAGVSKKIKIFEFNSLFNESVDI---  754

Query  347   SDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERD  526
                    H  A +  +   +KLS + W   +    L S DYDG+V  +D+     +    
Sbjct  755   -------HYPAVE--MPNRSKLSGVCWN-NYIRNYLASSDYDGIVKLWDVTTGQAISHFI  804

Query  527   EHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFS  706
             EH  +R WSVD+S +     ASGSDD +++ W+      NCL T+   +  + VCCVQFS
Sbjct  805   EHE-KRAWSVDFSEACPTKLASGSDDCSVKLWN--INERNCLGTI---RNIANVCCVQFS  858

Query  707   PFAPSIAA-GCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKM  883
             P +  + A G +D +TY YDLRN   P  IL GH KAV+YA+FLD  T++T+S D  +K+
Sbjct  859   PQSSHLLAFGSSDFRTYCYDLRNLRTPWCILSGHNKAVSYAKFLDNETLVTASTDNTLKL  918

Query  884   WD---TDHRNLVR-----TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
             WD   T H  L       T+ GH N   FVGLS   + G I+CGSE N+V+ Y      P
Sbjct  919   WDLKKTTHGGLSTNACSLTFGGHTNEKNFVGLST--SDGYIACGSETNEVYAYHRSLPMP  976

Query  1040  IWVYGCKSATGQPGSE-----NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             I  Y   S     G E     N F+SSVCW +R +    +V+  S+G ++V 
Sbjct  977   ITSYKFGSIDPISGKEIEEDNNLFVSSVCWRKRSN---MVVSASSNGSIKVL  1025



>gb|KGN50032.1| hypothetical protein Csa_5G150990 [Cucumis sativus]
Length=1060

 Score =   170 bits (431),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 124/335 (37%), Positives = 178/335 (53%), Gaps = 38/335 (11%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  L FD  + + A  G+++KIR++  NS+          SD+V + H  A + +  
Sbjct  747   SNVICSLSFDRDEEYFAAAGVSKKIRIFEFNSVF---------SDSVDI-HYPAVEMF--  794

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
               +KLS + W  G+    L S DYDGVV  +D      V + +EH  +R WSVD+S    
Sbjct  795   NRSKLSCICWN-GYIKNYLASTDYDGVVKLWDATVGQEVSQFNEHN-KRAWSVDFSQVHP  852

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPSIAA-GCADRKTY  754
                ASGSDD +++ W       NCL T+   +  + VCCVQFS  +  + A G AD +TY
Sbjct  853   TKLASGSDDCSVKLWS--INEKNCLGTI---RNIANVCCVQFSAHSTHLLAFGSADYRTY  907

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLV--------  910
              +DLRNT  P  +L GH KAV+Y +FLD  T++++S D  +K+WD +  N          
Sbjct  908   CFDLRNTKAPWCVLGGHEKAVSYVKFLDSGTLVSASTDNTLKLWDLNKTNPTGLSTKACS  967

Query  911   RTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE-  1087
              T+ GH N   FVGLSV  + G I+CGSE N+V+ Y      P+  Y   S     G E 
Sbjct  968   LTFSGHTNEKNFVGLSV--SNGYIACGSETNEVYAYHRSLPMPMTSYKFGSIDPISGKET  1025

Query  1088  ---NG-FISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                NG F+SSVCW  + D   T++A  S G ++V 
Sbjct  1026  EDDNGQFVSSVCWRGKSD---TVIAANSSGCIKVL  1057



>ref|XP_009769728.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X3 [Nicotiana 
sylvestris]
Length=577

 Score =   167 bits (423),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 115/342 (34%), Positives = 177/342 (52%), Gaps = 30/342 (9%)
 Frame = +2

Query  170   RISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGS  349
             R+  V     S +  +++ +  +EFD  D   AT G++R+I+V+   S+V+      E +
Sbjct  257   RLRVVAELRHSDLFHMANIVSSIEFDRDDELFATAGVSRRIKVFEFASVVN------EPA  310

Query  350   DAVSLDHSSACDYY-ICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERD  526
             +A        C    + T +KLS L W     +  L S DY+G+V  +D+  R  V E +
Sbjct  311   EA-------QCPLVEMSTRSKLSCLSWNKCTKNH-LASSDYEGIVTVWDVTTRQSVMEYE  362

Query  527   EHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFS  706
             EH  +R WSVD+  ++  V  SGSDD  ++ W   C      A+V     ++  C V+++
Sbjct  363   EHE-KRAWSVDFCRTEPSVLVSGSDDCKVKVW---CTKQE--ASVLTIDMKANACSVKYN  416

Query  707   PFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKM  883
             P +   +A G AD   + YDLRN ++PL I  GH KAV+Y +FL    + ++S D  +++
Sbjct  417   PGSSVLVAVGSADHHIHYYDLRNVSQPLHIFSGHRKAVSYVKFLSNNELASASTDSTLRL  476

Query  884   WDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP-IWVYGCK  1060
             WD      +RT+KGH N   FVGL+V  N   ++CGSE N+VFVY     +P  W     
Sbjct  477   WDVKENVPLRTFKGHANEKNFVGLTV--NSEYLACGSETNEVFVYHKEISKPAAWHKFGS  534

Query  1061  SATGQPGSENG--FISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                  P  E G  FIS+VCW +   D  T++   S G ++V 
Sbjct  535   DDQNDPDGEMGSYFISAVCWKR---DSSTILTANSQGTIKVL  573



>ref|XP_010422049.1| PREDICTED: protein SPA1-RELATED 2 [Camelina sativa]
Length=1033

 Score =   170 bits (431),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 128/352 (36%), Positives = 186/352 (53%), Gaps = 40/352 (11%)
 Frame = +2

Query  167   FRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEG  346
             F   AV+   TS + + S+ +  L FD  +++ AT G+++KI+++  NSL +   D    
Sbjct  705   FETRAVLR--TSELNSTSNVICSLGFDRDEDYFATAGVSKKIKIFEFNSLFNESVDI---  759

Query  347   SDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERD  526
                    H  A +  +   +KLS + W   +    L S DYDG+V  +D+     +    
Sbjct  760   -------HYPAVE--MPNRSKLSGVCWN-NYIRNYLASSDYDGIVKLWDVTTGQAISHFI  809

Query  527   EHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFS  706
             EH  +R WSVD+S +     ASGSDD +++ W+      NCL T+   +  + VCCVQFS
Sbjct  810   EHE-KRAWSVDFSEACPTKLASGSDDCSVKLWN--INERNCLGTI---RNIANVCCVQFS  863

Query  707   PFAPSIAA-GCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKM  883
             P +  + A G +D +TY YDLRN   P  IL GH KAV+YA+FLD  T++T+S D  +K+
Sbjct  864   PQSSHLLAFGSSDFRTYCYDLRNLRTPWCILSGHNKAVSYAKFLDNETLVTASTDNTLKL  923

Query  884   WD---TDHRNLVR-----TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
             WD   T H  L       T+ GH N   FVGLS   + G I+CGSE N+V+ Y      P
Sbjct  924   WDLKKTTHGGLSTNACSLTFGGHTNEKNFVGLST--SDGYIACGSETNEVYAYHRSLPMP  981

Query  1040  IWVYGCKSATGQPGSE-----NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             I  Y   S     G E     N F+SSVCW +R +    +V+  S+G ++V 
Sbjct  982   ITSYKFGSIDPISGKEIEEDNNLFVSSVCWRKRSN---MVVSASSNGSIKVL  1030



>ref|XP_004143877.1| PREDICTED: protein SPA1-RELATED 2-like [Cucumis sativus]
 ref|XP_004161464.1| PREDICTED: protein SPA1-RELATED 2-like [Cucumis sativus]
Length=1036

 Score =   170 bits (431),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 124/335 (37%), Positives = 178/335 (53%), Gaps = 38/335 (11%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  L FD  + + A  G+++KIR++  NS+          SD+V + H  A + +  
Sbjct  723   SNVICSLSFDRDEEYFAAAGVSKKIRIFEFNSVF---------SDSVDI-HYPAVEMF--  770

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
               +KLS + W  G+    L S DYDGVV  +D      V + +EH  +R WSVD+S    
Sbjct  771   NRSKLSCICWN-GYIKNYLASTDYDGVVKLWDATVGQEVSQFNEHN-KRAWSVDFSQVHP  828

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPSIAA-GCADRKTY  754
                ASGSDD +++ W       NCL T+   +  + VCCVQFS  +  + A G AD +TY
Sbjct  829   TKLASGSDDCSVKLWS--INEKNCLGTI---RNIANVCCVQFSAHSTHLLAFGSADYRTY  883

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLV--------  910
              +DLRNT  P  +L GH KAV+Y +FLD  T++++S D  +K+WD +  N          
Sbjct  884   CFDLRNTKAPWCVLGGHEKAVSYVKFLDSGTLVSASTDNTLKLWDLNKTNPTGLSTKACS  943

Query  911   RTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE-  1087
              T+ GH N   FVGLSV  + G I+CGSE N+V+ Y      P+  Y   S     G E 
Sbjct  944   LTFSGHTNEKNFVGLSV--SNGYIACGSETNEVYAYHRSLPMPMTSYKFGSIDPISGKET  1001

Query  1088  ---NG-FISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                NG F+SSVCW  + D   T++A  S G ++V 
Sbjct  1002  EDDNGQFVSSVCWRGKSD---TVIAANSSGCIKVL  1033



>gb|KEH28313.1| E3 ubiquitin-protein ligase COP1 [Medicago truncatula]
Length=573

 Score =   167 bits (423),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 177/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D+  AT G++R+I+V+  +++V+      E +DA    H    +  + 
Sbjct  269   ANIVSSIEFDRDDDLFATAGVSRRIKVFDFSAVVN------EPTDA----HCPVVE--MT  316

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  + E +EH  +R WSVD+S +D 
Sbjct  317   TRSKLSCLSWNK-YAKNQIASSDYEGIVTVWDVTTRKSLMEYEEHE-KRAWSVDFSRTDP  374

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  375   SMLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSGNYIAVGSADHHIH  429

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  430   YYDLRNISRPVHVFSGHKKAVSYVKFLSNDELASASTDSTLRLWDVKQNVPVRTFRGHAN  489

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-WVYGCKSATGQPGSENG--FISS  1105
                FVGL+V  +   I+CGSE N+VFVY     +P+ W             E G  FIS+
Sbjct  490   EKNFVGLTV--SSEYIACGSETNEVFVYHKEISKPLTWHRFSSPDMDDAEDEAGSYFISA  547

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  548   VCW---KSDRPTILTANSQGTIKVL  569



>ref|XP_009143916.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X2 [Brassica 
rapa]
Length=563

 Score =   167 bits (422),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 108/326 (33%), Positives = 174/326 (53%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+      E +D         C    +
Sbjct  259   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVN------EPADI-------QCPIVEM  305

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  306   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  363

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   
Sbjct  364   PSMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNFIAVGSADHHI  418

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  419   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  478

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY     +P+  +   S   +   E     FIS
Sbjct  479   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITKPVTSHRFGSLDMEEAEEEAGSYFIS  536

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  537   AVCW---KSDSPTMLTANSQGTIKVL  559



>ref|XP_006449823.1| hypothetical protein CICLE_v10014775mg [Citrus clementina]
 gb|ESR63063.1| hypothetical protein CICLE_v10014775mg [Citrus clementina]
Length=559

 Score =   167 bits (422),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 107/324 (33%), Positives = 172/324 (53%), Gaps = 27/324 (8%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+++  +S+V+   D           H    +  + 
Sbjct  256   ANIISSIEFDRDDELFATAGVSRRIKIFEFSSVVNEPRDV----------HYPMVE--MP  303

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KL  L W   +   ++ S DYDG+V  +D+     V E +EH  +R WSVD+S ++ 
Sbjct  304   TRSKLRCLSWNK-YTKNLIASSDYDGIVTIWDVTTSQSVMEYEEHE-KRAWSVDFSCTEP  361

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A     KA   +C V+++P + + +A G AD   +
Sbjct  362   SMLVSGSDDCKVKIW---CTNQEACALNIDMKAN--ICSVKYNPISSNYVAVGSADHHIH  416

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++PL++ +GH KAV+Y +FL    + ++S D  +++WD      +RT++GH N
Sbjct  417   YYDLRNISQPLYVFNGHKKAVSYVKFLSSNELASASTDSSLRLWDVKENLPLRTFRGHTN  476

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG--FISSV  1108
                FVGL+V  N   I+CGSE N+VFVY     +P   +   S       + G  FIS+V
Sbjct  477   EKNFVGLTV--NNEYIACGSETNEVFVYHKAISKPAASHRFGSDADHVDDDMGSYFISAV  534

Query  1109  CWMQRGDDHCTLVAGGSDGVLRVF  1180
             CW     D  T++   S G ++V 
Sbjct  535   CW---KSDSPTMLTANSKGAIKVL  555



>ref|XP_010455512.1| PREDICTED: protein SPA1-RELATED 2-like [Camelina sativa]
Length=1132

 Score =   170 bits (431),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 128/352 (36%), Positives = 186/352 (53%), Gaps = 40/352 (11%)
 Frame = +2

Query  167   FRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEG  346
             F   AV+   TS + + S+ +  L FD  +++ AT G+++KI+++  NSL +   D    
Sbjct  804   FETRAVLR--TSELNSTSNVICSLGFDRDEDYFATAGVSKKIKIFEFNSLFNESVDI---  858

Query  347   SDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERD  526
                    H  A +  +   +KLS + W   +    L S DYDG+V  +D+     +    
Sbjct  859   -------HYPAVE--MPNRSKLSGVCWN-NYIRNYLASSDYDGIVKLWDVTTGQAISHFI  908

Query  527   EHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFS  706
             EH  +R WSVD+S +     ASGSDD +++ W+      NCL T+   +  + VCCVQFS
Sbjct  909   EHE-KRAWSVDFSEACPTKLASGSDDCSVKLWN--INERNCLGTI---RNIANVCCVQFS  962

Query  707   PFAPSIAA-GCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKM  883
             P +  + A G +D +TY YDLRN   P  IL GH KAV+YA+FLD  T++T+S D  +K+
Sbjct  963   PQSSHLLAFGSSDFRTYCYDLRNLRTPWCILSGHNKAVSYAKFLDNETLVTASTDNTLKL  1022

Query  884   WD---TDHRNLVR-----TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
             WD   T H  L       T+ GH N   FVGLS   + G I+CGSE N+V+ Y      P
Sbjct  1023  WDLKKTTHGGLSTNACSLTFGGHTNEKNFVGLST--SDGYIACGSETNEVYAYHRSLPMP  1080

Query  1040  IWVYGCKSATGQPGSE-----NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             I  Y   S     G E     N F+SSVCW +R +    +V+  S+G ++V 
Sbjct  1081  ITSYKFGSIDPISGKEIEEDNNLFVSSVCWRKRSN---MVVSASSNGSIKVL  1129



>ref|XP_011047015.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X2 [Populus 
euphratica]
Length=536

 Score =   166 bits (421),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 108/341 (32%), Positives = 181/341 (53%), Gaps = 27/341 (8%)
 Frame = +2

Query  170   RISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGS  349
             R+ AV       +   ++ +  +EFD  D   AT G++R+I+++  +S+++      E +
Sbjct  217   RLRAVAELRHGDLFHSANIVSSIEFDRDDELFATAGVSRRIKIFEFSSVMN------EPA  270

Query  350   DAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDE  529
             D     H    +  + T +KLS L W   +    + S DY+G+V  +D+  R  + E +E
Sbjct  271   DV----HCPVVE--MSTRSKLSCLSWNK-YTKNHIASSDYEGIVTVWDVTTRQSIMEYEE  323

Query  530   HGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSP  709
             H  +R WSVD+S ++  +  SGSDD  ++ W   C      A+V     ++ +C V+++P
Sbjct  324   HE-KRAWSVDFSRTEPSMLVSGSDDCKVKIW---CTQQE--ASVLNIDMKANICSVKYNP  377

Query  710   -FAPSIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMW  886
               +  +A G AD   + YDLRN ++PL++  GH KAV+Y +FL    + ++S D  +++W
Sbjct  378   GSSIHVAVGSADHHIHYYDLRNISQPLYVFSGHRKAVSYVKFLSSNELASASTDSTLRLW  437

Query  887   DTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP-IW-VYGCK  1060
             D      +RT++GH N   FVGL+V  N   I+CGSE N+VFVY     +P  W  +   
Sbjct  438   DVKDNLALRTFRGHTNEKNFVGLTV--NSEYIACGSETNEVFVYHKAISKPAAWHRFSTD  495

Query  1061  SATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVFA  1183
                G+  + + FIS+VCW     D  T++   S G ++V  
Sbjct  496   LENGEDDAGSYFISAVCW---KSDSPTMLTANSQGTIKVLV  533



>ref|XP_005996897.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Latimeria chalumnae]
Length=702

 Score =   167 bits (424),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 109/331 (33%), Positives = 181/331 (55%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +       + 
Sbjct  392   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYPVI---EMT  439

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  440   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  495

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  496   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPTSRYHLAFGCADHC  550

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+ +  + +R++KGH
Sbjct  551   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVNKPHCLRSFKGH  610

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  611   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDKKEDDTN  668

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW  R D +   L+A  S G ++V 
Sbjct  669   EFVSAVCWRARPDGESNVLIAANSQGTIKVL  699



>ref|XP_009919899.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2-like [Haliaeetus 
albicilla]
Length=377

 Score =   163 bits (413),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 107/325 (33%), Positives = 178/325 (55%), Gaps = 33/325 (10%)
 Frame = +2

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  +   +K+S
Sbjct  73    IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYP---ENEMTCNSKIS  120

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  121   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  176

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  177   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  231

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  232   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  291

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  292   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  349

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  350   CWRALPDGESNVLIAANSQGTIKVL  374



>dbj|BAF01052.1| COP1 like protein [Arabidopsis thaliana]
Length=1100

 Score =   170 bits (431),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 126/342 (37%), Positives = 181/342 (53%), Gaps = 38/342 (11%)
 Frame = +2

Query  197   TSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSS  376
             TS +   S+ +  L FD  +++ AT G+++KI++Y  NSL +   D           H  
Sbjct  780   TSELNNTSNVICSLGFDRDEDYFATAGVSKKIKIYEFNSLFNESVDI----------HYP  829

Query  377   ACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSV  556
             A +  +   +KLS + W   +    L S DYDG+V  +D+     +    EH  +R WSV
Sbjct  830   AIE--MPNRSKLSGVCWN-NYIRNYLASSDYDGIVKLWDVTTGQAISHFIEHE-KRAWSV  885

Query  557   DYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPSIAA-G  733
             D+S +     ASGSDD +++ W+      NCL T+   +  + VCCVQFSP +  + A G
Sbjct  886   DFSEACPTKLASGSDDCSVKLWN--INERNCLGTI---RNIANVCCVQFSPQSSHLLAFG  940

Query  734   CADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWD---TDHRN  904
              +D +TY YDLRN   P  IL GH KAV+YA+FLD  T++T+S D  +K+WD   T H  
Sbjct  941   SSDFRTYCYDLRNLRTPWCILSGHNKAVSYAKFLDNETLVTASTDNTLKLWDLKKTTHGG  1000

Query  905   LVR-----TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSAT  1069
             L       T+ GH N   FVGLS   + G I+CGSE N+V+ Y      PI  Y   S  
Sbjct  1001  LSTNACSLTFGGHTNEKNFVGLST--SDGYIACGSETNEVYAYHRSLPMPITSYKFGSID  1058

Query  1070  GQPGSE-----NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                G E     N F+SSVCW +R +    +V+  S+G ++V 
Sbjct  1059  PISGKEIEEDNNLFVSSVCWRKRSN---MVVSASSNGSIKVL  1097



>ref|XP_002872549.1| hypothetical protein ARALYDRAFT_911432 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48808.1| hypothetical protein ARALYDRAFT_911432 [Arabidopsis lyrata subsp. 
lyrata]
Length=1032

 Score =   170 bits (430),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 125/342 (37%), Positives = 181/342 (53%), Gaps = 38/342 (11%)
 Frame = +2

Query  197   TSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSS  376
             TS + + S+ +  L FD  +++  T G+++KI++Y  NSL +   D           H  
Sbjct  712   TSELNSTSNVICSLGFDRDEDYFVTAGVSKKIKIYEFNSLFNESVDI----------HYP  761

Query  377   ACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSV  556
             A +  +   +KLS + W   +    L S DYDG+V  +D+     +    EH  +R WSV
Sbjct  762   AVE--MPNRSKLSGVCWN-NYIRNYLASSDYDGIVKLWDVTTGQAISHFIEHE-KRAWSV  817

Query  557   DYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPSIAA-G  733
             D+S +     ASGSDD +++ W+      NCL T+   +  + VCCVQFSP +  + A G
Sbjct  818   DFSEACPTKLASGSDDCSVKLWN--INERNCLGTI---RNIANVCCVQFSPQSSHLLAFG  872

Query  734   CADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWD---TDHRN  904
              +D +TY YDLRN   P  IL GH KAV+YA+FLD  T++T+S D  +K+WD   T H  
Sbjct  873   SSDFRTYCYDLRNLRTPWCILSGHNKAVSYAKFLDNETLVTASTDNTLKLWDLKKTTHGG  932

Query  905   LVR-----TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSAT  1069
             L       T+ GH N   FVGLS   + G I+CGSE N+V+ Y      PI  Y   S  
Sbjct  933   LSTNACSLTFGGHTNEKNFVGLST--SDGYIACGSETNEVYAYHRSLPMPITSYKFGSID  990

Query  1070  GQPGSE-----NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                G E     N F+SSVCW +R +    +V+  S+G ++V 
Sbjct  991   PISGKEIEEDNNLFVSSVCWRKRSN---MVVSASSNGSIKVL  1029



>ref|XP_001753935.1| predicted protein [Physcomitrella patens]
 gb|EDQ81257.1| predicted protein [Physcomitrella patens]
Length=702

 Score =   167 bits (424),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 175/326 (54%), Gaps = 29/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  +EFD  D F ATGG++R+I+V+   ++V+   D           H    +  + 
Sbjct  397   SNIVSSIEFDRDDEFFATGGVSRRIKVFEFATVVNELADV----------HCPVVE--MS  444

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVP----VFERDEHGGRRVWSVDYs  565
             T +KLS L W     S +  S DY+G++  +D+ +       + E +EH  +R WSVD+S
Sbjct  445   TRSKLSCLSWNKYIKSHI-ASSDYEGIITVWDINKHQAMLQSIMEYEEHE-KRAWSVDFS  502

Query  566   hsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCAD  742
              +D  +  SGSDDG    W  R       ++V     ++ +CCV+++P + + +A G AD
Sbjct  503   RTDPTMLVSGSDDGKASLWCTRQE-----SSVLNIDMKANICCVKYNPGSCNYVAVGSAD  557

Query  743   RKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYK  922
                + +D+RN+  PL++ +GH KAV+Y +FL    + ++S D  +++WD    + +RT K
Sbjct  558   HHIHYFDVRNSQMPLYVFNGHRKAVSYVKFLSSDELASASTDSTLRLWDVKENHAIRTLK  617

Query  923   GHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENGFIS  1102
             GH N   FVGL+V  N   I+CGSE+N+VFVY     +P   +   S   +    + FIS
Sbjct  618   GHANEKNFVGLTV--NSEYIACGSESNEVFVYHKAMSKPATWHRFGSQDEESDDTSHFIS  675

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW        T++A  S G ++V 
Sbjct  676   AVCWKSESP---TMLAANSQGTIKVL  698



>ref|XP_004143233.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Cucumis sativus]
 gb|KGN47000.1| hypothetical protein Csa_6G161200 [Cucumis sativus]
Length=675

 Score =   167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 115/325 (35%), Positives = 175/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R I+V+  +S+V+      E  DA    H    +  + 
Sbjct  371   TNIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVN------EPPDA----HCPIVE--MS  418

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T AKLS L W    +  ++ S DY+G+V  +D+ R   V E +EH  +R WSVD+S ++ 
Sbjct  419   TRAKLSCLSWDKQ-SKNIIASSDYEGIVTVWDVNRGQSVMEYEEHE-KRAWSVDFSRTEP  476

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
                 SGSDD  ++ W   C      A+V     ++ +CCV+F+P + + IA G AD   +
Sbjct  477   SRLVSGSDDCKVKVW---CMKQE--ASVLDIDMKANICCVKFNPGSGNHIAVGSADHNIH  531

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  532   YYDLRNISHPLHVFTGHKKAVSYVKFLSNSELASASTDSTLRLWDVKENLPVRTFRGHTN  591

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-W-VYGCKSATG-QPGSENGFISS  1105
                FVGL+V  N   I+CGSE N+VFVY      P+ W  +G    T  +    + FIS+
Sbjct  592   EKNFVGLTV--NNEYIACGSETNEVFVYHKEISRPLTWHRFGSPDVTDVEDDVGSYFISA  649

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  650   VCW---KSDSPTILTANSQGTIKVL  671



>ref|XP_010541450.1| PREDICTED: protein SPA1-RELATED 2 isoform X1 [Tarenaya hassleriana]
 ref|XP_010541460.1| PREDICTED: protein SPA1-RELATED 2 isoform X1 [Tarenaya hassleriana]
 ref|XP_010541467.1| PREDICTED: protein SPA1-RELATED 2 isoform X1 [Tarenaya hassleriana]
Length=1037

 Score =   169 bits (429),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 126/342 (37%), Positives = 181/342 (53%), Gaps = 38/342 (11%)
 Frame = +2

Query  197   TSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSS  376
             T      ++ +  L FD  +++ A  G+++KI+++  NS+           ++V + H  
Sbjct  717   TGEFNNTANVICSLSFDQDEDYFAAAGVSKKIKIFEFNSIF---------KNSVDI-HYP  766

Query  377   ACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSV  556
             A +  +   ++LSS+ W  G+    L S DYDG+V  +D+     +    EH  +R WSV
Sbjct  767   AIE--MPNRSRLSSVCWN-GYIRNYLASSDYDGIVKLWDVTTGQTISHFIEHE-KRAWSV  822

Query  557   DYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPSIAA-G  733
             D+S       ASGSDD +++ W+      NCL T+   +  + VCCVQFSP +  + A G
Sbjct  823   DFSQVCPTKLASGSDDCSVKLWN--INERNCLGTI---RNIANVCCVQFSPHSSHLLAFG  877

Query  734   CADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWD---TDHRN  904
              AD +TY YDLRN   P  IL GH KAV+YA+FLD  T+LT+S D  +K+WD   T H  
Sbjct  878   SADYRTYCYDLRNLRGPWCILSGHNKAVSYAKFLDHETLLTASTDNTLKLWDLKRTTHGG  937

Query  905   LVR-----TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSAT  1069
             L       T+ GH N   FVGLS     G I+CGSE N+V+ Y      PI  Y   S  
Sbjct  938   LSTNACGLTFSGHANEKNFVGLSTAD--GYIACGSETNEVYAYHRSLPMPITSYKFGSID  995

Query  1070  GQPGSE----NG-FISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                G E    NG F+SSVCW +R +    +VA  S+G ++V 
Sbjct  996   TISGKEIDDDNGLFVSSVCWRKRSN---MVVAASSNGSIKVL  1034



>ref|XP_006348254.1| PREDICTED: protein SPA1-RELATED 3-like isoform X1 [Solanum tuberosum]
Length=880

 Score =   169 bits (427),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 129/333 (39%), Positives = 181/333 (54%), Gaps = 37/333 (11%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  L FD    F AT G+ +KI+V+  NS+VD   D+D     V +           
Sbjct  570   SNLVCALGFDRDGEFFATAGVNKKIKVFEYNSIVDE--DRDIHYPVVEM----------A  617

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             + +KLSS+ W  G+    + S +++GVV  +D+ R     E  EH  RRVWSVD+S +D 
Sbjct  618   SRSKLSSICWN-GYIKSQIASSNFEGVVQVWDVTRSQVFMEMREHE-RRVWSVDFSVADP  675

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPF--APSIAAGCADRKT  751
              + ASGSDDG+++ W     N N  A+V   K ++ VCCVQF PF    S+A G AD K 
Sbjct  676   TMLASGSDDGSVKLW-----NINQGASVGTIKTKANVCCVQF-PFDSGRSLAFGSADHKI  729

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDH------RNLVR  913
             Y YDLRN+  PL  L GH K V+Y +F+D  T++++S D  +K+WD            ++
Sbjct  730   YYYDLRNSKMPLCTLIGHNKTVSYVKFIDSTTLVSASTDNTLKLWDLSICTSRIVDKPLQ  789

Query  914   TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE--  1087
             ++ GH+N   FVGLSV +  G I+ GSE N+VFVY   +  P   +   S     G E  
Sbjct  790   SFTGHMNVKNFVGLSVSE--GYIATGSETNEVFVYHKTFPMPALSFKFNSTDPLSGDEVD  847

Query  1088  --NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                 FISSVCW  RG    TLVA  S G +++ 
Sbjct  848   DQAQFISSVCW--RGQS-STLVAANSMGNIKLL  877



>ref|XP_010541474.1| PREDICTED: protein SPA1-RELATED 2 isoform X2 [Tarenaya hassleriana]
Length=1011

 Score =   169 bits (429),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 126/342 (37%), Positives = 181/342 (53%), Gaps = 38/342 (11%)
 Frame = +2

Query  197   TSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSS  376
             T      ++ +  L FD  +++ A  G+++KI+++  NS+           ++V + H  
Sbjct  691   TGEFNNTANVICSLSFDQDEDYFAAAGVSKKIKIFEFNSIF---------KNSVDI-HYP  740

Query  377   ACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSV  556
             A +  +   ++LSS+ W  G+    L S DYDG+V  +D+     +    EH  +R WSV
Sbjct  741   AIE--MPNRSRLSSVCWN-GYIRNYLASSDYDGIVKLWDVTTGQTISHFIEHE-KRAWSV  796

Query  557   DYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPSIAA-G  733
             D+S       ASGSDD +++ W+      NCL T+   +  + VCCVQFSP +  + A G
Sbjct  797   DFSQVCPTKLASGSDDCSVKLWN--INERNCLGTI---RNIANVCCVQFSPHSSHLLAFG  851

Query  734   CADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWD---TDHRN  904
              AD +TY YDLRN   P  IL GH KAV+YA+FLD  T+LT+S D  +K+WD   T H  
Sbjct  852   SADYRTYCYDLRNLRGPWCILSGHNKAVSYAKFLDHETLLTASTDNTLKLWDLKRTTHGG  911

Query  905   LVR-----TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSAT  1069
             L       T+ GH N   FVGLS     G I+CGSE N+V+ Y      PI  Y   S  
Sbjct  912   LSTNACGLTFSGHANEKNFVGLSTAD--GYIACGSETNEVYAYHRSLPMPITSYKFGSID  969

Query  1070  GQPGSE----NG-FISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                G E    NG F+SSVCW +R +    +VA  S+G ++V 
Sbjct  970   TISGKEIDDDNGLFVSSVCWRKRSN---MVVAASSNGSIKVL  1008



>gb|KHN38497.1| E3 ubiquitin-protein ligase COP1 [Glycine soja]
Length=669

 Score =   167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 113/327 (35%), Positives = 180/327 (55%), Gaps = 32/327 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D+  AT G++R+I+V+  +++V+      E +DA    H    +  + 
Sbjct  365   ANIVSSIEFDRDDDLFATAGVSRRIKVFDFSAVVN------EPTDA----HCPVVE--MS  412

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W     +++  S DY+G+V  +D+  R  + E +EH  +R WSVD+S +D 
Sbjct  413   TRSKLSCLSWNKFAKNQI-ASSDYEGIVTVWDVTTRKSLMEYEEHE-KRAWSVDFSRTDP  470

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  471   SMLVSGSDDCKVKIW---CTNQE--ASVLNIDMKANICCVKYNPGSGNYIAVGSADHHIH  525

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT+KGH N
Sbjct  526   YYDLRNISRPVHVFSGHRKAVSYVKFLSNDELASASTDSTLRLWDVKENLPVRTFKGHAN  585

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS-----ATGQPGSENGFI  1099
                FVGL+V  +   I+CGSE N+VFVY      P+  +   S     A  + GS   FI
Sbjct  586   EKNFVGLTV--SSEYIACGSETNEVFVYHKEISRPLTSHRFGSPDMDDAEDEAGSY--FI  641

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             S+VCW     D  T++   S G ++V 
Sbjct  642   SAVCW---KSDRPTILTANSQGTIKVL  665



>ref|XP_004361449.1| hypothetical protein DFA_05732 [Dictyostelium fasciculatum]
 gb|EGG23598.1| hypothetical protein DFA_05732 [Dictyostelium fasciculatum]
Length=751

 Score =   167 bits (424),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/327 (34%), Positives = 177/327 (54%), Gaps = 30/327 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD  D F AT G+ +KI+V+  + +               +D  +     +C
Sbjct  446   SSIVSSIEFDKDDEFFATAGVTKKIKVFEFSQVT-----------MKDVDVHAPVKEMVC  494

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
               +K+S L W   + +++  S DY+G++  +D+     +   +EH  +RVWSVD+S +D 
Sbjct  495   R-SKISCLSWNTYFKNQI-ASSDYEGIITLWDVNTGQEMAMMEEHE-KRVWSVDFSRTDP  551

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSP-FAPSIAAGCADRKTY  754
                ASGSDD  ++ W         L T++   +++ +CCV+F+P F+  IA G AD   +
Sbjct  552   TQFASGSDDTKVKLWST--TQKKALTTIE---SKANICCVKFNPSFSHLIAFGSADHHIH  606

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTD-HRNLVRTYKGHI  931
              YDLR     + +  GH KAV+Y +F+++  ++++S D  +K+W+ +   + VRTY GH 
Sbjct  607   YYDLRQPTTAVSVFKGHRKAVSYVKFMNKDEIISASTDSTLKLWNVNASESCVRTYSGHS  666

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWV--YGCKSATGQPGSENG--FI  1099
             N   FVGL+V  NG  I CGSENN V+ Y     +PI    +G  S +G+   E+G  F+
Sbjct  667   NEKNFVGLAV--NGDYICCGSENNGVYTYYKALSKPIVTHRFGANSGSGEETDEDGTQFV  724

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             SSVCW +   D   L+A  S G ++V 
Sbjct  725   SSVCWKK---DSNILLAANSQGNIKVL  748



>ref|XP_003519446.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Glycine max]
Length=669

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 113/327 (35%), Positives = 180/327 (55%), Gaps = 32/327 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D+  AT G++R+I+V+  +++V+      E +DA    H    +  + 
Sbjct  365   ANIVSSIEFDRDDDLFATAGVSRRIKVFDFSAVVN------EPTDA----HCPVVE--MS  412

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W     +++  S DY+G+V  +D+  R  + E +EH  +R WSVD+S +D 
Sbjct  413   TRSKLSCLSWNKFAKNQI-ASSDYEGIVTVWDVTTRKSLMEYEEHE-KRAWSVDFSRTDP  470

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  471   SMLVSGSDDCKVKIW---CTNQE--ASVLNIDMKANICCVKYNPGSGNYIAVGSADHHIH  525

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT+KGH N
Sbjct  526   YYDLRNISRPVHVFSGHRKAVSYVKFLSNDELASASTDSTLRLWDVKENLPVRTFKGHAN  585

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS-----ATGQPGSENGFI  1099
                FVGL+V  +   I+CGSE N+VFVY      P+  +   S     A  + GS   FI
Sbjct  586   EKNFVGLTV--SSEYIACGSETNEVFVYHKEISRPLTSHRFGSPDMDDAEDEAGSY--FI  641

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             S+VCW     D  T++   S G ++V 
Sbjct  642   SAVCW---KSDRPTILTANSQGTIKVL  665



>ref|XP_010509946.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X2 [Camelina 
sativa]
Length=562

 Score =   166 bits (420),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 171/326 (52%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+   D               C    +
Sbjct  258   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQ-------------CPIVEM  304

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  305   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  362

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   
Sbjct  363   PSMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNYIAVGSADHHI  417

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  418   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  477

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY      P+  +   S   +   E     FIS
Sbjct  478   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMEDAEEEAGSYFIS  535

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  536   AVCW---KSDSPTMLTANSQGTIKVL  558



>ref|XP_008805600.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X2 [Phoenix 
dactylifera]
Length=543

 Score =   166 bits (420),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 175/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++++I+V+  +++V+      E SD     H    +  + 
Sbjct  239   ANIVSSIEFDRDDELFATAGVSKRIKVFDFSTVVN------EPSDV----HCPVVE--MS  286

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   ++  ++ S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  287   TRSKLSCLSWNK-YSKNIIASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSQTEP  344

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   +A G AD   +
Sbjct  345   SMLVSGSDDCKVKVW---CTKQE--ASVINIDMKANICCVKYNPGSSIFVAVGSADHHIH  399

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              +DLRNT+ PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT+KGH N
Sbjct  400   YFDLRNTSTPLHVCRGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENCPVRTFKGHTN  459

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVY---GCKSATGQPGSENGFISS  1105
                FVGL+V  N   I+CGSE N VFVY     +P   +             S + FIS+
Sbjct  460   EKNFVGLTV--NNEYIACGSETNDVFVYHKAISKPAACHRFGSSDLDDTDDDSGSYFISA  517

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++A  S G ++V 
Sbjct  518   VCW---KSDSPTMLAANSQGTIKVL  539



>gb|AES99834.2| E3 ubiquitin-protein ligase COP1 [Medicago truncatula]
Length=677

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 177/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D+  AT G++R+I+V+  +++V+      E +DA    H    +  + 
Sbjct  373   ANIVSSIEFDRDDDLFATAGVSRRIKVFDFSAVVN------EPTDA----HCPVVE--MT  420

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  + E +EH  +R WSVD+S +D 
Sbjct  421   TRSKLSCLSWNK-YAKNQIASSDYEGIVTVWDVTTRKSLMEYEEHE-KRAWSVDFSRTDP  478

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  479   SMLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSGNYIAVGSADHHIH  533

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  534   YYDLRNISRPVHVFSGHKKAVSYVKFLSNDELASASTDSTLRLWDVKQNVPVRTFRGHAN  593

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-WVYGCKSATGQPGSENG--FISS  1105
                FVGL+V  +   I+CGSE N+VFVY     +P+ W             E G  FIS+
Sbjct  594   EKNFVGLTV--SSEYIACGSETNEVFVYHKEISKPLTWHRFSSPDMDDAEDEAGSYFISA  651

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  652   VCW---KSDRPTILTANSQGTIKVL  673



>emb|CAB89693.1| constitutively photomorphogenic 1 protein [Pisum sativum]
Length=675

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 112/327 (34%), Positives = 180/327 (55%), Gaps = 32/327 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D+  AT G++R+I+V+  +++V+      E +DA    H    +  + 
Sbjct  371   ANIVSSIEFDRDDDLFATAGVSRRIKVFDFSAVVN------EPTDA----HCPVVE--MT  418

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  + E +EH  +R WSVD+S +D 
Sbjct  419   TRSKLSCLSWNK-YAKNQIASSDYEGIVTVWDVTTRKSLMEYEEHE-KRAWSVDFSRTDP  476

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  477   SMLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSGNYIAVGSADHHIH  531

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  532   YYDLRNISRPVHVFTGHKKAVSYVKFLSNDELASASTDSTLRLWDVKQNLPVRTFRGHAN  591

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-W----VYGCKSATGQPGSENGFI  1099
                FVGL+V  +   I+CGSE N+VFVY     +P+ W        + A  + GS   FI
Sbjct  592   EKNFVGLTV--SSEYIACGSETNEVFVYHKEISKPLTWHRFGTLDMEDAEDEAGSY--FI  647

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             S+VCW     D  T++   S G ++V 
Sbjct  648   SAVCW---KSDRPTILTANSQGTIKVL  671



>gb|KHN44754.1| E3 ubiquitin-protein ligase COP1 [Glycine soja]
Length=668

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/327 (35%), Positives = 179/327 (55%), Gaps = 32/327 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D+  AT G++R+I+V+  +++V+      E +DA    H    +  + 
Sbjct  364   ANIVSSIEFDCDDDLFATAGVSRRIKVFDFSAVVN------EPTDA----HCPVVE--MS  411

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  + E +EH  +R WSVD+S +D 
Sbjct  412   TRSKLSCLSWNK-YAKNQIASSDYEGIVTVWDVTTRKSLMEYEEHE-KRAWSVDFSRTDP  469

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  470   SMLVSGSDDCKVKIW---CTNQE--ASVLNIDMKANICCVKYNPGSGNYIAVGSADHHIH  524

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT+KGH N
Sbjct  525   YYDLRNISRPVHVFSGHRKAVSYVKFLSNDELASASTDSTLRLWDVKENLPVRTFKGHAN  584

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS-----ATGQPGSENGFI  1099
                FVGL+V  +   I+CGSE N+VFVY      P+  +   S     A  + GS   FI
Sbjct  585   EKNFVGLTV--SSEYIACGSETNEVFVYHKEISRPLTCHRFGSPDMDDAEDEAGSY--FI  640

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             S+VCW     D  T++   S G ++V 
Sbjct  641   SAVCW---KSDRPTILTANSQGTIKVL  664



>ref|XP_003545597.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Glycine max]
Length=675

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/327 (35%), Positives = 179/327 (55%), Gaps = 32/327 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D+  AT G++R+I+V+  +++V+      E +DA    H    +  + 
Sbjct  371   ANIVSSIEFDCDDDLFATAGVSRRIKVFDFSAVVN------EPTDA----HCPVVE--MS  418

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  + E +EH  +R WSVD+S +D 
Sbjct  419   TRSKLSCLSWNK-YAKNQIASSDYEGIVTVWDVTTRKSLMEYEEHE-KRAWSVDFSRTDP  476

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  477   SMLVSGSDDCKVKIW---CTNQE--ASVLNIDMKANICCVKYNPGSGNYIAVGSADHHIH  531

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT+KGH N
Sbjct  532   YYDLRNISRPVHVFSGHRKAVSYVKFLSNDELASASTDSTLRLWDVKENLPVRTFKGHAN  591

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS-----ATGQPGSENGFI  1099
                FVGL+V  +   I+CGSE N+VFVY      P+  +   S     A  + GS   FI
Sbjct  592   EKNFVGLTV--SSEYIACGSETNEVFVYHKEISRPLTCHRFGSPDMDDAEDEAGSY--FI  647

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             S+VCW     D  T++   S G ++V 
Sbjct  648   SAVCW---KSDRPTILTANSQGTIKVL  671



>ref|XP_007141658.1| hypothetical protein PHAVU_008G214400g [Phaseolus vulgaris]
 gb|ESW13652.1| hypothetical protein PHAVU_008G214400g [Phaseolus vulgaris]
Length=675

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 112/325 (34%), Positives = 177/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D+  AT G++R+I+V+  +++V+      E +DA    H    +  + 
Sbjct  371   ANIVSSIEFDRDDDLFATAGVSRRIKVFDFSAVVN------EPTDA----HCPVVE--MS  418

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  + E +EH  +R WSVD+S +D 
Sbjct  419   TRSKLSCLSWNK-YAKNQIASSDYEGIVTVWDVTTRKSLMEYEEHE-KRAWSVDFSRTDP  476

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  477   SMLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSGNYIAVGSADHHIH  531

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT+KGH N
Sbjct  532   YYDLRNISRPVHVFSGHRKAVSYVKFLSNYELASASTDSTLRLWDVKENLPVRTFKGHAN  591

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-WVYGCKSATGQPGSENG--FISS  1105
                FVGL+V  +   I+CGSE N+VFVY     +P+ W             E G  FIS+
Sbjct  592   EKNFVGLTV--SSEYIACGSETNEVFVYHKEISKPLTWHRFGSPDMDDTEDEAGSYFISA  649

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  650   VCW---KSDRPTILTANSQGTIKVL  671



>gb|EMS63367.1| E3 ubiquitin-protein ligase COP1 [Triticum urartu]
Length=622

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/327 (35%), Positives = 176/327 (54%), Gaps = 32/327 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++++I+V+  +++V+      E SD     H    +  + 
Sbjct  318   ANIVSSIEFDRDDELFATAGVSKRIKVFEFSTVVN------EPSDV----HCPVVE--MA  365

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   ++  V+ S DY+G+V  +D++ R  V E +EH  +R WSVD+S ++ 
Sbjct  366   TRSKLSCLSWN-KYSKNVIASSDYEGIVTVWDVQTRQSVMEYEEHE-KRAWSVDFSRTEP  423

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A     KA   +C V+++P +   +A G AD   +
Sbjct  424   KMLVSGSDDCKVKVW---CTNQEASAINIDMKAN--ICSVKYNPGSSYYVAVGSADHHIH  478

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              +DLRN + PL +  GH KAV+Y +FL    + ++S D  +++WD      +RT++GH N
Sbjct  479   YFDLRNPSAPLHVFGGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNCPLRTFRGHKN  538

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS-----ATGQPGSENGFI  1099
                FVGLSV  N   I+CGSE N+VFVY     +P   +   S     A   PGS   FI
Sbjct  539   EKNFVGLSV--NNEYIACGSETNEVFVYHKAISKPASSHRFLSTDLDDAEDDPGS--YFI  594

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             S+VCW     D  T++   S G ++V 
Sbjct  595   SAVCW---KSDSPTMLTANSQGTIKVL  618



>ref|XP_006293448.1| hypothetical protein CARUB_v10022726mg [Capsella rubella]
 gb|EOA26346.1| hypothetical protein CARUB_v10022726mg [Capsella rubella]
Length=723

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/326 (33%), Positives = 171/326 (52%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+   D               C    +
Sbjct  419   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQ-------------CPIVEM  465

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  466   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  523

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   
Sbjct  524   PSMLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSSNYIAVGSADHHI  578

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  579   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  638

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY      P+  +   S       E     FIS
Sbjct  639   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFIS  696

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  697   AVCW---KSDSPTMLTANSQGTIKVL  719



>ref|XP_009143915.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X1 [Brassica 
rapa]
Length=677

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/326 (33%), Positives = 174/326 (53%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+      E +D         C    +
Sbjct  373   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVN------EPADI-------QCPIVEM  419

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  420   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  477

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   
Sbjct  478   PSMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNFIAVGSADHHI  532

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  533   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  592

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY     +P+  +   S   +   E     FIS
Sbjct  593   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITKPVTSHRFGSLDMEEAEEEAGSYFIS  650

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  651   AVCW---KSDSPTMLTANSQGTIKVL  673



>ref|XP_010578948.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Haliaeetus leucocephalus]
 ref|XP_010578949.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Haliaeetus leucocephalus]
Length=491

 Score =   165 bits (417),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 122/385 (32%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  132   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  186

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C  +K+S
Sbjct  187   IEFDRDCDYFAIAGVTKKIKVYEYGTVIQ---------DAVDIHYPE--NEMTCN-SKIS  234

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  235   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  290

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  291   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  345

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  346   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  405

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  406   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  463

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  464   CWRALPDGESNVLIAANSQGTIKVL  488



>emb|CDY52540.1| BnaA05g34990D [Brassica napus]
Length=677

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/326 (33%), Positives = 174/326 (53%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+      E +D         C    +
Sbjct  373   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVN------EPADI-------QCPIVEM  419

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  420   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  477

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   
Sbjct  478   PSMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNFIAVGSADHHI  532

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  533   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  592

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY     +P+  +   S   +   E     FIS
Sbjct  593   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITKPVTSHRFGSLDMEEAEEEAGSYFIS  650

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  651   AVCW---KSDSPTMLTANSQGTIKVL  673



>ref|XP_008456402.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X1 [Cucumis 
melo]
Length=675

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 114/326 (35%), Positives = 174/326 (53%), Gaps = 28/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R I+V+  +S+V+      E  DA    H    +  + 
Sbjct  371   TNIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVN------EPPDA----HCPIVE--MS  418

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T AKLS L W    +  ++ S DY+G+V  +D+ R   V E +EH  +R WSVD+S ++ 
Sbjct  419   TRAKLSCLSWDKQ-SKNIIASSDYEGIVTVWDVNRGQSVMEYEEHE-KRAWSVDFSRTEP  476

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
                 SGSDD  ++ W   C      A+V     ++ +CCV+F+P + + IA G AD   +
Sbjct  477   SRLVSGSDDCKVKVW---CMKQE--ASVLDIDMKANICCVKFNPGSGNLIAVGSADHNIH  531

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  532   YYDLRNISHPLHVFTGHKKAVSYVKFLSNSELASASTDSTLRLWDVKENLPVRTFRGHTN  591

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS---ATGQPGSENGFISS  1105
                FVGL+V  N   I+CGSE N+VFVY      P+  +   S   A  +    + FIS+
Sbjct  592   EKNFVGLTV--NNEYIACGSETNEVFVYHKEISRPLTWHRFGSPDVADVEDDVGSYFISA  649

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVFA  1183
             VCW     D  T++   S G ++V  
Sbjct  650   VCW---KSDSPTILTANSQGTIKVLV  672



>ref|XP_009769726.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X1 [Nicotiana 
sylvestris]
Length=692

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/342 (34%), Positives = 177/342 (52%), Gaps = 30/342 (9%)
 Frame = +2

Query  170   RISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGS  349
             R+  V     S +  +++ +  +EFD  D   AT G++R+I+V+   S+V+      E +
Sbjct  372   RLRVVAELRHSDLFHMANIVSSIEFDRDDELFATAGVSRRIKVFEFASVVN------EPA  425

Query  350   DAVSLDHSSACDYY-ICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERD  526
             +A        C    + T +KLS L W     +  L S DY+G+V  +D+  R  V E +
Sbjct  426   EA-------QCPLVEMSTRSKLSCLSWNKCTKNH-LASSDYEGIVTVWDVTTRQSVMEYE  477

Query  527   EHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFS  706
             EH  +R WSVD+  ++  V  SGSDD  ++ W   C      A+V     ++  C V+++
Sbjct  478   EHE-KRAWSVDFCRTEPSVLVSGSDDCKVKVW---CTKQE--ASVLTIDMKANACSVKYN  531

Query  707   PFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKM  883
             P +   +A G AD   + YDLRN ++PL I  GH KAV+Y +FL    + ++S D  +++
Sbjct  532   PGSSVLVAVGSADHHIHYYDLRNVSQPLHIFSGHRKAVSYVKFLSNNELASASTDSTLRL  591

Query  884   WDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP-IWVYGCK  1060
             WD      +RT+KGH N   FVGL+V  N   ++CGSE N+VFVY     +P  W     
Sbjct  592   WDVKENVPLRTFKGHANEKNFVGLTV--NSEYLACGSETNEVFVYHKEISKPAAWHKFGS  649

Query  1061  SATGQPGSENG--FISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                  P  E G  FIS+VCW +   D  T++   S G ++V 
Sbjct  650   DDQNDPDGEMGSYFISAVCWKR---DSSTILTANSQGTIKVL  688



>ref|XP_009769727.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X2 [Nicotiana 
sylvestris]
Length=684

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/342 (34%), Positives = 177/342 (52%), Gaps = 30/342 (9%)
 Frame = +2

Query  170   RISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGS  349
             R+  V     S +  +++ +  +EFD  D   AT G++R+I+V+   S+V+      E +
Sbjct  364   RLRVVAELRHSDLFHMANIVSSIEFDRDDELFATAGVSRRIKVFEFASVVN------EPA  417

Query  350   DAVSLDHSSACDYY-ICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERD  526
             +A        C    + T +KLS L W     +  L S DY+G+V  +D+  R  V E +
Sbjct  418   EA-------QCPLVEMSTRSKLSCLSWNKCTKNH-LASSDYEGIVTVWDVTTRQSVMEYE  469

Query  527   EHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFS  706
             EH  +R WSVD+  ++  V  SGSDD  ++ W   C      A+V     ++  C V+++
Sbjct  470   EHE-KRAWSVDFCRTEPSVLVSGSDDCKVKVW---CTKQE--ASVLTIDMKANACSVKYN  523

Query  707   PFAPS-IAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKM  883
             P +   +A G AD   + YDLRN ++PL I  GH KAV+Y +FL    + ++S D  +++
Sbjct  524   PGSSVLVAVGSADHHIHYYDLRNVSQPLHIFSGHRKAVSYVKFLSNNELASASTDSTLRL  583

Query  884   WDTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP-IWVYGCK  1060
             WD      +RT+KGH N   FVGL+V  N   ++CGSE N+VFVY     +P  W     
Sbjct  584   WDVKENVPLRTFKGHANEKNFVGLTV--NSEYLACGSETNEVFVYHKEISKPAAWHKFGS  641

Query  1061  SATGQPGSENG--FISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                  P  E G  FIS+VCW +   D  T++   S G ++V 
Sbjct  642   DDQNDPDGEMGSYFISAVCWKR---DSSTILTANSQGTIKVL  680



>gb|AEE81754.1| constitutively photomorphogenic 1 [Brassica rapa subsp. rapa]
Length=677

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/326 (33%), Positives = 174/326 (53%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+      E +D         C    +
Sbjct  373   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVN------EPADI-------QCPIVEM  419

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  420   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  477

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   
Sbjct  478   PSMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNFIAVGSADHHI  532

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  533   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  592

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY     +P+  +   S   +   E     FIS
Sbjct  593   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITKPVTSHRFGSLDMEEAEEEAGSYFIS  650

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  651   AVCW---KSDSPTMLTANSQGTIKVL  673



>ref|XP_001690267.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP10005.1| predicted protein [Chlamydomonas reinhardtii]
Length=280

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/279 (38%), Positives = 156/279 (56%), Gaps = 19/279 (7%)
 Frame = +2

Query  233   VLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC--TPA  406
              LEF P    LA GG+ ++IR+Y+++S      D DE    + L  + A D  +    P+
Sbjct  12    ALEFSPDGRLLAAGGVDKQIRLYNLSSFFGDLEDDDE----LGL-LTDAADGAVVQRMPS  66

Query  407   KLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvg  586
             K+S + W P  +  V+  GDYDGV+++  +     + + D HGGR++WSV +S     + 
Sbjct  67    KVSCISWSPFMDG-VMTVGDYDGVLLQLHIASGHQLSDVDAHGGRKIWSVAHSSRRPHLA  125

Query  587   asgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSP-FAPSIAAGCADRKTYTYD  763
             AS +DD T + W  R     C+AT+QP+  R++VCCV FSP     +A  C+DR +Y YD
Sbjct  126   ASAADDRTARLWAGR-GLAACVATLQPNP-RASVCCVDFSPEHDHMLALACSDRVSYLYD  183

Query  764   LRNTAE-PLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLV-----RTYKG  925
             LR  A  PL  L  H +  +Y RFL    ++T++ D  + +WD   RN V     R ++G
Sbjct  184   LRRLAGGPLAALRHHSRPASYCRFLGGDRLVTAATDASLALWDL--RNAVPQLPARVFRG  241

Query  926   HINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI  1042
             H N   FVGLSV    GL++CGSE ++ F Y T W +P+
Sbjct  242   HRNEKNFVGLSVRWPDGLVACGSECSRAFAYHTSWSDPL  280



>ref|XP_004491092.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Cicer arietinum]
Length=672

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 177/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D+  AT G++R+I+V+  +++V+      E +DA    H    +  + 
Sbjct  368   ANIVSSIEFDRDDDLFATAGVSRRIKVFDFSAVVN------EPTDA----HCPVVE--MT  415

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  + E +EH  +R WSVD+S +D 
Sbjct  416   TRSKLSCLSWNK-YAKNQIASSDYEGIVTVWDVTTRKSLMEYEEHE-KRAWSVDFSRTDP  473

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  474   SMLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSGNYIAVGSADHHIH  528

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  529   YYDLRNISRPVHVFSGHKKAVSYVKFLSNDELASASTDSTLRLWDVKENIPVRTFRGHAN  588

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-WVYGCKSATGQPGSENG--FISS  1105
                FVGL+V  +   I+CGSE N+VFVY     +P+ W             E G  FIS+
Sbjct  589   EKNFVGLTV--SSEYIACGSETNEVFVYHKEISKPLTWHRFSSPDMDDAEDEAGSYFISA  646

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  647   VCW---KSDRPTILTANSQGTIKVL  668



>ref|XP_006286352.1| hypothetical protein CARUB_v10000091mg, partial [Capsella rubella]
 gb|EOA19250.1| hypothetical protein CARUB_v10000091mg, partial [Capsella rubella]
Length=1095

 Score =   169 bits (428),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 129/352 (37%), Positives = 185/352 (53%), Gaps = 40/352 (11%)
 Frame = +2

Query  167   FRISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEG  346
             F   AV+   TS +   S+ +  L FD  +++ AT G+++KI+++  NSL +     D  
Sbjct  767   FETRAVLR--TSELNNTSNVICSLGFDRDEDYFATAGVSKKIKIFEFNSLFNE--SVDIH  822

Query  347   SDAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERD  526
               AV + + S          KLS + W   +    L S DYDG+V  +D+     +    
Sbjct  823   YPAVEMPNRS----------KLSGVCWN-NYIRNYLASSDYDGIVKLWDVTTGQAISHFI  871

Query  527   EHGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFS  706
             EH  +R WSVD+S +     ASGSDD +++ W+      NCL T+   +  + VCCVQFS
Sbjct  872   EHE-KRAWSVDFSEACPTKLASGSDDCSVKLWN--INERNCLGTI---RNIANVCCVQFS  925

Query  707   PFAPSIAA-GCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKM  883
             P +  + A G +D +TY YDLRN   P  IL GH KAV+YA+FLD  T++T+S D  +K+
Sbjct  926   PQSSHLLAFGSSDFRTYCYDLRNLRTPWCILSGHNKAVSYAKFLDNETLVTASTDNTLKL  985

Query  884   WD---TDHRNLVR-----TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP  1039
             WD   T H  L       T+ GH N   FVGLS   + G I+CGSE N+V+ Y      P
Sbjct  986   WDLKKTTHGGLSTNACSLTFGGHTNEKNFVGLST--SDGYIACGSETNEVYAYHRSLPMP  1043

Query  1040  IWVYGCKSATGQPGSE-----NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             I  Y   S     G E     N F+SSVCW +R +    +V+  S+G ++V 
Sbjct  1044  ITSYKFGSIDPISGKEIEEDNNLFVSSVCWRKRSN---MVVSASSNGSIKVL  1092



>emb|CDQ70546.1| unnamed protein product [Oncorhynchus mykiss]
Length=715

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 182/331 (55%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+V+   +++          DAV + +    +   C
Sbjct  405   SSIVSSIEFDRDGDYFAIAGVTKKIKVFEYGTVI---------QDAVDIHY--PVNEMTC  453

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  454   N-SKISCISWS-SYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  508

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  509   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPTSRYHLAFGCADHC  563

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F++   ++++S D  +K+W+ +  + +R++KGH
Sbjct  564   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVNGEEIVSASTDSQLKLWNVNKPHCLRSFKGH  623

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  ++CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  624   INEKNFVGLA--SNGDYVACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDKKEDDTN  681

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D D   L+A  S G ++V 
Sbjct  682   EFVSAVCWRAMPDGDSNVLIAANSQGTIKVL  712



>ref|XP_006711552.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X6 [Homo 
sapiens]
Length=420

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 180/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY  ++++          DAV + +    +  + 
Sbjct  110   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQ---------DAVDIHYP---ENEMT  157

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  158   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  213

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  214   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  268

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  269   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  328

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  329   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  386

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  387   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  417



>ref|XP_004658824.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X2 [Jaculus 
jaculus]
Length=491

 Score =   164 bits (416),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 109/331 (33%), Positives = 179/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  181   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQ---------DAVDIHYP---ENEMT  228

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  229   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  284

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  285   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  339

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  340   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  399

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  400   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  457

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D D   L+A  S G ++V 
Sbjct  458   EFVSAVCWRALPDGDSNVLIAANSQGTIKVL  488



>ref|XP_006410433.1| hypothetical protein EUTSA_v10016348mg [Eutrema salsugineum]
 gb|ESQ51886.1| hypothetical protein EUTSA_v10016348mg [Eutrema salsugineum]
Length=678

 Score =   166 bits (420),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 171/326 (52%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+   D               C    +
Sbjct  374   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQ-------------CPIVEM  420

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  421   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  478

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   
Sbjct  479   PSMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNYIAVGSADHHI  533

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  534   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  593

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY      P+  +   S   +   E     FIS
Sbjct  594   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMEDAEEEAGSYFIS  651

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  652   AVCW---KSDSPTMLTANSQGTIKVL  674



>ref|XP_006496924.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X3 [Mus 
musculus]
Length=433

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 179/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  123   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQ---------DAVDIHYP---ENEMT  170

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  171   CNSKISCISWS-SYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  226

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  227   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  281

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  282   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  341

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  342   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  399

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  400   EFVSAVCWRALSDGESNVLIAANSQGTIKVL  430



>dbj|BAK06015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=693

 Score =   166 bits (420),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 113/327 (35%), Positives = 176/327 (54%), Gaps = 32/327 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++++I+V+  +++V+      E SD     H    +  + 
Sbjct  389   ANIVSSIEFDRDDELFATAGVSKRIKVFEFSTVVN------EPSDV----HCPVVE--MA  436

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   ++  V+ S DY+G+V  +D++ R  V E +EH  +R WSVD+S ++ 
Sbjct  437   TRSKLSCLSWN-KYSKNVIASSDYEGIVTVWDVQTRQSVMEYEEHE-KRAWSVDFSRTEP  494

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A     KA   +C V+++P +   +A G AD   +
Sbjct  495   KMLVSGSDDCKVKVW---CTNQEASAINIDMKAN--ICSVKYNPGSSYYVAVGSADHHIH  549

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              +DLRN + PL +  GH KAV+Y +FL    + ++S D  +++WD      +RT++GH N
Sbjct  550   YFDLRNPSAPLHVFGGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNCPLRTFRGHKN  609

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS-----ATGQPGSENGFI  1099
                FVGLSV  N   I+CGSE N+VFVY     +P   +   S     A   PGS   FI
Sbjct  610   EKNFVGLSV--NNEYIACGSETNEVFVYHKAISKPASSHRFLSTDLDDAEDDPGSY--FI  665

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             S+VCW     D  T++   S G ++V 
Sbjct  666   SAVCW---KSDSPTMLTANSQGTIKVL  689



>ref|XP_011047014.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X1 [Populus 
euphratica]
Length=602

 Score =   166 bits (419),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 108/340 (32%), Positives = 181/340 (53%), Gaps = 27/340 (8%)
 Frame = +2

Query  170   RISAVVSSPTSAVGAVSDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGS  349
             R+ AV       +   ++ +  +EFD  D   AT G++R+I+++  +S+++      E +
Sbjct  283   RLRAVAELRHGDLFHSANIVSSIEFDRDDELFATAGVSRRIKIFEFSSVMN------EPA  336

Query  350   DAVSLDHSSACDYYICTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDE  529
             D     H    +  + T +KLS L W   +    + S DY+G+V  +D+  R  + E +E
Sbjct  337   DV----HCPVVE--MSTRSKLSCLSWNK-YTKNHIASSDYEGIVTVWDVTTRQSIMEYEE  389

Query  530   HGGRRVWSVDYshsdsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSP  709
             H  +R WSVD+S ++  +  SGSDD  ++ W   C      A+V     ++ +C V+++P
Sbjct  390   HE-KRAWSVDFSRTEPSMLVSGSDDCKVKIW---CTQQE--ASVLNIDMKANICSVKYNP  443

Query  710   FAP-SIAAGCADRKTYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMW  886
              +   +A G AD   + YDLRN ++PL++  GH KAV+Y +FL    + ++S D  +++W
Sbjct  444   GSSIHVAVGSADHHIHYYDLRNISQPLYVFSGHRKAVSYVKFLSSNELASASTDSTLRLW  503

Query  887   DTDHRNLVRTYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP-IW-VYGCK  1060
             D      +RT++GH N   FVGL+V  N   I+CGSE N+VFVY     +P  W  +   
Sbjct  504   DVKDNLALRTFRGHTNEKNFVGLTV--NSEYIACGSETNEVFVYHKAISKPAAWHRFSTD  561

Query  1061  SATGQPGSENGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                G+  + + FIS+VCW     D  T++   S G ++V 
Sbjct  562   LENGEDDAGSYFISAVCW---KSDSPTMLTANSQGTIKVL  598



>ref|XP_007049189.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX93346.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma 
cacao]
Length=523

 Score =   164 bits (416),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 104/325 (32%), Positives = 174/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EF+  D   AT G++R+I+V+  + +++   D           H    +  + 
Sbjct  219   ANIVSSIEFNRDDELFATAGVSRRIKVFDFSMVLNDQADV----------HCPVVE--MS  266

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   ++   + S DY+G+V  +D++ R  + E +EH  +R WSVD+S ++ 
Sbjct  267   TRSKLSCLSWNK-YSKNHIASSDYEGIVTVWDVQTRQSLMEYEEHE-KRAWSVDFSRTEP  324

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  325   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSSNYIAVGSADHHIH  379

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + PL +  GH KAV+Y +FL    + ++S D  +++WD      +RT++GH N
Sbjct  380   YYDLRNISSPLHVFSGHKKAVSYVKFLSENELASASTDSTLRLWDVKESLPLRTFRGHTN  439

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   I+CGSE N+V+VY     +P+  +   S       E+    FIS+
Sbjct  440   EKNFVGLTV--NSEYIACGSEKNEVYVYHKEISKPVTWHRFGSQDMDDADEDAGSHFISA  497

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  498   VCW---KSDSPTMLTANSQGTIKVL  519



>gb|KDP30815.1| hypothetical protein JCGZ_13758 [Jatropha curcas]
Length=681

 Score =   166 bits (420),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 171/326 (52%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLV-DPFWDQDEGSDAVSLDHSSACDYYI  394
             ++ +  +EFD  D   AT G++R+I+V+  ++++ DP    D     V +   S      
Sbjct  377   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSTVLNDP---ADVHCPVVEMSAHS------  427

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
                 KLS L W   +    + S DY+GVV  +D+  R  V E +EH  +R WSVD+S ++
Sbjct  428   ----KLSCLSWNK-YAKNQIASSDYEGVVNVWDVTTRQSVMEYEEHE-KRAWSVDFSRTE  481

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W   C N    A+V      + +CCV+++P + + IA G AD   
Sbjct  482   PSMLVSGSDDCKVKVW---CTNQE--ASVLNIDMTANICCVKYNPGSSNYIAVGSADHHI  536

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN + PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  537   HYYDLRNISHPLHVFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENVPVRTFRGHT  596

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGLSV  N   I+CGSE N+VFVY     +P+  +   S       E+    FIS
Sbjct  597   NEKNFVGLSV--NHEYIACGSETNEVFVYHKEISKPVTWHRFGSPEMDDTDEDAASYFIS  654

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW        T++   S G ++V 
Sbjct  655   AVCWKSNSP---TMLTANSQGTIKVL  677



>gb|AFW73661.1| ubiquitin ligase protein COP1 [Zea mays]
Length=693

 Score =   166 bits (420),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 113/327 (35%), Positives = 179/327 (55%), Gaps = 32/327 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++++I+V+  +++V+      E SD     H    +  + 
Sbjct  389   ANIVSSIEFDRDDELFATAGVSKRIKVFEFSTVVN------EPSDV----HCPVVE--MA  436

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   ++  ++ S DY+G+V  +D++ R  V E +EH  +R WSVD+S +DS
Sbjct  437   TRSKLSCLSWN-KYSKNIIASSDYEGIVTVWDVQTRQSVMEYEEHE-KRAWSVDFSRTDS  494

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +C V+++P +   +A G AD   +
Sbjct  495   SMLVSGSDDCKVKVW---CTNQE--ASVINIDMKANICSVKYNPGSSFYVAVGSADHHIH  549

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              +DLRN + P+ I  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  550   YFDLRNPSSPVHIFGGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNCPVRTFRGHKN  609

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSA-----TGQPGSENGFI  1099
                FVGLSV  N   I+CGSE N+VFVY     +P   +   S+        PGS   FI
Sbjct  610   EKNFVGLSV--NNEYIACGSETNEVFVYHKAISKPAASHRFVSSDLDDADDDPGSY--FI  665

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             S+VCW     D  T++   S G ++V 
Sbjct  666   SAVCW---KSDSPTMLTANSQGTIKVL  689



>ref|XP_010469530.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X3 [Camelina 
sativa]
Length=562

 Score =   165 bits (417),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 170/326 (52%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+   D               C    +
Sbjct  258   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQ-------------CPIVEM  304

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  305   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  362

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   
Sbjct  363   PSMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNYIAVGSADHHI  417

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  418   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  477

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY      P+  +   S       E     FIS
Sbjct  478   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFIS  535

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  536   AVCW---KSDSPTMLTANSQGTIKVL  558



>ref|NP_001020297.1| E3 ubiquitin-protein ligase RFWD2 [Rattus norvegicus]
 gb|AAH91284.1| Ring finger and WD repeat domain 2 [Rattus norvegicus]
Length=433

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 179/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  123   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQ---------DAVDIHYP---ENEMT  170

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  171   CNSKISCISWS-SYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  226

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  227   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  281

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  282   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  341

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  342   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  399

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  400   EFVSAVCWRALSDGESNVLIAANSQGTIKVL  430



>ref|XP_010413924.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like isoform X1 [Camelina 
sativa]
Length=562

 Score =   165 bits (417),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 170/326 (52%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+   D               C    +
Sbjct  258   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQ-------------CPIVEM  304

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  305   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  362

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   
Sbjct  363   PSMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNYIAVGSADHHI  417

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  418   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  477

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY      P+  +   S       E     FIS
Sbjct  478   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFIS  535

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  536   AVCW---KSDSPTMLTANSQGTIKVL  558



>gb|ADR72985.1| COP1 protein [Brassica rapa var. purpuraria]
 gb|AEI89703.1| COP1 protein [Brassica rapa subsp. chinensis]
 emb|CDY12145.1| BnaC04g11750D [Brassica napus]
Length=676

 Score =   166 bits (419),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 108/326 (33%), Positives = 174/326 (53%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+      E +D         C    +
Sbjct  372   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVN------EPADI-------QCPIVEM  418

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  419   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  476

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W   C      A+V     ++ +CCV+++P + + IA G AD   
Sbjct  477   PSMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSSNFIAVGSADHHI  531

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  532   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  591

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY     +P+  +   S   +   E     FIS
Sbjct  592   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITKPVTSHRFGSLDMEEAEEEAGSYFIS  649

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  650   AVCW---KSDSPTMLTANSQGTIKVL  672



>ref|XP_010404622.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X2 [Corvus 
cornix cornix]
Length=586

 Score =   165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 122/385 (32%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  227   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  281

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C  +K+S
Sbjct  282   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYPE--NEMTCN-SKIS  329

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  330   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  385

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  386   SGSDDAKVKLWSTNLDN-----SVASIEAKAKVCCVKFSPSSRYHLAFGCADHCVHYYDL  440

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  441   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  500

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  501   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  558

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  559   CWRALPDGESNVLIAANSQGTIKVL  583



>ref|XP_010509945.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X1 [Camelina 
sativa]
Length=678

 Score =   166 bits (419),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 171/326 (52%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+   D               C    +
Sbjct  374   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQ-------------CPIVEM  420

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  421   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  478

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   
Sbjct  479   PSMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNYIAVGSADHHI  533

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  534   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  593

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY      P+  +   S   +   E     FIS
Sbjct  594   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMEDAEEEAGSYFIS  651

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  652   AVCW---KSDSPTMLTANSQGTIKVL  674



>ref|XP_003616876.1| E3 ubiquitin-protein ligase COP1 [Medicago truncatula]
Length=761

 Score =   166 bits (421),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 177/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D+  AT G++R+I+V+  +++V+      E +DA    H    +  + 
Sbjct  457   ANIVSSIEFDRDDDLFATAGVSRRIKVFDFSAVVN------EPTDA----HCPVVE--MT  504

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  + E +EH  +R WSVD+S +D 
Sbjct  505   TRSKLSCLSWNK-YAKNQIASSDYEGIVTVWDVTTRKSLMEYEEHE-KRAWSVDFSRTDP  562

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C N    A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  563   SMLVSGSDDCKVKVW---CTNQE--ASVLNIDMKANICCVKYNPGSGNYIAVGSADHHIH  617

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  618   YYDLRNISRPVHVFSGHKKAVSYVKFLSNDELASASTDSTLRLWDVKQNVPVRTFRGHAN  677

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPI-WVYGCKSATGQPGSENG--FISS  1105
                FVGL+V  +   I+CGSE N+VFVY     +P+ W             E G  FIS+
Sbjct  678   EKNFVGLTV--SSEYIACGSETNEVFVYHKEISKPLTWHRFSSPDMDDAEDEAGSYFISA  735

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  736   VCW---KSDRPTILTANSQGTIKVL  757



>ref|XP_006496923.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X2 [Mus 
musculus]
Length=491

 Score =   164 bits (415),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 179/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  181   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQ---------DAVDIHYP---ENEMT  228

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  229   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  284

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  285   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  339

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  340   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  399

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  400   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  457

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  458   EFVSAVCWRALSDGESNVLIAANSQGTIKVL  488



>emb|CBI41056.3| unnamed protein product [Vitis vinifera]
Length=602

 Score =   165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 173/325 (53%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  298   ANIVSSIEFDRDDELFATAGVSRRIKVFEFSSVVN------EPADV----HCPVVE--MS  345

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  346   TRSKLSCLSWNK-YTKNHIASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTEP  403

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +C V+++P +   +A G AD   +
Sbjct  404   SMLVSGSDDCKVKIW---CTKQE--ASVLNIDMKANICSVKYNPGSSIYVAVGSADHHIH  458

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  459   YYDLRNISQPLHVFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENMPVRTFRGHSN  518

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP-IWVYGCKSATGQPGSENG--FISS  1105
                FVGL+V  N   I+CGSE N+VF Y     +P  W     S       +NG  FIS+
Sbjct  519   EKNFVGLTV--NSEYIACGSETNEVFAYHKAISKPAAWHRFGSSDLDDTDDDNGSYFISA  576

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  577   VCW---KSDSPTMLTANSQGTIKVL  598



>ref|XP_010404621.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X1 [Corvus 
cornix cornix]
Length=590

 Score =   165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSD------ALGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  231   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  285

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  +   +K+S
Sbjct  286   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYP---ENEMTCNSKIS  333

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  334   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  389

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  390   SGSDDAKVKLWSTNLDN-----SVASIEAKAKVCCVKFSPSSRYHLAFGCADHCVHYYDL  444

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  445   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  504

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  505   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  562

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  563   CWRALPDGESNVLIAANSQGTIKVL  587



>ref|XP_006859027.1| hypothetical protein AMTR_s00068p00174010 [Amborella trichopoda]
 gb|ERN20494.1| hypothetical protein AMTR_s00068p00174010 [Amborella trichopoda]
Length=927

 Score =   167 bits (424),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 124/332 (37%), Positives = 180/332 (54%), Gaps = 35/332 (11%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  L FD    F AT G+ RKI+V+  + +++   D           H    +  + 
Sbjct  617   SNLVCSLGFDRDKEFFATAGVNRKIKVFECDMILNEDLDI----------HYPVIE--MA  664

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             + +KLSS+ W     S+ + S D++G+V  +D+ R     +  EH  RRVWSVD+S +D 
Sbjct  665   SRSKLSSICWNSYIKSQ-MASSDFEGIVQVWDVARSQVFMDLREHE-RRVWSVDFSQADP  722

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSP-FAPSIAAGCADRKTY  754
                ASGSDDG ++ W     N N   +V   K ++ VCCVQF+P  + S+A G AD K Y
Sbjct  723   TRLASGSDDGAVKLW-----NINQGGSVGTIKTKANVCCVQFAPDSSRSLAIGSADHKVY  777

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDH------RNLVRT  916
              YDLRNT  P   L GH K V+Y +F+D  T++++S D  +K+WD          + V+T
Sbjct  778   CYDLRNTKMPWCTLIGHTKTVSYIKFIDSTTLVSASTDSTLKLWDLSMNTSRVIESPVQT  837

Query  917   YKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE---  1087
             + GH N   FVGLS+  + G I+ GSE N+VFVY   +  P+  Y  +S+    G E   
Sbjct  838   FTGHTNIKNFVGLSI--SDGYITTGSETNEVFVYHKAFPMPVLSYKFRSSDPLTGQEVDD  895

Query  1088  -NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
              + FIS VCW  RG    TLVA  S G +++F
Sbjct  896   ASQFISCVCW--RGHS-STLVAANSTGNIKIF  924



>emb|CAQ15481.1| novel protein similar to vertebrate ring finger and WD repeat 
domain 2 (RFWD2, zgc:163067) [Danio rerio]
Length=694

 Score =   166 bits (419),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 120/385 (31%), Positives = 205/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  +   + S+T+ Q +D  E   C   F R ++V   P + +   SD       +  
Sbjct  335   FSNRMSRITDDSRTVNQLDDFME---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  389

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+V+   +++          DAV + +    +   C  +K+S
Sbjct  390   IEFDRDCDYFAIAGVTKKIKVFEYGTVI---------QDAVDIHY--PVNEMTCN-SKIS  437

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  438   CISWS-SYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  493

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  494   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPTSRYHLAFGCADHCVHYYDL  548

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F++   ++++S D  +K+W+ +  + +R++KGHIN   F
Sbjct  549   RNTKQPIMVFKGHRKAVSYAKFVNGEEIVSASTDSQLKLWNVNKPHCLRSFKGHINEKNF  608

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  ++CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  609   VGLA--SNGDYVACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDKKEDDTNEFVSAV  666

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  667   CWRALPDGESNVLIAANSQGTIKVL  691



>ref|XP_008805599.1| PREDICTED: E3 ubiquitin-protein ligase COP1 isoform X1 [Phoenix 
dactylifera]
Length=688

 Score =   166 bits (419),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 175/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++++I+V+  +++V+      E SD     H    +  + 
Sbjct  384   ANIVSSIEFDRDDELFATAGVSKRIKVFDFSTVVN------EPSDV----HCPVVE--MS  431

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   ++  ++ S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  432   TRSKLSCLSWNK-YSKNIIASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSQTEP  489

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   +A G AD   +
Sbjct  490   SMLVSGSDDCKVKVW---CTKQE--ASVINIDMKANICCVKYNPGSSIFVAVGSADHHIH  544

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              +DLRNT+ PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT+KGH N
Sbjct  545   YFDLRNTSTPLHVCRGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENCPVRTFKGHTN  604

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVY---GCKSATGQPGSENGFISS  1105
                FVGL+V  N   I+CGSE N VFVY     +P   +             S + FIS+
Sbjct  605   EKNFVGLTV--NNEYIACGSETNDVFVYHKAISKPAACHRFGSSDLDDTDDDSGSYFISA  662

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++A  S G ++V 
Sbjct  663   VCW---KSDSPTMLAANSQGTIKVL  684



>ref|XP_001759457.1| predicted protein [Physcomitrella patens]
 gb|EDQ75759.1| predicted protein [Physcomitrella patens]
Length=668

 Score =   166 bits (419),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 108/323 (33%), Positives = 174/323 (54%), Gaps = 26/323 (8%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  ++FD  D   AT G+ R+I++++  +++D   D           H    +  I 
Sbjct  366   SNIVSSIDFDGDDQLFATAGVTRRIKIFNFATVIDDVVDV----------HCPVTE--IP  413

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W       ++ S DY+G++  +D+ R   V E +EH  +R WSVD+S  D 
Sbjct  414   TRSKLSCLSWN-KLKKPLVASSDYEGIIAVWDVNRSQSVVEYEEHE-KRAWSVDFSCIDP  471

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDDG ++ W   C N +  A     KA   +CCV+++P + + IA G +D   +
Sbjct  472   SMMVSGSDDGKVKVW---CINQDASAFSIDMKAN--ICCVKYNPGSSNHIAIGSSDHHIH  526

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN   PLF+  GH KAV+Y +F+    ++++S D  +++WD      V+T  GH N
Sbjct  527   YYDLRNLRTPLFVFKGHRKAVSYVKFMSSNELVSASTDSTLRLWDVQTDTSVQTLGGHTN  586

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQP-GSENGFISSVC  1111
                FVGL+V  N   I+CGSE ++VFVY     +P + +  +S+  +  G +  F+S+VC
Sbjct  587   EKNFVGLTV--NSDYIACGSETSEVFVYHKATSKPSFSHKFRSSYAEDIGDDISFVSAVC  644

Query  1112  WMQRGDDHCTLVAGGSDGVLRVF  1180
             W        T++A  S G ++V 
Sbjct  645   WKSESP---TMLAANSQGTIKVL  664



>ref|XP_010714112.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X2 [Meleagris 
gallopavo]
Length=586

 Score =   165 bits (417),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 122/385 (32%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  227   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  281

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C  +K+S
Sbjct  282   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYPE--NEMTCN-SKIS  329

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  330   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  385

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  386   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  440

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  441   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  500

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  501   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  558

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  559   CWRALPDGESNVLIAANSQGTIKVL  583



>ref|XP_003767505.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2-like [Sarcophilus 
harrisii]
Length=460

 Score =   163 bits (413),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 180/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  150   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQ---------DAVDIHYP---ENEMT  197

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  198   CNSKISCISWS-SYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  253

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  254   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  308

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGH
Sbjct  309   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGH  368

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  369   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  426

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  427   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  457



>ref|XP_009086657.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Serinus canaria]
Length=586

 Score =   165 bits (417),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  227   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  281

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  +   +K+S
Sbjct  282   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYP---ENEMTCNSKIS  329

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  330   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  385

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  386   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  440

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  441   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  500

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  501   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  558

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  559   CWRALPDGESNVLIAANSQGTIKVL  583



>emb|CDM84202.1| unnamed protein product [Triticum aestivum]
Length=769

 Score =   166 bits (420),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/324 (37%), Positives = 167/324 (52%), Gaps = 35/324 (11%)
 Frame = +2

Query  242   FDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLSSL  421
             FD  + F AT G+ +KI+V+  N +V+   D           H    +  +   +KLS +
Sbjct  467   FDRDNEFFATAGVNKKIKVFEYNMIVNEHRDI----------HYPVVE--MSNKSKLSCI  514

Query  422   RWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsdsvvgasgsd  601
              W     S +  S D+DG+V  +D+ R     E  EH  RRVWSVD+S +D     SGSD
Sbjct  515   SWNSYMKSHI-ASSDFDGLVQVWDVTRSQVFVEMREHE-RRVWSVDFSLADPTKLVSGSD  572

Query  602   dgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSP-FAPSIAAGCADRKTYTYDLRNTA  778
             DGT++ W     + N   +V   + R+ VC VQF P  A SIA G AD K Y YDLRN  
Sbjct  573   DGTVKLW-----SMNQAGSVGTIRTRANVCSVQFQPDSARSIAIGSADHKIYCYDLRNIR  627

Query  779   EPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHR------NLVRTYKGHINTT  940
              P   L GH K V+Y +++D  T+++ S D  +K+WD          N V+T+ GH NT 
Sbjct  628   APYCTLVGHTKTVSYVKYVDASTIVSGSTDNSLKLWDLSTNQARVIDNPVQTFTGHTNTK  687

Query  941   RFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE----NGFISSV  1108
              FVGLS+  + G I+ GSE N+VFVY   +  P+  Y         G E    + FIS V
Sbjct  688   NFVGLSI--SDGYIATGSETNEVFVYHKAFPMPVLAYKFNVTDPISGQEIDDQSQFISCV  745

Query  1109  CWMQRGDDHCTLVAGGSDGVLRVF  1180
             CW  RG    TL++  S G ++V 
Sbjct  746   CW--RGQS-STLLSANSSGNIKVL  766



>ref|XP_004244232.1| PREDICTED: protein SPA1-RELATED 4-like [Solanum lycopersicum]
Length=879

 Score =   167 bits (423),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 126/333 (38%), Positives = 183/333 (55%), Gaps = 37/333 (11%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  L FD    + AT G+ +KI+V+  NS+V+   D+D     V +           
Sbjct  569   SNLVCALGFDRDGEYFATAGVNKKIKVFEYNSIVNE--DRDIHYPVVEM----------A  616

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             + +KLSS+ W  G+    + S +++GVV  +D+ R     E  EH  RRVWSVD+S +D 
Sbjct  617   SRSKLSSICWN-GYIKSQIASSNFEGVVQVWDVTRSQVFMEMREHE-RRVWSVDFSAADP  674

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPF--APSIAAGCADRKT  751
              + ASGSDDG+++ W     N N   +V   K ++ VCCVQF PF    S+A G AD K 
Sbjct  675   TMLASGSDDGSVKLW-----NINQGVSVGTIKTKANVCCVQF-PFDSGRSLAFGSADHKI  728

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTD---HRNL---VR  913
             Y YDLRN+  PL  L GH K V+Y +F+D  T++++S D  +K+WD      R L   ++
Sbjct  729   YYYDLRNSKMPLCTLIGHNKTVSYVKFIDSTTLVSASTDNTLKLWDLSICTSRILDTPLQ  788

Query  914   TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS----ATGQPG  1081
             ++ GH+N   FVGLSV +  G I+ GSE N+VFVY   +  P   +   S    + G+  
Sbjct  789   SFTGHMNVKNFVGLSVSE--GYIATGSETNEVFVYHKAFPMPALSFKFNSTDPLSGGEVD  846

Query  1082  SENGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
              +  FISSVCW    D   TLVA  S G +++ 
Sbjct  847   DQAQFISSVCWR---DQSSTLVAANSMGNIKLL  876



>ref|XP_009604688.1| PREDICTED: protein SPA1-RELATED 4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009604689.1| PREDICTED: protein SPA1-RELATED 4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009604690.1| PREDICTED: protein SPA1-RELATED 4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=880

 Score =   167 bits (423),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 127/333 (38%), Positives = 182/333 (55%), Gaps = 37/333 (11%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  L FD    F AT G+ +KI+V+  NS+V+   D+D     V +           
Sbjct  570   SNLVCALSFDRDGEFFATAGVNKKIKVFEYNSIVNE--DRDIRYPVVEM----------A  617

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             + +KLSS+ W  G+    + S +++GVV  +D+ R     E  EH  RRVWSVD+S +D 
Sbjct  618   SRSKLSSICWN-GYIKSQIASSNFEGVVQVWDVTRNQLFMEMREHE-RRVWSVDFSVADP  675

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPF--APSIAAGCADRKT  751
              + ASGSDDG+++ W     N N   ++   K ++ VCCVQF PF    S+A G AD K 
Sbjct  676   TMLASGSDDGSVKLW-----NINQGVSIGTIKTKANVCCVQF-PFDSGRSLAFGSADHKI  729

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDT---DHRNL---VR  913
             Y YDLRN+  PL  L GH K V+Y +F+D  T++++S D  +K+WD      R L   ++
Sbjct  730   YYYDLRNSKMPLCTLIGHNKTVSYVKFIDSTTLVSASTDNTLKLWDLSICSSRILDSPLQ  789

Query  914   TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE--  1087
             ++ GH+N   FVGLS+  + G I+ GSE N+VFVY   +  P   +   S     G E  
Sbjct  790   SFTGHMNVKNFVGLSI--SDGYIATGSETNEVFVYHKAFPMPALSFKFNSTDPLSGDEVD  847

Query  1088  --NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                 FISSVCW  RG    TLVA  S G +++ 
Sbjct  848   DQAQFISSVCW--RGQS-STLVAANSMGNIKLL  877



>ref|XP_009784585.1| PREDICTED: protein SPA1-RELATED 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784586.1| PREDICTED: protein SPA1-RELATED 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784587.1| PREDICTED: protein SPA1-RELATED 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784588.1| PREDICTED: protein SPA1-RELATED 4-like isoform X1 [Nicotiana 
sylvestris]
Length=881

 Score =   167 bits (423),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 128/333 (38%), Positives = 182/333 (55%), Gaps = 37/333 (11%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  L FD    F AT G+ +KI+V+  NS+V+   D+D     V +           
Sbjct  571   SNLVCALSFDRDGEFFATAGVNKKIKVFEYNSIVNE--DRDIRYPVVEM----------A  618

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             + +KLSS+ W  G+    + S +++GVV  +D+ R     E  EH  RRVWSVD+S +D 
Sbjct  619   SRSKLSSICWN-GYIKSQIASSNFEGVVQVWDVTRNQLFMEMREHE-RRVWSVDFSVADP  676

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPF--APSIAAGCADRKT  751
              + ASGSDDG+++ W     N N   ++   K ++ VCCVQF PF    S+A G AD K 
Sbjct  677   TMLASGSDDGSVKLW-----NINQGVSIGTIKTKANVCCVQF-PFDSGRSLAFGSADHKI  730

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDT---DHRNL---VR  913
             Y YDLRN+  PL  L GH K V+Y +F+D  T++++S D  +K+WD      R L   ++
Sbjct  731   YYYDLRNSKMPLCTLIGHNKTVSYVKFIDSTTLVSASTDNTLKLWDLSICSSRILDSPLQ  790

Query  914   TYKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE--  1087
             ++ GH+N   FVGLSV  + G I+ GSE N+VFVY   +  P   +   S     G E  
Sbjct  791   SFTGHMNVKNFVGLSV--SDGYIATGSETNEVFVYHKAFPMPALSFKFNSMDPLSGDEVD  848

Query  1088  --NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
                 FISSVCW  RG    TLVA  S G +++ 
Sbjct  849   DQAQFISSVCW--RGQS-STLVAANSMGNIKLL  878



>ref|XP_007061227.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X2 [Chelonia 
mydas]
Length=586

 Score =   165 bits (417),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  227   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  281

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  +   +K+S
Sbjct  282   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYP---ENEMTCNSKIS  329

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  330   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  385

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  386   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  440

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  441   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNIGKPHCLRSFKGHINEKNF  500

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  501   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  558

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  559   CWRALPDGESNVLIAANSQGTIKVL  583



>ref|XP_010714111.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X1 [Meleagris 
gallopavo]
Length=590

 Score =   165 bits (417),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  231   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  285

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  +   +K+S
Sbjct  286   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYP---ENEMTCNSKIS  333

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  334   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  389

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  390   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  444

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  445   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  504

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  505   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  562

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  563   CWRALPDGESNVLIAANSQGTIKVL  587



>ref|XP_006187343.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X2 [Camelus 
ferus]
Length=491

 Score =   164 bits (414),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 180/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY  ++++          DAV + +    +  + 
Sbjct  181   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQ---------DAVDIHYP---ENEMT  228

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  229   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  284

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  285   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  339

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  340   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  399

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  400   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  457

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  458   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  488



>ref|XP_008333059.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Cynoglossus semilaevis]
Length=715

 Score =   166 bits (419),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 183/331 (55%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+V+  ++++          DAV + +    +   C
Sbjct  405   SSIVSSIEFDRDCDYFAIAGVTKKIKVFEYSTVIQ---------DAVDIHY--PVNEMTC  453

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  454   N-SKISCISWS-SYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  508

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  509   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPTSRYHLAFGCADHC  563

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F++   ++++S D  +K+W+ +  + +R++KGH
Sbjct  564   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVNGEEIVSASTDSQLKLWNVNKTHCLRSFKGH  623

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  ++CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  624   INEKNFVGLA--SNGDYVACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDKKEDDTN  681

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  682   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  712



>ref|XP_006829490.1| hypothetical protein AMTR_s00074p00101590 [Amborella trichopoda]
 gb|ERM96906.1| hypothetical protein AMTR_s00074p00101590 [Amborella trichopoda]
Length=686

 Score =   165 bits (418),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 109/325 (34%), Positives = 176/325 (54%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +++V+      E +D     H    +  + 
Sbjct  382   ANIVSSIEFDRDDELFATAGVSRRIKVFEFSTVVN------EPADV----HCPVVE--MS  429

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +N   + S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  430   TRSKLSCLSWNK-YNKSHIASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTEP  487

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +CCV+++P +   +A G AD   +
Sbjct  488   SMLVSGSDDCKVKVW---CTKQE--ASVLNIDMKANICCVKYNPGSSIYVAVGSADHHIH  542

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD +    VRT+KGH N
Sbjct  543   YYDLRNISAPVHVFSGHSKAVSYVKFLSTNELASASTDSTLRLWDVNENCAVRTFKGHTN  602

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSA---TGQPGSENGFISS  1105
                FVGL+V  N   I+CGSE N+VFVY     +P   +   S+        + + FIS+
Sbjct  603   EKNFVGLTV--NSEYIACGSETNEVFVYHKAISKPAAWHRFGSSEVDDSDDDAASHFISA  660

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  661   VCW---KSDSPTMLTANSQGTIKVL  682



>ref|XP_010487353.1| PREDICTED: protein SPA1-RELATED 3-like [Camelina sativa]
Length=847

 Score =   167 bits (422),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 124/332 (37%), Positives = 179/332 (54%), Gaps = 35/332 (11%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  L FD      AT G+ +KI+++  NS+V+   ++D     V L   S       
Sbjct  536   SNLVCALAFDRDGELFATAGVNKKIKIFECNSIVNN--NRDIHYPVVELAGRS-------  586

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
                K+SSLRW     S++  S ++DGVV  +D+ R   V E  EH  +RVWS+D S +D 
Sbjct  587   ---KVSSLRWNSYIKSQI-ASSNFDGVVQIWDVSRSQLVTEMKEHK-KRVWSIDISSADP  641

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQF-SPFAPSIAAGCADRKTY  754
              + ASGSDDGT++ W      G  + T+   K ++ +CCVQF S    S+A G AD K Y
Sbjct  642   TLLASGSDDGTVKLWS--INQGASIGTI---KTKANICCVQFPSDSGRSLAFGSADHKVY  696

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTD------HRNLVRT  916
              YDLRN   PL  + GH K V+Y +F+D  T+++SS D  +K+WD        +   + +
Sbjct  697   YYDLRNPKIPLCTMVGHSKTVSYVKFVDSSTLVSSSTDNTLKLWDLSLSASGINETPLHS  756

Query  917   YKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE---  1087
             + GH N   FVGLSV  + G I+ GSE N+VFVY   +  P+  Y   +     G E   
Sbjct  757   FTGHTNLKNFVGLSV--SDGYIATGSETNEVFVYHKAFPMPVMSYMFNNTDSVSGLEVDD  814

Query  1088  -NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
              + FISS+CW  RG    TLVA  S+G +++ 
Sbjct  815   ASQFISSICW--RGQS-STLVAANSNGNIKIL  843



>ref|XP_004476732.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2-like isoform 5 [Dasypus 
novemcinctus]
Length=433

 Score =   162 bits (411),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 179/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  123   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQ---------DAVDIHYP---ENEMT  170

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  171   CNSKISCISWS-SYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  226

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  227   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  281

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  282   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  341

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  342   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  399

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  400   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  430



>ref|XP_007061226.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X1 [Chelonia 
mydas]
Length=590

 Score =   164 bits (416),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 122/385 (32%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  231   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  285

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C  +K+S
Sbjct  286   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYPE--NEMTCN-SKIS  333

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  334   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  389

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  390   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  444

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  445   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNIGKPHCLRSFKGHINEKNF  504

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  505   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  562

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  563   CWRALPDGESNVLIAANSQGTIKVL  587



>ref|XP_009671007.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Struthio camelus 
australis]
Length=590

 Score =   164 bits (416),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSD------ALGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  231   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  285

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  +   +K+S
Sbjct  286   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYP---ENEMTCNSKIS  333

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  334   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  389

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  390   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  444

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  445   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  504

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  505   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  562

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  563   CWRALPDGESNVLIAANSQGTIKVL  587



>ref|XP_009437065.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X5 [Pan 
troglodytes]
 ref|XP_009437073.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X5 [Pan 
troglodytes]
Length=483

 Score =   163 bits (413),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 180/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY  ++++          DAV + +    +  + 
Sbjct  173   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQ---------DAVDIHYP---ENEMT  220

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  221   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  276

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  277   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  331

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  332   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  391

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  392   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  449

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  450   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  480



>ref|XP_005019367.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Anas platyrhynchos]
Length=603

 Score =   165 bits (417),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 122/385 (32%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  244   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  298

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C  +K+S
Sbjct  299   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYPE--NEMTCN-SKIS  346

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  347   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  402

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  403   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  457

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  458   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  517

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  518   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  575

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  576   CWRALPDGESNVLIAANSQGTIKVL  600



>ref|XP_008932171.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Manacus vitellinus]
 ref|XP_009891153.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Charadrius vociferus]
Length=590

 Score =   164 bits (416),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSD------ALGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  231   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  285

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  +   +K+S
Sbjct  286   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYP---ENEMTCNSKIS  333

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  334   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  389

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  390   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  444

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  445   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  504

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  505   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  562

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  563   CWRALPDGESNVLIAANSQGTIKVL  587



>ref|XP_005490281.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2, partial [Zonotrichia 
albicollis]
Length=595

 Score =   164 bits (416),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 122/385 (32%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  236   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  290

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C  +K+S
Sbjct  291   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYPE--NEMTCN-SKIS  338

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  339   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  394

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  395   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  449

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  450   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  509

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  510   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  567

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  568   CWRALPDGESNVLIAANSQGTIKVL  592



>ref|NP_001273573.1| E3 ubiquitin-protein ligase RFWD2 isoform c precursor [Homo sapiens]
Length=491

 Score =   163 bits (413),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 180/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY  ++++          DAV + +    +  + 
Sbjct  181   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQ---------DAVDIHYP---ENEMT  228

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  229   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  284

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  285   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  339

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  340   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  399

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  400   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  457

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  458   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  488



>ref|XP_007901206.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Callorhinchus milii]
Length=694

 Score =   165 bits (418),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 181/331 (55%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   +F A  G+ ++I+V+   +++          DAV + +    +   C
Sbjct  384   SSIVSSIEFDRDCDFFAIAGVTKRIKVFEYGNVI---------QDAVDIHY--PVNEMTC  432

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  433   N-SKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  487

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  488   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPTSMYHLAFGCADHC  542

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+ +  + +R++KGH
Sbjct  543   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVNKPHCLRSFKGH  602

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  603   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKEKKEDDTN  660

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  661   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  691



>ref|XP_006406987.1| hypothetical protein EUTSA_v10020057mg [Eutrema salsugineum]
 gb|ESQ48440.1| hypothetical protein EUTSA_v10020057mg [Eutrema salsugineum]
Length=845

 Score =   166 bits (421),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 124/332 (37%), Positives = 180/332 (54%), Gaps = 35/332 (11%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S+ +  L FD    FLAT G+ +KI+++  NS+V+   ++D     V L           
Sbjct  534   SNLVCALAFDRDGEFLATAGVNKKIKIFECNSIVND--NRDIHYPVVEL----------A  581

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             + +KLSS+ W     S++  S +++GVV  +D+ R   V E  EH  +RVWS+D S +D 
Sbjct  582   SRSKLSSVCWNSYIKSQI-ASSNFEGVVQIWDVARSQLVTEMKEHK-KRVWSIDISSADP  639

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQF-SPFAPSIAAGCADRKTY  754
              + ASGSDDGT++ W      G  + T+   K ++ VCCVQF S    S+A G AD K Y
Sbjct  640   TLLASGSDDGTVKLWS--INQGVSIGTI---KTKANVCCVQFPSDSGRSLAFGSADHKVY  694

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTD------HRNLVRT  916
              YDLRN   PL  + GH K V+Y +F+D  T+++SS D  +K+WD            + +
Sbjct  695   YYDLRNPKIPLCTMIGHSKTVSYVKFVDSSTLVSSSTDNTLKLWDLSMSASGVSETPLHS  754

Query  917   YKGHINTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSE---  1087
             + GH N   FVGLSV  + G I+ GSE N+VFVY   +  P+  Y   +     G E   
Sbjct  755   FAGHTNLKNFVGLSV--SDGYIATGSETNEVFVYHKAFPMPVMSYMFNNTESASGLESDD  812

Query  1088  -NGFISSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
              + FISS+CW  RG    TLVA  S+G +++ 
Sbjct  813   ASQFISSICW--RGQS-STLVAANSNGNIKIL  841



>ref|XP_010035503.1| PREDICTED: E3 ubiquitin-protein ligase COP1 [Eucalyptus grandis]
 gb|KCW46922.1| hypothetical protein EUGRSUZ_K00737 [Eucalyptus grandis]
Length=687

 Score =   165 bits (417),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 106/326 (33%), Positives = 176/326 (54%), Gaps = 28/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +++V+      E +D     H    +  + 
Sbjct  383   ANIVSSIEFDRDDELFATAGVSRRIKVFDFSTVVN------EPTDV----HCPVVE--MT  430

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D++ R  + E +EH  +R WSVD+S ++ 
Sbjct  431   TRSKLSCLSWN-KYAKNHIASSDYEGIVTVWDVDTRQSLMEYEEHE-KRAWSVDFSRTEP  488

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  489   SMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNHIAVGSADHHIH  543

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  544   YYDLRNISQPLHVFTGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENLPVRTFRGHTN  603

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   I+CGSE N+V+VY     + +  +   S       ++    FIS+
Sbjct  604   EKNFVGLTV--NSEYIACGSETNEVYVYHKEISKHVTSHKFGSPDPDDPDDDAGSYFISA  661

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVFA  1183
             VCW     D  T++   S G ++V  
Sbjct  662   VCW---KSDSPTMLTANSQGTIKVLV  684



>ref|NP_001145835.1| uncharacterized protein LOC100279342 [Zea mays]
 gb|ACL52681.1| unknown [Zea mays]
 gb|AFW64314.1| hypothetical protein ZEAMMB73_321715 [Zea mays]
Length=655

 Score =   165 bits (417),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 178/326 (55%), Gaps = 32/326 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++++I+V+  +++V+      E SD     H    +  + 
Sbjct  351   ANIVSSIEFDRDDELFATAGVSKRIKVFEFSTVVN------EPSDV----HCPVVE--MA  398

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   ++  ++ S DY+G+V  +D++ R  V E +EH  +R WSVD+S ++ 
Sbjct  399   TRSKLSCLSWN-KYSKNIIASSDYEGIVTVWDVQTRQSVMEYEEHE-KRAWSVDFSRTEP  456

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +C V+++P +   +A G AD   +
Sbjct  457   SMLVSGSDDCKVKVW---CTKQE--ASVINIDMKANICSVKYNPGSSFYVAVGSADHHIH  511

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              +DLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  512   YFDLRNPSAPVHVFGGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHKN  571

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS-----ATGQPGSENGFI  1099
                FVGLSV  N   I+CGSE N+VFVY     +P   +   S     A   PGS   FI
Sbjct  572   EKNFVGLSV--NNEYIACGSETNEVFVYHKAISKPAASHRFVSSNLDDADDDPGS--YFI  627

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRV  1177
             S+VCW     D  T++A  S G ++V
Sbjct  628   SAVCW---KSDSPTMLAANSQGTIKV  650



>gb|ADL59932.1| constitutively photomorphogenic 1 [Brassica napus]
Length=677

 Score =   165 bits (417),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 174/326 (53%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+      E +D         C    +
Sbjct  373   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVN------EPADI-------QCPIVEM  419

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  420   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  477

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   
Sbjct  478   PSMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNFIAVGSADHHI  532

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  533   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELESASTDSTLRLWDVKDNLPVRTFRGHT  592

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY     +P+  +   +   +   E     FIS
Sbjct  593   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITKPVTSHRFGALDMEEAEEEAGSYFIS  650

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  651   AVCW---KSDSPTMLTANSQGTIKVL  673



>ref|XP_008634343.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Corvus brachyrhynchos]
Length=634

 Score =   165 bits (417),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 122/385 (32%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSD------ALGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  275   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  329

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C  +K+S
Sbjct  330   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYPE--NEMTCN-SKIS  377

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  378   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  433

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  434   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  488

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  489   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  548

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  549   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  606

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  607   CWRALPDGESNVLIAANSQGTIKVL  631



>gb|KFK31097.1| e3 ubiquitin-protein ligase cop1 [Arabis alpina]
Length=673

 Score =   165 bits (417),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 106/325 (33%), Positives = 171/325 (53%), Gaps = 29/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R I+V+  +S+V+   + D     V +           
Sbjct  370   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVN---EPDTQCPIVEMS----------  416

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++ 
Sbjct  417   TRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTEP  474

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   +
Sbjct  475   SMLVSGSDDCKVKVWCTRQE-----ASVLNIDMKANICCVKYNPGSSNYIAVGSADHHIH  529

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  530   YYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTN  589

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FISS  1105
                FVGL+V  N   ++CGSE N+V+VY      P+  +   +       E     FIS+
Sbjct  590   EKNFVGLTV--NSEYLACGSETNEVYVYHKEITRPVTSHRFGAPEMDDAEEEAGSYFISA  647

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  648   VCW---KSDSPTMLTANSQGTIKVL  669



>ref|XP_007451425.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X3 [Lipotes 
vexillifer]
 ref|XP_007451426.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X4 [Lipotes 
vexillifer]
Length=471

 Score =   163 bits (412),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 179/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  161   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQ---------DAVDIHYP---ENEMT  208

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  209   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  264

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  265   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  319

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  320   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  379

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  380   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  437

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  438   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  468



>ref|XP_002270330.2| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Vitis vinifera]
Length=687

 Score =   165 bits (417),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 173/325 (53%), Gaps = 28/325 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++R+I+V+  +S+V+      E +D     H    +  + 
Sbjct  383   ANIVSSIEFDRDDELFATAGVSRRIKVFEFSSVVN------EPADV----HCPVVE--MS  430

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   +    + S DY+G+V  +D+  R  V E +EH  +R WSVD+S ++ 
Sbjct  431   TRSKLSCLSWNK-YTKNHIASSDYEGIVTVWDVTTRQSVMEYEEHE-KRAWSVDFSRTEP  488

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +C V+++P +   +A G AD   +
Sbjct  489   SMLVSGSDDCKVKIW---CTKQE--ASVLNIDMKANICSVKYNPGSSIYVAVGSADHHIH  543

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  544   YYDLRNISQPLHVFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENMPVRTFRGHSN  603

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEP-IWVYGCKSATGQPGSENG--FISS  1105
                FVGL+V  N   I+CGSE N+VF Y     +P  W     S       +NG  FIS+
Sbjct  604   EKNFVGLTV--NSEYIACGSETNEVFAYHKAISKPAAWHRFGSSDLDDTDDDNGSYFISA  661

Query  1106  VCWMQRGDDHCTLVAGGSDGVLRVF  1180
             VCW     D  T++   S G ++V 
Sbjct  662   VCW---KSDSPTMLTANSQGTIKVL  683



>ref|XP_005429687.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2, partial [Geospiza 
fortis]
Length=597

 Score =   164 bits (416),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 122/385 (32%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  238   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  292

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C  +K+S
Sbjct  293   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYPE--NEMTCN-SKIS  340

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  341   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  396

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  397   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  451

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  452   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  511

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  512   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  569

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  570   CWRALPDGESNVLIAANSQGTIKVL  594



>ref|XP_008493077.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Calypte anna]
Length=624

 Score =   164 bits (416),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 122/385 (32%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  265   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  319

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C  +K+S
Sbjct  320   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYPE--NEMTCN-SKIS  367

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  368   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  423

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  424   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  478

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  479   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  538

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  539   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  596

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  597   CWRALPDGESNVLIAANSQGTIKVL  621



>ref|XP_010226923.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Tinamus guttatus]
Length=629

 Score =   164 bits (416),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 122/385 (32%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  270   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  324

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C  +K+S
Sbjct  325   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYPE--NEMTCN-SKIS  372

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  373   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  428

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  429   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  483

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  484   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  543

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  544   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  601

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  602   CWRALPDGESNVLIAANSQGTIKVL  626



>ref|XP_010365697.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X5 [Rhinopithecus 
roxellana]
Length=491

 Score =   163 bits (413),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 179/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  181   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQ---------DAVDIHYP---ENEMT  228

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  229   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  284

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  285   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  339

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  340   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  399

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  400   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  457

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  458   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  488



>ref|NP_001016199.1| ring finger and WD repeat domain 2, E3 ubiquitin protein ligase 
[Xenopus (Silurana) tropicalis]
 emb|CAJ82063.1| ring finger and WD repeat domain 2 [Xenopus (Silurana) tropicalis]
 gb|AAI70678.1| ring finger and WD repeat domain 2 [Xenopus (Silurana) tropicalis]
Length=684

 Score =   165 bits (417),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 110/331 (33%), Positives = 181/331 (55%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C
Sbjct  374   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQ---------DAVDIHYPE--NEMTC  422

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  VL S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  423   N-SKISCISWS-SYHKNVLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  477

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  478   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  532

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F++   ++++S D  +K+W+    + +R++KGH
Sbjct  533   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVNGDEIVSASTDSQLKLWNVSRPHCLRSFKGH  592

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  593   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  650

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  651   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  681



>gb|KFP90040.1| E3 ubiquitin-protein ligase RFWD2, partial [Apaloderma vittatum]
Length=594

 Score =   164 bits (416),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 122/384 (32%), Positives = 203/384 (53%), Gaps = 45/384 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  236   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  290

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C  +K+S
Sbjct  291   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYPE--NEMTCN-SKIS  338

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  339   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  394

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  395   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  449

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  450   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  509

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  510   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  567

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRV  1177
             CW    D +   L+A  S G ++V
Sbjct  568   CWRALPDGESNVLIAANSQGTIKV  591



>ref|XP_006017764.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X1 [Alligator 
sinensis]
 ref|XP_006017765.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X2 [Alligator 
sinensis]
Length=590

 Score =   164 bits (416),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 202/385 (52%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T   + S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  231   FSTRMTRVTDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  285

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  +   +K+S
Sbjct  286   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYP---ENEMTCNSKIS  333

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  334   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  389

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  390   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  444

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  445   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  504

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  505   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  562

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  563   CWRALPDGESNVLIAANSQGTIKVL  587



>ref|XP_004658823.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X1 [Jaculus 
jaculus]
Length=564

 Score =   164 bits (415),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 109/331 (33%), Positives = 179/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  254   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYP---ENEMT  301

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  302   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  357

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  358   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  412

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  413   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  472

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  473   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  530

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D D   L+A  S G ++V 
Sbjct  531   EFVSAVCWRALPDGDSNVLIAANSQGTIKVL  561



>ref|XP_008677082.1| PREDICTED: uncharacterized protein LOC100279342 isoform X1 [Zea 
mays]
Length=686

 Score =   165 bits (417),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 178/326 (55%), Gaps = 32/326 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++++I+V+  +++V+      E SD     H    +  + 
Sbjct  382   ANIVSSIEFDRDDELFATAGVSKRIKVFEFSTVVN------EPSDV----HCPVVE--MA  429

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   ++  ++ S DY+G+V  +D++ R  V E +EH  +R WSVD+S ++ 
Sbjct  430   TRSKLSCLSWN-KYSKNIIASSDYEGIVTVWDVQTRQSVMEYEEHE-KRAWSVDFSRTEP  487

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTY  754
              +  SGSDD  ++ W   C      A+V     ++ +C V+++P +   +A G AD   +
Sbjct  488   SMLVSGSDDCKVKVW---CTKQE--ASVINIDMKANICSVKYNPGSSFYVAVGSADHHIH  542

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              +DLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  543   YFDLRNPSAPVHVFGGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHKN  602

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKS-----ATGQPGSENGFI  1099
                FVGLSV  N   I+CGSE N+VFVY     +P   +   S     A   PGS   FI
Sbjct  603   EKNFVGLSV--NNEYIACGSETNEVFVYHKAISKPAASHRFVSSNLDDADDDPGS--YFI  658

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRV  1177
             S+VCW     D  T++A  S G ++V
Sbjct  659   SAVCW---KSDSPTMLAANSQGTIKV  681



>gb|AAK49415.1|AF261992_1 COP1, partial [Oryza sativa Indica Group]
Length=519

 Score =   164 bits (414),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 111/327 (34%), Positives = 175/327 (54%), Gaps = 32/327 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             ++ +  +EFD  D   AT G++++I+V+  +++V+      E SD     H    +  + 
Sbjct  215   ANIVSSIEFDRDDELFATAGVSKRIKVFEFSTVVN------EPSDV----HCPVVE--MA  262

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsds  577
             T +KLS L W   ++  V+ S DY+G+V  +D++ R  V E +EH  +R WSVD+S ++ 
Sbjct  263   TRSKLSCLSWN-KYSKNVIASSDYEGIVTVWDVQTRQSVMEYEEHE-KRAWSVDFSRTEP  320

Query  578   vvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKTY  754
              +  SGSDD  ++ W   C      A     KA   +C V+++P +   +A G AD   +
Sbjct  321   SMLVSGSDDCKVKVW---CTKQEASAINIDMKAN--ICSVKYNPGSSHYVAVGSADHHIH  375

Query  755   TYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHIN  934
              +DLRN + P+ +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH N
Sbjct  376   YFDLRNPSAPVHVFGGHKKAVSYVKFLSTNELASASTDSTLRLWDVKENCPVRTFRGHKN  435

Query  935   TTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSA-----TGQPGSENGFI  1099
                FVGLSV  N   I+CGSE N+VFVY     +P   +   S+        PGS   FI
Sbjct  436   EKNFVGLSV--NNEYIACGSETNEVFVYHKAISKPAANHRFVSSDLDDADDDPGS--YFI  491

Query  1100  SSVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             S+VCW     D  T++   S G ++V 
Sbjct  492   SAVCW---KSDSPTMLTANSQGTIKVL  515



>ref|XP_005867753.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Myotis brandtii]
 ref|XP_007451423.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X1 [Lipotes 
vexillifer]
 ref|XP_008520330.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X2 [Equus 
przewalskii]
 ref|XP_009193234.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X6 [Papio 
anubis]
Length=491

 Score =   163 bits (412),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 179/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  181   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQ---------DAVDIHYP---ENEMT  228

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  229   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  284

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  285   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  339

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+      +R++KGH
Sbjct  340   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGH  399

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  400   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  457

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  458   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  488



>emb|CDQ56465.1| unnamed protein product [Oncorhynchus mykiss]
Length=712

 Score =   165 bits (417),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 120/385 (31%), Positives = 204/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T   + S+ + Q +D  E   C   F R ++V   P + +   SD       +  
Sbjct  353   FSNRMTRLTDDSRNLNQLDDFME---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  407

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+V+   +++          DAV + +    +   C  +K+S
Sbjct  408   IEFDRDCDYFAIAGVTKKIKVFEYGTVI---------QDAVDIHY--PVNEMTCN-SKIS  455

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  456   CISWS-SYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  511

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  512   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPTSRYHLAFGCADHCVHYYDL  566

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F++   ++++S D  +K+W+ +  + +R++KGHIN   F
Sbjct  567   RNTKQPIMVFKGHRKAVSYAKFVNGEEIVSASTDSQLKLWNVNKPHCLRSFKGHINEKNF  626

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  ++CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  627   VGLA--SNGDYVACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDKKEDDTNEFVSAV  684

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  685   CWRAMPDGESNVLIAANSQGTIKVL  709



>ref|NP_180854.1| E3 ubiquitin-protein ligase COP1 [Arabidopsis thaliana]
 sp|P43254.2|COP1_ARATH RecName: Full=E3 ubiquitin-protein ligase COP1; AltName: Full=Constitutive 
photomorphogenesis protein 1 [Arabidopsis thaliana]
 gb|AAB91983.1| COP1 regulatory protein [Arabidopsis thaliana]
 gb|ABF57293.1| At2g32950 [Arabidopsis thaliana]
 gb|AEC08766.1| E3 ubiquitin-protein ligase COP1 [Arabidopsis thaliana]
Length=675

 Score =   165 bits (417),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 170/326 (52%), Gaps = 30/326 (9%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYY-I  394
             ++ +  +EFD  D   AT G++R I+V+  +S+V+   D               C    +
Sbjct  371   ANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQ-------------CPIVEM  417

Query  395   CTPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYDLERRVPVFERDEHGGRRVWSVDYshsd  574
              T +KLS L W     + +  S DY+G+V  +D+  R  + E +EH  +R WSVD+S ++
Sbjct  418   STRSKLSCLSWNKHEKNHI-ASSDYEGIVTVWDVTTRQSLMEYEEHE-KRAWSVDFSRTE  475

Query  575   svvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAPS-IAAGCADRKT  751
               +  SGSDD  ++ W  R       A+V     ++ +CCV+++P + + IA G AD   
Sbjct  476   PSMLVSGSDDCKVKVWCTRQE-----ASVINIDMKANICCVKYNPGSSNYIAVGSADHHI  530

Query  752   YTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHI  931
             + YDLRN ++PL +  GH KAV+Y +FL    + ++S D  +++WD      VRT++GH 
Sbjct  531   HYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHT  590

Query  932   NTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYGCKSATGQPGSENG---FIS  1102
             N   FVGL+V  N   ++CGSE N+V+VY      P+  +   S       E     FIS
Sbjct  591   NEKNFVGLTV--NSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFIS  648

Query  1103  SVCWMQRGDDHCTLVAGGSDGVLRVF  1180
             +VCW     D  T++   S G ++V 
Sbjct  649   AVCW---KSDSPTMLTANSQGTIKVL  671



>ref|XP_007667111.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X3 [Ornithorhynchus 
anatinus]
Length=567

 Score =   164 bits (415),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 180/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  257   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYP---ENEMT  304

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  305   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  360

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  361   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  415

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGH
Sbjct  416   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGH  475

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  476   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  533

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  534   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  564



>ref|XP_005501212.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 [Columba livia]
Length=616

 Score =   164 bits (416),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 122/385 (32%), Positives = 203/385 (53%), Gaps = 45/385 (12%)
 Frame = +2

Query  77    FSSSPTSAAETSQTIQQEEDDGEKARCDWDF-RISAVVSSPTSAVGAVSDA------LGV  235
             FS+  T  ++ S+T  Q ++  E   C   F R ++V   P + +   SD       +  
Sbjct  257   FSTRMTRVSDDSRTTSQLDEFQE---CLSKFTRYNSV--RPLATLSYASDLYNGSSIVSS  311

Query  236   LEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYICTPAKLS  415
             +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +   C  +K+S
Sbjct  312   IEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYPE--NEMTCN-SKIS  359

Query  416   SLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshsdsvvga  589
              + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  D  + A
Sbjct  360   CISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLMDPKLLA  415

Query  590   sgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRKTYTYDL  766
             SGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD   + YDL
Sbjct  416   SGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDL  470

Query  767   RNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGHINTTRF  946
             RNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGHIN   F
Sbjct  471   RNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGHINEKNF  530

Query  947   VGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---NGFISSV  1108
             VGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N F+S+V
Sbjct  531   VGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV  588

Query  1109  CWMQRGD-DHCTLVAGGSDGVLRVF  1180
             CW    D +   L+A  S G ++V 
Sbjct  589   CWRALPDGESNVLIAANSQGTIKVL  613



>ref|XP_006139401.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2 isoform X1 [Pelodiscus 
sinensis]
Length=590

 Score =   164 bits (415),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 180/331 (54%), Gaps = 33/331 (10%)
 Frame = +2

Query  218   SDALGVLEFDPSDNFLATGGIARKIRVYSVNSLVDPFWDQDEGSDAVSLDHSSACDYYIC  397
             S  +  +EFD   ++ A  G+ +KI+VY   +++          DAV + +    +  + 
Sbjct  280   SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVI---------QDAVDIHYP---ENEMT  327

Query  398   TPAKLSSLRWKPGWNSRVLGSGDYDGVVMEYD--LERRVPVFERDEHGGRRVWSVDYshs  571
               +K+S + W   ++  +L S DY+G V+ +D    +R  V++  E   +R WSVD++  
Sbjct  328   CNSKISCISW-SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHE---KRCWSVDFNLM  383

Query  572   dsvvgasgsddgTMQTWDPRCPNGNCLATVQPSKARSAVCCVQFSPFAP-SIAAGCADRK  748
             D  + ASGSDD  ++ W     N     +V   +A++ VCCV+FSP +   +A GCAD  
Sbjct  384   DPKLLASGSDDAKVKLWSTNLDN-----SVASIEAKANVCCVKFSPSSRYHLAFGCADHC  438

Query  749   TYTYDLRNTAEPLFILDGHLKAVTYARFLDRRTVLTSSVDGCIKMWDTDHRNLVRTYKGH  928
              + YDLRNT +P+ +  GH KAV+YA+F+    ++++S D  +K+W+    + +R++KGH
Sbjct  439   VHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPHCLRSFKGH  498

Query  929   INTTRFVGLSVWKNGGLISCGSENNQVFVYDTRWGEPIWVYG---CKSATGQPGSE---N  1090
             IN   FVGL+   NG  I+CGSENN +++Y     + +  +     KS   +   E   N
Sbjct  499   INEKNFVGLA--SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTN  556

Query  1091  GFISSVCWMQRGD-DHCTLVAGGSDGVLRVF  1180
              F+S+VCW    D +   L+A  S G ++V 
Sbjct  557   EFVSAVCWRALPDGESNVLIAANSQGTIKVL  587



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3923302955220