BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17195_g1_i2 len=510 path=[710:0-242 953:243-278 988:279-364
224:365-509]

Length=510
                                                                      Score     E

ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            84.0    1e-17   
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            82.0    5e-17   
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            80.5    2e-16   
dbj|BAA95697.1|  thionin like protein                                 79.7    4e-16   Nicotiana tabacum [American tobacco]
gb|AAS65426.1|  Kunitz-type trypsin inhibitor                         79.3    5e-16   Ipomoea batatas [batate]
gb|AAL35366.1|AF442388_1  defensin protein precursor                  77.8    2e-15   Capsicum annuum
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      76.3    7e-15   
gb|AIT42148.1|  defensin-like protein                                 75.1    2e-14   
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    73.9    5e-14   
ref|XP_003628979.1|  Defensin                                         73.9    5e-14   
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    73.6    6e-14   
ref|XP_004297787.1|  PREDICTED: defensin-like protein 2-like          73.6    8e-14   
gb|AIT42147.1|  defensin-like protein                                 73.6    8e-14   
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    73.2    8e-14   
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    72.4    1e-13   Vitis vinifera
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 72.4    2e-13   
gb|ACB32234.1|  gamma-thionin/defensin                                72.4    2e-13   Solanum chacoense
gb|ABO36637.1|  defensin protein                                      72.4    2e-13   Solanum lycopersicum
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       72.4    2e-13   
gb|ABO36641.1|  defensin protein                                      72.0    2e-13   Solanum pimpinellifolium [currant tomato]
ref|XP_004297786.1|  PREDICTED: defensin-like protein 2-like          71.6    4e-13   
ref|XP_004242750.1|  PREDICTED: defensin-like protein P322            71.6    4e-13   
ref|XP_009768914.1|  PREDICTED: defensin-like protein isoform X1      71.6    4e-13   
gb|AIT42152.1|  defensin-like protein                                 71.6    4e-13   
ref|XP_009792224.1|  PREDICTED: defensin-like protein P322            71.6    4e-13   
gb|ACJ26760.1|  protease inhibitor-related protein                    71.6    4e-13   Solanum tuberosum [potatoes]
gb|AFW90621.1|  protease inhibitor-related protein                    71.2    5e-13   
ref|XP_009769843.1|  PREDICTED: defensin-like protein P322            70.5    1e-12   
gb|AIT42153.1|  defensin-like protein                                 69.7    2e-12   
ref|XP_003629332.1|  Defensin                                         70.1    2e-12   
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               69.7    2e-12   
gb|AFK44299.1|  unknown                                               69.3    2e-12   
emb|CDP10468.1|  unnamed protein product                              69.3    3e-12   
ref|XP_003628978.1|  Defensin                                         68.9    3e-12   
gb|AIT42149.1|  defensin-like protein                                 68.6    5e-12   
ref|NP_176302.2|  defensin-like protein                               68.2    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28445.1|  unknown                                               68.2    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007156391.1|  hypothetical protein PHAVU_003G282500g           67.8    1e-11   
ref|NP_001234872.1|  gamma-thionin precursor                          66.6    2e-11   
gb|KHN06998.1|  Defensin-like protein                                 66.6    3e-11   
gb|ACV84379.1|  defensin precursor                                    66.2    3e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               65.9    4e-11   
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               65.9    4e-11   
gb|ADK87340.1|  defensin                                              65.5    6e-11   
ref|XP_009351645.1|  PREDICTED: defensin Ec-AMP-D2-like               65.1    7e-11   
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               65.1    7e-11   
gb|AAL85480.1|  defensin protein 1                                    65.1    8e-11   Prunus persica
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           65.1    8e-11   
ref|NP_178320.1|  defensin-like protein 4                             65.1    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 64.7    1e-10   
ref|XP_002886566.1|  protease inhibitor II                            64.7    1e-10   
gb|AAM62652.1|  protease inhibitor II                                 64.7    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               64.7    1e-10   
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           64.3    1e-10   
gb|ACN93800.1|  defensin precursor                                    64.3    2e-10   Vigna unguiculata
ref|NP_178321.1|  defensin-like protein 1                             63.9    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            63.9    2e-10   
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               63.9    2e-10   
sp|P20346.1|DF322_SOLTU  RecName: Full=Defensin-like protein P322...  63.5    3e-10   Solanum tuberosum [potatoes]
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               63.5    3e-10   
ref|XP_006647552.1|  PREDICTED: defensin-like protein P322-like       63.5    3e-10   
gb|AGT51229.1|  defensin                                              63.5    3e-10   
gb|AGT51227.1|  defensin                                              63.2    3e-10   
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         63.2    4e-10   
ref|XP_009354384.1|  PREDICTED: defensin Ec-AMP-D2-like               63.2    4e-10   
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            63.9    5e-10   
ref|XP_006359486.1|  PREDICTED: defensin-like protein-like            62.8    5e-10   
ref|XP_004242748.1|  PREDICTED: defensin-like protein                 62.8    6e-10   
ref|XP_009413079.1|  PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|P...  62.4    7e-10   
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               62.4    8e-10   
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  62.4    9e-10   Petunia integrifolia [violet-flowered petunia]
gb|KFK26328.1|  hypothetical protein AALP_AA8G233400                  62.0    9e-10   
emb|CDY48618.1|  BnaC09g20670D                                        62.0    9e-10   
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               62.0    1e-09   
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               61.6    1e-09   
ref|NP_178319.1|  defensin-like protein 2                             61.6    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003630422.1|  Defensin                                         61.6    1e-09   
gb|EYU30124.1|  hypothetical protein MIMGU_mgv1a017438mg              61.6    1e-09   
ref|XP_009599356.1|  PREDICTED: defensin-like protein                 61.6    2e-09   
ref|XP_004509603.1|  PREDICTED: defensin-like protein-like            61.6    2e-09   
ref|XP_009802655.1|  PREDICTED: defensin-like protein                 61.2    2e-09   
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         61.2    2e-09   
ref|XP_006392063.1|  hypothetical protein EUTSA_v10023787mg           61.2    2e-09   
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               61.2    2e-09   
gb|AGT51228.1|  defensin                                              60.8    3e-09   
gb|ACM90159.1|  low-molecular-weight cysteine-rich 69                 60.8    3e-09   Jatropha curcas
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           60.8    3e-09   
ref|NP_001047493.1|  Os02g0629800                                     60.8    3e-09   Oryza sativa Japonica Group [Japonica rice]
sp|P82659.1|DFSD2_HELAN  RecName: Full=Defensin SD2; AltName: Ful...  60.8    3e-09   Helianthus annuus
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 60.5    3e-09   
ref|XP_002468581.1|  hypothetical protein SORBIDRAFT_01g048380        60.5    4e-09   Sorghum bicolor [broomcorn]
ref|XP_004509602.1|  PREDICTED: defensin-1-like                       60.5    4e-09   
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       60.5    4e-09   
ref|XP_004509606.1|  PREDICTED: defensin J1-2-like                    60.1    4e-09   
emb|CAH58740.1|  defensin                                             60.1    5e-09   Plantago major [cart-track plant]
ref|XP_003630421.1|  Defensin                                         59.7    5e-09   
ref|XP_011070574.1|  PREDICTED: defensin J1-2-like                    59.7    6e-09   
ref|XP_004503912.1|  PREDICTED: defensin-like protein-like            59.7    6e-09   
gb|ACS96442.1|  defensin                                              59.7    7e-09   Jatropha curcas
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           59.7    8e-09   
gb|EAY86781.1|  hypothetical protein OsI_08161                        63.5    8e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               59.3    8e-09   
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           59.3    8e-09   
ref|NP_001048853.1|  Os03g0130300                                     59.3    9e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           59.3    1e-08   
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               59.3    1e-08   
ref|XP_004953175.1|  PREDICTED: defensin-like protein 2-like          58.9    1e-08   
gb|AFW58880.1|  low-molecular-weight cysteine-rich protein LCR70      58.9    1e-08   
ref|XP_007045354.1|  Defensin-like protein isoform 2                  58.5    1e-08   
gb|KHN23780.1|  Defensin SD2                                          58.5    2e-08   
gb|AIT42150.1|  defensin-like protein                                 58.2    2e-08   
ref|XP_011084089.1|  PREDICTED: defensin Ec-AMP-D2-like               58.2    2e-08   
ref|XP_006301968.1|  hypothetical protein CARUB_v10022448mg           58.2    2e-08   
gb|AAA91049.1|  protease inhibitor II                                 58.2    3e-08   Brassica rapa
gb|ABK93231.1|  unknown                                               57.8    3e-08   Populus trichocarpa [western balsam poplar]
sp|P82781.2|DEF03_ARATH  RecName: Full=Putative defensin-like pro...  57.8    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAL15885.1|AF417297_1  putative gamma-thionin                      57.8    3e-08   Castanea sativa
gb|KGN49760.1|  hypothetical protein Csa_5G114570                     57.8    3e-08   
gb|AFE88173.1|  g-thionin                                             57.8    3e-08   
emb|CEJ09690.1|  Defensin protein                                     57.8    3e-08   
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               57.8    3e-08   
ref|XP_003599384.1|  Defensin                                         57.8    3e-08   
ref|XP_008466730.1|  PREDICTED: defensin J1-2-like                    57.8    3e-08   
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            57.8    3e-08   
ref|XP_003628977.1|  Defensin                                         57.8    3e-08   
ref|NP_001234987.1|  protease inhibitor precursor                     57.4    4e-08   
gb|ABA81896.1|  putative defensin                                     57.4    4e-08   Aquilegia formosa
ref|XP_004985852.1|  PREDICTED: defensin SD2-like                     57.4    5e-08   
ref|XP_008389117.1|  PREDICTED: defensin Tk-AMP-D1.1-like             57.4    5e-08   
ref|XP_011001251.1|  PREDICTED: defensin-like protein 1               57.4    5e-08   
ref|NP_001149230.1|  LOC100282852 precursor                           57.0    6e-08   Zea mays [maize]
ref|XP_002513261.1|  8.4 kDa sulfur-rich protein precursor, putative  57.0    6e-08   Ricinus communis
ref|XP_008389118.1|  PREDICTED: defensin-like protein 1               57.0    6e-08   
dbj|BAK07043.1|  predicted protein                                    57.4    7e-08   
gb|AAG51654.1|AC018908_20  unknown protein; 87272-87105               56.2    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002325734.2|  defensin-like family protein                     56.6    7e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010319372.1|  PREDICTED: defensin Ec-AMP-D2-like               56.6    7e-08   
ref|XP_007226630.1|  hypothetical protein PRUPE_ppa022845mg           56.6    9e-08   
gb|ACV84384.1|  defensin precursor                                    56.6    9e-08   Triticum turgidum subsp. durum
ref|XP_007156390.1|  hypothetical protein PHAVU_003G282400g           56.2    1e-07   
gb|EMS65298.1|  Defensin-like protein 1                               56.6    1e-07   
gb|EMS49334.1|  Defensin-like protein                                 56.2    1e-07   
ref|XP_006292846.1|  hypothetical protein CARUB_v10019106mg           56.2    1e-07   
ref|XP_010671291.1|  PREDICTED: defensin Ec-AMP-D2-like               56.2    1e-07   
ref|XP_006394251.1|  hypothetical protein EUTSA_v10005235mg           55.8    1e-07   
dbj|BAK07823.1|  predicted protein                                    56.6    1e-07   
sp|O65740.1|DEF2_CAPAN  RecName: Full=Defensin J1-2; Flags: Precu...  55.8    1e-07   Capsicum annuum
ref|XP_003562142.1|  PREDICTED: defensin Ec-AMP-D1-like               55.8    1e-07   
ref|XP_003575412.1|  PREDICTED: defensin Tm-AMP-D1.2-like             55.8    2e-07   
gb|ADQ43196.1|  unknown                                               55.5    2e-07   
ref|XP_011001252.1|  PREDICTED: defensin-like protein 1               55.5    2e-07   
gb|AFJ04517.1|  low-molecular-weight cysteine-rich 69                 55.5    2e-07   
ref|XP_002459605.1|  hypothetical protein SORBIDRAFT_02g007410        55.1    2e-07   Sorghum bicolor [broomcorn]
ref|XP_006367121.1|  PREDICTED: defensin J1-2-like                    55.1    3e-07   
ref|XP_006420697.1|  hypothetical protein CICLE_v10006362mg           55.1    3e-07   
ref|XP_009397593.1|  PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|P...  55.1    3e-07   
gb|AGC82207.1|  defensin                                              55.1    3e-07   
gb|AHA50470.1|  defensin-like protein 1                               54.7    3e-07   
ref|XP_004306561.1|  PREDICTED: defensin D2-like                      54.7    3e-07   
ref|XP_002865329.1|  hypothetical protein ARALYDRAFT_917107           55.1    3e-07   
gb|EMT00351.1|  Defensin-like protein                                 55.1    3e-07   
gb|ABS72000.1|  putative defensin protein 1                           54.3    3e-07   Olea europaea
ref|XP_010908980.1|  PREDICTED: defensin Ec-AMP-D1-like               54.7    4e-07   
ref|XP_002325735.1|  hypothetical protein POPTR_0019s00770g           54.7    4e-07   Populus trichocarpa [western balsam poplar]
emb|CDP10467.1|  unnamed protein product                              55.1    4e-07   
gb|ABA86587.1|  putative defensin 1                                   54.3    4e-07   Aquilegia chrysantha
gb|ABA86586.1|  putative defensin 1                                   54.3    4e-07   Aquilegia formosa
gb|ACG41256.1|  low-molecular-weight cysteine-rich protein LCR70 ...  54.3    5e-07   Zea mays [maize]
ref|XP_010260874.1|  PREDICTED: defensin D2-like                      54.3    6e-07   
gb|EYU40734.1|  hypothetical protein MIMGU_mgv11b023365mg             54.3    6e-07   
gb|KDP32807.1|  hypothetical protein JCGZ_12099                       54.3    6e-07   
gb|AIA66989.1|  defensin                                              54.3    6e-07   
ref|XP_007045353.1|  Defensin-like protein isoform 1                  53.9    6e-07   
ref|XP_009763849.1|  PREDICTED: defensin-like protein 1               53.9    6e-07   
ref|XP_002875116.1|  hypothetical protein ARALYDRAFT_904442           53.9    7e-07   
gb|ACV84381.1|  defensin precursor                                    53.9    7e-07   Triticum turgidum subsp. durum
ref|XP_010675152.1|  PREDICTED: defensin-like protein 1 isoform X1    53.9    8e-07   
gb|KEH35661.1|  Defensin                                              53.9    8e-07   
sp|P81571.1|DEFD2_SPIOL  RecName: Full=Defensin D2; AltName: Full...  53.1    8e-07   Spinacia oleracea
gb|EYU27578.1|  hypothetical protein MIMGU_mgv1a026683mg              53.5    1e-06   
ref|XP_007137817.1|  hypothetical protein PHAVU_009G158100g           54.7    1e-06   
gb|AAL14240.1|  proteinase inhibitor                                  52.8    1e-06   Musa acuminata [banana]
gb|EYU27577.1|  hypothetical protein MIMGU_mgv1a024490mg              53.1    1e-06   
gb|AIA67012.1|  defensin                                              53.5    1e-06   
ref|XP_003526900.1|  PREDICTED: defensin-like protein 6-like          53.1    1e-06   
ref|XP_004151187.1|  PREDICTED: defensin J1-2-like                    53.1    1e-06   
dbj|BAH29762.1|  defensin-like cystein-rich peptide                   53.1    1e-06   Torenia fournieri [bluewings]
gb|ABA86589.1|  putative defensin 1                                   52.8    1e-06   Aquilegia pyrenaica
ref|NP_178322.1|  defensin-like protein 10                            52.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ADK36631.1|  defensin-like protein                                 52.4    2e-06   
ref|XP_002459603.1|  hypothetical protein SORBIDRAFT_02g007390        52.8    2e-06   Sorghum bicolor [broomcorn]
gb|EMT22729.1|  Defensin Tk-AMP-D2                                    52.8    2e-06   
ref|NP_201171.1|  defensin-like protein 6                             52.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002459604.1|  hypothetical protein SORBIDRAFT_02g007400        52.8    2e-06   Sorghum bicolor [broomcorn]
gb|ABK23404.1|  unknown                                               52.8    2e-06   Picea sitchensis
ref|XP_006649329.1|  PREDICTED: defensin J1-2-like                    52.8    2e-06   
ref|XP_002864860.1|  predicted protein                                52.4    2e-06   
gb|AIA67000.1|  defensin                                              52.8    2e-06   
gb|ADB02899.1|  gamma-thionin PPT precursor defensin 1-like protein   52.8    2e-06   
gb|AFD01290.1|  defensin 3                                            52.4    2e-06   
ref|XP_009631841.1|  PREDICTED: defensin-like protein 1               52.0    2e-06   
ref|XP_010675153.1|  PREDICTED: defensin-like protein 1 isoform X2    52.0    3e-06   
gb|AIA66994.1|  defensin                                              52.4    3e-06   
gb|EMT06279.1|  Defensin-like protein 2                               52.0    3e-06   
ref|XP_009353671.1|  PREDICTED: defensin-like protein 2               52.4    3e-06   
gb|ADQ43197.1|  unknown                                               52.0    3e-06   
ref|XP_009353672.1|  PREDICTED: defensin-like protein 2               52.0    4e-06   
gb|ACI02057.1|  fabatin precursor                                     52.0    4e-06   Vicia faba [broad bean]
ref|XP_009101271.1|  PREDICTED: defensin-like protein 10              52.0    4e-06   
dbj|BAK06284.1|  predicted protein                                    52.4    4e-06   
ref|XP_008360020.1|  PREDICTED: defensin-like protein 2               52.0    4e-06   
gb|AFK47422.1|  unknown                                               51.6    4e-06   
ref|XP_009345992.1|  PREDICTED: defensin-like protein 2               52.0    4e-06   
emb|CAA62761.1|  putative gamma-thionin protein                       52.0    4e-06   Picea abies
ref|XP_011070576.1|  PREDICTED: defensin Ec-AMP-D1-like               51.6    5e-06   
ref|XP_009590912.1|  PREDICTED: defensin-like protein 1               50.8    7e-06   
ref|XP_008340512.1|  PREDICTED: defensin-like protein 1               51.2    8e-06   
ref|XP_007203247.1|  hypothetical protein PRUPE_ppa019504mg           51.2    8e-06   
emb|CDY39856.1|  BnaC02g42620D                                        50.8    8e-06   
gb|AIA67010.1|  defensin                                              50.8    9e-06   
dbj|BAC10287.1|  defensin                                             50.8    1e-05   Triticum aestivum [Canadian hard winter wheat]
emb|CEJ09689.1|  Defensin protein                                     50.8    1e-05   
ref|XP_004976261.1|  PREDICTED: defensin-like protein P322-like       50.8    1e-05   
gb|AAS13434.1|  defensin                                              50.1    1e-05   Nicotiana attenuata
gb|EMT03365.1|  Defensin-like protein 1                               50.8    1e-05   
ref|XP_008340513.1|  PREDICTED: defensin-like protein 1               50.8    1e-05   
gb|ABK25062.1|  unknown                                               50.8    1e-05   Picea sitchensis
gb|AIA67014.1|  defensin                                              50.4    1e-05   
ref|XP_009342667.1|  PREDICTED: defensin-like protein 2               50.4    1e-05   
ref|XP_008437687.1|  PREDICTED: defensin J1-2-like                    50.1    1e-05   
ref|XP_008793610.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X2    50.1    2e-05   
gb|ADK91098.1|  PCP17C2                                               49.7    2e-05   
gb|ACV84385.1|  defensin precursor                                    50.1    2e-05   Triticum turgidum subsp. durum
ref|XP_004976259.1|  PREDICTED: defensin-like protein-like            50.1    2e-05   
ref|XP_009355482.1|  PREDICTED: defensin Tk-AMP-D1.1-like             50.1    2e-05   
ref|XP_009389205.1|  PREDICTED: defensin Tk-AMP-D2-like               50.1    2e-05   
dbj|BAJ89304.1|  predicted protein                                    50.1    2e-05   
ref|XP_006367122.1|  PREDICTED: defensin J1-2-like                    49.7    2e-05   
gb|ACB20518.1|  defensin precursor                                    49.7    2e-05   Saccharum officinarum [noble cane]
ref|XP_007159918.1|  hypothetical protein PHAVU_002G278600g           49.7    2e-05   
ref|XP_009345976.1|  PREDICTED: defensin-like protein 2               49.7    2e-05   
gb|ABK21016.1|  unknown                                               49.7    3e-05   Picea sitchensis
gb|ABK23037.1|  unknown                                               49.7    3e-05   Picea sitchensis
ref|XP_009351647.1|  PREDICTED: defensin-like protein 1               49.7    3e-05   
gb|AHA50472.1|  defensin-like protein 5                               49.3    3e-05   
ref|XP_006586320.1|  PREDICTED: defensin-like protein-like            49.3    3e-05   
sp|Q43413.1|DEF1_CAPAN  RecName: Full=Defensin J1-1; Flags: Precu...  49.3    4e-05   Capsicum annuum
gb|AAW33979.1|  proteinase inhibitor SE60-like protein                48.9    4e-05   Ammopiptanthus mongolicus
ref|XP_008793609.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X1    49.3    4e-05   
ref|XP_009355481.1|  PREDICTED: defensin Tk-AMP-D1.1-like             49.3    4e-05   
ref|XP_003573542.1|  PREDICTED: defensin-like protein 3               49.3    4e-05   
dbj|BAB64929.1|  defensin-like protein                                49.3    4e-05   Pyrus pyrifolia [sha li]
gb|EMT16291.1|  Defensin SD2                                          49.3    4e-05   
gb|AAP80654.1|AF479035_1  proteinase inhibitor Rgpi9                  49.3    4e-05   Triticum aestivum [Canadian hard winter wheat]
gb|AIA66999.1|  defensin                                              48.9    4e-05   
ref|XP_008385108.1|  PREDICTED: defensin-like protein 2               48.9    4e-05   
ref|NP_001148158.1|  LOC100281766 precursor                           48.9    4e-05   Zea mays [maize]
gb|ACG25019.1|  low-molecular-weight cysteine-rich protein LCR69 ...  48.9    5e-05   Zea mays [maize]
ref|NP_001147001.1|  LOC100280611 precursor                           48.9    5e-05   Zea mays [maize]
gb|ABM89231.1|  defensin                                              48.9    5e-05   Setaria italica
gb|KHN09675.1|  Defensin-like protein                                 48.5    5e-05   
gb|AAG17880.1|AF293407_1  Kunitz trypsin inhibitor protein            48.5    5e-05   Phaseolus coccineus [scarlet runner bean]
ref|XP_007137816.1|  hypothetical protein PHAVU_009G158000g           48.5    5e-05   
gb|EMS65297.1|  Defensin SD2                                          48.5    5e-05   
emb|CAA79164.1|  seed-specific low molecular weight sulfur-rich p...  48.5    5e-05   Glycine max [soybeans]
gb|KHG09995.1|  Defensin-like protein 1                               48.5    6e-05   
ref|XP_004976260.1|  PREDICTED: defensin-like protein-like            48.9    6e-05   
ref|XP_007203287.1|  hypothetical protein PRUPE_ppa025677mg           48.9    6e-05   
gb|EMT03364.1|  Defensin SD2                                          48.5    6e-05   
ref|XP_010088525.1|  Defensin-like protein 2                          48.5    6e-05   
gb|ACV84382.1|  defensin precursor                                    48.5    6e-05   Triticum turgidum subsp. durum
ref|XP_011070575.1|  PREDICTED: defensin Ec-AMP-D2-like               48.5    6e-05   
ref|XP_011099999.1|  PREDICTED: defensin Ec-AMP-D2-like               48.5    6e-05   
gb|EMT22721.1|  Defensin Tk-AMP-D2                                    48.5    7e-05   
gb|ABX84377.1|  amylase inhibitor-like protein                        48.1    8e-05   Triticum aestivum [Canadian hard winter wheat]
gb|AHA50471.1|  defensin-like protein 4                               48.1    8e-05   
gb|ABX84378.1|  amylase inhibitor-like protein                        48.1    9e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007033370.1|  Scorpion toxin-like knottin superfamily protein  48.1    9e-05   
ref|XP_006410329.1|  hypothetical protein EUTSA_v10017942mg           48.1    9e-05   
gb|ACG30752.1|  low-molecular-weight cysteine-rich protein LCR69 ...  48.1    1e-04   
gb|AIA66992.1|  defensin                                              48.1    1e-04   
ref|XP_006409770.1|  hypothetical protein EUTSA_v10017555mg           47.8    1e-04   
ref|XP_009338353.1|  PREDICTED: defensin-like protein 2               48.1    1e-04   
ref|XP_007033927.1|  Scorpion toxin-like knottin superfamily protein  48.9    1e-04   
ref|XP_009351648.1|  PREDICTED: defensin-like protein 1               47.8    1e-04   
gb|EMS64594.1|  Defensin Tm-AMP-D1.2                                  47.8    1e-04   
sp|A4L7R8.1|DEF2_PINSY  RecName: Full=Defensin-2; Flags: Precursor    47.8    1e-04   
ref|XP_007202809.1|  hypothetical protein PRUPE_ppa014119mg           47.8    1e-04   
ref|XP_007202934.1|  hypothetical protein PRUPE_ppa016748mg           47.8    1e-04   
ref|XP_006295860.1|  hypothetical protein CARUB_v10024990mg           47.4    2e-04   
gb|AAR84643.1|  defensin                                              47.4    2e-04   
gb|KGN62247.1|  hypothetical protein Csa_2G340400                     47.8    2e-04   
gb|AHA50468.1|  defensin-like protein 2                               47.4    2e-04   
gb|AIC35288.1|  defensin 4                                            47.4    2e-04   
gb|AIA66987.1|  defensin                                              47.4    2e-04   
ref|XP_007204040.1|  hypothetical protein PRUPE_ppa021088mg           47.0    2e-04   
gb|ACV84380.1|  defensin precursor                                    47.4    2e-04   
gb|EMS52097.1|  Defensin Tk-AMP-D1                                    47.4    2e-04   
ref|XP_002272913.2|  PREDICTED: defensin-like protein 1 isoform X1    47.0    2e-04   
ref|XP_004503015.1|  PREDICTED: defensin-like protein 6-like isof...  47.0    2e-04   
ref|XP_009780051.1|  PREDICTED: defensin-like protein 1               47.0    2e-04   
gb|AIA66990.1|  defensin                                              47.0    2e-04   
gb|EMT02837.1|  Defensin J1-2                                         47.0    2e-04   
ref|XP_010653029.1|  PREDICTED: defensin-like protein 1 isoform X2    46.6    3e-04   
ref|XP_007159919.1|  hypothetical protein PHAVU_002G278700g           46.6    3e-04   
gb|AIA66993.1|  defensin                                              47.0    3e-04   
ref|XP_007202863.1|  hypothetical protein PRUPE_ppa015550mg           47.0    3e-04   
ref|XP_002452484.1|  hypothetical protein SORBIDRAFT_04g026670        47.0    3e-04   
gb|EMT22726.1|  Defensin Tm-AMP-D1.2                                  47.0    3e-04   
gb|AHA50473.1|  defensin-like protein 6                               46.6    3e-04   
sp|P81457.1|DEF2_VICFA  RecName: Full=Defensin-like protein 2; Al...  46.2    3e-04   
gb|AAU04859.1|  defensin precursor                                    46.6    4e-04   
ref|NP_001052199.1|  Os04g0189400                                     47.0    4e-04   
ref|XP_008240819.1|  PREDICTED: defensin Ec-AMP-D1-like               46.2    4e-04   
ref|XP_004147317.1|  PREDICTED: defensin-like protein-like            46.2    4e-04   
emb|CAN69975.1|  hypothetical protein VITISV_020776                   46.2    5e-04   
gb|EEC76838.1|  hypothetical protein OsI_14993                        46.2    5e-04   
ref|XP_004503014.1|  PREDICTED: defensin-like protein 6-like isof...  46.2    5e-04   
gb|ADK91116.1|  PCP17C2                                               45.8    5e-04   
sp|A4L7R7.1|DEF1_PINSY  RecName: Full=Defensin-1; Flags: Precursor    46.2    5e-04   
gb|ABK20960.1|  unknown                                               46.2    5e-04   
emb|CAD41436.1|  OSJNBa0019D11.21                                     45.8    5e-04   
gb|KHN16909.1|  Defensin J1-2                                         45.8    6e-04   
gb|EMT22728.1|  Defensin Tm-AMP-D1.2                                  45.8    6e-04   
ref|XP_006384382.1|  hypothetical protein POPTR_0004s14520g           45.8    6e-04   
ref|XP_010228361.1|  PREDICTED: defensin Tk-AMP-D1.1-like             45.8    7e-04   
emb|CAA65045.1|  defensin                                             45.4    7e-04   
gb|AFQ69079.1|  defensin precursor                                    45.8    7e-04   
gb|EMT11359.1|  Defensin-like protein P322                            45.4    7e-04   
emb|CDY04774.1|  BnaC05g18150D                                        46.6    8e-04   
emb|CDO99915.1|  unnamed protein product                              45.8    8e-04   
ref|XP_002446801.1|  hypothetical protein SORBIDRAFT_06g022870        45.4    0.001   
gb|AIA67004.1|  defensin                                              45.4    0.001   
emb|CEJ09688.1|  Defensin protein                                     45.4    0.001   



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R F  VLL  +++MATEMG  T   + EA++C   S +F+ PC     C A C+ 
Sbjct  1    MAKSMRFFATVLLLAMLVMATEMGPMT---IAEARRCESKSQRFRGPCVREKNCAAVCET  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G+ RRC+C RPC
Sbjct  58   EGFSGGDCRGLRRRCFCTRPC  78



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA+S+R F  VLL  +++MATEMG  T   + EA+ C   S +FK PC     C   C  
Sbjct  1    MANSMRFFATVLLIALLVMATEMGPMT---IAEARTCESQSHRFKGPCSRDSNCATVCLT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G  RRC+C RPC
Sbjct  58   EGFSGGDCRGFRRRCFCTRPC  78



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R F  VLL  I+ MATEMG  T   + EA+ C   S +F+  C     C A C+ 
Sbjct  1    MAKSMRFFATVLLLAILFMATEMGPMT---IAEARHCESQSQRFRGLCVREKNCAAVCET  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G+ RRC+C RPC
Sbjct  58   EGFSGGDCRGLRRRCFCTRPC  78



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA+S+R F  VLL  +++ ATEMG  T   + EA+ C   S +FK PC     C   C  
Sbjct  1    MANSMRFFATVLLIALLVTATEMGPMT---IAEARTCESQSHRFKGPCSRDSNCATVCLT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G  RRC+C RPC
Sbjct  58   EGFSGGDCRGFRRRCFCTRPC  78



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +2

Query  44   FVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITR  223
            FV++ MATE+GTN  IMV EA+ C   SSKFK PC     C   C  EGF  GDCKG  R
Sbjct  14   FVMLFMATELGTNR-IMVAEARMCESASSKFKGPCSRDSNCATVCHTEGFTGGDCKGFRR  72

Query  224  RCYCIRPC  247
            RC+C +PC
Sbjct  73   RCFCTKPC  80



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R F  VLL  +++MATEMG    + + EA+ C   S +FK  C     C + C+ 
Sbjct  1    MAHSMRFFAIVLLLAMLVMATEMGP---MRIVEARTCESQSHRFKGVCASETNCASVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G  RRC+C RPC
Sbjct  58   EGFSGGDCRGFRRRCFCTRPC  78



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + V L ++++ ATEMG    IMV EA+ C   S +FK  C     C + C  
Sbjct  2    MRRSMRLLSTVFLLLMVVFATEMGP---IMVAEARNCESQSQRFKGVCVSNRNCASVCNT  58

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP+G CKG+ RRC+C+R C
Sbjct  59   EGFPDGKCKGLRRRCFCLRNC  79



>gb|AIT42148.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R FT V L  +++MATEMG    + + EA+ C   S +FK PC     C + C+ 
Sbjct  1    MAHSMRFFTTVFLLAMIVMATEMGP---MRIAEARNCESLSHRFKGPCTRDSNCASVCET  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G+C G  RRC+C +PC
Sbjct  58   ERFSGGNCHGFRRRCFCTKPC  78



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 46/81 (57%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA   + F  V L +++I ATEMGT    MV EA+ C   S +FK PC     C A C+ 
Sbjct  1    MAGFKKLFATVFLMLMLIFATEMGT----MVAEARTCESQSHRFKGPCVRKSNCAAVCQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C + C
Sbjct  57   EGFHGGHCRGFRRRCFCTKHC  77



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA SL   + + +F ++++ATEMG    IMV EA+ C  PS+ FK  C     C + C+ 
Sbjct  1    MARSLPLVSTIFVFFLLLVATEMGP---IMVAEARTCETPSNNFKGLCVSDTNCASVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP G C+G  +RC+C +PC
Sbjct  58   EGFPGGHCEGFRQRCFCTKPC  78



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA   + F  V L ++++ ATEMGT    MV +A+ C   S +FK PC     C A C+ 
Sbjct  1    MAGFKKLFATVFLVLMLVFATEMGT----MVADARTCESQSHRFKGPCVRKSNCAAVCQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+GI RRC+C + C
Sbjct  57   EGFHAGHCRGIRRRCFCTKHC  77



>ref|XP_004297787.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M S +R F+ V + +++++AT MG NT  MV EA+ C   S KFK  C     C + CK 
Sbjct  1    MESFMRMFSAVFVALLLLVATGMGPNT--MVAEARTCESLSHKFKGTCLSETNCASVCKT  58

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G+ RRC+C + C
Sbjct  59   EGFSGGDCRGLRRRCFCTKHC  79



>gb|AIT42147.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R FT V L  +++MATEMG    + + EA+ C   S +FK PC     C + C+ 
Sbjct  1    MAYSMRFFTIVFLLAMIVMATEMGP---MRIVEARHCESLSHRFKGPCASDKNCASVCET  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G+C+G  RRC+C +PC
Sbjct  58   ERFSGGNCRGFRRRCFCTKPC  78



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 46/81 (57%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA   + F  V L ++++ ATEMGT    MV EA+ C   S +FK PC     C A C+ 
Sbjct  1    MAGFKKLFATVFLMLMLVFATEMGT----MVAEARTCESQSHRFKGPCVRKSNCAAVCQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C + C
Sbjct  57   EGFHGGHCRGFRRRCFCTKHC  77



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 46/81 (57%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S R F+  LL +++ MATEMG     MV EA+ C   S +FK  C     C A C+ 
Sbjct  1    MKGSQRLFSAFLLVILLFMATEMGP----MVAEARTCESQSHRFKGTCVRQSNCAAVCQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G+C+G  RRC+C + C
Sbjct  57   EGFHGGNCRGFRRRCFCTKHC  77



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +2

Query  17   LRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFP  196
            +R  + V L ++++ ATEMG    +MV EA+ C   S +FK  C     C + C  EGFP
Sbjct  2    MRLLSTVFLLLMVVFATEMGP---VMVAEARNCESQSERFKGVCVSNRNCASVCNTEGFP  58

Query  197  EGDCKGITRRCYCIRPC  247
            +G CKG+ RRC+C+R C
Sbjct  59   DGKCKGLRRRCFCLRNC  75



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA+S+R F  +LL  +++MAT         + EA+ C   S +FK PC     C + C+ 
Sbjct  1    MANSMRLFATMLLLAMLVMAT-----GPTRIVEARTCESQSHRFKGPCVSEKNCASVCET  55

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G+ RRC+C RPC
Sbjct  56   EGFSGGDCRGLRRRCFCTRPC  76



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA+S+R F  +LL  +++MAT       + + EA+ C   S +FK PC     C + C+ 
Sbjct  1    MANSMRLFATMLLLAMLVMAT-----GPMRIVEARTCESQSHRFKGPCVSEKNCASVCET  55

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G  RRC+C RPC
Sbjct  56   EGFSGGDCRGFRRRCFCTRPC  76



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R F  VL   +++M T+MG    + + EA+ C  PS +FK PC     C + C+ 
Sbjct  1    MAHSMRFFATVLFLAMLVMDTKMGP---MRIIEARICESPSQRFKGPCLTDRNCASVCET  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G+ RRC+C + C
Sbjct  58   EGFTGGDCRGLRRRCFCTKEC  78



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA+S+R F  +LL  +++MAT       + + EA+ C   S +FK PC     C + C+ 
Sbjct  1    MANSMRLFATMLLLAMLVMAT-----GPMKIVEARTCESQSHRFKGPCVSEKNCASVCET  55

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G  RRC+C RPC
Sbjct  56   EGFSGGDCRGFRRRCFCTRPC  76



>ref|XP_004297786.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M S +R F+ V + +++++AT MG N   MV EA+ C   S KFK  C     C + C+ 
Sbjct  1    MESFMRMFSAVFVALLLLVATGMGPNA--MVAEARTCETLSHKFKGTCLRESNCASVCQT  58

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G+ RRC+C + C
Sbjct  59   EGFTGGDCRGLRRRCFCTKHC  79



>ref|XP_004242750.1| PREDICTED: defensin-like protein P322 [Solanum lycopersicum]
 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium]
Length=78

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R F  + L  +++MATEMG      + EA+ C   S +FK PC     C + C+ 
Sbjct  1    MAQSIRFFATLFLLAMLVMATEMGPTR---IVEARHCESLSHRFKGPCVSDKNCASVCET  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G+C+G  RRC+C +PC
Sbjct  58   ERFSGGNCRGFRRRCFCTKPC  78



>ref|XP_009768914.1| PREDICTED: defensin-like protein isoform X1 [Nicotiana sylvestris]
Length=80

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 4/82 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATE-MGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACK  181
            M  S+R  + V L ++++ ATE MG    IMV EA+ C   S +FK  C     C + C 
Sbjct  2    MRRSMRLLSTVFLLLMVVFATEEMGP---IMVAEARNCESQSQRFKGVCVSNRNCASVCN  58

Query  182  GEGFPEGDCKGITRRCYCIRPC  247
             EGFP+G CKG+ RRC+C+R C
Sbjct  59   TEGFPDGKCKGLRRRCFCLRNC  80



>gb|AIT42152.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R F+   L  +++MATEMG    + + EA+ C   S +FK PC     C + C+ 
Sbjct  1    MALSMRFFSTFFLLAMLVMATEMGP---MRIVEARHCESLSHRFKGPCASDRNCASVCET  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G+C+G  RRC+C +PC
Sbjct  58   ERFSGGNCRGFRRRCFCTKPC  78



>ref|XP_009792224.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (62%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA+S+R F  VLL  +++MATEMG  T   + EA+ C     +FK PC   G C   C  
Sbjct  1    MANSMRFFATVLLLTLLVMATEMGPMT---IAEARTCESQRHRFKGPCSRDGNCATVCLT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G+ RRC+C RPC
Sbjct  58   EGFSGGDCRGLRRRCFCTRPC  78



>gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum]
Length=78

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 46/81 (57%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R F    L  +++MATEMG    + + EA+ C   S +FK PC     C + C+ 
Sbjct  1    MALSMRFFATFFLLAMLVMATEMGP---MRIAEARHCESLSHRFKGPCTRDSNCASVCET  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G+C G  RRC+C +PC
Sbjct  58   ERFSGGNCHGFRRRCFCTKPC  78



>gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum]
 gb|AIT42151.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 46/81 (57%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R F    L  +++MATEMG    + + EA+ C   S +FK PC     C + C+ 
Sbjct  1    MALSMRFFATFFLLAMLVMATEMGP---MRIAEARNCESLSHRFKGPCTRDSNCASVCET  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G+C G  RRC+C +PC
Sbjct  58   ERFSGGNCHGFRRRCFCTKPC  78



>ref|XP_009769843.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA+S+R F  VLL  +++MATEMG  T   + EA+ C   S +FK PC     C   C  
Sbjct  1    MANSMRFFATVLLLTLLVMATEMGPMT---IAEARTCESQSHRFKGPCSRDSNCATVCLT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G  RRC+C RPC
Sbjct  58   EGFSGGDCRGFRRRCFCTRPC  78



>gb|AIT42153.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R F    L  +++M+TEMG    + + EA+ C   S +FK PC     C + C+ 
Sbjct  1    MALSMRFFATFFLLAMLVMSTEMGP---MRIVEARHCESLSHRFKGPCASDKNCASVCET  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G+C+G  RRC+C +PC
Sbjct  58   ERFSGGNCRGFRRRCFCTKPC  78



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA    S   + LF+++++ATEMG+   IMV EA+KC   S  FK  C     C   C  
Sbjct  1    MALQFLSIRTIFLFLLVLVATEMGS---IMVVEARKCLSQSHSFKGLCLSDQNCATVCLT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF +G C+G  +RC+C +PC
Sbjct  58   EGFTDGRCRGFRQRCFCSKPC  78



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S R    +LL V++++A+EM T    M+ EA+ C   S KFK PC     C   CK 
Sbjct  1    MERSRRMLPAILLLVLIVVASEMAT----MMVEARTCESQSHKFKGPCLRASNCANVCKT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C + C
Sbjct  57   EGFHGGKCRGFRRRCFCTKHC  77



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA SL   + + +F+++++ATEMG     MV EA+ C   S +FK PC     C + C G
Sbjct  1    MARSLPLVSTIFVFLLLLVATEMGPT---MVAEARDCESQSHRFKGPCVSDTNCASVCHG  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G C+G  RRC+C + C
Sbjct  58   EKFSGGHCRGFRRRCFCTKHC  78



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F    L +++ M+TEM     + V EA+ C   S +FK  C     C A C+ 
Sbjct  1    MTYSMRLFATAFLLLMLFMSTEM---DPVRVAEARTCESLSHRFKGTCVRGSNCAAVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP G C G+ RRC+C +PC
Sbjct  58   EGFPGGQCSGLRRRCFCSKPC  78



>ref|XP_003628978.1| Defensin [Medicago truncatula]
 ref|XP_003636615.1| Defensin [Medicago truncatula]
 gb|AET03454.1| Defensin MtDef4.3 [Medicago truncatula]
Length=77

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+   + + +F ++I+ATEMG +    +  A+ C  PS+ FK  C     C + C+ 
Sbjct  1    MARSVSLVSTIFVFFLLIVATEMGPS----MVAARTCETPSNSFKGACFSDTNCASVCQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP G CKG  +RC+C +PC
Sbjct  57   EGFPGGHCKGFRQRCFCTKPC  77



>gb|AIT42149.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R F+   L  +++MATEMG    + + EA+ C   S +FK PC     C + C+ 
Sbjct  1    MALSMRFFSTFFLLAMLVMATEMGP---MRIVEARHCESLSHRFKGPCASDRNCASVCET  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G+C+G  R C+C +PC
Sbjct  58   ERFSGGNCRGFRRLCFCTKPC  78



>ref|NP_176302.2| defensin-like protein [Arabidopsis thaliana]
 sp|Q9C947.2|DEF05_ARATH RecName: Full=Defensin-like protein 5; AltName: Full=Low-molecular-weight 
cysteine-rich protein 66; Short=Protein LCR66; 
AltName: Full=Plant defensin 2.4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABE65729.1| plant defensin-fusion protein [Arabidopsis thaliana]
 gb|AEE33774.1| defensin-like protein [Arabidopsis thaliana]
Length=76

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 39/74 (53%), Gaps = 4/74 (5%)
 Frame = +2

Query  26   FTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGD  205
                LL + MI+AT MG    ++  EA+ C   S+ F  PC     C   C  EGF +GD
Sbjct  7    LNSALLLLFMILATVMG----LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGD  62

Query  206  CKGITRRCYCIRPC  247
            C+G  RRC C RPC
Sbjct  63   CRGFRRRCLCTRPC  76



>gb|ABK28445.1| unknown [Arabidopsis thaliana]
Length=77

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 39/74 (53%), Gaps = 4/74 (5%)
 Frame = +2

Query  26   FTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGD  205
                LL + MI+AT MG    ++  EA+ C   S+ F  PC     C   C  EGF +GD
Sbjct  7    LNSALLLLFMILATVMG----LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGD  62

Query  206  CKGITRRCYCIRPC  247
            C+G  RRC C RPC
Sbjct  63   CRGFRRRCLCTRPC  76



>ref|XP_007156391.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
 gb|ADR30067.1| defensin D2 [Phaseolus vulgaris]
 gb|ESW28385.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
Length=78

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+   + + +F+++++ATEMG     MV EA+ C   S +FK PC     C + C+ 
Sbjct  1    MARSVSFVSTIFVFLLLLLATEMGPR---MVAEARTCESQSHRFKGPCVSDTNCASVCRT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G C+G  RRC+C + C
Sbjct  58   ERFSGGHCRGFRRRCFCTKHC  78



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 5/77 (6%)
 Frame = +2

Query  17   LRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFP  196
            +R F  +LL  +++MAT       + + EA+ C   S +FK PC     C + C+ EGF 
Sbjct  1    MRLFATMLLLAMLVMAT-----GPMRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFS  55

Query  197  EGDCKGITRRCYCIRPC  247
             GDC+G  RRC+C RPC
Sbjct  56   GGDCRGFRRRCFCTRPC  72



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+   + + + +++++ATEMG     MV EA+ C   S +FK PC     C + C+ 
Sbjct  1    MARSVPLVSTIFVLLLLLIATEMGP---TMVAEARTCESQSHRFKGPCLSDTNCGSVCRT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G +RRC+C + C
Sbjct  58   EGFSGGHCRGFSRRCFCTKEC  78



>gb|ACV84379.1| defensin precursor [Triticum aestivum]
 gb|EMT06280.1| Defensin-like protein 5 [Aegilops tauschii]
 gb|AIA66986.1| defensin [Triticum aestivum]
Length=81

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 3/78 (4%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            R  T   L + +++ATEMGT TT+ V EA+ C   S  FK  C     C A C+ E FP+
Sbjct  5    RRMTASALLLFLLVATEMGT-TTVKVAEARNCLSQSHNFKGACLSSSNCAAVCRTENFPD  63

Query  200  GDCKG--ITRRCYCIRPC  247
            G+C      R+C+C RPC
Sbjct  64   GECHAPHYERKCFCKRPC  81



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 6/81 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F    +F+++++AT  GT    MV E + C   S++FK  C     C A C+ 
Sbjct  1    MERSMRLFPTAFVFLLLLVAT--GT----MVAEGRTCESQSNRFKGTCVSKSNCAAVCQT  54

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP G+C+G+ RRC+C + C
Sbjct  55   EGFPGGNCRGLRRRCFCTKHC  75



>ref|XP_009351646.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F+   +FV++++AT M      M+ E + C   S KFK  C     C + C+ 
Sbjct  1    MERSMRLFSTAFVFVLLLVATGM---MGPMLAEGRTCESQSRKFKGACLSRSNCASVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP G C+G  RRC+C + C
Sbjct  58   EGFPGGHCRGFRRRCFCTKHC  78



>gb|ADK87340.1| defensin [Pyrus pyrifolia]
 gb|AGC00408.1| defensin 1 [Pyrus pyrifolia]
Length=78

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F+   +FV++++AT M      M+ E + C   S KFK  C     C + C+ 
Sbjct  1    MERSVRLFSTAFVFVLLLVATGM---MGPMLAEGRTCESQSRKFKGACLSRSNCASVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP G C+G  RRC+C + C
Sbjct  58   EGFPGGHCRGFRRRCFCTKHC  78



>ref|XP_009351645.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 43/81 (53%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F+   +FV++++AT M      M+ E + C   S KFK  C     C   C+ 
Sbjct  1    MERSVRLFSTAFVFVLLLVATGM---MGPMLAEGRTCEAHSRKFKGHCHSKSNCATVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C GI RRC+C + C
Sbjct  58   EGFQGGHCHGIRRRCFCTKHC  78



>ref|XP_009114206.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY04121.1| BnaA09g18990D [Brassica napus]
Length=77

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  SLR  + VLL  ++ +A+ MG  T     EA+ C   S KF+ PC     C   C  
Sbjct  1    MKLSLRLISAVLLMFMIFVASGMGPVTV----EARTCESKSHKFRGPCVSRHNCANVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRCYC R C
Sbjct  57   EGFHGGKCRGFRRRCYCTRHC  77



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F+   +F +++ A  M      MV EA+ C   S++FK  C     C + C+ 
Sbjct  1    MERSMRLFSTAFVFFLLLAAAGMMMGP--MVAEARTCESQSNRFKGTCVSTSNCASVCQT  58

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP G C+G  RRC+C + C
Sbjct  59   EGFPGGHCRGFRRRCFCTKHC  79



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F+   +F +++ A  M      MV EA+ C   S++FK  C     C + C+ 
Sbjct  1    MERSMRLFSTAFVFFLLLAAAGM---MGPMVAEARTCESQSNRFKGTCVSTSNCASVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP G C+G  RRC+C + C
Sbjct  58   EGFPGGHCRGFRRRCFCTKHC  78



>ref|NP_178320.1| defensin-like protein 4 [Arabidopsis thaliana]
 sp|Q41914.2|DEF04_ARATH RecName: Full=Defensin-like protein 4; AltName: Full=Low-molecular-weight 
cysteine-rich protein 70; Short=Protein LCR70; 
AltName: Full=Plant defensin 2.1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97222.1| protease inhibitor II [Arabidopsis thaliana]
 dbj|BAC42603.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAO42893.1| At2g02120 [Arabidopsis thaliana]
 gb|AEC05548.1| defensin-like protein 4 [Arabidopsis thaliana]
Length=77

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VL  V++ +AT MG  T     EA+ C   S +FK  C     C   C  
Sbjct  1    MKFSMRLISAVLFLVMIFVATGMGPVTV----EARTCASQSQRFKGKCVSDTNCENVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP GDC+G  RRC+C R C
Sbjct  57   EGFPGGDCRGFRRRCFCTRNC  77



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M   +R F+ ++L ++++ ATEMG      V EA+ C   S +FK  C     C + C+ 
Sbjct  1    MERGMRLFSSLVLVLLLVTATEMGPK----VAEARTCESQSHRFKGACLSDTNCASVCQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP GDCKG  RRC+C++PC
Sbjct  57   EGFPAGDCKGARRRCFCVKPC  77



>ref|XP_002886566.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62825.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
Length=76

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
 Frame = +2

Query  26   FTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGD  205
                LL + MI+AT +G  T     EA+ C   S+ F  PC     C   C  EGF +GD
Sbjct  7    LISALLLLFMILATGIGPVTV----EARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGD  62

Query  206  CKGITRRCYCIRPC  247
            C+G  RRC C RPC
Sbjct  63   CRGFRRRCLCTRPC  76



>gb|AAM62652.1| protease inhibitor II [Arabidopsis thaliana]
Length=76

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
 Frame = +2

Query  26   FTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGD  205
                LL + MI+AT MG     +  EA+ C   S+ F  PC     C   C  EGF +GD
Sbjct  7    LKSALLLLFMILATVMGP----VRVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGD  62

Query  206  CKGITRRCYCIRPC  247
            C+G  RRC C RPC
Sbjct  63   CRGFRRRCLCTRPC  76



>ref|XP_008340514.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=78

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F+   +FV++++AT M      ++ E + C   S KFK  C     C + C+ 
Sbjct  1    MERSMRLFSTAFVFVLLLVATGM---MGPLLAEGRTCESQSRKFKGTCLSKTNCASVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP G+C+G  RRC+C + C
Sbjct  58   EGFPGGNCRGFRRRCFCTKHC  78



>ref|XP_002875115.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51374.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VL+  ++ +AT MG  T     EA+ C   S +FK PC     C   C  
Sbjct  1    MKLSMRLISAVLIMFMVFVATGMGPVTV----EARTCESKSHRFKGPCVSTHNCANVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRCYC R C
Sbjct  57   EGFGGGKCRGFRRRCYCTRHC  77



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+   + + +F+++++ATEMG     MV EA+ C   S +FK PC     C + C+ 
Sbjct  1    MARSVPLVSTIFVFLLLLVATEMGPT---MVAEARTCESQSHRFKGPCVSDTNCASVCRT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G C+G  RRC C + C
Sbjct  58   ERFSGGHCRGFRRRCLCTKHC  78



>ref|NP_178321.1| defensin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZUL7.1|DEF01_ARATH RecName: Full=Defensin-like protein 1; AltName: Full=Low-molecular-weight 
cysteine-rich protein 68; Short=Protein LCR68; 
AltName: Full=Plant defensin 2.3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97221.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAK93656.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAL85136.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AEC05549.1| defensin-like protein 1 [Arabidopsis thaliana]
Length=77

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 41/81 (51%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  +  LL  ++ +AT MG  T     EA+ C   S +FK PC     C   C  
Sbjct  1    MKLSVRFISAALLLFMVFIATGMGPVTV----EARTCESKSHRFKGPCVSTHNCANVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRCYC R C
Sbjct  57   EGFGGGKCRGFRRRCYCTRHC  77



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F    L  +++++TEMG  +     EA+ C   S  FK PC     C + C+ 
Sbjct  1    MGYSMRLFATFFLVAMLLLSTEMGPMSG--GAEARTCESQSHSFKGPCVGDTNCASVCQT  58

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G+ R+C+C R C
Sbjct  59   EGFIGGDCRGLRRQCFCTRNC  79



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+R F+ + + + ++ AT MG      V EA+ C   S +FK  C     C A C+ 
Sbjct  1    MARSMRLFSILFVVLFLLTATGMGPK----VAEARTCESQSHRFKGICVRKSNCAAVCQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C + C
Sbjct  57   EGFHGGHCRGFRRRCFCTKHC  77



>sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable 
protease inhibitor P322; Flags: Precursor [Solanum tuberosum]
 emb|CAA31577.1| unnamed protein product [Solanum tuberosum]
Length=74

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 3/77 (4%)
 Frame = +2

Query  17   LRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFP  196
            +R F    L  ++++AT+MG    + + EA+ C   S +FK PC     C + C+ E F 
Sbjct  1    MRFFATFFLLAMLVVATKMGP---MRIAEARHCESLSHRFKGPCTRDSNCASVCETERFS  57

Query  197  EGDCKGITRRCYCIRPC  247
             G+C G  RRC+C +PC
Sbjct  58   GGNCHGFRRRCFCTKPC  74



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VLL  ++ +AT MG     +  EA+ C   S +FK PC     C   C  
Sbjct  1    MKLSMRLISAVLLLFMIFVATGMGP----VSVEARTCESQSHRFKGPCVSENNCANVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G+ RRC+C R C
Sbjct  57   EGFGGGKCRGLRRRCFCTRHC  77



>ref|XP_006647552.1| PREDICTED: defensin-like protein P322-like [Oryza brachyantha]
Length=80

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R    V L + +++ATEMGT     V EA+ C   S +FK  C     C   CK 
Sbjct  1    MAPSRRMVASVFLLLAILVATEMGTT---QVAEARHCLSQSHRFKGMCVSSNNCANVCKT  57

Query  185  EGFPEGDCK--GITRRCYCIRPC  247
            E FP+G+CK  G+ R+C+C + C
Sbjct  58   ENFPDGECKSHGLERKCFCKKLC  80



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VLL  ++ +AT MG     +  EA+ C   S +FK PC     C   C  
Sbjct  1    MKLSMRLISAVLLLFMIFVATGMGP----VSVEARTCESQSHRFKGPCVSDNNCANVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G+ RRC+C R C
Sbjct  57   EGFGGGKCRGLRRRCFCTRHC  77



>gb|AGT51227.1| defensin [Brassica napus]
Length=77

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  SLR  + VLL +++ +A+ MG  T     EA+     S KF+ PC     C   C  
Sbjct  1    MKLSLRLISAVLLMIMIFVASGMGPVTV----EARTSESKSHKFRGPCVSRHNCANVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRCYC R C
Sbjct  57   EGFHGGKCRGFRRRCYCTRHC  77



>ref|XP_009610211.1| PREDICTED: defensin J1-2 [Nicotiana tomentosiformis]
Length=77

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA   +    V L ++++ ATEMG     MV EA+ C   S +FK  C     C + C  
Sbjct  1    MAGYPKVVATVFLMLMLVFATEMGP----MVAEARTCESQSHRFKGLCFSKSNCASVCHT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C R C
Sbjct  57   EGFYGGHCRGFRRRCFCTRHC  77



>ref|XP_009354384.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F+   +FV++++AT M      M+ E + C   S KFK  C     C + C+ 
Sbjct  1    MERSMRLFSTAFVFVLLLVATGM---MGPMLAEGRTCEAHSRKFKGTCLGKSNCASVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C + C
Sbjct  58   EGFHGGHCRGFRRRCFCTKHC  78



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+   + + + +++++ATEMG     MV EA+ C   S +FK PC     C + C+ 
Sbjct  1    MARSVPLVSTIFVLLLLLIATEMGP---TMVAEARTCESQSHRFKGPCLSDTNCGSVCRT  57

Query  185  EGFPEGDCKGITRRCYCIR  241
            EGF  G C+G +RRC+C +
Sbjct  58   EGFSGGHCRGFSRRCFCTK  76



>ref|XP_006359486.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=78

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M    R F    L  ++++++EMGT ++    EA+ C   S++FK  C     C   C+ 
Sbjct  1    MGHFKRLFATFFLVAMLLLSSEMGTMSS---AEARTCESQSNRFKGTCVRDSNCATVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G+C+G  RRC+C R C
Sbjct  58   EGFIGGNCRGFRRRCFCTRNC  78



>ref|XP_004242748.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36638.1| defensin protein [Solanum lycopersicum]
 gb|ABO36642.1| defensin protein [Solanum pimpinellifolium]
Length=79

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = +2

Query  5    MASSLRSF-TDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACK  181
            MA S+R F T  L+ ++++++TEMG    I   EA+ C   S+ FK  C     C   C+
Sbjct  1    MAHSIRLFATFFLVAMLLLLSTEMGP---ISSAEARTCESQSNSFKGTCVRDSNCATVCQ  57

Query  182  GEGFPEGDCKGITRRCYCIRPC  247
             EGF  G+C+G  RRC+C R C
Sbjct  58   TEGFIGGNCRGFRRRCFCTRNC  79



>ref|XP_009413079.1| PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=81

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S R    ++L  ++++ ++MG  +     EA+KC   S KFK  C     C   CK 
Sbjct  1    MEDSRRMLPAIVLLFLLLITSDMGMTSV----EARKCESASHKFKGLCFRASNCANVCKT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G+ RRC+C + C
Sbjct  57   EGFHGGHCRGLRRRCFCTKHC  77



>ref|XP_010513973.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VLL  ++ +AT MG  T     EA+ C   S +F+ PC     C   C  
Sbjct  1    MKLSMRLISAVLLMFMLFVATGMGPVTV----EARTCESKSHRFRGPCVSRHNCGNVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C R C
Sbjct  57   EGFSGGKCRGFRRRCFCTRHC  77



>sp|Q40901.1|DEF_PETIN RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog PPT; Flags: Precursor [Petunia integrifolia]
 gb|AAA64740.1| gamma-thionin homolog [Petunia integrifolia subsp. inflata]
Length=78

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 42/81 (52%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F    L  ++ ++TEMG  T+    EA+ C   S +F   C     C + C+ 
Sbjct  1    MGRSIRLFATFFLIAMLFLSTEMGPMTS---AEARTCESQSHRFHGTCVRESNCASVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G+C+   RRC+C R C
Sbjct  58   EGFIGGNCRAFRRRCFCTRNC  78



>gb|KFK26328.1| hypothetical protein AALP_AA8G233400 [Arabis alpina]
Length=78

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 4/70 (6%)
 Frame = +2

Query  38   LLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGI  217
            +LF++++  T +G  T     EA+ C   S  F  PC     C   C  EGFP+GDC+G 
Sbjct  13   VLFMLLVATTGIGPVTV----EARTCETSSQLFNGPCLSTTNCANVCHNEGFPDGDCRGF  68

Query  218  TRRCYCIRPC  247
             RRC C RPC
Sbjct  69   RRRCLCSRPC  78



>emb|CDY48618.1| BnaC09g20670D [Brassica napus]
Length=77

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 41/81 (51%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  SLR  + VLL  ++ +A+ MG  T     EA+ C   S KF+  C     C   C  
Sbjct  1    MKLSLRLISAVLLMFMIFVASGMGPVTV----EARTCESKSHKFRGLCVSRHNCANVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRCYC R C
Sbjct  57   EGFHGGKCRGFRRRCYCTRHC  77



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F+   LF++++    MG     MV E + C   S +FK  C     C   C+ 
Sbjct  1    MERSMRLFSTAFLFLLLVATGMMGP----MVAEGRTCDSQSHRFKGSCVSKSNCATVCQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C + C
Sbjct  57   EGFRGGHCRGFRRRCFCTKHC  77



>ref|XP_010495961.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VLL  ++ +AT MG  T     EA+ C   S +F+ PC     C   C  
Sbjct  1    MKLSMRLISAVLLMFMIFVATGMGPVTV----EARTCESKSHRFRGPCVSRHNCGNVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C R C
Sbjct  57   EGFSGGKCRGFRRRCFCTRHC  77



>ref|NP_178319.1| defensin-like protein 2 [Arabidopsis thaliana]
 sp|Q39182.1|DEF02_ARATH RecName: Full=Defensin-like protein 2; AltName: Full=Low-molecular-weight 
cysteine-rich protein 69; Short=Protein LCR69; 
AltName: Full=Plant defensin 2.2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK44170.1|AF370355_1 putative protease inhibitor II [Arabidopsis thaliana]
 emb|CAA48892.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAC97223.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAX39303.1| defensin-like protein [Arabidopsis thaliana]
 gb|AEC05546.1| defensin-like protein 2 [Arabidopsis thaliana]
Length=77

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VL+  ++ +AT MG  T     EA+ C   S +FK  C     C   C  
Sbjct  1    MKLSMRLISAVLIMFMIFVATGMGPVTV----EARTCESQSHRFKGTCVSASNCANVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G+C+G  RRC+C R C
Sbjct  57   EGFVGGNCRGFRRRCFCTRHC  77



>ref|XP_003630422.1| Defensin [Medicago truncatula]
 gb|AET04898.1| Defensin MtDef4.7 [Medicago truncatula]
Length=74

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 41/76 (54%), Gaps = 4/76 (5%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            R    +L  + +++A ++   T     E ++C   S KFK PC     C + C+GEGF  
Sbjct  3    RKTLGILFMLFLVLAADVAVKTA----EGRRCESQSHKFKGPCVSDSNCGSVCRGEGFIG  58

Query  200  GDCKGITRRCYCIRPC  247
            GDC+G+  RC+C R C
Sbjct  59   GDCRGVRHRCFCTRNC  74



>gb|EYU30124.1| hypothetical protein MIMGU_mgv1a017438mg [Erythranthe guttata]
Length=75

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 40/81 (49%), Gaps = 6/81 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MAS LR F   L  V+++ +T M    T      + C   S +FK  C     C A C+ 
Sbjct  1    MASFLRLFATALFMVMLVFSTGMVAEAT------RTCEAKSHRFKGICARKANCAAVCQT  54

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C + C
Sbjct  55   EGFHGGHCRGFRRRCFCTKHC  75



>ref|XP_009599356.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 3/76 (4%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            R F    L  ++++ATEMG  ++    EA+ C   S +F   C     C + C+ EGF  
Sbjct  3    RLFATFFLVAMLLLATEMGQMSS---AEARTCESQSHRFHGTCVRDSNCASICQTEGFIG  59

Query  200  GDCKGITRRCYCIRPC  247
            G+C+G  RRC+C R C
Sbjct  60   GNCRGFRRRCFCTRNC  75



>ref|XP_004509603.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=78

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+   + +++  ++++ATEM     IMV EA+ C   S  FK  C     C   C+ 
Sbjct  1    MARSVPLVSTIIVIFLLLVATEM---RPIMVAEARTCESLSYSFKGLCVRDHNCAVVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G CKG  RRC+C +PC
Sbjct  58   EGFTGGQCKGFRRRCFCNKPC  78



>ref|XP_009802655.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=75

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 42/76 (55%), Gaps = 3/76 (4%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            R F    L  ++++ATEMG  ++    EA+ C   S +F   C     C + C+ EGF  
Sbjct  3    RLFATFFLVAMLLLATEMGPMSS---AEARTCESQSHRFHGTCVRGSNCASVCQTEGFIG  59

Query  200  GDCKGITRRCYCIRPC  247
            G+C+G+ RRC+C R C
Sbjct  60   GNCRGLRRRCFCTRNC  75



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 41/81 (51%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA   +    V L ++++ A EMG     MV EA+ C   S +FK  C     C + C  
Sbjct  1    MAGFPKVLAIVFLMLMLVFANEMGP----MVAEARTCESQSHRFKGLCISKSNCASVCHT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C R C
Sbjct  57   EGFNGGHCRGFRRRCFCTRHC  77



>ref|XP_006392063.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
 gb|ESQ29349.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
Length=79

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  SL   + + + +++++AT MG  T     EA+ C   S  F  PC     C   C  
Sbjct  3    MKISLPLISAIAIMLMLLLATGMGPVTV----EARMCESSSQLFNGPCLSTTNCANICHN  58

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF +GDC+G  RRC C RPC
Sbjct  59   EGFTDGDCQGFRRRCICTRPC  79



>ref|XP_009101273.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
 emb|CDY17613.1| BnaA06g34320D [Brassica napus]
Length=77

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 41/81 (51%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VLL  ++ +AT MG  T     EA+ C   S +FK  C     C   C  
Sbjct  1    MKLSMRLISAVLLLFMIFVATGMGPVTV----EARTCESKSHRFKGTCVSSTNCGNVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRCYC R C
Sbjct  57   EGFGGGKCRGFRRRCYCTRHC  77



>gb|AGT51228.1| defensin [Brassica napus]
 emb|CDY03076.1| BnaC07g21510D [Brassica napus]
Length=76

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 42/81 (52%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VLLF+I + AT MG  T     EA+ C   S +FK  C     C   C  
Sbjct  1    MNLSMRLISAVLLFMIFV-ATGMGPVTV----EARTCESKSHRFKGTCVSSTNCGNVCHN  55

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRCYC R C
Sbjct  56   EGFGGGKCRGFRRRCYCTRHC  76



>gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas]
 gb|KDP32806.1| hypothetical protein JCGZ_12098 [Jatropha curcas]
Length=77

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M + +R F+ VL  +++++ATE+G+     + EA+ C   S KFK  C     C   CK 
Sbjct  1    MKNPMRPFSAVLFLLLLLVATEIGSK----MAEARTCESQSHKFKGTCLSETNCANVCKT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G+ RRC+C R C
Sbjct  57   EGFTGGDCRGLRRRCFCTRHC  77



>ref|XP_006395808.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
 gb|ACQ90607.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33094.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
Length=77

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + +LL  ++ +AT MG  T     EA+KC   S +FK  C     C   C  
Sbjct  1    MKLSMRLISALLLVFMIFVATGMGPVTV----EARKCESKSHRFKGKCLSETNCKNVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G+C+G  RRC+C R C
Sbjct  57   EGFTGGNCRGFRRRCFCTRNC  77



>ref|NP_001047493.1| Os02g0629800 [Oryza sativa Japonica Group]
 dbj|BAD23741.1| putative defensin [Oryza sativa Japonica Group]
 dbj|BAF09407.1| Os02g0629800 [Oryza sativa Japonica Group]
 gb|EEE57415.1| hypothetical protein OsJ_07607 [Oryza sativa Japonica Group]
Length=80

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 45/83 (54%), Gaps = 5/83 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R      L + +++ATEMGT     V EA+ C   S +FK  C     C   C+ 
Sbjct  1    MAPSRRMVASAFLLLAILVATEMGTTK---VAEARHCLSQSHRFKGMCVSSNNCANVCRT  57

Query  185  EGFPEGDCK--GITRRCYCIRPC  247
            E FP+G+CK  G+ R+C+C + C
Sbjct  58   ESFPDGECKSHGLERKCFCKKVC  80



>sp|P82659.1|DFSD2_HELAN RecName: Full=Defensin SD2; AltName: Full=Flower-specific gamma-thionin; 
Flags: Precursor [Helianthus annuus]
 gb|AAF66591.1|AF141131_1 defensin [Helianthus annuus]
 gb|AAF72042.1|AF178634_1 defensin SD2 [Helianthus annuus]
Length=78

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 42/81 (52%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M SS++ F  +LL V+ ++A EMG     +V EA+ C   S KFK  C     C   C  
Sbjct  1    MKSSMKMFAALLLVVMCLLANEMGGP---LVVEARTCESQSHKFKGTCLSDTNCANVCHS  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G C+G  RRC+C   C
Sbjct  58   ERFSGGKCRGFRRRCFCTTHC  78



>ref|XP_004242747.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36635.1| defensin protein [Solanum lycopersicum]
 gb|ABO36640.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M +SLR F    L  ++++AT  G  T++   EA+ C   S  FK  C     C + C+ 
Sbjct  1    MGNSLRLFATFFLVAMLLLAT--GPTTSV---EARTCESQSHHFKGNCLSDTNCGSVCRT  55

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G+C+G  RRC+C R C
Sbjct  56   EGFTGGNCRGFRRRCFCTRNC  76



>ref|XP_002468581.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
 gb|EER95579.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
Length=80

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S + FT V+L +++++ATE+G    + V EA+ C   S +F+ PC     C   C+ 
Sbjct  1    MELSRKLFTAVVLVMLLLVATEIGA---VAVAEARTCQSQSHRFRGPCVRRENCANVCRT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP+G C+G  RRC+C+  C
Sbjct  58   EGFPDGKCRGFRRRCFCLTHC  78



>ref|XP_004509602.1| PREDICTED: defensin-1-like [Cicer arietinum]
Length=80

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 5/83 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA  L S + + +  ++++ TEMG N   MV EA+ C   S  +K  C     C   C+ 
Sbjct  1    MARLLSSVSTIFVMFLLLVVTEMGAN---MVAEARSCISKSFTYKGLCVHDRNCANVCRT  57

Query  185  EGFPEGDCKGIT--RRCYCIRPC  247
            EGF EG C+G     RC+C +PC
Sbjct  58   EGFVEGHCRGFAFGSRCFCYKPC  80



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+   + + +  ++++ATEMG    I V EA+ C   S+ FK PC     C   C+ 
Sbjct  1    MARSIPFISTIFVMFLLLVATEMGP---IKVAEARICDSQSNTFKGPCVIDHSCAIVCQT  57

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G+ R C+C +PC
Sbjct  58   EGFTGGQCEGLRRICFCTKPC  78



>ref|XP_004509606.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=74

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 7/81 (9%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+   + + +F+++++ATEM       V EA+ C   S KFK  C     C + C+ 
Sbjct  1    MARSIPMVSTIFVFLLLLVATEM-------VAEARTCESKSQKFKGACVSDRNCASVCQT  53

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E FP G C+G  RRC+C   C
Sbjct  54   ERFPGGHCRGFRRRCFCTTHC  74



>emb|CAH58740.1| defensin [Plantago major]
Length=72

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 40/74 (54%), Gaps = 5/74 (7%)
 Frame = +2

Query  26   FTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGD  205
            F  VL  + +++       T  MV EA+KC   S +FK  C     C + CK EGFP GD
Sbjct  4    FWSVLFALFLVLVI-----TGPMVGEARKCRSASHRFKGTCLSDTNCASVCKTEGFPGGD  58

Query  206  CKGITRRCYCIRPC  247
            CKG+ RRC+C   C
Sbjct  59   CKGLRRRCFCETHC  72



>ref|XP_003630421.1| Defensin [Medicago truncatula]
 gb|AET04897.1| Defensin MtDef4.6 [Medicago truncatula]
Length=74

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +2

Query  80   NTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +  +   E ++C   S KFK PC     C + C+GEGF  GDC+G  RRC+C R C
Sbjct  19   DIAVKTAEGRRCESKSHKFKGPCSRDSNCASVCRGEGFTGGDCRGFRRRCFCTRNC  74



>ref|XP_011070574.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 7/81 (9%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA  LR F    + ++++ +T M       V EA+KC   S +FK  C     C A C+ 
Sbjct  1    MACFLRMFATAFVMLMLVFSTGM-------VAEARKCESQSHRFKGICLRKANCAAVCQT  53

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G   RC+C + C
Sbjct  54   EGFHSGHCRGFRGRCFCTKHC  74



>ref|XP_004503912.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=76

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +2

Query  38   LLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGI  217
            +LF+  ++ T + T+  +   EA+ C   S +FK  C     C  AC+ EGF  GDC+G+
Sbjct  8    VLFMFFLLLTAV-TDVAVKTAEARTCESRSHRFKGTCLSDTTCAHACRNEGFSGGDCRGL  66

Query  218  TRRCYCIRPC  247
             RRC+C R C
Sbjct  67   RRRCFCNRLC  76



>gb|ACS96442.1| defensin [Jatropha curcas]
Length=77

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M + +R F+ VL  +++++ATE+G+     + EA+ C   + KFK  C     C   CK 
Sbjct  1    MKNPMRPFSAVLFLLLLLVATEIGSK----MAEARTCESQTHKFKGTCLSETNCANVCKT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC+G+ RRC+C R C
Sbjct  57   EGFTGGDCRGLRRRCFCTRHC  77



>ref|XP_006292136.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
 gb|EOA25034.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
Length=77

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VL+  ++ +AT MG  T     EA+ C   S +FK  C     C   C  
Sbjct  1    MKLSMRLISAVLVMFMIFVATGMGPVTV----EARTCESKSHRFKGTCLSESNCKNVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G+C+G  RRC+C R C
Sbjct  57   EGFQGGNCRGFRRRCFCTRHC  77



>gb|EAY86781.1| hypothetical protein OsI_08161 [Oryza sativa Indica Group]
Length=487

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R      L + +++ATEMGT     V EA+ C   S +FK  C     C   C+ 
Sbjct  1    MAPSRRMVASAFLLLAILVATEMGTTK---VAEARHCLSQSHRFKGMCVSSNNCANVCRT  57

Query  185  EGFPEGDCK--GITRRCYCIRPC  247
            E FP+G+CK  G+ R+C+C +PC
Sbjct  58   ESFPDGECKSHGLERKCFCKKPC  80



>ref|XP_010513972.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
 ref|XP_010495963.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VL+  ++ +AT MG  T     EA+ C   S +FK  C     C   C  
Sbjct  1    MKLSIRLISAVLVLFMIFVATGMGPVTV----EARTCESKSHRFKGKCFSETNCRNVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G+C+G  RRC+C R C
Sbjct  57   EGFSGGNCRGFRRRCFCTRHC  77



>ref|XP_006395809.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
 gb|ACQ90606.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33095.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
Length=77

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + V+L  ++ +AT MG  T     EA+ C   S +FK  C     C   C  
Sbjct  1    MKLSMRLISTVILVFMIFVATGMGPVTV----EARTCESKSHRFKGACLSETNCKNVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G+C+G+ RRC+C R C
Sbjct  57   EGFRGGNCRGLRRRCFCTRNC  77



>ref|NP_001048853.1| Os03g0130300 [Oryza sativa Japonica Group]
 gb|AAB17095.1| proteinase inhibitor [Oryza sativa Indica Group]
 gb|AAC00503.1| proteinase inhibitor [Oryza sativa Indica Group]
 dbj|BAA85411.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF93798.1| Gamma-thionin PPT precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10767.1| Os03g0130300 [Oryza sativa Japonica Group]
 dbj|BAH00191.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74445.1| hypothetical protein OsI_09847 [Oryza sativa Indica Group]
 gb|EEE58270.1| hypothetical protein OsJ_09283 [Oryza sativa Japonica Group]
Length=81

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 3/82 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMAT-EMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACK  181
            M +S + F+ +LL V+++ AT EMG    +MV EA+ C   S +FK PC     C + C 
Sbjct  1    MEASRKVFSAMLLMVLLLAATGEMGG--PVMVAEARTCESQSHRFKGPCARKANCASVCN  58

Query  182  GEGFPEGDCKGITRRCYCIRPC  247
             EGFP+G C G+ RRC C +PC
Sbjct  59   TEGFPDGYCHGVRRRCMCTKPC  80



>ref|XP_006292781.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
 gb|EOA25679.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
Length=77

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VL+  ++ +AT MG  T     EA+ C   S +FK  C     C   C  
Sbjct  1    MKLSIRLISAVLVLFMIFVATGMGPVTV----EARTCESKSHRFKGKCFSETNCKNVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G+C+G  RRC+C R C
Sbjct  57   EGFTGGNCRGFRRRCFCTRHC  77



>ref|XP_010502227.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 42/81 (52%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VL+  ++ +AT MG  T     EA+ C   S +FK  C     C   C  
Sbjct  1    MKLSIRLISAVLVLFMIFVATGMGPVTV----EARTCESQSHRFKGKCFSETNCRNVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G+C+G  RRC+C R C
Sbjct  57   EGFSGGNCRGFRRRCFCTRYC  77



>ref|XP_004953175.1| PREDICTED: defensin-like protein 2-like [Setaria italica]
Length=80

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 47/83 (57%), Gaps = 5/83 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R    VL+F+++++A+EMG  T   V EA+ C   S  FK  C     C   C+ 
Sbjct  1    MALSRRMAAPVLVFLLLLIASEMGPAT---VAEARHCLSQSHHFKGLCLSSSNCANVCRV  57

Query  185  EGFPEGDCKGI--TRRCYCIRPC  247
            E FP+G+C+    TR+C+C R C
Sbjct  58   ERFPDGECQTTAGTRKCFCKRIC  80



>gb|AFW58880.1| low-molecular-weight cysteine-rich protein LCR70 [Zea mays]
Length=82

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 6/82 (7%)
 Frame = +2

Query  11   SSLRSFTDVLLFVIMIMA-TEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGE  187
            +S R     L+F++M++A +EMGT     V EA+ C   S +F   C     C   C+ E
Sbjct  4    TSRRMVASALVFLLMLLAASEMGTTR---VAEARHCTSQSHRFVGACMSKSNCENVCRTE  60

Query  188  GFPEGDCK--GITRRCYCIRPC  247
            GFP G+C+  GI R+C+C R C
Sbjct  61   GFPWGECRWHGIERKCHCKRIC  82



>ref|XP_007045354.1| Defensin-like protein isoform 2 [Theobroma cacao]
 gb|EOY01186.1| Defensin-like protein isoform 2 [Theobroma cacao]
Length=77

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S R F+   + +++++ATEMG        EA+ C   S +FK  C     C A C+ 
Sbjct  1    MERSTRLFSAAFVLLLLLLATEMGPK----AAEARTCQSQSHRFKGMCMRKSNCAAVCQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C + C
Sbjct  57   EGFHSGHCRGFHRRCFCTKHC  77



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M+ S+   + + + +++++ATEM   T  MV EA+ C   S +FK PC     C + C+ 
Sbjct  1    MSRSVPLVSTIFVLLLLLVATEMMGPT--MVAEARTCESQSHRFKGPCLSDTNCGSVCRT  58

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G C+G  RRC+C + C
Sbjct  59   ERFTGGHCRGFRRRCFCTKHC  79



>gb|AIT42150.1| defensin-like protein [Solanum tuberosum]
Length=63

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +2

Query  50   IMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRC  229
            +++M+TEMG    + + EA+ C   S +FK PC     C + C+ E F  G+C+G  RRC
Sbjct  1    MLVMSTEMGP---MRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRC  57

Query  230  YCIRPC  247
            +C +PC
Sbjct  58   FCTKPC  63



>ref|XP_011084089.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=74

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            R  T   + ++++++TE G     MV EA+ C   S +FK  C     C + C  EGFP 
Sbjct  3    RLATVFFVLMLVVISTERGP----MVGEARTCESLSHRFKGACVSSTNCASVCHTEGFPG  58

Query  200  GDCKGITRRCYCIRPC  247
            G+C+G  RRC+C + C
Sbjct  59   GNCRGFRRRCFCTKHC  74



>ref|XP_006301968.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
 gb|EOA34866.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
Length=72

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 36/74 (49%), Gaps = 8/74 (11%)
 Frame = +2

Query  26   FTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGD  205
                +L + M++AT        +  E + C   S+ F  PC     C   C  EGFP+GD
Sbjct  7    LISAVLLLFMLLAT--------VTVEGRTCESSSNLFSGPCLSESNCANVCNTEGFPDGD  58

Query  206  CKGITRRCYCIRPC  247
            C+G  RRC C RPC
Sbjct  59   CRGFRRRCMCTRPC  72



>gb|AAA91049.1| protease inhibitor II [Brassica rapa]
Length=77

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 40/81 (49%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  + VLL  ++ +AT MG  T     EA+ C   S +FK  C     C   C  
Sbjct  1    MKLSMRLISAVLLLFMIFVATGMGPVTV----EARTCESKSHRFKGTCVSSTNCGNVCHN  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G   RCYC R C
Sbjct  57   EGFGGGKCRGFRVRCYCTRHC  77



>gb|ABK93231.1| unknown [Populus trichocarpa]
Length=75

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (53%), Gaps = 5/76 (7%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            RSF    L +I++ + E+     ++ TEA+ C   S  FK PC     C   C+ EGF  
Sbjct  5    RSFGLFFLLLIVLASQEV-----VVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSG  59

Query  200  GDCKGITRRCYCIRPC  247
            G CKG  RRC+C + C
Sbjct  60   GRCKGFRRRCFCTKLC  75



>sp|P82781.2|DEF03_ARATH RecName: Full=Putative defensin-like protein 3; AltName: Full=Putative 
low-molecular-weight cysteine-rich protein 71; Short=Protein 
LCR71; Flags: Precursor [Arabidopsis thaliana]
Length=62

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 35/66 (53%), Gaps = 4/66 (6%)
 Frame = +2

Query  50   IMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRC  229
            +MI+    G+ T     EA+ C   S KFK PC     C   C  EGFP+GDC G+ RRC
Sbjct  1    MMILVNAWGSVTV----EARICKSRSQKFKGPCVSEDNCANVCHTEGFPDGDCDGLLRRC  56

Query  230  YCIRPC  247
            YC   C
Sbjct  57   YCNTHC  62



>gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa]
Length=78

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATE-MGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACK  181
            M+ S+R F+ V + +++++AT+ MG     MV EA+ C   S +FK PC     C + C+
Sbjct  1    MSRSMRVFSTVFVVLLLLVATQYMGP----MVAEARTCESQSHRFKGPCVRKSNCASVCQ  56

Query  182  GEGFPEGDCKGITRRCYCIRPC  247
             EGF  G C+G  RRC+C + C
Sbjct  57   TEGFHGGQCRGFRRRCFCTKHC  78



>gb|KGN49760.1| hypothetical protein Csa_5G114570 [Cucumis sativus]
Length=74

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = +2

Query  47   VIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRR  226
             I ++   +GT    MVTEA+ C  PS +FK  C     C   CK EGF  G C+G  RR
Sbjct  7    AIFLLLLLLGTGMGPMVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRR  66

Query  227  CYCIRPC  247
            C+C + C
Sbjct  67   CFCTKHC  73



>gb|AFE88173.1| g-thionin [Panax ginseng]
Length=75

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 40/81 (49%), Gaps = 6/81 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M   +R FT + + ++++MAT       +   E + C   S KFK  C     C   CK 
Sbjct  1    MGVLMRLFTTIFMVLMLLMATG------LEPAEGRTCESQSHKFKGTCASGTNCANVCKT  54

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP G C+G  RRC+C   C
Sbjct  55   EGFPGGKCRGFRRRCFCTTHC  75



>emb|CEJ09690.1| Defensin protein [Zea mays]
Length=80

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R    VL+ +++ +ATE+GT     V EA+ C   S +FK  C     C   C+ 
Sbjct  1    MAPSRRMAAPVLVLMLLPVATELGTTK---VAEARHCLSQSHRFKGLCMSSNNCANVCQT  57

Query  185  EGFPEGDCK--GITRRCYCIRPC  247
            E FP G+CK  G TR+C+C + C
Sbjct  58   ENFPGGECKAEGATRKCFCKKIC  80



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S R     L+ +++++ATEM      MV EA+ C   S +FK  C     C + C+ 
Sbjct  1    MDFSKRLIPAALIVMLLLVATEMEP----MVVEARTCESQSQRFKGACVSKTNCASVCQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C + C
Sbjct  57   EGFHGGHCRGFRRRCFCTKHC  77



>ref|XP_003599384.1| Defensin [Medicago truncatula]
 gb|AES69635.1| gamma-thionin/defensin [Medicago truncatula]
Length=80

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 41/81 (51%), Gaps = 1/81 (1%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+     +  F+ ++++TEM   T +   EA+ C   S  FK  C     C   CK 
Sbjct  1    MARSITLVCTIFFFLFLLVSTEM-QPTHVEEPEARTCDSQSHSFKGVCWIKHNCANVCKT  59

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C G  RRC+C +PC
Sbjct  60   EGFTGGHCHGFRRRCFCSKPC  80



>ref|XP_008466730.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=74

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 37/72 (51%), Gaps = 0/72 (0%)
 Frame = +2

Query  32   DVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCK  211
              L   I ++   +GT    MVTEA+ C  PS +FK  C     C   CK EGF  G C+
Sbjct  2    KFLSAAIFLLLLLLGTGMGPMVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCR  61

Query  212  GITRRCYCIRPC  247
            G  RRC+C + C
Sbjct  62   GFRRRCFCTKHC  73



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M +SLR F    L  ++++AT  G  T +   EA+ C   S  FK  C     C + C  
Sbjct  1    MGNSLRLFATFFLVTMLLLAT--GPTTRV---EARTCESKSHHFKGKCLSDTNCGSVCHT  55

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G+C+G+ +RC+C R C
Sbjct  56   EGFTGGNCRGLRQRCFCTRNC  76



>ref|XP_003628977.1| Defensin [Medicago truncatula]
 ref|XP_003636614.1| Defensin [Medicago truncatula]
 gb|AET03453.1| Defensin MtDef4.2 [Medicago truncatula]
 gb|AFK35827.1| unknown [Medicago truncatula]
Length=76

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+   + + +F+++++AT        MV EA+ C   S KFK PC     C + C+ 
Sbjct  1    MARSVPLVSTIFVFLLLLVATGPS-----MVAEARTCESQSHKFKGPCASDHNCASVCQT  55

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G C+G  RRC+C   C
Sbjct  56   ERFSGGHCRGFRRRCFCTTHC  76



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M+ S+   + + + +++++ATEM   T  MV EA+ C   S +FK PC     C + C+ 
Sbjct  1    MSRSVPLVSTICVLLLLLVATEMMGPT--MVAEARTCESQSHRFKGPCLSDTNCGSVCRT  58

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G C+G  RRC+C + C
Sbjct  59   ERFTGGHCRGFRRRCFCTKHC  79



>gb|ABA81896.1| putative defensin [Aquilegia formosa]
 gb|ABA86588.1| putative defensin 1 [Aquilegia brevistyla]
Length=70

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 34/61 (56%), Gaps = 4/61 (7%)
 Frame = +2

Query  65   TEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRP  244
            TEMG    + V EA+ C   S KFK  C     C + C+ EGF  G C+G+TRRCYC   
Sbjct  12   TEMG----LKVAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAK  67

Query  245  C  247
            C
Sbjct  68   C  68



>ref|XP_004985852.1| PREDICTED: defensin SD2-like [Setaria italica]
Length=81

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S + F+ VLL +++++ATE+G    + V EA+ C   S KF+ PC     C   C+ 
Sbjct  1    MELSRKLFSAVLLVLLLLVATEVGG--PVGVAEARTCLSQSHKFRGPCVRRANCANVCRT  58

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP+G C+G+ RRC+C   C
Sbjct  59   EGFPDGKCRGLRRRCFCTTHC  79



>ref|XP_008389117.1| PREDICTED: defensin Tk-AMP-D1.1-like [Malus domestica]
Length=87

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 45/87 (52%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKK------CPIPSSKFKEPCDEVGKC  166
            M  S+R  + V + V+++ ATEMG  +   +TE+ K      C +PS+ FK  C     C
Sbjct  1    MERSMRLVSAVCVLVLLLAATEMGPISVEAMTESNKAVEGKICEVPSTLFKGLCFSSNNC  60

Query  167  VAACKGEGFPEGDCKGITRRCYCIRPC  247
               C+ E F  G C G+TR C C + C
Sbjct  61   KHTCRKEQFTRGKCSGLTRTCMCTKKC  87



>ref|XP_011001251.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=75

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (53%), Gaps = 5/76 (7%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            RSF    L +I++ + E+     ++ TEA+ C   S  FK PC     C   C+ EGF  
Sbjct  5    RSFGLFFLLLIVLASQEV-----VVPTEARVCLSQSHYFKGPCARDHNCAWVCRNEGFSG  59

Query  200  GDCKGITRRCYCIRPC  247
            G CKG  RRC+C + C
Sbjct  60   GRCKGFRRRCFCTKLC  75



>ref|NP_001149230.1| LOC100282852 precursor [Zea mays]
 gb|ACG34648.1| low-molecular-weight cysteine-rich protein LCR70 precursor [Zea 
mays]
Length=82

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 6/82 (7%)
 Frame = +2

Query  11   SSLRSFTDVLLFVIMIMA-TEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGE  187
            +S R     L+F++M++A +EMGT       EA+ C   S +F   C     C   C+ E
Sbjct  4    TSRRMVASALVFLLMLLAASEMGTTRX---AEARHCTSQSHRFVGACMSKSNCENVCRTE  60

Query  188  GFPEGDCK--GITRRCYCIRPC  247
            GFP G+C+  GI R+C+C R C
Sbjct  61   GFPWGECRWHGIERKCHCKRIC  82



>ref|XP_002513261.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
 gb|EEF49129.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
Length=74

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 41/76 (54%), Gaps = 4/76 (5%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            + F  V L +++++A++      I+ TEA+ C   S  FK PC     C   C+ E F  
Sbjct  3    KRFFGVFLLLLIVLASQ----EAIVPTEARVCESQSHYFKGPCLRDHNCAMVCRNEAFSG  58

Query  200  GDCKGITRRCYCIRPC  247
            G CKG+ RRC+C + C
Sbjct  59   GRCKGVRRRCFCTKLC  74



>ref|XP_008389118.1| PREDICTED: defensin-like protein 1 [Malus domestica]
Length=87

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 43/87 (49%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGT------NTTIMVTEAKKCPIPSSKFKEPCDEVGKC  166
            M  S+R  +   + V++++ATEMGT      + +  V E + C   S KFK  C     C
Sbjct  1    MERSMRLVSASFVLVLLLVATEMGTMGVEARSKSSKVVEERTCEAASGKFKGLCFSSNNC  60

Query  167  VAACKGEGFPEGDCKGITRRCYCIRPC  247
               CK E F  G C+G  RRC C + C
Sbjct  61   KHTCKREQFTGGKCRGFRRRCMCNKKC  87



>dbj|BAK07043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +2

Query  68   EMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            EMG    + V EA++C  PS  F+ PC     C   C+ EGFP G+C+G+ RRC+C   C
Sbjct  45   EMGG--PVAVAEARRCESPSHMFRGPCVRGHNCANVCRTEGFPGGNCRGLRRRCFCTTHC  102



>gb|AAG51654.1|AC018908_20 unknown protein; 87272-87105 [Arabidopsis thaliana]
Length=55

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            ++  EA+ C   S+ F  PC     C   C  EGF +GDC+G  RRC C RPC
Sbjct  3    LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  55



>ref|XP_002325734.2| defensin-like family protein [Populus trichocarpa]
 gb|EEF00116.2| defensin-like family protein [Populus trichocarpa]
Length=76

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            RSF    L +I++ + E      ++ TEA+ C   S  FK PC     C   C+ EGF  
Sbjct  5    RSFGLFFLLLIVLASPE----EVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSG  60

Query  200  GDCKGITRRCYCIRPC  247
            G CKG  RRC+C + C
Sbjct  61   GRCKGFRRRCFCTKLC  76



>ref|XP_010319372.1| PREDICTED: defensin Ec-AMP-D2-like [Solanum lycopersicum]
Length=73

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 8/81 (10%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA   +      L ++++ A E+        TEA+ C   S ++K PC     C   CK 
Sbjct  1    MAGFKKLLATFFLVLMLVFAAEL--------TEARTCESQSHRYKGPCVRKNNCANVCKT  52

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C + C
Sbjct  53   EGFSGGHCRGFRRRCFCAKHC  73



>ref|XP_007226630.1| hypothetical protein PRUPE_ppa022845mg [Prunus persica]
 gb|EMJ27829.1| hypothetical protein PRUPE_ppa022845mg [Prunus persica]
Length=87

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 44/87 (51%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMG------TNTTIMVTEAKKCPIPSSKFKEPCDEVGKC  166
            M  S+R  +   + V++++A EMG       +   +  + K C   S KFK  C     C
Sbjct  1    MDRSIRLVSAAFVLVLLLVAAEMGPMAVEGRDAKKVEPKKKTCDSQSQKFKGMCFLTSSC  60

Query  167  VAACKGEGFPEGDCKGITRRCYCIRPC  247
            V +CK EGF  G C+G  RRC+C + C
Sbjct  61   VQSCKSEGFTGGQCRGFRRRCFCSKNC  87



>gb|ACV84384.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R     LL +++++ATEMG  TT+ + EA+ C   S KFK  C     C A C+ 
Sbjct  1    MALSRRMAASALLLLVLLVATEMGA-TTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRT  59

Query  185  EGFPEGDC--KGITRRCYCIRPC  247
            E FP+G+C      R+C+C RPC
Sbjct  60   ENFPDGECHTHNFARKCFCKRPC  82



>ref|XP_007156390.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
 gb|ESW28384.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
Length=78

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (56%), Gaps = 3/77 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S+   + + +F+++++ATEMG     MV EA+ C   S   +  C+    C +AC+ 
Sbjct  1    MARSVSFVSTIFVFLLLLLATEMGPR---MVAEARGCESRSRHLRGKCESDENCASACRT  57

Query  185  EGFPEGDCKGITRRCYC  235
            E F  G C+G   RC+C
Sbjct  58   ERFSGGHCRGFRCRCFC  74



>gb|EMS65298.1| Defensin-like protein 1 [Triticum urartu]
Length=82

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +MV EA+ C   S +F+ PC     C   CK EGFP+G C+G  RRC+C   C
Sbjct  28   VMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  80



>gb|EMS49334.1| Defensin-like protein [Triticum urartu]
 gb|AIA66991.1| defensin [Triticum aestivum]
Length=82

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R     LL +++++ATEMGT TT  V EA+ C   S KFK  C     C A C+ 
Sbjct  1    MALSRRMAASALLLLVLLVATEMGT-TTTKVAEARDCLSQSFKFKGACLSSSNCAAVCRT  59

Query  185  EGFPEGDC--KGITRRCYCIRPC  247
            E FP+G+C  + + R+C+C RPC
Sbjct  60   EKFPDGECHRQHLERKCFCKRPC  82



>ref|XP_006292846.1| hypothetical protein CARUB_v10019106mg [Capsella rubella]
 gb|EOA25744.1| hypothetical protein CARUB_v10019106mg [Capsella rubella]
Length=73

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 42/81 (52%), Gaps = 8/81 (10%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  SLR  + +LL ++++ AT MG        EA+ C  PSSKF   C     C  AC  
Sbjct  1    MKLSLRLVSALLLSIMLLFATGMGP------VEARTCESPSSKFSGVCLNSQTCAKACPS  54

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C  +  RCYC +PC
Sbjct  55   EGFTGGRCNSL--RCYCSKPC  73



>ref|XP_010671291.1| PREDICTED: defensin Ec-AMP-D2-like [Beta vulgaris subsp. vulgaris]
Length=78

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 5/82 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMAT-EMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACK  181
            M   +R  + +LL +++  +T E+G      V EA+ C   S +FK  C     C A C+
Sbjct  1    MDRFMRLISALLLVMLLFSSTAEVGPK----VAEARTCETRSHRFKGICGRKANCAAVCQ  56

Query  182  GEGFPEGDCKGITRRCYCIRPC  247
             EGF  G C+G  RRC+C + C
Sbjct  57   AEGFQGGHCRGFRRRCFCTKHC  78



>ref|XP_006394251.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
 gb|ESQ31537.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
Length=73

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 37/76 (49%), Gaps = 6/76 (8%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            ++F  + LF+++       ++  I+  E + C   S  FK  C     C   C+ EGF  
Sbjct  4    KTFAAIFLFLVLF------SSQKIIGIEGRMCQSKSHHFKHMCWSDHNCAIICRNEGFSG  57

Query  200  GDCKGITRRCYCIRPC  247
            G C+G  RRCYC R C
Sbjct  58   GRCRGFHRRCYCTRLC  73



>dbj|BAK07823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +MV EA+ C   S +F+ PC     C   CK EGFP+G C+G  RRC+C   C
Sbjct  51   VMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  103



>sp|O65740.1|DEF2_CAPAN RecName: Full=Defensin J1-2; Flags: Precursor [Capsicum annuum]
 emb|CAA65046.1| unnamed protein product [Capsicum annuum]
Length=74

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 39/81 (48%), Gaps = 7/81 (9%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA   +    + L ++++ AT M       V EA+ C   S +FK  C     C + C  
Sbjct  1    MAGFSKVIATIFLMMMLVFATGM-------VAEARTCESQSHRFKGLCFSKSNCGSVCHT  53

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C R C
Sbjct  54   EGFNGGHCRGFRRRCFCTRHC  74



>ref|XP_003562142.1| PREDICTED: defensin Ec-AMP-D1-like [Brachypodium distachyon]
Length=81

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +MV EA+ C   S +F+ PC     C   CK EGF +G C+G  RRC+C+  C
Sbjct  27   MMVAEARTCESRSHRFRGPCMRASNCRNVCKTEGFQDGKCRGFRRRCFCVSQC  79



>ref|XP_003575412.1| PREDICTED: defensin Tm-AMP-D1.2-like [Brachypodium distachyon]
Length=80

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 48/83 (58%), Gaps = 5/83 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R     LL +++++ATEMGT     V EA+ C   S KFK  C   G C   CK 
Sbjct  1    MALSRRMAASALLLMVLLVATEMGT---TKVAEARHCLSQSHKFKGTCVRSGNCANVCKT  57

Query  185  EGFPEGDCK--GITRRCYCIRPC  247
            E FP+G+CK  G+ R+C+C R C
Sbjct  58   ENFPDGECKTQGLERKCFCKRVC  80



>gb|ADQ43196.1| unknown [Eutrema parvulum]
Length=76

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 39/81 (48%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R  +  LL + MI    MG  T     EA+ C   S +FK  C   G C   C  
Sbjct  1    MKLSMRLISAALL-MFMIFVAAMGPVTV----EARTCESQSHRFKGKCLSDGNCGNVCHN  55

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C R C
Sbjct  56   EGFGGGKCRGFRRRCFCTRNC  76



>ref|XP_011001252.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=74

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +2

Query  77   TNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +   ++ TEA+ C   S  FK PC     C   CK EGFP G+CKG  RRC+C +PC
Sbjct  18   SQEMMVPTEARVCLSQSHNFKGPCVRGHNCANVCKTEGFPGGECKGFRRRCFCAKPC  74



>gb|AFJ04517.1| low-molecular-weight cysteine-rich 69 [Vernicia fordii]
Length=73

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +2

Query  95   VTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +TEA+ C   S KFK  C     C + CK EGF  GDC+G+ RRC+C R C
Sbjct  23   MTEARTCESQSHKFKGTCLSETNCASVCKTEGFTGGDCRGLRRRCFCTRNC  73



>ref|XP_002459605.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
 gb|EER96126.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
Length=78

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = +2

Query  77   TNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            T   I +  A+KC  PS KF+ PC     C + C  EGF  G+CKG+  RC+C R C
Sbjct  22   TQGPITMALARKCESPSLKFRGPCSRDANCASVCLTEGFTGGECKGLRHRCFCTRDC  78



>ref|XP_006367121.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=74

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 7/81 (9%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA   +    +LL ++++ +T M       + EA+ C   S +FK  C     C + C  
Sbjct  1    MAGFSKLVATILLMLMLVFSTGM-------IAEARTCESQSRRFKGLCFSKSNCGSVCHT  53

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C R C
Sbjct  54   EGFSGGHCRGFRRRCFCTRHC  74



>ref|XP_006420697.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 ref|XP_006470884.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
 gb|ESR33937.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 gb|KDO53542.1| hypothetical protein CISIN_1g034999mg [Citrus sinensis]
Length=76

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S+R F+ VLL V++++A+EMG    +   EA+ C   S +FK PC     C A C+ 
Sbjct  1    MERSVRLFSTVLL-VLLLLASEMG----LRAAEARICESQSHRFKGPCVSKSNCAAVCQT  55

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G  RRC+C + C
Sbjct  56   EGFHGGHCRGFRRRCFCTKRC  76



>ref|XP_009397593.1| PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=77

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            ++  E + C   S++FK  C     C + C+GEGFP+G C+G+ RRC C +PC
Sbjct  25   MVAVEGRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  77



>gb|AGC82207.1| defensin [Persea americana var. drymifolia]
Length=78

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 36/71 (51%), Gaps = 4/71 (6%)
 Frame = +2

Query  35   VLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKG  214
            +LL   +++ +E+         EA  C  PS  F   C     C + C GE F +G C+G
Sbjct  12   LLLLCFLVIVSEIAVTRV----EAATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQG  67

Query  215  ITRRCYCIRPC  247
            + RRC C++PC
Sbjct  68   VRRRCMCLKPC  78



>gb|AHA50470.1| defensin-like protein 1 [Citrullus lanatus]
Length=74

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = +2

Query  17   LRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFP  196
            ++ F+  +L +++++AT MG     MVT+A+ C  PS  FK  C     C   CK EGF 
Sbjct  1    MKFFSAAILLLLLLLATGMGP----MVTDARTCESPSRHFKGLCFSKNNCGHVCKTEGFH  56

Query  197  EGDCKGITRRCYCIRPC  247
             G C+G  RRC+C + C
Sbjct  57   GGHCRGFRRRCFCTKHC  73



>ref|XP_004306561.1| PREDICTED: defensin D2-like [Fragaria vesca subsp. vesca]
Length=74

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 40/76 (53%), Gaps = 5/76 (7%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            + F   L F+I++ + EM     ++ +EA+ C +PS  FK  C     C+  C  EG+  
Sbjct  4    KYFGFALFFIILLTSQEM-----VIQSEARVCEVPSKTFKGMCFRDTHCIVRCHSEGYGY  58

Query  200  GDCKGITRRCYCIRPC  247
            G C  + RRC C++ C
Sbjct  59   GKCSHVLRRCKCLKAC  74



>ref|XP_002865329.1| hypothetical protein ARALYDRAFT_917107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41588.1| hypothetical protein ARALYDRAFT_917107 [Arabidopsis lyrata subsp. 
lyrata]
Length=81

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M SS++  + +   VI+++A  M      MV   + C   S  F+  C +   C   C  
Sbjct  1    MKSSIQLISTLFFLVILVLAPGMMK----MVEGQQMCETQSINFRGMCTKWRNCQRVCMS  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGFP+G CKG  R+C C +PC
Sbjct  57   EGFPDGRCKGFIRKCICTKPC  77



>gb|EMT00351.1| Defensin-like protein [Aegilops tauschii]
Length=82

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R     LL +++++ATEMG  TT  V EA+ C   S KFK  C     C   C+ 
Sbjct  1    MALSRRMAASTLLLLVLLVATEMGA-TTTKVAEARDCLSQSFKFKGACLSSSNCAGVCRT  59

Query  185  EGFPEGDC--KGITRRCYCIRPC  247
            E FP+G+C  + + R+C+C +PC
Sbjct  60   ENFPDGECHRQHLERKCFCKKPC  82



>gb|ABS72000.1| putative defensin protein 1 [Olea europaea]
Length=56

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +MV +A+ C   S +FK  C     C A C+ EGFP+G C+G  RRC+C + C
Sbjct  4    LMVADARTCESQSHRFKGSCVSKSNCAAVCQTEGFPDGYCRGFRRRCFCSKHC  56



>ref|XP_010908980.1| PREDICTED: defensin Ec-AMP-D1-like [Elaeis guineensis]
 gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis]
Length=77

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S R    +LL + ++M +EMGT     V EA+ C   S KF+  C     C   C+ 
Sbjct  1    MEHSRRMLPAILLLLFLLMPSEMGTK----VAEARTCESQSHKFQGTCLRESNCANVCQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G+ RRC+C R C
Sbjct  57   EGFQGGVCRGVRRRCFCTRLC  77



>ref|XP_002325735.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
 gb|ABK93028.1| unknown [Populus trichocarpa]
 gb|ABK93041.1| unknown [Populus trichocarpa]
 gb|ABK93536.1| unknown [Populus trichocarpa]
 gb|ABK93961.1| unknown [Populus trichocarpa]
 gb|ABK94429.1| unknown [Populus trichocarpa]
 gb|ABK94555.1| unknown [Populus trichocarpa]
 gb|EEF00117.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
Length=74

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +2

Query  77   TNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +   ++  EA+ C   S  FK PC     C + CK EGFP G+CKG  RRC+C +PC
Sbjct  18   SQEMMVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKGFRRRCFCAKPC  74



>emb|CDP10467.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +2

Query  107  KKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            + C  PS +FK PC +   C A C+ EGF  G C+G+ RRC+C RPC
Sbjct  55   RTCETPSKRFKGPCVKESNCAAVCQTEGFQGGKCRGLRRRCFCTRPC  101



>gb|ABA86587.1| putative defensin 1 [Aquilegia chrysantha]
Length=70

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 32/61 (52%), Gaps = 4/61 (7%)
 Frame = +2

Query  65   TEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRP  244
            TEMG    + V  A+ C   S KFK  C     C + C  EGF  G C+G+TRRCYC   
Sbjct  12   TEMG----LKVAXARDCESQSHKFKGTCIRXSNCASVCXSEGFNGGHCRGVTRRCYCTAK  67

Query  245  C  247
            C
Sbjct  68   C  68



>gb|ABA86586.1| putative defensin 1 [Aquilegia formosa]
Length=70

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 33/61 (54%), Gaps = 4/61 (7%)
 Frame = +2

Query  65   TEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRP  244
            TEMG      V EA+ C   S KFK  C     C + C+ EGF  G C+G+TRRCYC   
Sbjct  12   TEMGPK----VAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAK  67

Query  245  C  247
            C
Sbjct  68   C  68



>gb|ACG41256.1| low-molecular-weight cysteine-rich protein LCR70 precursor [Zea 
mays]
Length=82

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 6/82 (7%)
 Frame = +2

Query  11   SSLRSFTDVLLFVIMIMA-TEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGE  187
            +S R     L+F++M++A +EMGT     V EA+ C   S +F   C     C   C+ E
Sbjct  4    TSRRMVASALVFLLMLLAASEMGTTR---VAEARHCTSQSHRFVGACMSKSNCENVCRTE  60

Query  188  GFPEGDCK--GITRRCYCIRPC  247
            GFP  +C+  GI R+C C R C
Sbjct  61   GFPWXECRWHGIERKCXCKRIC  82



>ref|XP_010260874.1| PREDICTED: defensin D2-like [Nelumbo nucifera]
Length=72

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 38/67 (57%), Gaps = 5/67 (7%)
 Frame = +2

Query  47   VIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRR  226
            ++  +A EM     ++  +A+ C  PS  F+  C     C   C+ EGFP+G CKG+ RR
Sbjct  9    LLWFVAEEM-----VVHVDARMCDTPSRLFRGLCLINRNCDNTCRVEGFPDGHCKGLRRR  63

Query  227  CYCIRPC  247
            C+C RPC
Sbjct  64   CFCSRPC  70



>gb|EYU40734.1| hypothetical protein MIMGU_mgv11b023365mg [Erythranthe guttata]
Length=80

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 6/79 (8%)
 Frame = +2

Query  29   TDVLLFVIMIMATEMGTNTT------IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEG  190
            T V + +++++     +N        + + E K+C   S KF   C    KC   C  EG
Sbjct  2    TAVFMLMLLLINVSAQSNVDGEIADYLKIEEKKRCNYESKKFWGICLSDSKCGEVCTKEG  61

Query  191  FPEGDCKGITRRCYCIRPC  247
            F  GDCKG+ RRCYC   C
Sbjct  62   FEGGDCKGLRRRCYCFNNC  80



>gb|KDP32807.1| hypothetical protein JCGZ_12099 [Jatropha curcas]
Length=77

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M   +R F+ +LL +++++ATE G     MV EA+ C   S +FK  C     C A C+ 
Sbjct  1    MKCPMRLFSTLLLLLLLLLATETGP----MVAEARTCESLSHRFKGICVRNSNCAAICQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G+ RRC+C + C
Sbjct  57   EGFQGGHCRGLRRRCFCTKHC  77



>gb|AIA66989.1| defensin [Triticum aestivum]
Length=82

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 3/83 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R     LL +++++ATEMG  TT+ + EA+ C   S KFK  C     C A C+ 
Sbjct  1    MALSRRMAASALLLLVLLVATEMGA-TTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRT  59

Query  185  EGFPEGDC--KGITRRCYCIRPC  247
            E FP+G+C      R+C+C R C
Sbjct  60   ENFPDGECHTHNFARKCFCKRAC  82



>ref|XP_007045353.1| Defensin-like protein isoform 1 [Theobroma cacao]
 gb|EOY01185.1| Defensin-like protein isoform 1 [Theobroma cacao]
Length=78

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 5/82 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATE-MGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACK  181
            M  S R F+   + +++++ATE MG        EA+ C   S +FK  C     C A C+
Sbjct  1    MERSTRLFSAAFVLLLLLLATEEMGPK----AAEARTCQSQSHRFKGMCMRKSNCAAVCQ  56

Query  182  GEGFPEGDCKGITRRCYCIRPC  247
             EGF  G C+G  RRC+C + C
Sbjct  57   TEGFHSGHCRGFHRRCFCTKHC  78



>ref|XP_009763849.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=76

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 36/76 (47%), Gaps = 2/76 (3%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            R  T   LFV +I+         +   EA+ C  PS  +  PC     C   C+ EGF  
Sbjct  3    RKGTFGFLFVFLIIFVS--QMEMMRQVEARVCMSPSHGYHGPCWHDHNCALVCRNEGFSG  60

Query  200  GDCKGITRRCYCIRPC  247
            GDC GI R+CYC + C
Sbjct  61   GDCVGIQRKCYCTKLC  76



>ref|XP_002875116.1| hypothetical protein ARALYDRAFT_904442 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51375.1| hypothetical protein ARALYDRAFT_904442 [Arabidopsis lyrata subsp. 
lyrata]
Length=73

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 42/81 (52%), Gaps = 8/81 (10%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  SLR  + +LL V+++ AT MG        EA+ C  PS+KF+  C     C  AC  
Sbjct  1    MKLSLRLISALLLSVMLLFATGMGP------VEARTCESPSNKFQGVCLNSQSCAKACPS  54

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C  +  RCYC + C
Sbjct  55   EGFSGGRCSSL--RCYCSKAC  73



>gb|ACV84381.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 46/83 (55%), Gaps = 3/83 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R     LL +++++ATEMG  TT  V EA+ C   S  FK  C     C A C+ 
Sbjct  1    MALSRRMAPSALLLLVLLVATEMGA-TTTKVAEARDCVSQSHNFKGACLSSSNCPAVCRT  59

Query  185  EGFPEGDCK--GITRRCYCIRPC  247
            E FP+G+C      R+C+C RPC
Sbjct  60   ENFPDGECHTPHFERKCFCKRPC  82



>ref|XP_010675152.1| PREDICTED: defensin-like protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=73

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 33/72 (46%), Gaps = 0/72 (0%)
 Frame = +2

Query  32   DVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCK  211
            D  LF + I+   +  +  +   E + C   S  FK PC     C   C+ EGF  G C 
Sbjct  2    DRRLFGLCILFLVLFASPEVKQAEGRVCQSRSHYFKGPCARDHNCAYVCRNEGFSGGRCH  61

Query  212  GITRRCYCIRPC  247
            G  RRCYC R C
Sbjct  62   GFFRRCYCTRLC  73



>gb|KEH35661.1| Defensin [Medicago truncatula]
Length=73

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (55%), Gaps = 5/71 (7%)
 Frame = +2

Query  35   VLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKG  214
                +++++A++M     ++ TE + C   S +FK  C     C + C  EGFP G+C+G
Sbjct  8    FFFILLILLASQM-----MVQTEGRHCESKSHRFKGMCMSDHNCASVCHVEGFPGGNCRG  62

Query  215  ITRRCYCIRPC  247
              RRC+C + C
Sbjct  63   FRRRCFCKKRC  73



>sp|P81571.1|DEFD2_SPIOL RecName: Full=Defensin D2; AltName: Full=Antimicrobial peptide 
D2; AltName: Full=So-D2, partial [Spinacia oleracea]
Length=52

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +2

Query  95   VTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +  ++KC  PS  FK  C     C  +C+ EG+P GDCKGI RRC C +PC
Sbjct  2    IFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC  52



>gb|EYU27578.1| hypothetical protein MIMGU_mgv1a026683mg [Erythranthe guttata]
Length=74

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = +2

Query  95   VTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
             T A+ C   SS FK  C     C A C GE FP+G C G  RRC+C +PC
Sbjct  24   TTMARTCTSKSSNFKGLCFSSHNCKAVCNGENFPDGKCHGFKRRCFCQKPC  74



>ref|XP_007137817.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
 gb|ESW09811.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
Length=145

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (54%), Gaps = 5/71 (7%)
 Frame = +2

Query  35   VLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKG  214
                +++++A++M     ++ TE + C   S +FK  C     C + C  EGF  G+C+G
Sbjct  80   FFFMLLILLASQM-----MVQTEGRHCESKSHRFKGMCLSDRNCASVCHLEGFTGGNCRG  134

Query  215  ITRRCYCIRPC  247
              RRC+C R C
Sbjct  135  FRRRCFCTRHC  145



>gb|AAL14240.1| proteinase inhibitor [Musa acuminata AAA Group]
Length=49

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  101  EAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            E++ C   S++FK  C     C + C+GEGFP+G C+G+ RRC C +PC
Sbjct  1    ESRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  49



>gb|EYU27577.1| hypothetical protein MIMGU_mgv1a024490mg [Erythranthe guttata]
Length=71

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 37/71 (52%), Gaps = 8/71 (11%)
 Frame = +2

Query  35   VLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKG  214
            ++LF++ + A E     T        C   S  F+ PC     C A C+ EGF +GDC+G
Sbjct  9    LVLFLVFVFACEEAKGRT--------CESQSFNFRGPCVIDHNCKAVCESEGFTDGDCQG  60

Query  215  ITRRCYCIRPC  247
              RRC+C +PC
Sbjct  61   FRRRCFCRKPC  71



>gb|AIA67012.1| defensin [Triticum aestivum]
Length=82

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +MV EA+ C   S +F+ PC     C   C+ EGF +G C+G  RRC+C   C
Sbjct  28   VMVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGKCRGFRRRCFCTTHC  80



>ref|XP_003526900.1| PREDICTED: defensin-like protein 6-like [Glycine max]
 gb|ACU20671.1| unknown [Glycine max]
 gb|KHN09676.1| Defensin-like protein 6 [Glycine soja]
Length=73

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 0/72 (0%)
 Frame = +2

Query  32   DVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCK  211
            D   F    M   + ++  ++ TE + C   S +FK  C     C + C  EGF  G C+
Sbjct  2    DKARFGFFFMLLILLSSQMVVQTEGRHCESKSHRFKGMCLSKHNCASVCHLEGFTGGKCR  61

Query  212  GITRRCYCIRPC  247
            G  RRC+C R C
Sbjct  62   GFRRRCFCTRHC  73



>ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
 ref|XP_004171498.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
Length=74

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 0/66 (0%)
 Frame = +2

Query  50   IMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRC  229
            I ++    G+    MV EA+ C  PS  FK  C     C   CK EGF  G C+G  RRC
Sbjct  8    IFLLLLIFGSGMAPMVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGVCRGFRRRC  67

Query  230  YCIRPC  247
            +C + C
Sbjct  68   FCTKHC  73



>dbj|BAH29762.1| defensin-like cystein-rich peptide [Torenia fournieri]
Length=71

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  CPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            C  PS KFK PC     C + C+GEGF  G+C+G  RRC+C +PC
Sbjct  27   CRSPSQKFKGPCFSDSNCQSVCEGEGFTGGECEGFRRRCFCSKPC  71



>gb|ABA86589.1| putative defensin 1 [Aquilegia pyrenaica]
 gb|ABA86590.1| putative defensin 1 [Aquilegia olympica]
Length=70

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 32/61 (52%), Gaps = 4/61 (7%)
 Frame = +2

Query  65   TEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRP  244
            TEMG        EA+ C   S KFK  C     C + C+ EGF  G C+G+TRRCYC   
Sbjct  12   TEMGPK----AAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAK  67

Query  245  C  247
            C
Sbjct  68   C  68



>ref|NP_178322.1| defensin-like protein 10 [Arabidopsis thaliana]
 sp|Q9ZUL8.1|DEF10_ARATH RecName: Full=Defensin-like protein 10; AltName: Full=Low-molecular-weight 
cysteine-rich protein 72; Short=Protein LCR72; 
AltName: Full=Plant defensin 2.6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97220.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAM64623.1| protease inhibitor II [Arabidopsis thaliana]
 gb|ABI49429.1| At2g02140 [Arabidopsis thaliana]
 gb|AEC05550.1| defensin-like protein 10 [Arabidopsis thaliana]
Length=73

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 42/81 (52%), Gaps = 8/81 (10%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  SLR  + +L+ V+++ AT MG        EA+ C  PS+KF+  C     C  AC  
Sbjct  1    MKLSLRLISALLMSVMLLFATGMGP------VEARTCESPSNKFQGVCLNSQSCAKACPS  54

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C  +  RCYC + C
Sbjct  55   EGFSGGRCSSL--RCYCSKAC  73



>gb|ADK36631.1| defensin-like protein, partial [Solanum lycopersicum var. cerasiforme]
Length=48

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  104  AKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            A+ C   S +FK PC     C + C+ EGF  GDC+G  RRC+C RPC
Sbjct  1    ARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  48



>ref|XP_002459603.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
 gb|EER96124.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
Length=79

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            + +  A+KC  PS +F+ PC     C   C+ EGF  G CKG+  RC+C + C
Sbjct  27   VTMALARKCESPSHRFQGPCSRDANCATVCRTEGFTGGKCKGLRHRCFCTKDC  79



>gb|EMT22729.1| Defensin Tk-AMP-D2 [Aegilops tauschii]
Length=76

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 34/65 (52%), Gaps = 5/65 (8%)
 Frame = +2

Query  59   MATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDC--KGITRRCY  232
            +ATEMGT  T    EA+ C   S KFK PC     C   C+ E FP G C    + R+CY
Sbjct  15   VATEMGTTKTA---EARTCESQSHKFKGPCFSDSNCATVCRTENFPRGQCNTHHVERKCY  71

Query  233  CIRPC  247
            C R C
Sbjct  72   CERDC  76



>ref|NP_201171.1| defensin-like protein 6 [Arabidopsis thaliana]
 sp|Q9FFP8.1|DEF06_ARATH RecName: Full=Defensin-like protein 6; AltName: Full=Low-molecular-weight 
cysteine-rich protein 74; Short=Protein LCR74; 
AltName: Full=Plant defensin 2.5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10459.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97782.1| defensin-like protein 6 [Arabidopsis thaliana]
Length=73

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 32/74 (43%), Gaps = 6/74 (8%)
 Frame = +2

Query  26   FTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGD  205
            F    L +++  + E      I+  E + C   S  FK  C     C   C+ EGF  G 
Sbjct  6    FAAFFLLLVLFSSQE------IIGGEGRTCQSKSHHFKYMCTSNHNCAIVCRNEGFSGGR  59

Query  206  CKGITRRCYCIRPC  247
            C G  RRCYC R C
Sbjct  60   CHGFHRRCYCTRLC  73



>ref|XP_002459604.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
 gb|EER96125.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
Length=78

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            + V  A+KC   S KFK PC     C   C  EGF  G C+G+ RRC+C R C
Sbjct  26   VTVALARKCQSKSFKFKGPCSRDENCATVCLTEGFTSGKCRGLRRRCFCTRDC  78



>gb|ABK23404.1| unknown [Picea sitchensis]
 gb|ABK23503.1| unknown [Picea sitchensis]
 gb|ABR17883.1| unknown [Picea sitchensis]
 gb|ACN40306.1| unknown [Picea sitchensis]
Length=83

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 41/83 (49%), Gaps = 8/83 (10%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            + S L +F  ++L VI I   ++       + EA+ C  PS KFK  C     C   C+ 
Sbjct  6    VGSRLSAFFLLVLLVISIGMIQL------ELAEARTCKTPSGKFKGVCASSNNCKNVCQT  59

Query  185  EGFPEGDC--KGITRRCYCIRPC  247
            EGFP G C      R+CYC +PC
Sbjct  60   EGFPSGSCDFHVANRKCYCSKPC  82



>ref|XP_006649329.1| PREDICTED: defensin J1-2-like [Oryza brachyantha]
Length=80

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +MV EA+ C   S +F   C     C + C  EGF  G C+G  RRC+C +PC
Sbjct  28   VMVAEARTCESQSHRFNGVCVRSSNCASVCSTEGFTGGHCRGFRRRCFCTKPC  80



>ref|XP_002864860.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41119.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=73

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (6%)
 Frame = +2

Query  41   LFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGIT  220
             F+++++ +  G    I+ ++ + C   S  FK  C     C   C+ EGF  G C G  
Sbjct  9    FFLLLVLISCQG----IIGSDGRTCQSKSHHFKYMCTSSHNCAIVCRNEGFSGGRCHGFH  64

Query  221  RRCYCIRPC  247
            RRCYC R C
Sbjct  65   RRCYCTRLC  73



>gb|AIA67000.1| defensin [Triticum aestivum]
Length=84

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 34/65 (52%), Gaps = 5/65 (8%)
 Frame = +2

Query  59   MATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDC--KGITRRCY  232
            +ATEMGT  T    EA+ C   S KFK PC     C   C+ E FP G C    + R+CY
Sbjct  23   VATEMGTTKTA---EARTCESQSHKFKGPCFSDSNCATVCRTENFPRGQCNTHHVERKCY  79

Query  233  CIRPC  247
            C R C
Sbjct  80   CERDC  84



>gb|ADB02899.1| gamma-thionin PPT precursor defensin 1-like protein [Jatropha 
curcas]
Length=92

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M   +R F+ +LL +++++ATE G     MV EA+ C   S +FK  C     C A C+ 
Sbjct  1    MKCPMRLFSTLLLLLLLLLATETGP----MVAEARTCESLSHRFKGICVRNSNCAAICQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G+ RRC+C   C
Sbjct  57   EGFQGGHCRGLRRRCFCTMYC  77



>gb|AFD01290.1| defensin 3 [Pinus sylvestris]
Length=83

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 37/76 (49%), Gaps = 5/76 (7%)
 Frame = +2

Query  26   FTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGD  205
               + L V++++   M     + V E + C  PS KFK  C     C   C+ EGFP G 
Sbjct  10   LNAIFLLVLLVITIGM---MAVQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTEGFPSGS  66

Query  206  C--KGITRRCYCIRPC  247
            C     +R+CYC +PC
Sbjct  67   CDFHVTSRKCYCYKPC  82



>ref|XP_009631841.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=62

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 33/65 (51%), Gaps = 3/65 (5%)
 Frame = +2

Query  53   MIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCY  232
            MI A +M     +   EA+ C  PS  +  PC     C   C+ EGF  GDC GI R+CY
Sbjct  1    MIFALQMEMMPQV---EARVCMSPSHGYHGPCWHDHNCALVCRNEGFSGGDCVGIQRKCY  57

Query  233  CIRPC  247
            C + C
Sbjct  58   CTKLC  62



>ref|XP_010675153.1| PREDICTED: defensin-like protein 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=72

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 34/76 (45%), Gaps = 7/76 (9%)
 Frame = +2

Query  20   RSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPE  199
            R F   +LF+++         + +   E + C   S  FK PC     C   C+ EGF  
Sbjct  4    RLFGLCILFLVLFA-------SQVKQAEGRVCQSRSHYFKGPCARDHNCAYVCRNEGFSG  56

Query  200  GDCKGITRRCYCIRPC  247
            G C G  RRCYC R C
Sbjct  57   GRCHGFFRRCYCTRLC  72



>gb|AIA66994.1| defensin [Triticum aestivum]
Length=82

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 3/83 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA + R     LL +++++ATEMGT T     EA+ C   S KFK  C     C   C+ 
Sbjct  1    MALTRRMAASALLLLLLLVATEMGT-TRTKTAEARDCLSQSHKFKGACLSSSNCAGVCRT  59

Query  185  EGFPEGDC--KGITRRCYCIRPC  247
            E FP+G+C      R+C+C R C
Sbjct  60   ENFPDGECHTHNFARKCFCKRAC  82



>gb|EMT06279.1| Defensin-like protein 2 [Aegilops tauschii]
Length=82

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 3/83 (4%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA + R     LL +++++ATEMGT T     EA+ C   S KFK  C     C   C+ 
Sbjct  1    MAPTRRMAASALLLLLLLVATEMGT-TRTKTAEARDCLSQSHKFKGACLSSSNCAGVCRT  59

Query  185  EGFPEGDC--KGITRRCYCIRPC  247
            E FP+G+C      R+C+C R C
Sbjct  60   ENFPDGECHTHNFARKCFCKRAC  82



>ref|XP_009353671.1| PREDICTED: defensin-like protein 2 [Pyrus x bretschneideri]
Length=87

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKK------CPIPSSKFKEPCDEVGKC  166
            M  S+R  +   + V+++ ATEMG       TE+ K      C +PS+ FK  C     C
Sbjct  1    MERSMRLVSATFVLVLLLAATEMGPMDVEARTESSKAVEGKICEVPSTLFKGLCFSSNNC  60

Query  167  VAACKGEGFPEGDCKGITRRCYCIRPC  247
               C+ E F  G C  +TR C C + C
Sbjct  61   KHTCRKEQFTRGHCSVLTRACVCTKKC  87



>gb|ADQ43197.1| unknown [Eutrema parvulum]
Length=72

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 41/81 (51%), Gaps = 9/81 (11%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  SLR  + +LL  ++++A  MG        EAK C  PS K+   C     C + C  
Sbjct  1    MKLSLRLASSILLSFMLLLAA-MGQ------VEAKTCESPSGKYHGVCLNAKNCASVCPS  53

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G CK +  RCYCI+ C
Sbjct  54   EGFTGGHCKSL--RCYCIKTC  72



>ref|XP_009353672.1| PREDICTED: defensin-like protein 2 [Pyrus x bretschneideri]
Length=87

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKK------CPIPSSKFKEPCDEVGKC  166
            M  S+R  +   + V+++ ATEMG       TE+ K      C +PS+ FK  C     C
Sbjct  1    MERSMRLVSAAFVLVLLLAATEMGPMGVKARTESSKAVEGKICEVPSTLFKGLCFSSNNC  60

Query  167  VAACKGEGFPEGDCKGITRRCYCIRPC  247
               C+ E F  G C  +TR C C + C
Sbjct  61   KHTCRKEQFTRGHCSVLTRACVCTKKC  87



>gb|ACI02057.1| fabatin precursor [Vicia faba]
Length=74

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (56%), Gaps = 5/72 (7%)
 Frame = +2

Query  23   SFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEG  202
            SFT  +LF++++    + T+  ++     +C + S++F  PC     C   C+GEG+  G
Sbjct  7    SFT-FMLFLLLVADVSVKTSEALL----GRCKVKSNRFNGPCLTDTHCSTVCRGEGYKGG  61

Query  203  DCKGITRRCYCI  238
            DC G  RRC C+
Sbjct  62   DCHGFRRRCMCL  73



>ref|XP_009101271.1| PREDICTED: defensin-like protein 10 [Brassica rapa]
 emb|CDY17612.1| BnaA06g34310D [Brassica napus]
 emb|CDY03075.1| BnaC07g21520D [Brassica napus]
Length=73

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 8/81 (10%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  SLR  + +LL  ++++A  M      +  EA+ C  PS+KF+  C     C   C G
Sbjct  1    MKLSLRLVSTILLSFMLLLAAGM------IPVEARTCESPSTKFQGVCLNAKNCAGVCTG  54

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C  +  +CYC + C
Sbjct  55   EGFTGGQCSSL--KCYCTKTC  73



>dbj|BAK06284.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=100

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 41/81 (51%), Gaps = 6/81 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M SS + F+ V + +++++ATE+         +A++C + S +F   C     C   C  
Sbjct  26   MESSHKLFSAVAILLLLVVATEVAP------AQARECEVESERFNGLCFVSANCAGVCGA  79

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C G+ R C C + C
Sbjct  80   EGFTGGKCSGLKRSCMCTKQC  100



>ref|XP_008360020.1| PREDICTED: defensin-like protein 2 [Malus domestica]
Length=87

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 40/87 (46%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKK------CPIPSSKFKEPCDEVGKC  166
            M  S+R  +   + V+   AT MG  +    TE+ K      C +PS+ FK  C     C
Sbjct  1    MERSMRLVSAAFILVMFFAATXMGPMSVEARTESSKAIEGKICEVPSTLFKGLCFSSNNC  60

Query  167  VAACKGEGFPEGDCKGITRRCYCIRPC  247
               C+ E F  G C G+TR C C + C
Sbjct  61   KHTCRKEQFTRGKCSGLTRTCVCTKKC  87



>gb|AFK47422.1| unknown [Lotus japonicus]
Length=74

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = +2

Query  38   LLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGI  217
            L FV+ I+   + ++  ++ TE + C   S +F   C     C + C  EGF  G C+G 
Sbjct  8    LFFVLFIL---LASHQMVVQTEGRHCESKSHRFHGLCLSHHNCASVCHLEGFTGGKCRGF  64

Query  218  TRRCYCIRPC  247
             +RC+C + C
Sbjct  65   RKRCFCKKRC  74



>ref|XP_009345992.1| PREDICTED: defensin-like protein 2 [Pyrus x bretschneideri]
 dbj|BAB64930.1| defensin-like protein [Pyrus pyrifolia]
Length=87

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKK------CPIPSSKFKEPCDEVGKC  166
            M  S+R  +   + V+++ ATEMG       TE+ K      C +PS+ FK  C     C
Sbjct  1    MERSMRLVSAAFVLVLLLAATEMGPMGVEARTESSKAVEGKICEVPSTLFKGLCFSSNNC  60

Query  167  VAACKGEGFPEGDCKGITRRCYCIRPC  247
               C+ E F  G C  +TR C C + C
Sbjct  61   KHTCRKEQFTRGHCSVLTRACVCTKKC  87



>emb|CAA62761.1| putative gamma-thionin protein [Picea abies]
Length=83

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 38/76 (50%), Gaps = 5/76 (7%)
 Frame = +2

Query  26   FTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGD  205
             + + L V+++++  M     + + E + C  PS KFK  C     C   C+ EGFP G 
Sbjct  10   LSAIFLLVLLVISIGM---MQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGS  66

Query  206  C--KGITRRCYCIRPC  247
            C      R+CYC +PC
Sbjct  67   CDFHVANRKCYCSKPC  82



>ref|XP_011070576.1| PREDICTED: defensin Ec-AMP-D1-like [Sesamum indicum]
Length=84

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 36/72 (50%), Gaps = 2/72 (3%)
 Frame = +2

Query  38   LLFVIMIMATEMGTNTTIMVTEAKK--CPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCK  211
             + ++MI     G     +  E KK  C   S KF   C    KC + CK EGF  G C+
Sbjct  13   FMLLLMIQGICPGAAAEGLRVEEKKKTCLYKSKKFGGICIAGAKCDSVCKREGFQGGKCR  72

Query  212  GITRRCYCIRPC  247
            G+ RRCYC +PC
Sbjct  73   GLRRRCYCFKPC  84



>ref|XP_009590912.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=74

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query  38   LLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGI  217
            L+F+++I+     +   I   E + C   S  ++ PC     C   C+ EGF  GDC G 
Sbjct  8    LIFLLLIV---FASQMAIQRAEGRVCISQSHGYRGPCVHDHNCALVCRNEGFSGGDCIGW  64

Query  218  TRRCYCIRPC  247
             RRC+C + C
Sbjct  65   RRRCFCTKLC  74



>ref|XP_008340512.1| PREDICTED: defensin-like protein 1 [Malus domestica]
Length=90

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 43/90 (48%), Gaps = 9/90 (10%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMG--------TNTTIMVTEAKKC-PIPSSKFKEPCDEV  157
            M  S+R  +   + +++++ T MG          T+    E KKC   PSSKFK  C   
Sbjct  1    MEPSMRFVSAAFVLILLLVTTGMGPMAAEGRSGMTSKGAAEKKKCDSHPSSKFKGVCFFT  60

Query  158  GKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
              CV  CK EG   G C+G  RRC C + C
Sbjct  61   NNCVDTCKLEGSSGGQCRGFRRRCICTKQC  90



>ref|XP_007203247.1| hypothetical protein PRUPE_ppa019504mg [Prunus persica]
 gb|EMJ04446.1| hypothetical protein PRUPE_ppa019504mg [Prunus persica]
Length=85

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMG----TNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVA  172
            M  S R F+ V + +++++A E G            E++ C   S+KFK  C    +C  
Sbjct  1    MEGSRRMFSTVFILILLLVAIETGPMVAEGKVATKEESRTCESLSTKFKGFCLRSSRCAE  60

Query  173  ACKGEGFPEGDCKGITRRCYCIRPC  247
            AC+ EGF  G C G   RC C + C
Sbjct  61   ACQKEGFMGGKCPGFRLRCTCTKKC  85



>emb|CDY39856.1| BnaC02g42620D [Brassica napus]
 emb|CDY31356.1| BnaA02g33850D [Brassica napus]
Length=73

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (46%), Gaps = 6/74 (8%)
 Frame = +2

Query  26   FTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGD  205
            F    LF+++  + E      ++  E + C   S  F+  C     C   C+GE F  G 
Sbjct  6    FAAFFLFLVLFSSQE------VIGIEGRMCQSRSHHFRSICLSNHNCANICRGERFSGGR  59

Query  206  CKGITRRCYCIRPC  247
            C G+ R+CYC R C
Sbjct  60   CHGLHRKCYCTRLC  73



>gb|AIA67010.1| defensin [Triticum aestivum]
Length=84

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 28/53 (53%), Gaps = 0/53 (0%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            + V EA+ C   S +F+ PC     C   CK EGFP G C+G   RC+C   C
Sbjct  30   VAVAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTHC  82



>dbj|BAC10287.1| defensin [Triticum aestivum]
 gb|EMS52103.1| Defensin Tk-AMP-D2 [Triticum urartu]
 gb|AGX26528.1| defensin [Triticum aestivum]
 gb|AIA66998.1| defensin [Triticum aestivum]
Length=82

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 34/63 (54%), Gaps = 5/63 (8%)
 Frame = +2

Query  65   TEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKG--ITRRCYCI  238
            TEMGT   +   EA+ C   S KFK  C     C A C+ E FP+G+C    + R+CYC 
Sbjct  23   TEMGT---MKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCK  79

Query  239  RPC  247
            R C
Sbjct  80   RTC  82



>emb|CEJ09689.1| Defensin protein [Zea mays]
 emb|CEJ09691.1| Defensin protein [Zea mays]
Length=80

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 5/83 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R    VL+ +++++ATE+GT     V EA+ C   S +FK  C     C  AC+ 
Sbjct  1    MAPSRRMAAPVLVLLLLLVATELGT---TKVAEARHCLSQSHRFKGLCMSSNNCANACQT  57

Query  185  EGFPEGDCK--GITRRCYCIRPC  247
            E FP G+CK  G TR+C+C + C
Sbjct  58   ENFPGGECKAEGATRKCFCKKIC  80



>ref|XP_004976261.1| PREDICTED: defensin-like protein P322-like [Setaria italica]
Length=83

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 35/64 (55%), Gaps = 5/64 (8%)
 Frame = +2

Query  62   ATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCK--GITRRCYC  235
            A+E+G      V EA+ C   S KF+  C     C   CK EGFP G+CK  GI R+CYC
Sbjct  23   ASEIGP---TRVAEARHCVSQSHKFEGTCTRKSNCENVCKTEGFPWGECKWHGIVRKCYC  79

Query  236  IRPC  247
             R C
Sbjct  80   KRLC  83



>gb|AAS13434.1| defensin [Nicotiana attenuata]
Length=52

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (54%), Gaps = 0/52 (0%)
 Frame = +2

Query  92   MVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            MV EA+ C   S +F+  C     C + C  EGF  G C+G  RRC+C R C
Sbjct  1    MVAEARTCESQSRRFRGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC  52



>gb|EMT03365.1| Defensin-like protein 1 [Aegilops tauschii]
Length=82

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 28/53 (53%), Gaps = 0/53 (0%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            + V EA+ C   S +F+ PC     C   CK EGFP G C+G   RC+C   C
Sbjct  28   VAVAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTHC  80



>ref|XP_008340513.1| PREDICTED: defensin-like protein 1 [Malus domestica]
 gb|AFH74425.1| defensin [Malus domestica]
Length=87

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 38/87 (44%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMG------TNTTIMVTEAKKCPIPSSKFKEPCDEVGKC  166
            M  S+R  +   + V+++  TEMG       + +    E + C   S KFK  C     C
Sbjct  1    MEHSMRLVSAAFVLVLLLATTEMGPMGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNNC  60

Query  167  VAACKGEGFPEGDCKGITRRCYCIRPC  247
               C  E F  G CKG  RRC C + C
Sbjct  61   ANTCAREKFDGGKCKGFRRRCMCTKKC  87



>gb|ABK25062.1| unknown [Picea sitchensis]
Length=83

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 39/81 (48%), Gaps = 8/81 (10%)
 Frame = +2

Query  11   SSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEG  190
            S L +F  ++L VI I   ++       + E + C  PS KFK  C     C   C+ EG
Sbjct  8    SRLSAFFLLVLLVISIGMMQL------ELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEG  61

Query  191  FPEGDC--KGITRRCYCIRPC  247
            FP G C      R+CYC +PC
Sbjct  62   FPSGSCDFHVANRKCYCSKPC  82



>gb|AIA67014.1| defensin [Triticum aestivum]
Length=75

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 40/81 (49%), Gaps = 6/81 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M SS + F  V + +++++ATE      ++  +A++C   S +F   C     C   C  
Sbjct  1    MESSHKLFPAVAILLLLVVATE------VVPAQARECETESERFNGLCFVSANCAGVCNA  54

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C G+ R C C + C
Sbjct  55   EGFTGGKCSGLKRSCMCTKEC  75



>ref|XP_009342667.1| PREDICTED: defensin-like protein 2 [Pyrus x bretschneideri]
Length=89

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 42/89 (47%), Gaps = 8/89 (9%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMG------TNTTIMVTEAKKCPIPSSKFKEPCDEVGKC  166
            M  S+R  +   + V+++ ATEMG         +    E K C +PS+ FK  C     C
Sbjct  1    MECSMRLVSAAFVLVLLLAATEMGPMGIEAKTESSKAVEGKICEVPSTLFKGLCVSSNNC  60

Query  167  VAACKGEGFPEGDC--KGITRRCYCIRPC  247
               C+ E F  G C   G+TR+C C + C
Sbjct  61   KHTCRKEQFTRGKCIGDGLTRKCVCTKKC  89



>ref|XP_008437687.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=77

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 31/59 (53%), Gaps = 0/59 (0%)
 Frame = +2

Query  71   MGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +G+    MV EA+ C  PS  FK  C     C   CK EGF  G C+G  RRC+C + C
Sbjct  18   VGSGMAPMVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGLCRGFRRRCFCTKHC  76



>ref|XP_008793610.1| PREDICTED: defensin Ec-AMP-D1-like isoform X2 [Phoenix dactylifera]
Length=77

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            M  S R    +LL + +++++EMGT     V EA+ C   S +FK  C     C   C+ 
Sbjct  1    MEHSRRLLPAILLLLFLLISSEMGTK----VVEARTCESQSHRFKGTCLRASNCANVCQT  56

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  G C+G+  RC+C + C
Sbjct  57   EGFQGGVCRGLRGRCFCTKRC  77



>gb|ADK91098.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91099.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91100.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91101.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91102.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91103.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91104.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91105.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91106.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91107.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91108.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91109.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91110.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91111.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91112.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91113.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91114.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91115.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91117.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91118.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91119.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91120.1| PCP17C2 [Arabidopsis halleri]
Length=55

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (52%), Gaps = 0/52 (0%)
 Frame = +2

Query  92   MVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
            +  EA+ C   S +FK  C     C   C  EGF  G+C+G  RRC+C R C
Sbjct  4    VTVEARTCESQSHRFKGTCVSASNCANVCHNEGFIGGNCRGFRRRCFCTRNC  55



>gb|ACV84385.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 33/63 (52%), Gaps = 3/63 (5%)
 Frame = +2

Query  65   TEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDC--KGITRRCYCI  238
            TEMGT TT +  EA+ C   S  FK  C     C   C  E FP G+C  +   R+C+C 
Sbjct  21   TEMGTTTTKLA-EARDCLSQSHNFKGACLSSSNCAGVCHTESFPGGECHTQHFERKCFCK  79

Query  239  RPC  247
            RPC
Sbjct  80   RPC  82



>ref|XP_004976259.1| PREDICTED: defensin-like protein-like [Setaria italica]
Length=84

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 5/66 (8%)
 Frame = +2

Query  59   MATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCK---GITRRC  229
            +A+EMGT  T  V EA++C   S KF   C     C   C+ EGFP G+C+   G+ RRC
Sbjct  21   VASEMGT--TRPVAEARRCVSQSHKFVGSCMRKSNCQHVCQTEGFPWGECRFHGGLLRRC  78

Query  230  YCIRPC  247
            +C + C
Sbjct  79   FCNKLC  84



>ref|XP_009355482.1| PREDICTED: defensin Tk-AMP-D1.1-like [Pyrus x bretschneideri]
Length=87

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 40/87 (46%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKK------CPIPSSKFKEPCDEVGKC  166
            M  S+R  +   + ++++ ATEMG       TE+ K      C  PS+ FK  C     C
Sbjct  1    MERSMRLVSAAFVLILLLAATEMGPMGVEARTESSKAVEGKICEFPSTMFKGLCFSSNNC  60

Query  167  VAACKGEGFPEGDCKGITRRCYCIRPC  247
               C+ E F  G C  +TR C C + C
Sbjct  61   KHTCRKEQFTRGKCSLLTRTCMCTKKC  87



>ref|XP_009389205.1| PREDICTED: defensin Tk-AMP-D2-like [Musa acuminata subsp. malaccensis]
Length=79

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 43/83 (52%), Gaps = 6/83 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MASS R    +LL + ++M +EMGT     V   + C   S KF  PC     C   C+ 
Sbjct  1    MASSRRMLPPLLLLLFLLMTSEMGTT----VVNGRTCESQSHKFVGPCVRKANCGNVCQT  56

Query  185  EGFPEGDCKG--ITRRCYCIRPC  247
            EGF  G C+G  I R+CYC + C
Sbjct  57   EGFHGGVCRGSLIHRKCYCTKNC  79



>dbj|BAJ89304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=83

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 34/64 (53%), Gaps = 5/64 (8%)
 Frame = +2

Query  62   ATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKG--ITRRCYC  235
            ATEMGT   +   EA+ C   S KFK  C     C   C+ E FP+G+C    + R+CYC
Sbjct  23   ATEMGT---MKAAEARTCLSQSHKFKGTCLSNSNCAGVCRTENFPDGECNSHRLERKCYC  79

Query  236  IRPC  247
             R C
Sbjct  80   KRTC  83



>ref|XP_006367122.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=71

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 37/81 (46%), Gaps = 10/81 (12%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA+  +    +LL +++I +T           EAK C  PS +FK  C    KC   C  
Sbjct  1    MAALSKVVATILLMLMLIFST----------VEAKTCESPSRRFKGLCFNTWKCRFVCST  50

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            E F  G C G+  RC C + C
Sbjct  51   ERFSSGHCNGLRHRCICTKQC  71



>gb|ACB20518.1| defensin precursor [Saccharum officinarum]
Length=80

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 48/83 (58%), Gaps = 5/83 (6%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA S R    VL+ V++++ATE+GT T   V EA+ C   S +FK  C     C   C+ 
Sbjct  1    MALSRRMAAPVLVLVLLLVATELGTTT---VAEARYCLSQSHRFKGLCMSSSNCANVCQT  57

Query  185  EGFPEGDCK--GITRRCYCIRPC  247
            E FP G+CK  G TR+C+C + C
Sbjct  58   ENFPGGECKADGATRKCFCKKIC  80



>ref|XP_007159918.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
 gb|ESW31912.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
Length=75

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 36/69 (52%), Gaps = 4/69 (6%)
 Frame = +2

Query  41   LFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGIT  220
            L +++I A++MG    +M +EA+ C  PS  FK  C     C   C  EGF  G C+G  
Sbjct  11   LVLLVIFASDMG----VMKSEARLCESPSHSFKGLCFNDRNCANVCLTEGFTGGKCEGAR  66

Query  221  RRCYCIRPC  247
             RC+C   C
Sbjct  67   HRCFCTIIC  75



>ref|XP_009345976.1| PREDICTED: defensin-like protein 2 [Pyrus x bretschneideri]
Length=87

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (45%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMG------TNTTIMVTEAKKCPIPSSKFKEPCDEVGKC  166
            M  S+R  +   + V+++ A EMG         +    E K C +PS+ FK  C     C
Sbjct  1    MERSMRLVSAAFVLVLLLAAIEMGPMGVEARTESSKAVEGKICEVPSTLFKGLCFSSNNC  60

Query  167  VAACKGEGFPEGDCKGITRRCYCIRPC  247
               C+ E F  G C  +TR C C + C
Sbjct  61   KHTCRKEQFTRGHCSVLTRACVCTKKC  87



>gb|ABK21016.1| unknown [Picea sitchensis]
 gb|ABK23113.1| unknown [Picea sitchensis]
 gb|ACN39802.1| unknown [Picea sitchensis]
 gb|ACN40104.1| unknown [Picea sitchensis]
Length=83

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 2/55 (4%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDC--KGITRRCYCIRPC  247
            + V EA+ C  PSSKFK  C     C   C+ EGFP G C     +R+CYC +PC
Sbjct  28   VEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKPC  82



>gb|ABK23037.1| unknown [Picea sitchensis]
 gb|ABR16956.1| unknown [Picea sitchensis]
Length=83

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 2/55 (4%)
 Frame = +2

Query  89   IMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDC--KGITRRCYCIRPC  247
            + V EA+ C  PSSKFK  C     C   C+ EGFP G C     +R+CYC +PC
Sbjct  28   VEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKPC  82



>ref|XP_009351647.1| PREDICTED: defensin-like protein 1 [Pyrus x bretschneideri]
Length=87

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 38/87 (44%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMG------TNTTIMVTEAKKCPIPSSKFKEPCDEVGKC  166
            M  S+R  +   + V+++  TEMG       + +    E + C   S KFK  C     C
Sbjct  1    MEPSMRLVSAAFVLVLLLATTEMGPMGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNNC  60

Query  167  VAACKGEGFPEGDCKGITRRCYCIRPC  247
               C  E F  G CKG  RRC C + C
Sbjct  61   ANTCAREKFDGGKCKGFRRRCMCTKKC  87



>gb|AHA50472.1| defensin-like protein 5 [Citrullus lanatus]
Length=74

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 30/59 (51%), Gaps = 0/59 (0%)
 Frame = +2

Query  71   MGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYCIRPC  247
             GT    +V EA+ C   S  FK  C     C   CK EGF  G C+G  RRC+C +PC
Sbjct  15   FGTGMEPIVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGVCRGFRRRCFCTKPC  73



>ref|XP_006586320.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=74

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 35/81 (43%), Gaps = 7/81 (9%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MAS    F  + L VI +       +  +   E + C   S  FK  C     C   C+ 
Sbjct  1    MASKDPHFVHLELLVICV-------DVAVKRAEGRDCSSKSHGFKGLCFSDTNCAHVCRT  53

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF  GDC G  RRC+C R C
Sbjct  54   EGFTGGDCGGFRRRCFCTRIC  74



>sp|Q43413.1|DEF1_CAPAN RecName: Full=Defensin J1-1; Flags: Precursor [Capsicum annuum]
 gb|AAM09502.1|AF488780_1 gamma thionin [Capsicum annuum]
 emb|CAA64653.1| gamma-thionin [Capsicum annuum]
 gb|ACB30365.1| defensin [Capsicum annuum]
Length=75

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 7/81 (9%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKG  184
            MA   +    + L ++++ AT+M       + EAK C   S  FK  C     C   C+ 
Sbjct  1    MAGFSKVVATIFLMMLLVFATDM-------MAEAKICEALSGNFKGLCLSSRDCGNVCRR  53

Query  185  EGFPEGDCKGITRRCYCIRPC  247
            EGF +G C G   +C+C +PC
Sbjct  54   EGFTDGSCIGFRLQCFCTKPC  74



>gb|AAW33979.1| proteinase inhibitor SE60-like protein [Ammopiptanthus mongolicus]
Length=68

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = +2

Query  41   LFVIMIMATEMGTNTTIMVTEAKKCP-IPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGI  217
            + ++++ + EM   T  +    +KCP + S++FK  C     C + C+ EG+  GDC+G+
Sbjct  1    MLLVLLASQEMVVQTEGLFR--RKCPSVLSNRFKGKCFSDHNCASVCQLEGYFGGDCRGL  58

Query  218  TRRCYCIRPC  247
             +RC+C + C
Sbjct  59   RQRCFCTKSC  68



>ref|XP_008793609.1| PREDICTED: defensin Ec-AMP-D1-like isoform X1 [Phoenix dactylifera]
Length=78

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 33/64 (52%), Gaps = 4/64 (6%)
 Frame = +2

Query  56   IMATEMGTNTTIMVTEAKKCPIPSSKFKEPCDEVGKCVAACKGEGFPEGDCKGITRRCYC  235
            I + EMGT     V EA+ C   S +FK  C     C   C+ EGF  G C+G+  RC+C
Sbjct  19   ISSEEMGTK----VVEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFC  74

Query  236  IRPC  247
             + C
Sbjct  75   TKRC  78



>ref|XP_009355481.1| PREDICTED: defensin Tk-AMP-D1.1-like [Pyrus x bretschneideri]
Length=87

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (46%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    MASSLRSFTDVLLFVIMIMATEMGTNTTIMVTEAKK------CPIPSSKFKEPCDEVGKC  166
            M  S+   +   + ++++ ATEMG  +    TE+ K      C  PS+ FK  C     C
Sbjct  1    MERSMHLVSAAFVLILLLAATEMGPMSVEARTESSKAVEGKICEFPSTLFKGLCFSSNNC  60

Query  167  VAACKGEGFPEGDCKGITRRCYCIRPC  247
               C+ E F  G C  +TR C C + C
Sbjct  61   KHTCRKEQFTRGKCSLLTRTCMCTKKC  87



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513299277426