BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17190_g2_i1 len=816 path=[3150:0-815]

Length=816
                                                                      Score     E

ref|XP_010320327.1|  PREDICTED: subtilisin-like protease                251   9e-74   
gb|EYU36350.1|  hypothetical protein MIMGU_mgv1a001799mg                248   1e-72   
ref|XP_010320531.1|  PREDICTED: subtilisin-like protease                243   9e-71   
emb|CDP01317.1|  unnamed protein product                                235   5e-70   
emb|CAN60787.1|  hypothetical protein VITISV_034533                     240   1e-69   Vitis vinifera
ref|XP_002284869.3|  PREDICTED: subtilisin-like protease                240   2e-69   Vitis vinifera
ref|XP_010320326.1|  PREDICTED: subtilisin-like protease                238   4e-69   
ref|XP_011074591.1|  PREDICTED: subtilisin-like protease                238   7e-69   
ref|XP_002284864.1|  PREDICTED: subtilisin-like protease                237   1e-68   Vitis vinifera
gb|KDP41712.1|  hypothetical protein JCGZ_16119                         233   3e-67   
ref|XP_002282841.2|  PREDICTED: uncharacterized protein LOC100259061    238   4e-67   Vitis vinifera
emb|CBI19501.3|  unnamed protein product                                236   2e-66   
gb|KDP41710.1|  hypothetical protein JCGZ_16117                         229   2e-66   
ref|XP_007017194.1|  Subtilisin-like serine endopeptidase family ...    228   3e-65   
gb|EYU36339.1|  hypothetical protein MIMGU_mgv1a001782mg                225   2e-64   
emb|CDP17236.1|  unnamed protein product                                224   5e-64   
ref|XP_002510194.1|  Xylem serine proteinase 1 precursor, putative      223   2e-63   Ricinus communis
emb|CDP01318.1|  unnamed protein product                                222   4e-63   
gb|ACA64705.1|  subtilase                                               218   7e-63   Nicotiana tabacum [American tobacco]
ref|XP_004304798.1|  PREDICTED: subtilisin-like protease-like           224   8e-63   
ref|XP_006434737.1|  hypothetical protein CICLE_v10000364mg             221   1e-62   
gb|ACA64703.1|  subtilase                                               221   1e-62   Nicotiana tabacum [American tobacco]
ref|XP_007207210.1|  hypothetical protein PRUPE_ppa001938mg             220   1e-62   
ref|XP_009621569.1|  PREDICTED: subtilisin-like protease                221   1e-62   
gb|AAO62352.1|  subtilase                                               220   2e-62   Casuarina glauca
ref|XP_008218400.1|  PREDICTED: subtilisin-like protease                219   3e-62   
gb|KDO84129.1|  hypothetical protein CISIN_1g004265mg                   219   6e-62   
ref|XP_009797476.1|  PREDICTED: subtilisin-like protease                219   6e-62   
ref|XP_006345401.1|  PREDICTED: subtilisin-like protease-like           219   7e-62   
ref|XP_011069662.1|  PREDICTED: subtilisin-like protease                219   8e-62   
ref|XP_008370912.1|  PREDICTED: subtilisin-like protease                218   1e-61   
ref|XP_009787984.1|  PREDICTED: subtilisin-like protease                217   3e-61   
gb|KHN04972.1|  Subtilisin-like protease                                211   4e-61   
ref|XP_011074393.1|  PREDICTED: subtilisin-like protease                216   6e-61   
ref|XP_003624105.1|  Xylem serine proteinase                            216   6e-61   
emb|CDP01315.1|  unnamed protein product                                216   7e-61   
gb|ACA64702.1|  subtilase                                               216   9e-61   Nicotiana tabacum [American tobacco]
pdb|3I6S|A  Chain A, Crystal Structure Of The Plant Subtilisin-Li...    214   9e-61   
emb|CAA59964.1|  subtilisin-like protease                               215   1e-60   Alnus glutinosa
gb|EYU36340.1|  hypothetical protein MIMGU_mgv1a001790mg                215   2e-60   
gb|EYU36342.1|  hypothetical protein MIMGU_mgv1a001789mg                214   2e-60   
ref|NP_001234774.1|  subtilisin-like protease precursor                 214   2e-60   
ref|XP_007147252.1|  hypothetical protein PHAVU_006G108700g             214   3e-60   
ref|XP_009342993.1|  PREDICTED: subtilisin-like protease                213   9e-60   
ref|XP_009337959.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    213   1e-59   
ref|XP_007143987.1|  hypothetical protein PHAVU_007G119500g             212   2e-59   
gb|KHN14785.1|  Subtilisin-like protease                                210   5e-59   
ref|XP_003535388.1|  PREDICTED: subtilisin-like protease-like           210   1e-58   
ref|XP_003552427.1|  PREDICTED: subtilisin-like protease-like           210   1e-58   
gb|KHN40450.1|  Subtilisin-like protease                                210   1e-58   
ref|XP_003590866.1|  Subtilisin-like protease                           209   1e-58   
gb|AES61117.2|  subtilisin-like serine protease                         209   2e-58   
ref|XP_006345406.1|  PREDICTED: subtilisin-like protease-like           209   3e-58   
ref|XP_008370910.1|  PREDICTED: subtilisin-like protease                207   3e-58   
ref|XP_006345402.1|  PREDICTED: subtilisin-like protease-like           209   3e-58   
ref|XP_009608285.1|  PREDICTED: subtilisin-like protease                208   6e-58   
gb|ABD28577.1|  Proteinase inhibitor I9, subtilisin propeptide          207   1e-57   Medicago truncatula
ref|XP_010112176.1|  Subtilisin-like protease                           199   1e-57   
ref|XP_009343011.1|  PREDICTED: subtilisin-like protease                206   2e-57   
ref|XP_009338017.1|  PREDICTED: subtilisin-like protease                206   2e-57   
ref|XP_004229665.1|  PREDICTED: subtilisin-like protease                206   2e-57   
ref|XP_004229661.1|  PREDICTED: subtilisin-like protease                206   2e-57   
ref|XP_007139760.1|  hypothetical protein PHAVU_008G056700g             206   3e-57   
ref|XP_009769989.1|  PREDICTED: subtilisin-like protease                206   4e-57   
ref|XP_009608286.1|  PREDICTED: subtilisin-like protease                204   9e-57   
ref|XP_004249504.1|  PREDICTED: subtilisin-like protease                204   1e-56   
gb|EYU19442.1|  hypothetical protein MIMGU_mgv1a001731mg                204   1e-56   
gb|EYU25438.1|  hypothetical protein MIMGU_mgv1a001996mg                203   2e-56   
ref|XP_008355893.1|  PREDICTED: subtilisin-like protease                203   3e-56   
ref|XP_011069660.1|  PREDICTED: subtilisin-like protease                203   3e-56   
ref|XP_004496012.1|  PREDICTED: subtilisin-like protease-like           203   4e-56   
ref|XP_007139763.1|  hypothetical protein PHAVU_008G057000g             202   4e-56   
ref|XP_009771925.1|  PREDICTED: subtilisin-like protease                202   5e-56   
gb|EYU36336.1|  hypothetical protein MIMGU_mgv1a019012mg                201   1e-55   
gb|KHN43135.1|  Subtilisin-like protease                                199   1e-55   
emb|CAA07059.1|  SBT4B protein                                          201   1e-55   Solanum lycopersicum
ref|XP_006345494.1|  PREDICTED: subtilisin-like protease-like           201   2e-55   
gb|AAY63882.1|  subtilisin-like serine protease                         200   2e-55   Solanum tuberosum [potatoes]
ref|XP_003624104.1|  Subtilisin-like protease                           203   3e-55   
gb|EYU36337.1|  hypothetical protein MIMGU_mgv1a020902mg                200   4e-55   
ref|XP_004229664.2|  PREDICTED: subtilisin-like protease                200   5e-55   
ref|XP_009595146.1|  PREDICTED: subtilisin-like protease                199   9e-55   
ref|XP_011069661.1|  PREDICTED: subtilisin-like protease                199   9e-55   
ref|XP_009604890.1|  PREDICTED: subtilisin-like protease                199   1e-54   
ref|XP_003553772.1|  PREDICTED: subtilisin-like protease-like           199   1e-54   
ref|XP_004492811.1|  PREDICTED: subtilisin-like protease-like           198   1e-54   
gb|ACA64704.1|  subtilase                                               198   2e-54   Nicotiana tabacum [American tobacco]
emb|CDP01316.1|  unnamed protein product                                198   2e-54   
ref|XP_011074394.1|  PREDICTED: subtilisin-like protease                197   2e-54   
gb|EYU45084.1|  hypothetical protein MIMGU_mgv1a001942mg                197   3e-54   
ref|XP_010059917.1|  PREDICTED: subtilisin-like protease                195   2e-53   
ref|XP_006345400.1|  PREDICTED: subtilisin-like protease-like           195   2e-53   
ref|XP_009769987.1|  PREDICTED: subtilisin-like protease isoform X1     195   2e-53   
ref|XP_010059916.1|  PREDICTED: subtilisin-like protease                194   3e-53   
ref|XP_010059918.1|  PREDICTED: subtilisin-like protease                194   7e-53   
ref|XP_006339058.1|  PREDICTED: subtilisin-like protease-like           193   9e-53   
ref|XP_010687642.1|  PREDICTED: subtilisin-like protease                193   1e-52   
gb|KCW62487.1|  hypothetical protein EUGRSUZ_H05125                     192   2e-52   
ref|XP_010025755.1|  PREDICTED: subtilisin-like protease                192   2e-52   
ref|XP_009771086.1|  PREDICTED: subtilisin-like protease                192   3e-52   
ref|XP_011029618.1|  PREDICTED: subtilisin-like protease                191   4e-52   
emb|CAA07062.1|  SBT4E protein                                          191   5e-52   Solanum lycopersicum
gb|KDP31945.1|  hypothetical protein JCGZ_12406                         189   5e-52   
ref|XP_004249505.1|  PREDICTED: subtilisin-like protease                191   6e-52   
gb|KCW66398.1|  hypothetical protein EUGRSUZ_F00212                     190   1e-51   
ref|XP_006374913.1|  subtilase family protein                           190   1e-51   
gb|ACT34764.1|  subtilisin-like protease preproenzyme                   190   2e-51   Nicotiana tabacum [American tobacco]
ref|XP_010059919.1|  PREDICTED: subtilisin-like protease                189   2e-51   
ref|XP_009595649.1|  PREDICTED: subtilisin-like protease                189   3e-51   
ref|XP_006374911.1|  subtilase family protein                           187   1e-50   
ref|XP_011029640.1|  PREDICTED: subtilisin-like protease                187   2e-50   
ref|XP_009800439.1|  PREDICTED: subtilisin-like protease                186   3e-50   
gb|EYU25437.1|  hypothetical protein MIMGU_mgv1a002005mg                186   4e-50   
gb|AFW81832.1|  putative subtilase family protein                       182   8e-50   
gb|ACL52543.1|  unknown                                                 182   8e-50   Zea mays [maize]
gb|ABK95622.1|  unknown                                                 184   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_010320328.1|  PREDICTED: subtilisin-like protease                184   1e-49   
ref|XP_009790288.1|  PREDICTED: subtilisin-like protease                183   2e-49   
ref|XP_011069659.1|  PREDICTED: subtilisin-like protease                183   2e-49   
ref|XP_006655358.1|  PREDICTED: subtilisin-like protease-like           183   4e-49   
gb|EAY98174.1|  hypothetical protein OsI_20091                          181   5e-49   Oryza sativa Indica Group [Indian rice]
gb|AFW81831.1|  putative subtilase family protein                       182   7e-49   
ref|NP_001145972.1|  uncharacterized protein LOC100279499 precursor     182   7e-49   Zea mays [maize]
emb|CAA07060.1|  SBT4C protein                                          182   9e-49   Solanum lycopersicum
ref|XP_006345404.1|  PREDICTED: subtilisin-like protease-like           182   1e-48   
ref|NP_001055646.1|  Os05g0435800                                       181   2e-48   Oryza sativa Japonica Group [Japonica rice]
gb|KCW66392.1|  hypothetical protein EUGRSUZ_F00206                     180   3e-48   
ref|NP_001234780.1|  subtilisin-like protease                           180   4e-48   
ref|XP_008785865.1|  PREDICTED: subtilisin-like protease                179   6e-48   
ref|XP_002523603.1|  Cucumisin precursor, putative                      174   8e-48   Ricinus communis
ref|XP_006345405.1|  PREDICTED: subtilisin-like protease-like           179   9e-48   
ref|XP_009419397.1|  PREDICTED: subtilisin-like protease                179   1e-47   
ref|XP_006386505.1|  hypothetical protein POPTR_0002s12610g             179   1e-47   
ref|XP_007204261.1|  hypothetical protein PRUPE_ppa001828mg             177   3e-47   
ref|XP_006342632.1|  PREDICTED: subtilisin-like protease-like           177   3e-47   
ref|XP_009610212.1|  PREDICTED: subtilisin-like protease                177   3e-47   
ref|XP_007047285.1|  Subtilisin-like serine endopeptidase family ...    177   4e-47   
gb|EAY76626.1|  hypothetical protein OsI_04578                          175   6e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_010263512.1|  PREDICTED: subtilisin-like protease                177   6e-47   
ref|XP_004252763.1|  PREDICTED: subtilisin-like protease                177   6e-47   
ref|XP_007017195.1|  Subtilisin-like serine endopeptidase family ...    176   9e-47   
ref|XP_002441162.1|  hypothetical protein SORBIDRAFT_09g021490          175   2e-46   Sorghum bicolor [broomcorn]
ref|XP_009345959.1|  PREDICTED: subtilisin-like protease                175   2e-46   
ref|XP_009799242.1|  PREDICTED: subtilisin-like protease                175   2e-46   
ref|XP_007047286.1|  Subtilisin-like serine endopeptidase family ...    175   2e-46   
dbj|BAD82002.1|  putative subtilase                                     175   2e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55729.1|  hypothetical protein OsJ_04215                          175   2e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006342631.1|  PREDICTED: subtilisin-like protease-like           175   2e-46   
ref|XP_011017184.1|  PREDICTED: subtilisin-like protease                174   6e-46   
ref|XP_008241490.1|  PREDICTED: subtilisin-like protease                174   7e-46   
gb|EMT05720.1|  Subtilisin-like protease                                172   7e-46   
ref|XP_008220244.1|  PREDICTED: subtilisin-like protease                174   7e-46   
ref|XP_008785921.1|  PREDICTED: subtilisin-like protease                174   8e-46   
ref|XP_002523606.1|  Cucumisin precursor, putative                      174   8e-46   Ricinus communis
ref|XP_010912031.1|  PREDICTED: subtilisin-like protease                173   1e-45   
gb|KDO79191.1|  hypothetical protein CISIN_1g004824mg                   173   1e-45   
ref|XP_006425911.1|  hypothetical protein CICLE_v10024929mg             173   1e-45   
ref|XP_002523602.1|  Cucumisin precursor, putative                      172   1e-45   Ricinus communis
ref|XP_008785918.1|  PREDICTED: subtilisin-like protease                169   2e-45   
ref|XP_006466594.1|  PREDICTED: subtilisin-like protease-like           172   3e-45   
ref|XP_002310134.2|  subtilase family protein                           172   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_004291093.1|  PREDICTED: subtilisin-like protease-like           171   5e-45   
dbj|BAJ89456.1|  predicted protein                                      171   6e-45   
ref|XP_008220243.1|  PREDICTED: subtilisin-like protease                171   7e-45   
ref|XP_008785920.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    171   8e-45   
ref|XP_008221259.1|  PREDICTED: subtilisin-like protease                170   2e-44   
ref|XP_010263511.1|  PREDICTED: subtilisin-like protease                169   2e-44   
emb|CBI18429.3|  unnamed protein product                                168   3e-44   
ref|XP_007221958.1|  hypothetical protein PRUPE_ppa001770mg             169   3e-44   
emb|CDP17956.1|  unnamed protein product                                169   4e-44   
ref|XP_009343175.1|  PREDICTED: subtilisin-like protease                169   4e-44   
ref|XP_007206792.1|  hypothetical protein PRUPE_ppa026679mg             159   5e-44   
dbj|BAJ90426.1|  predicted protein                                      168   5e-44   
ref|XP_006434738.1|  hypothetical protein CICLE_v10000411mg             168   5e-44   
dbj|BAJ88973.1|  predicted protein                                      168   6e-44   
ref|XP_004514928.1|  PREDICTED: subtilisin-like protease-like           168   6e-44   
ref|XP_007135313.1|  hypothetical protein PHAVU_010G118800g             168   6e-44   
ref|XP_002510196.1|  Cucumisin precursor, putative                      168   7e-44   Ricinus communis
dbj|BAJ87233.1|  predicted protein                                      168   8e-44   
dbj|BAJ88882.1|  predicted protein                                      167   8e-44   
ref|XP_002267740.1|  PREDICTED: subtilisin-like protease                167   1e-43   Vitis vinifera
gb|EYU45081.1|  hypothetical protein MIMGU_mgv1a002217mg                167   1e-43   
ref|XP_011043530.1|  PREDICTED: subtilisin-like protease                167   1e-43   
ref|XP_007207718.1|  hypothetical protein PRUPE_ppa1027200mg            161   2e-43   
gb|KDO84130.1|  hypothetical protein CISIN_1g004809mg                   166   2e-43   
gb|AFW84453.1|  putative subtilase family protein                       167   2e-43   
ref|XP_008444560.1|  PREDICTED: subtilisin-like protease                166   3e-43   
gb|KDP41713.1|  hypothetical protein JCGZ_16120                         166   5e-43   
ref|XP_002277899.1|  PREDICTED: subtilisin-like protease                166   6e-43   Vitis vinifera
ref|XP_004514927.1|  PREDICTED: subtilisin-like protease-like           165   7e-43   
ref|XP_009359804.1|  PREDICTED: subtilisin-like protease                165   8e-43   
ref|XP_003566210.2|  PREDICTED: subtilisin-like protease                164   1e-42   
emb|CBI21415.3|  unnamed protein product                                165   1e-42   
ref|XP_002510195.1|  Cucumisin precursor, putative                      164   2e-42   Ricinus communis
emb|CDM85158.1|  unnamed protein product                                164   2e-42   
gb|EEC71868.1|  hypothetical protein OsI_04579                          163   2e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_003626594.1|  Subtilisin-like protease                           164   2e-42   
ref|XP_004494864.1|  PREDICTED: subtilisin-like protease-like           164   2e-42   
ref|XP_010093626.1|  Subtilisin-like protease                           164   2e-42   
gb|KEH18578.1|  subtilisin-like serine protease                         164   2e-42   
gb|KDP41714.1|  hypothetical protein JCGZ_16121                         163   4e-42   
ref|XP_010540359.1|  PREDICTED: subtilisin-like protease                163   5e-42   
ref|XP_010267360.1|  PREDICTED: subtilisin-like protease                163   6e-42   
ref|XP_004156411.1|  PREDICTED: subtilisin-like protease-like           162   6e-42   
ref|XP_004143027.1|  PREDICTED: subtilisin-like protease-like           162   6e-42   
ref|XP_008351993.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    162   7e-42   
emb|CBI19502.3|  unnamed protein product                                153   8e-42   
gb|EPS63009.1|  subtilisin-like protease preproenzyme                   162   8e-42   
ref|XP_008393790.1|  PREDICTED: subtilisin-like protease                162   1e-41   
gb|KEH18574.1|  subtilisin-like serine protease                         161   3e-41   
ref|XP_004961962.1|  PREDICTED: subtilisin-like protease-like           160   6e-41   
gb|KHN06360.1|  Subtilisin-like protease                                159   3e-40   
ref|NP_001044922.1|  Os01g0868900                                       158   3e-40   Oryza sativa Japonica Group [Japonica rice]
gb|KHN15890.1|  Subtilisin-like protease                                158   3e-40   
ref|XP_010927458.1|  PREDICTED: subtilisin-like protease                157   3e-40   
ref|XP_006847107.1|  hypothetical protein AMTR_s00017p00219220          157   4e-40   
ref|XP_009405278.1|  PREDICTED: subtilisin-like protease                156   1e-39   
emb|CDM85157.1|  unnamed protein product                                155   1e-39   
gb|KEH42928.1|  subtilisin-like serine protease                         155   3e-39   
ref|XP_010028239.1|  PREDICTED: subtilisin-like protease                155   4e-39   
gb|KEH18576.1|  subtilisin-like serine protease                         154   6e-39   
ref|XP_010927456.1|  PREDICTED: subtilisin-like protease                154   1e-38   
ref|XP_010112177.1|  Subtilisin-like protease                           153   2e-38   
gb|KEH18575.1|  subtilisin-like serine protease                         153   2e-38   
ref|XP_008793983.1|  PREDICTED: subtilisin-like protease                152   4e-38   
ref|XP_006495263.1|  PREDICTED: subtilisin-like protease-like           152   4e-38   
ref|XP_003548151.1|  PREDICTED: subtilisin-like protease-like           152   5e-38   
gb|KDO37430.1|  hypothetical protein CISIN_1g039556mg                   149   9e-38   
gb|KHN15886.1|  Subtilisin-like protease                                150   1e-37   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      150   2e-37   Ricinus communis
ref|XP_006487124.1|  PREDICTED: subtilisin-like protease-like           150   4e-37   
ref|XP_006487123.1|  PREDICTED: subtilisin-like protease-like           149   5e-37   
ref|XP_008357385.1|  PREDICTED: subtilisin-like protease                149   5e-37   
emb|CBI32395.3|  unnamed protein product                                147   9e-37   
ref|XP_006422999.1|  hypothetical protein CICLE_v10027863mg             148   1e-36   
ref|XP_002282304.3|  PREDICTED: subtilisin-like protease                147   2e-36   Vitis vinifera
ref|XP_006422997.1|  hypothetical protein CICLE_v10027850mg             147   2e-36   
gb|KDO59723.1|  hypothetical protein CISIN_1g046220mg                   147   2e-36   
ref|XP_010647741.1|  PREDICTED: subtilisin-like protease                147   2e-36   
ref|XP_006487072.1|  PREDICTED: subtilisin-like protease-like           147   2e-36   
gb|KCW63764.1|  hypothetical protein EUGRSUZ_G01428                     146   3e-36   
gb|KCW63766.1|  hypothetical protein EUGRSUZ_G01430                     146   3e-36   
ref|XP_004972264.1|  PREDICTED: subtilisin-like protease-like           147   3e-36   
gb|KCW63761.1|  hypothetical protein EUGRSUZ_G01423                     147   3e-36   
gb|KCW63767.1|  hypothetical protein EUGRSUZ_G01432                     145   4e-36   
ref|XP_010068464.1|  PREDICTED: subtilisin-like protease                146   5e-36   
ref|XP_010647877.1|  PREDICTED: subtilisin-like protease                145   5e-36   
ref|XP_010068463.1|  PREDICTED: subtilisin-like protease                146   6e-36   
ref|XP_003529873.2|  PREDICTED: subtilisin-like protease-like           146   6e-36   
ref|XP_003595551.1|  Subtilisin-like serine protease                    146   7e-36   
gb|KCW44172.1|  hypothetical protein EUGRSUZ_L024071                    142   7e-36   
ref|XP_010068466.1|  PREDICTED: subtilisin-like protease                145   1e-35   
ref|XP_010066012.1|  PREDICTED: subtilisin-like protease                145   1e-35   
gb|KEH23384.1|  subtilisin-like serine protease                         143   1e-35   
gb|KCW54937.1|  hypothetical protein EUGRSUZ_I00910                     145   2e-35   
ref|XP_006422995.1|  hypothetical protein CICLE_v10030049mg             144   2e-35   
emb|CAN64995.1|  hypothetical protein VITISV_001779                     145   2e-35   Vitis vinifera
gb|EMS48839.1|  Subtilisin-like protease                                145   3e-35   
ref|XP_006847081.1|  hypothetical protein AMTR_s00017p00213940          142   3e-35   
emb|CAN64996.1|  hypothetical protein VITISV_001780                     144   5e-35   Vitis vinifera
gb|KHN15887.1|  Subtilisin-like protease                                142   8e-35   
ref|XP_003548400.1|  PREDICTED: subtilisin-like protease-like           143   9e-35   
emb|CAN81091.1|  hypothetical protein VITISV_040911                     140   9e-35   Vitis vinifera
ref|XP_010068558.1|  PREDICTED: subtilisin-like protease                142   1e-34   
emb|CBI32393.3|  unnamed protein product                                140   2e-34   
ref|XP_006847079.1|  hypothetical protein AMTR_s00017p00212440          141   3e-34   
gb|KDP28707.1|  hypothetical protein JCGZ_14478                         141   3e-34   
gb|KHN15704.1|  Subtilisin-like protease                                140   5e-34   
ref|XP_004492670.1|  PREDICTED: subtilisin-like protease-like           140   6e-34   
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           140   6e-34   
ref|XP_002282333.2|  PREDICTED: subtilisin-like protease                140   8e-34   Vitis vinifera
emb|CAN68827.1|  hypothetical protein VITISV_029978                     140   9e-34   Vitis vinifera
gb|ABN05870.1|  Proteinase inhibitor I9, subtilisin propeptide          137   2e-33   Medicago truncatula
ref|XP_011000657.1|  PREDICTED: subtilisin-like protease                139   2e-33   
ref|XP_010547521.1|  PREDICTED: subtilisin-like protease SDD1           139   2e-33   
ref|XP_006661279.1|  PREDICTED: subtilisin-like protease-like           137   2e-33   
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like           139   3e-33   
ref|XP_009375850.1|  PREDICTED: subtilisin-like protease                138   4e-33   
ref|NP_001064523.2|  Os10g0394200                                       130   9e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004140440.1|  PREDICTED: subtilisin-like protease-like           137   1e-32   
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             137   1e-32   
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    137   1e-32   
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     136   2e-32   
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     136   2e-32   
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease                136   2e-32   
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    136   2e-32   
ref|XP_006422998.1|  hypothetical protein CICLE_v10029893mg             133   2e-32   
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           135   3e-32   
gb|KCW63975.1|  hypothetical protein EUGRSUZ_G01657                     135   3e-32   
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                135   3e-32   
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                135   4e-32   
ref|XP_010919953.1|  PREDICTED: subtilisin-like protease                135   4e-32   
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g             135   4e-32   
ref|XP_007224572.1|  hypothetical protein PRUPE_ppa1027224mg            135   5e-32   
ref|XP_006847104.1|  hypothetical protein AMTR_s00017p00218650          134   7e-32   
ref|XP_002320086.2|  subtilase family protein                           134   7e-32   
emb|CBI32394.3|  unnamed protein product                                135   7e-32   
gb|EMS51375.1|  Subtilisin-like protease                                134   7e-32   
ref|XP_010105478.1|  Subtilisin-like protease                           134   8e-32   
gb|ABK96588.1|  unknown                                                 127   1e-31   
ref|XP_008454762.1|  PREDICTED: subtilisin-like protease                134   1e-31   
gb|KCW63759.1|  hypothetical protein EUGRSUZ_G01419                     133   1e-31   
ref|XP_006583358.1|  PREDICTED: subtilisin-like protease-like iso...    134   1e-31   
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    134   1e-31   
gb|KHN04600.1|  Subtilisin-like protease                                134   1e-31   
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                134   1e-31   
ref|XP_004140477.1|  PREDICTED: subtilisin-like protease-like           134   1e-31   
gb|KHG02130.1|  Subtilisin-like protease                                134   1e-31   
ref|XP_004171629.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    134   1e-31   
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g             134   2e-31   
gb|KHN04108.1|  Subtilisin-like protease                                133   2e-31   
ref|XP_003623810.1|  Subtilisin-like protease                           134   2e-31   
gb|EAZ04458.1|  hypothetical protein OsI_26606                          133   2e-31   
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease                133   2e-31   
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                133   2e-31   
ref|NP_001060094.1|  Os07g0578300                                       133   2e-31   
gb|AES80028.2|  subtilisin-like serine protease                         133   2e-31   
ref|XP_008220348.1|  PREDICTED: subtilisin-like protease                133   2e-31   
gb|KHN13887.1|  Subtilisin-like protease                                132   2e-31   
gb|KHN27220.1|  Subtilisin-like protease                                133   3e-31   
ref|XP_002518750.1|  Xylem serine proteinase 1 precursor, putative      133   3e-31   
gb|KDP41709.1|  hypothetical protein JCGZ_16116                         133   3e-31   
dbj|BAD36156.1|  putative serine protease                               133   3e-31   
ref|XP_010919194.1|  PREDICTED: subtilisin-like protease isoform X1     133   3e-31   
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    133   3e-31   
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           133   3e-31   
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                132   3e-31   
ref|XP_010919195.1|  PREDICTED: subtilisin-like protease isoform X2     132   3e-31   
tpg|DAA61658.1|  TPA: putative subtilase family protein                 130   3e-31   
gb|KHN06359.1|  Subtilisin-like protease                                125   3e-31   
ref|XP_006847102.1|  hypothetical protein AMTR_s00017p00218450          128   4e-31   
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    132   5e-31   
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like           132   5e-31   
ref|XP_002272824.2|  PREDICTED: subtilisin-like protease                132   5e-31   
ref|XP_010540256.1|  PREDICTED: subtilisin-like protease                132   6e-31   
emb|CDY15145.1|  BnaC05g00240D                                          132   6e-31   
ref|XP_002313857.1|  hypothetical protein POPTR_0009s10340g             132   7e-31   
ref|XP_002272999.1|  PREDICTED: subtilisin-like protease                132   7e-31   
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                132   7e-31   
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                132   7e-31   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           132   7e-31   
ref|XP_002272965.1|  PREDICTED: subtilisin-like protease                131   8e-31   
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    131   9e-31   
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease                131   1e-30   
ref|XP_010108079.1|  Subtilisin-like protease SDD1                      125   1e-30   
ref|XP_010105479.1|  Subtilisin-like protease                           131   1e-30   
ref|XP_007051971.1|  Subtilase family protein                           131   1e-30   
gb|KHN13888.1|  Subtilisin-like protease                                131   1e-30   
gb|EAZ14292.1|  hypothetical protein OsJ_04216                          130   1e-30   
ref|NP_001130775.1|  uncharacterized protein LOC100191879 precursor     131   1e-30   
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                131   1e-30   
gb|ACB87529.1|  subtilisin protease                                     129   1e-30   
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease                131   1e-30   
gb|ACF79126.1|  unknown                                                 131   1e-30   
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g             130   2e-30   
ref|XP_009362303.1|  PREDICTED: subtilisin-like protease                130   2e-30   
gb|EYU36338.1|  hypothetical protein MIMGU_mgv1a002690mg                130   2e-30   
ref|XP_006595827.1|  PREDICTED: subtilisin-like protease-like iso...    130   2e-30   
ref|XP_011041660.1|  PREDICTED: subtilisin-like protease                130   2e-30   
ref|XP_007051969.1|  Subtilase family protein isoform 1                 130   2e-30   
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                130   2e-30   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           130   2e-30   
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             130   2e-30   
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease                130   2e-30   
ref|XP_006595826.1|  PREDICTED: subtilisin-like protease-like iso...    130   2e-30   
ref|XP_010109072.1|  Subtilisin-like protease                           130   2e-30   
ref|XP_008372210.1|  PREDICTED: subtilisin-like protease                130   3e-30   
ref|XP_006306838.1|  hypothetical protein CARUB_v10008379mg             130   3e-30   
ref|XP_002321861.2|  subtilase family protein                           130   3e-30   
ref|XP_010090170.1|  Subtilisin-like protease                           130   3e-30   
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                130   4e-30   
ref|XP_006847088.1|  hypothetical protein AMTR_s00017p00215590          125   4e-30   
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                129   4e-30   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             129   5e-30   
emb|CAN60788.1|  hypothetical protein VITISV_034534                     129   5e-30   
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                129   5e-30   
gb|EEE50901.1|  hypothetical protein OsJ_31407                          129   6e-30   
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease                129   6e-30   
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg                129   6e-30   
ref|NP_001234288.1|  SBT2 protein precursor                             129   6e-30   
gb|EAY78354.1|  hypothetical protein OsI_33442                          129   7e-30   
dbj|BAJ93208.1|  predicted protein                                      129   7e-30   
ref|XP_006857969.1|  hypothetical protein AMTR_s00069p00177600          129   7e-30   
gb|AAM22744.1|AC092388_28  putative cucumisin-like serine protease      129   7e-30   
ref|XP_009119746.1|  PREDICTED: subtilisin-like protease                129   8e-30   
dbj|BAJ87876.1|  predicted protein                                      129   8e-30   
ref|XP_002282856.2|  PREDICTED: subtilisin-like protease                129   8e-30   
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          129   8e-30   
ref|XP_004292811.1|  PREDICTED: subtilisin-like protease-like           127   1e-29   
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease                128   1e-29   
ref|XP_006847097.1|  hypothetical protein AMTR_s00017p00216950          128   1e-29   
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                128   1e-29   
ref|XP_002876011.1|  predicted protein                                  128   1e-29   
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                128   1e-29   
ref|XP_010692332.1|  PREDICTED: subtilisin-like protease                128   1e-29   
ref|XP_003625390.1|  Subtilisin-like protease                           128   2e-29   
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like           128   2e-29   
gb|ACL52505.1|  unknown                                                 125   2e-29   
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1     127   2e-29   
gb|EAY90937.1|  hypothetical protein OsI_12551                          125   2e-29   
emb|CDP11959.1|  unnamed protein product                                127   2e-29   
ref|XP_006381615.1|  subtilase family protein                           127   2e-29   
emb|CDX90065.1|  BnaA10g00170D                                          127   2e-29   
gb|AES62637.2|  subtilisin-like serine protease                         127   2e-29   
gb|KHN44769.1|  Subtilisin-like protease                                127   2e-29   
gb|KCW68720.1|  hypothetical protein EUGRSUZ_F02324                     124   2e-29   
ref|XP_010474817.1|  PREDICTED: subtilisin-like protease                127   2e-29   
gb|EYU25845.1|  hypothetical protein MIMGU_mgv1a013289mg                121   3e-29   
ref|XP_003545195.1|  PREDICTED: subtilisin-like protease-like           127   3e-29   
ref|XP_004975630.1|  PREDICTED: subtilisin-like protease-like           127   3e-29   
dbj|BAD94244.1|  serine protease like protein                           123   3e-29   
gb|KHN44767.1|  Subtilisin-like protease                                127   3e-29   
gb|EMT30759.1|  Subtilisin-like protease                                127   3e-29   
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like           127   4e-29   
ref|XP_002982832.1|  hypothetical protein SELMODRAFT_234125             126   4e-29   
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810          127   4e-29   
ref|XP_006418467.1|  hypothetical protein EUTSA_v10006878mg             127   4e-29   
ref|XP_004308418.1|  PREDICTED: subtilisin-like protease-like           126   4e-29   
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease                126   4e-29   
ref|XP_006857965.1|  hypothetical protein AMTR_s00069p00175260          126   4e-29   
ref|XP_010238218.1|  PREDICTED: subtilisin-like protease                127   5e-29   
ref|XP_008354238.1|  PREDICTED: subtilisin-like protease                124   5e-29   
gb|AES81608.2|  subtilisin-like serine protease                         127   5e-29   
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease-like           126   6e-29   
ref|XP_003592386.1|  Subtilisin-like protease                           126   6e-29   
ref|XP_006662325.1|  PREDICTED: subtilisin-like protease-like           124   6e-29   
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg             126   8e-29   
ref|XP_008784364.1|  PREDICTED: subtilisin-like protease                126   8e-29   
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like           125   8e-29   
ref|XP_004956934.1|  PREDICTED: subtilisin-like protease-like           125   8e-29   
ref|XP_006374912.1|  hypothetical protein POPTR_0014s02640g             125   9e-29   
ref|XP_002519362.1|  conserved hypothetical protein                     119   1e-28   
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease                125   1e-28   
emb|CDP16846.1|  unnamed protein product                                122   1e-28   
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                125   1e-28   
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                125   1e-28   
dbj|BAJ99639.1|  predicted protein                                      125   1e-28   
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                125   1e-28   
gb|KFK38784.1|  hypothetical protein AALP_AA3G160100                    125   1e-28   
gb|AGT17100.1|  serine protease                                         125   1e-28   
ref|XP_008669405.1|  PREDICTED: subtilisin-like protease                125   1e-28   
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             125   1e-28   
ref|XP_002986914.1|  hypothetical protein SELMODRAFT_425830             125   1e-28   
ref|XP_002272791.1|  PREDICTED: subtilisin-like protease                125   1e-28   
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                125   1e-28   
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             125   1e-28   
ref|XP_004973598.1|  PREDICTED: subtilisin-like protease-like           125   2e-28   
dbj|BAK06243.1|  predicted protein                                      125   2e-28   
gb|EMS62253.1|  Subtilisin-like protease                                119   2e-28   
ref|NP_001145743.1|  uncharacterized protein LOC100279250 precursor     125   2e-28   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             125   2e-28   
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease                125   2e-28   
tpg|DAA50071.1|  TPA: putative subtilase family protein                 125   2e-28   
ref|XP_002446493.1|  hypothetical protein SORBIDRAFT_06g016860          125   2e-28   
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         124   2e-28   
ref|XP_002981864.1|  hypothetical protein SELMODRAFT_115574             124   2e-28   
ref|XP_004493834.1|  PREDICTED: subtilisin-like protease SDD1-like      124   2e-28   
gb|KHN10783.1|  Subtilisin-like protease SDD1                           124   2e-28   
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease                124   2e-28   
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050          124   2e-28   
ref|XP_010457066.1|  PREDICTED: subtilisin-like protease isoform X1     124   2e-28   
gb|AFW61874.1|  putative subtilase family protein                       124   3e-28   
ref|XP_003520616.1|  PREDICTED: subtilisin-like protease SDD1-like      124   3e-28   
ref|XP_002980085.1|  hypothetical protein SELMODRAFT_111799             124   3e-28   
ref|XP_003576659.2|  PREDICTED: subtilisin-like protease SBT5.4         124   3e-28   
ref|NP_567972.1|  subtilisin-like serine protease 2                     124   3e-28   
gb|EMT32146.1|  Subtilisin-like protease                                118   3e-28   
ref|XP_006857622.1|  hypothetical protein AMTR_s00061p00122710          124   3e-28   
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             124   3e-28   
ref|XP_006339270.1|  PREDICTED: subtilisin-like protease-like           123   3e-28   
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                124   3e-28   
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                124   4e-28   
ref|XP_002976152.1|  hypothetical protein SELMODRAFT_416154             122   4e-28   
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                124   4e-28   
emb|CDP05276.1|  unnamed protein product                                124   4e-28   
gb|EPS61652.1|  hypothetical protein M569_13143                         124   4e-28   
ref|XP_006297035.1|  hypothetical protein CARUB_v10013025mg             124   4e-28   
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                124   4e-28   
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease                124   4e-28   
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease                124   4e-28   
gb|AAL32016.1|AF436834_1  AT3g14240/MLN21_2                             122   5e-28   
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease                124   5e-28   
gb|EMS60034.1|  Subtilisin-like protease                                121   5e-28   
ref|XP_006339268.1|  PREDICTED: subtilisin-like protease-like           123   5e-28   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             123   5e-28   
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                123   5e-28   
ref|XP_010661611.1|  PREDICTED: subtilisin-like protease                123   5e-28   
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease-like           123   5e-28   
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                123   5e-28   
ref|XP_007226995.1|  hypothetical protein PRUPE_ppa001756mg             123   6e-28   
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             123   6e-28   
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290          123   6e-28   
ref|XP_010479641.1|  PREDICTED: subtilisin-like protease                123   6e-28   
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                123   6e-28   
gb|EEE69917.1|  hypothetical protein OsJ_29768                          123   6e-28   
gb|ABR18065.1|  unknown                                                 123   6e-28   
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease                123   7e-28   
ref|XP_008220305.1|  PREDICTED: subtilisin-like protease                123   7e-28   
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                123   7e-28   
ref|XP_007051968.1|  Subtilase family protein                           123   7e-28   



>ref|XP_010320327.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=757

 Score =   251 bits (641),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 155/207 (75%), Gaps = 5/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA   DNTN PIKD   N++ A+PL+MGAG V+PN ALNPGLIYDATPQ
Sbjct  556  SPAAIRSAMITTAINIDNTNSPIKDSGLNYSIATPLAMGAGLVNPNFALNPGLIYDATPQ  615

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC+M FT+ QILTITRS  YT +N +SDLNYPSFI LY      +E+G  + + F
Sbjct  616  DYINLLCAMKFTRKQILTITRSSTYTCQNASSDLNYPSFIALY-----TNETGATLSQKF  670

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
            +RTVT VGDGPA ++++++ P N+ + +    LSF +KY++  Y L + Y GN+TGE+ F
Sbjct  671  IRTVTNVGDGPANYSINMTVPSNTNISVYPSTLSFSSKYDKLSYTLTVEYSGNRTGEIVF  730

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPTW  621
            GS+TW+D  G + V SPI VAPMI TW
Sbjct  731  GSITWVDVLGLHAVTSPIVVAPMIQTW  757



>gb|EYU36350.1| hypothetical protein MIMGU_mgv1a001799mg [Erythranthe guttata]
Length=757

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 151/207 (73%), Gaps = 5/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            +PAAIRSAM+TTANP DNTN  I+D  FN+ +A+PL+MGAGQVDPN AL+PGL+YDA PQ
Sbjct  556  TPAAIRSAMMTTANPLDNTNNYIRDSYFNYETATPLAMGAGQVDPNRALDPGLVYDAAPQ  615

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLCSMNFT  QI TITRS +Y   NP+SDLNYPSFI LY  NQ+      G+ R F
Sbjct  616  DYVNLLCSMNFTSNQIATITRS-SYKCSNPSSDLNYPSFIALYATNQTTG----GLVRKF  670

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG    ++ V V  P  S+V +   NL F  KYE+  Y + + Y G+++G V F
Sbjct  671  ERTVTNVGGDSGSYKVQVIAPSGSKVSVDPSNLVFGKKYEKQSYSVTVEYNGDKSGGVTF  730

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPTW  621
            GS+TW++++GK+ VRSPI V+PMIP W
Sbjct  731  GSITWVEDNGKHTVRSPIVVSPMIPVW  757



>ref|XP_010320531.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=750

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 150/207 (72%), Gaps = 5/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+T A   DN N PIKD   N++ A+PL+MGAG V+PN ALNPGLIYDATPQ
Sbjct  548  SPAAIRSAMITGAINIDNINSPIKDSGLNYSIATPLAMGAGLVNPNFALNPGLIYDATPQ  607

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC+M FT  QILTITRS  YT +N +SDLNYPSFI LY      +E+   + + F
Sbjct  608  DYINLLCTMKFTHKQILTITRSSTYTCQNASSDLNYPSFIALY-----TNETAATLSQKF  662

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
            VRTVT VG+GPA +++++  P N+ V +    LSF +KYE+  Y L + Y GN+TGEV F
Sbjct  663  VRTVTNVGNGPANYSINMIVPSNTNVSVYPSRLSFSSKYEKLSYTLTVEYSGNRTGEVVF  722

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPTW  621
            GS+TW+D  G + V SPI VAPMI TW
Sbjct  723  GSITWVDVIGLHAVTSPIVVAPMIHTW  749



>emb|CDP01317.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 151/207 (73%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            +PAAIRSA+VTTANP DNT  PI+D  F++ +A+P+SMGAGQV+PNSAL+PGLIYDATPQ
Sbjct  286  TPAAIRSALVTTANPLDNTGTPIRDAGFSYATATPVSMGAGQVNPNSALDPGLIYDATPQ  345

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV++LCSMNFT+ QI TITRS +Y     +SDLNYPSFI LYP N++++     + + F
Sbjct  346  DYVSILCSMNFTQKQIQTITRS-SYNCSKTSSDLNYPSFIALYP-NKTKN----ALAKKF  399

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             R VT VGDG AT+ V V+ P+ S V +    L F  KY++  Y L L Y  NQ   V F
Sbjct  400  ERIVTNVGDGAATYKVQVTAPKGSGVTVYPEALVFGQKYDKQSYSLKLKYKANQNKTVTF  459

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPTW  621
            GS+ W++ +GK+ VRSPI VAP+IP W
Sbjct  460  GSVIWVEVNGKHIVRSPIVVAPIIPVW  486



>emb|CAN60787.1| hypothetical protein VITISV_034533 [Vitis vinifera]
Length=763

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 149/207 (72%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSAMVTTANPYDNT   I+D   +F  ASPL+MGAGQ+DPN AL+PGLIYDATPQ
Sbjct  563  SVAAIRSAMVTTANPYDNTFNNIRDNGLSFEIASPLAMGAGQIDPNRALDPGLIYDATPQ  622

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLCSMNFT  QILTITRS  YT  NP+ DLNYPSFI LY  N+S +       + F
Sbjct  623  DYVNLLCSMNFTTKQILTITRSNTYTCSNPSPDLNYPSFIALYN-NKSTA-----FVQKF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG +++   V+ P+ S+V +    L+F+NKYE+  Y L + Y   + G+V F
Sbjct  677  QRTVTNVGDGASSYKAIVTAPKGSKVMVSPATLAFENKYEKLSYTLTIEYKSEKDGKVSF  736

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPTW  621
            GSLTWI++ GK+ VRSPI V+ ++  W
Sbjct  737  GSLTWIEDDGKHTVRSPIVVSQVVTPW  763



>ref|XP_002284869.3| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=778

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 149/207 (72%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSAMVTTANPYDNT   I+D   +F  ASPL+MGAGQ+DPN AL+PGLIYDATPQ
Sbjct  578  SVAAIRSAMVTTANPYDNTFNNIRDNGLSFEIASPLAMGAGQIDPNRALDPGLIYDATPQ  637

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLCSMNFT  QILTITRS  YT  NP+ DLNYPSFI LY  N+S +       + F
Sbjct  638  DYVNLLCSMNFTTKQILTITRSNTYTCSNPSPDLNYPSFIALYN-NKSTA-----FVQKF  691

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG +++   V+ P+ S+V +    L+F+NKYE+  Y L + Y   + G+V F
Sbjct  692  QRTVTNVGDGASSYKAIVTAPKGSKVMVSPATLAFENKYEKLSYTLTIEYKSEKDGKVSF  751

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPTW  621
            GSLTWI++ GK+ VRSPI V+ ++  W
Sbjct  752  GSLTWIEDDGKHTVRSPIVVSQVVTPW  778



>ref|XP_010320326.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=749

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 149/207 (72%), Gaps = 5/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+T A   DNTN PIKD   N++ A+PL+MGAG V+PN ALNPGLIYDATPQ
Sbjct  548  SPAAIRSAMITGAINIDNTNSPIKDSGLNYSIATPLAMGAGLVNPNFALNPGLIYDATPQ  607

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC+M FT  QILTITRS  YT +N +SDLNYPSFI  Y      +E+   + + F
Sbjct  608  DYINLLCAMKFTHKQILTITRSSTYTCQNASSDLNYPSFIAPY-----TNETTATLSQKF  662

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
            VRTVT VG+GPA +++++  P N+ + +    LSF +KYE+  Y L + Y GN+TGEV F
Sbjct  663  VRTVTNVGNGPANYSINMVVPSNTNISVYPSRLSFSSKYEKLSYTLTIEYSGNKTGEVVF  722

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPTW  621
            GSLTW+D  G + V S I VAPMI TW
Sbjct  723  GSLTWVDVIGLHAVTSSIVVAPMIRTW  749



>ref|XP_011074591.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   238 bits (606),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 148/207 (71%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTANP+DNT   I+D  FN+  A+PL+MGAGQVDPN AL+PGLIYDA+PQ
Sbjct  558  SPAAIRSAMMTTANPFDNTQNYIRDSYFNYEIATPLAMGAGQVDPNQALDPGLIYDASPQ  617

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLCSMNFT  QI TITRS +Y    P+SDLNYPSFI LY  N++R      + + F
Sbjct  618  DYVNLLCSMNFTHNQISTITRS-SYNCSTPSSDLNYPSFIALY-TNKTRDS----LVQEF  671

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             R VT VGD   ++ V V+ P  S V +    L F +KYE+  Y L + Y  N TG + F
Sbjct  672  HRVVTNVGDDVTSYKVQVTAPSGSTVTVYPTTLVFGHKYEKQSYSLTIQYKSNSTGAITF  731

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPTW  621
            GS+TWI+++GK+ VRSPI V+PMIP W
Sbjct  732  GSITWIEDNGKHTVRSPIVVSPMIPVW  758



>ref|XP_002284864.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=763

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 149/207 (72%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSAMVTTANPYDNT   I+D   +F  ASPL+MGAGQ+DPN AL+PGLIYDATPQ
Sbjct  563  SVAAIRSAMVTTANPYDNTFNYIRDNGLSFEIASPLAMGAGQIDPNRALDPGLIYDATPQ  622

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLCSMNFT  QILTITRS  YT  N + DLNYPSFI LY  N+S +       + F
Sbjct  623  DYVNLLCSMNFTTKQILTITRSNTYTCSNSSPDLNYPSFIALYN-NKSTT-----FVQKF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGD  A++   V+ P+ S+V I    L+F+NKYE+ +Y L + Y  ++ G+V F
Sbjct  677  QRTVTNVGDKAASYKAMVTAPKGSKVMISPATLAFENKYEKLDYTLTIKYKSHKDGKVSF  736

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPTW  621
            GSLTW+++ GK+ VRSPI V+ ++  W
Sbjct  737  GSLTWVEDDGKHTVRSPIVVSQVVTPW  763



>gb|KDP41712.1| hypothetical protein JCGZ_16119 [Jatropha curcas]
Length=732

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 146/204 (72%), Gaps = 5/204 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTANP DNT  PI+D   N   ASPL+MGAGQ+DPN AL PGLIYDATPQ
Sbjct  532  SPAAIRSAMITTANPLDNTQNPIRDNGINLELASPLAMGAGQLDPNRALQPGLIYDATPQ  591

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVN+LCSMN+TK QILTITRS  Y   NP+SD+NYPSFI LY  N++ S     + ++F
Sbjct  592  DYVNILCSMNYTKNQILTITRSIRYNCSNPSSDMNYPSFIALYN-NKTTST----VTQSF  646

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G AT+   +  PR S V +    L F  KY++  Y L + Y  ++ G V F
Sbjct  647  QRTVTNVGEGAATYKAKLIAPRGSIVTVSPDTLVFGKKYDKQSYNLRIRYRRDEKGVVSF  706

Query  541  GSLTWIDESGKYKVRSPIAVAPMI  612
            GS+ WI+E+G + VRSPIA++P++
Sbjct  707  GSIVWIEENGVHTVRSPIAISPLV  730



>ref|XP_002282841.2| PREDICTED: uncharacterized protein LOC100259061 [Vitis vinifera]
Length=1529

 Score =   238 bits (606),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA+VTTANPYDNT   I+D   NFT ASPL+MGAGQ+DPN AL+PGL+YDATPQ
Sbjct  566  SVAAIRSAIVTTANPYDNTFNHIRDNGLNFTIASPLAMGAGQIDPNGALDPGLVYDATPQ  625

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLCSMNFTK QILTITRS  YT    + DLNYPSFI LY  N ++S +   + + F
Sbjct  626  DYVNLLCSMNFTKKQILTITRSNTYTCPKTSPDLNYPSFIALYSQNDNKSTT---VVQKF  682

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG AT+   V  PR S+V +    L F+ KYE+  Y + + Y  ++ G++ F
Sbjct  683  QRTVTNVGDGTATYHATVIAPRGSKVTVSPTTLVFEKKYEKQSYTMSIKYKSDKDGKISF  742

Query  541  GSLTWIDESGKYKVRSPIAVAP  606
            G LTWI++ G++ VRSPI V+P
Sbjct  743  GWLTWIEDDGEHTVRSPIVVSP  764


 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 128/198 (65%), Gaps = 2/198 (1%)
 Frame = +1

Query  1     SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
             SPAAIRSAM+TT++  DNT  PIK    +   ASPL+MG+G ++PN AL+PG IYD   +
Sbjct  1324  SPAAIRSAMMTTSDSLDNTLNPIKGIGDDNQPASPLAMGSGHINPNKALDPGFIYDVNLE  1383

Query  181   DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
             D++NLLC++N++  QI  ITRS +YT  +P+ DLNYPSFI  +  N SRS+S     + F
Sbjct  1384  DHINLLCALNYSTKQIQIITRSSSYTCSDPSLDLNYPSFIASFDANDSRSDS--KTVQEF  1441

Query  361   VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
              RTVT VG+  +T+   ++G    QV +    L FK+KY++  YKL +         V F
Sbjct  1442  RRTVTNVGEAMSTYNAKLTGMDGFQVSVVPDKLVFKDKYQKLSYKLRIEGPSLMKETVAF  1501

Query  541   GSLTWIDESGKYKVRSPI  594
             GSL+W+D   K+ VRSPI
Sbjct  1502  GSLSWVDVEAKHVVRSPI  1519



>emb|CBI19501.3| unnamed protein product [Vitis vinifera]
Length=1686

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 146/201 (73%), Gaps = 6/201 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSAMVTTANPYDNT   I+D   +F  ASPL+MGAGQ+DPN AL+PGLIYDATPQ
Sbjct  397  SVAAIRSAMVTTANPYDNTFNNIRDNGLSFEIASPLAMGAGQIDPNRALDPGLIYDATPQ  456

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLCSMNFT  QILTITRS  YT  NP+ DLNYPSFI LY  N+S +       + F
Sbjct  457  DYVNLLCSMNFTTKQILTITRSNTYTCSNPSPDLNYPSFIALYN-NKSTA-----FVQKF  510

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG +++   V+ P+ S+V +    L+F+NKYE+  Y L + Y   + G+V F
Sbjct  511  QRTVTNVGDGASSYKAIVTAPKGSKVMVSPATLAFENKYEKLSYTLTIEYKSEKDGKVSF  570

Query  541  GSLTWIDESGKYKVRSPIAVA  603
            GSLTWI++ GK+ VRSPI V+
Sbjct  571  GSLTWIEDDGKHTVRSPIVVS  591


 Score =   234 bits (596),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 148/204 (73%), Gaps = 6/204 (3%)
 Frame = +1

Query  1     SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
             S AAIRSAMVTTANPYDNT   I+D   +F  ASPL+MGAGQ+DPN AL+PGLIYDATPQ
Sbjct  970   SVAAIRSAMVTTANPYDNTFNYIRDNGLSFEIASPLAMGAGQIDPNRALDPGLIYDATPQ  1029

Query  181   DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
             DYVNLLCSMNFT  QILTITRS  YT  N + DLNYPSFI LY  N+S +       + F
Sbjct  1030  DYVNLLCSMNFTTKQILTITRSNTYTCSNSSPDLNYPSFIALYN-NKSTT-----FVQKF  1083

Query  361   VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
              RTVT VGD  A++   V+ P+ S+V I    L+F+NKYE+ +Y L + Y  ++ G+V F
Sbjct  1084  QRTVTNVGDKAASYKAMVTAPKGSKVMISPATLAFENKYEKLDYTLTIKYKSHKDGKVSF  1143

Query  541   GSLTWIDESGKYKVRSPIAVAPMI  612
             GSLTW+++ GK+ VRSPI V+ ++
Sbjct  1144  GSLTWVEDDGKHTVRSPIVVSQVV  1167


 Score =   172 bits (437),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 115/176 (65%), Gaps = 3/176 (2%)
 Frame = +1

Query  85    NFTSASPLSMGAGQVDPNSALNPGLIYDATPQDYVNLLCSMNFTKTQILTITRSKNYTFE  264
             ++T  S  SM        +AL  GL+YDATPQDYVNLLCSMNFTK QILTITRS  YT  
Sbjct  1510  DYTMVSGTSMACPHASGVAALLRGLVYDATPQDYVNLLCSMNFTKKQILTITRSNTYTCP  1569

Query  265   NPNSDLNYPSFILLYPVNQSRSESGYGIRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEI  444
               + DLNYPSFI LY  N ++S +   + + F RTVT VGDG AT+   V  PR S+V +
Sbjct  1570  KTSPDLNYPSFIALYSQNDNKSTT---VVQKFQRTVTNVGDGTATYHATVIAPRGSKVTV  1626

Query  445   QNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEFGSLTWIDESGKYKVRSPIAVAPMI  612
                 L F+ KYE+  Y + + Y  ++ G++ FG LTWI++ G++ VRSPI V+P++
Sbjct  1627  SPTTLVFEKKYEKQSYTMSIKYKSDKDGKISFGWLTWIEDDGEHTVRSPIVVSPLV  1682



>gb|KDP41710.1| hypothetical protein JCGZ_16117 [Jatropha curcas]
Length=651

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 145/207 (70%), Gaps = 5/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA+VTTANP DNT  PI+D    F  ASPL+MGAGQ+DP+ AL+PGLIYDATP 
Sbjct  450  SPAAIRSAIVTTANPLDNTLNPIRDNGEKFAYASPLAMGAGQIDPHRALDPGLIYDATPH  509

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVN+LCSMN+TK QILTITRSK YT  NP+ DLNYPSFI LY        +   ++R F
Sbjct  510  DYVNILCSMNYTKKQILTITRSKRYTCSNPSPDLNYPSFIALY----DNKTAAVAVQR-F  564

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RT+T VGDG AT+   +   + S+V +   +L F  KY++  Y L + Y  ++ G V F
Sbjct  565  RRTLTNVGDGAATYKAKIVVTKGSKVTVSPDSLVFGKKYDKQTYTLTIKYSKDKGGRVSF  624

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPTW  621
            GS+ WI+++G + VRSPIAV+P +  W
Sbjct  625  GSIVWIEQNGVHTVRSPIAVSPAVKLW  651



>ref|XP_007017194.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14419.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=793

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 148/204 (73%), Gaps = 6/204 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAF-NFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            S AAIRSA+VTTAN  DNT KPI+D    N + ASPL+MGAGQ+DPN AL+PGLIYDATP
Sbjct  562  SAAAIRSALVTTANTLDNTVKPIRDNGDDNLSFASPLAMGAGQIDPNQALDPGLIYDATP  621

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            QDYVNLLC+MNFT++QILTITRSK+Y   NP+SDLNYPSFI LY  N + +     + + 
Sbjct  622  QDYVNLLCTMNFTRSQILTITRSKSYNCSNPSSDLNYPSFIALYNPNVTET-----VAKI  676

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT +G+G AT+ V +  P  S + +    L FKN YE+  + + ++Y  ++ G V 
Sbjct  677  FRRTVTNMGEGAATYNVKIVQPEGSTIVVSPETLVFKNTYEKQIFSVTISYSSHKKGRVS  736

Query  538  FGSLTWIDESGKYKVRSPIAVAPM  609
            FG L W++E+GK+ VRSP+ V+P+
Sbjct  737  FGELVWVEENGKHTVRSPVVVSPI  760



>gb|EYU36339.1| hypothetical protein MIMGU_mgv1a001782mg [Erythranthe guttata]
Length=760

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 146/201 (73%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AI+SAM+TTAN  DNTN+PIKD AFN+++A+PL +G+G VDPN AL+PGL+YDATPQ
Sbjct  558  SPSAIQSAMMTTANHLDNTNQPIKDMAFNYSNATPLGIGSGHVDPNRALDPGLVYDATPQ  617

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            D+VNL+CSMN T+ Q  TITRS  Y   +P+SDLNYPSFI L+  +    E G    RTF
Sbjct  618  DFVNLVCSMNLTREQTQTITRS-TYNCSSPSSDLNYPSFIALFNFD----ERGMTFNRTF  672

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT V DG AT+ V +  P N++V IQ   L F+ KYE+  Y L + Y G+      F
Sbjct  673  HRTVTNVADGAATYKVKLEKPANTRVRIQPKTLVFQKKYEKQSYSLNIRYRGDIDSFPTF  732

Query  541  GSLTWIDESGKYKVRSPIAVA  603
            GSLTW++E+GK+KVRSPI V+
Sbjct  733  GSLTWVEETGKHKVRSPIVVS  753



>emb|CDP17236.1| unnamed protein product [Coffea canephora]
Length=761

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 146/207 (71%), Gaps = 5/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTA+  DNT  PIKD  FN+  ASPL+MGAG ++PN+AL+PGLIYDAT Q
Sbjct  559  SPAAIRSAIMTTASTLDNTQSPIKDMGFNYDIASPLAMGAGHINPNAALDPGLIYDATAQ  618

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY++LLC+MN T++QI +I RS +Y+  N +SDLNYPSFI LY    +   +G  + + F
Sbjct  619  DYISLLCTMNLTRSQIASIVRSTDYSCLNASSDLNYPSFIALY----NNGSTGV-LNKIF  673

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDGPAT+   V+ PR S VE+    L+F+ KY+   Y L + Y  + + +V F
Sbjct  674  ERTVTNVGDGPATYKAIVTAPRGSVVEVNPQTLAFQKKYDRQTYSLTIRYTSDNSAKVSF  733

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPTW  621
            GS+TW D  GK+ VRSPI V+P+   W
Sbjct  734  GSITWSDFGGKHVVRSPIVVSPITTVW  760



>ref|XP_002510194.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52381.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=766

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 145/205 (71%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFN-FTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRSAM+TTANP DNT  PI+D   +    ASPL+MGAGQ+DPN ALNPGLIYDATP
Sbjct  562  SPAAIRSAMITTANPLDNTQNPIRDNGDDKLGYASPLAMGAGQIDPNRALNPGLIYDATP  621

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            QDYVNLLCSMN+TK QILTITRS +Y   + +S LNYPSFI LY    +++ +G  + R 
Sbjct  622  QDYVNLLCSMNYTKKQILTITRSNSYNCTSSSSGLNYPSFIALY---DNKTSAGVTLTRK  678

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG+G A +   V  P  + V +    L F  K+++  Y+L + Y  ++ G+V 
Sbjct  679  FRRTVTNVGEGAAIYNAKVIAPLGATVTVWPETLVFGKKHDKQSYRLTIYYGADKKGKVS  738

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
            FGS+ W +E+G + VRSPIA++P++
Sbjct  739  FGSIVWTEENGVHTVRSPIAISPLV  763



>emb|CDP01318.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 145/207 (70%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAMVTTANP DNT  PI+D   N T ASPLSMGAG+V+PN ALNPGLIY+AT +
Sbjct  569  SPAAIRSAMVTTANPLDNTGNPIQDIGLNNTIASPLSMGAGEVNPNGALNPGLIYNATTE  628

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLCS N+T  QI  ITRS NY+  N +SD+NYPSFI LY  N +++     +++ F
Sbjct  629  DYINLLCSANYTWKQIKIITRS-NYSCSNASSDMNYPSFIALYN-NTTKNV----LKQRF  682

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G AT+   V+ P+ S V +    L F  KYEE  Y L + Y  NQ   + F
Sbjct  683  QRTVTNVGNGAATYKAQVTAPKGSVVTVYPEILVFGKKYEEQSYVLTIQYNANQNKTITF  742

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPTW  621
            GS+ W++ +GK+ VRSPIAVAPMI  W
Sbjct  743  GSIVWVEVNGKHIVRSPIAVAPMIEVW  769



>gb|ACA64705.1| subtilase, partial [Nicotiana tabacum]
Length=531

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 141/208 (68%), Gaps = 6/208 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTA+P DNT KPIKD   N  +A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  328  SPSAIRSAMMTTADPLDNTRKPIKDSDIN-KAATPLDMGAGHVDPNRALDPGLVYDATPQ  386

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYVNLLCS+NFT+ Q  TI RS  N+   NP++DLNYPSFI LYP+    +     + + 
Sbjct  387  DYVNLLCSLNFTEEQFKTIARSSDNHNCSNPSADLNYPSFIALYPLEGPFTF----LEQK  442

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG G AT+   +  P+N+ V +    L FK K E+  Y L + YLG+      
Sbjct  443  FRRTVTNVGQGAATYKAKLKAPKNTTVSVSPQTLVFKKKNEKQSYTLTIRYLGDVGQSRN  502

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             GS+TW++E+G + VRSPI  +P+I  W
Sbjct  503  VGSITWVEENGNHSVRSPIVTSPIIEIW  530



>ref|XP_004304798.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=1264

 Score =   224 bits (572),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 145/215 (67%), Gaps = 9/215 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA+VTTANP DNT  PI+D   NF  ASPL+MGAGQ+DPN AL PGLIYDAT Q
Sbjct  565  SAAAIRSALVTTANPLDNTRNPIRDNGDNFNFASPLAMGAGQIDPNRALEPGLIYDATIQ  624

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIR-RT  357
            DYVNLLCS NFT+ QIL ITRS  Y     +SDLNYPSFI LY  + ++      +R + 
Sbjct  625  DYVNLLCSTNFTRKQILAITRSHEYDCSKASSDLNYPSFIALYGQHHAKK-----LRVQK  679

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VGDG A + V V+ P  S V +    L+F N YE+  Y + + Y G++  +V 
Sbjct  680  FQRTVTNVGDGAAKYKVFVTAPNGSTVIVSPEILNFANIYEKQSYTVTIKYKGDKQKKVS  739

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPTW*FLGRIH  642
            FG L W++E+GKYKVRSPI V+P +    FL  +H
Sbjct  740  FGELVWVEENGKYKVRSPIVVSPDLT---FLLALH  771


 Score =   159 bits (401),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 107/177 (60%), Gaps = 11/177 (6%)
 Frame = +1

Query  106   LSMGAGQVDPN--------SALNPGLIYDATPQDYVNLLCSMNFTKTQILTITRSKNYTF  261
             L++ AG +D +        +AL PGLIYDATPQDYVNLLCS NFT  QIL ITRS  Y  
Sbjct  1088  LTVAAGTIDRSFGGILTLGNALEPGLIYDATPQDYVNLLCSTNFTAKQILAITRSPAYDC  1147

Query  262   ENPNSDLNYPSFILLYPVNQSRSESGYGIRRTFVRTVTYVGDGPATFTVHVSGPRNSQVE  441
              NP+SDLNYPSFI LY     R ++     + F RTVT VG G AT+   V  P+ S+V 
Sbjct  1148  FNPSSDLNYPSFIALY---DRRHDTKKLKVQKFQRTVTNVGHGAATYKASVIAPQGSKVT  1204

Query  442   IQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEFGSLTWIDESGKYKVRSPIAVAPMI  612
             +    L F  KYE+  Y L ++Y G + G V FG + W     KY VRSPI V+P++
Sbjct  1205  VSPDTLFFSEKYEKQSYTLTISYKGKKKGNVSFGEIVWAVVDLKYMVRSPIVVSPLV  1261



>ref|XP_006434737.1| hypothetical protein CICLE_v10000364mg [Citrus clementina]
 gb|ESR47977.1| hypothetical protein CICLE_v10000364mg [Citrus clementina]
Length=765

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 138/205 (67%), Gaps = 7/205 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAF-NFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            S AAIRSAMVTTANP DNTN PI+D    NFTSASPL+MGAGQVDPN AL+PGLIYDATP
Sbjct  566  SAAAIRSAMVTTANPLDNTNNPIRDNGLINFTSASPLAMGAGQVDPNRALDPGLIYDATP  625

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            QDYVNLLCSMNFT+ QIL+ITRS  Y    P SDLNYPSFI L+    ++        +T
Sbjct  626  QDYVNLLCSMNFTQNQILSITRSNRYNCSTPTSDLNYPSFITLHDNTSTK------FVQT  679

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG   AT+   ++ P  + + +    L F  +YE+  Y L + Y  +    + 
Sbjct  680  FHRTVTNVGGSAATYKAKITAPLGTVISVSPDTLVFGKQYEQQSYTLTINYKTDGGEIIS  739

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
            FG L W++E+G + VRSPI V+P +
Sbjct  740  FGELVWVEENGNHTVRSPITVSPFM  764



>gb|ACA64703.1| subtilase [Nicotiana tabacum]
Length=766

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 142/208 (68%), Gaps = 6/208 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTA+P DNT KPIKD   N  +A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  563  SPSAIRSAMMTTADPLDNTRKPIKDSDIN-KAATPLDMGAGHVDPNRALDPGLVYDATPQ  621

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYVNLLCS+NFT+ Q  TI RS  N+   NP++DLNYPSFI LYP+    +     + + 
Sbjct  622  DYVNLLCSLNFTEEQFKTIARSSDNHNCSNPSADLNYPSFIALYPLEGPFTL----LEQK  677

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG G AT+   +  P+NS V +    L FK K E+  Y L + YLG++     
Sbjct  678  FRRTVTNVGQGAATYKAKLKAPKNSTVSVSPQTLVFKKKNEKQSYTLTIRYLGDEGQSRN  737

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             GS+TW++E+G + VRSPI  +P+I  W
Sbjct  738  VGSITWVEENGNHSVRSPIVTSPIIEIW  765



>ref|XP_007207210.1| hypothetical protein PRUPE_ppa001938mg [Prunus persica]
 gb|EMJ08409.1| hypothetical protein PRUPE_ppa001938mg [Prunus persica]
Length=739

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 139/204 (68%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNTN PI+D   NF  ASPL+MGAGQ+DPN AL PGLIYDATPQ
Sbjct  540  SAAAIRSALMTTANPLDNTNNPIRDDGDNFNFASPLAMGAGQIDPNRALEPGLIYDATPQ  599

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLCS NFT+ QIL ITRS  Y   NP+ DLNYPSFI LY       ++   +++ F
Sbjct  600  DYVNLLCSTNFTRKQILAITRSYAYDCSNPSCDLNYPSFIALY---NDHHKTKTKVQK-F  655

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG A +   V  P+ S+V +    L F   YE+  + + + Y   + G V  
Sbjct  656  QRTVTNVGDGAARYKAAVIAPKGSKVTVSPEILIFGETYEKQSFTVTIKYKAKKKGTVSS  715

Query  541  GSLTWIDESGKYKVRSPIAVAPMI  612
            G+L WI+++GKY VRSPI V+P++
Sbjct  716  GALVWIEQNGKYTVRSPIVVSPLV  739



>ref|XP_009621569.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=766

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 142/208 (68%), Gaps = 6/208 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTA+P DNT KPIKD   N  +A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  563  SPSAIRSAMMTTADPLDNTRKPIKDSDIN-KAATPLDMGAGHVDPNRALDPGLVYDATPQ  621

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYVNLLCS+NFT+ Q  TI RS  N+   NP++DLNYPSFI LYP+    +     + + 
Sbjct  622  DYVNLLCSLNFTEEQFKTIARSSDNHNCSNPSADLNYPSFIALYPLEGPFTL----LEQK  677

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG G AT+   +  P+NS V +    L FK K E+  Y L + YLG++     
Sbjct  678  FRRTVTNVGQGAATYKAKLKAPKNSTVSVSPQTLVFKKKNEKQSYTLTIRYLGDEGQSRN  737

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             GS+TW++E+G + VRSPI  +P+I  W
Sbjct  738  VGSITWVEENGNHSVRSPIVTSPIIEIW  765



>gb|AAO62352.1| subtilase [Casuarina glauca]
Length=764

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 139/203 (68%), Gaps = 6/203 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTANP DNT KPI+D   +   ASPL+MGAG +DPN AL PGL+YDATPQ
Sbjct  565  SPAAIRSAMITTANPLDNTQKPIRDNGLDHQVASPLAMGAGNIDPNCALEPGLVYDATPQ  624

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLCSMNF +TQIL I R+++Y   NP+SDLNYPSFI  +     ++++   + + F
Sbjct  625  DYINLLCSMNFDRTQILAIIRTRSYNCSNPSSDLNYPSFIAFH---NGKNDT---VVKKF  678

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGD  A +   ++ PR S+V +    L FK KYE+  + L + +      +  F
Sbjct  679  RRTVTNVGDAVAIYNASIAAPRGSRVVVYPQTLVFKEKYEQKSFTLTMKFKRGPKMDTSF  738

Query  541  GSLTWIDESGKYKVRSPIAVAPM  609
            G+L W  E+GK+ VRSPI V+PM
Sbjct  739  GALVWTHENGKHIVRSPIVVSPM  761



>ref|XP_008218400.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=766

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 139/204 (68%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNTN PI+D   NF  ASPL+MGAGQ+DPN AL PGLIYDATPQ
Sbjct  567  SAAAIRSALMTTANPLDNTNNPIRDDGDNFNFASPLAMGAGQIDPNRALEPGLIYDATPQ  626

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLCS NFT+ QIL ITRS  Y   NP+ DLNYPSFI LY       ++   +++ F
Sbjct  627  DYVNLLCSTNFTRKQILAITRSHAYDCSNPSCDLNYPSFITLY---NDHHKTKTKVQK-F  682

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G A +   V  P+ S+V +    L F   YE+  + + + Y   + G V  
Sbjct  683  QRTVTNVGEGAARYKAAVIAPKGSKVTVSPEILIFGETYEKQSFTVTIKYKAKKKGTVSS  742

Query  541  GSLTWIDESGKYKVRSPIAVAPMI  612
            G+L WI+++GKY VRSPI V+P++
Sbjct  743  GALVWIEQNGKYTVRSPIVVSPLV  766



>gb|KDO84129.1| hypothetical protein CISIN_1g004265mg [Citrus sinensis]
Length=765

 Score =   219 bits (557),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 138/205 (67%), Gaps = 7/205 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAF-NFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            S AAIRSAMVTTANP DNTN PI+D    NFTSASPL+MGAGQVDPN AL+PGLIYDATP
Sbjct  566  SAAAIRSAMVTTANPLDNTNNPIRDNGLINFTSASPLAMGAGQVDPNRALDPGLIYDATP  625

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            QDYV+LLCSMNFT+ QIL+ITRS  Y    P SDLNYPSFI L+    ++        +T
Sbjct  626  QDYVSLLCSMNFTQNQILSITRSNRYNCSTPTSDLNYPSFITLHDNTSTK------FVQT  679

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG   AT+   ++ P  + + +    L F  +YE+  Y L + Y  +    + 
Sbjct  680  FHRTVTNVGGSAATYKAKITAPLGTVISVSPDTLVFGKQYEQQSYTLTINYKTDGGEIIS  739

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
            FG L W++E+G + VRSPI V+P +
Sbjct  740  FGELVWVEENGNHTVRSPITVSPFM  764



>ref|XP_009797476.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=766

 Score =   219 bits (557),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 142/208 (68%), Gaps = 6/208 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTA+P DNT KPIKD   N  +A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  563  SPSAIRSAMMTTADPLDNTRKPIKDSDIN-KAATPLDMGAGHVDPNRALDPGLVYDATPQ  621

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYVNLLCS+NFT+ Q  TI RS  N+   NP++DLNYPSFI LYP+    +     + + 
Sbjct  622  DYVNLLCSLNFTEEQFKTIARSSDNHNCSNPSADLNYPSFIALYPLEGPFTF----LEQK  677

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG G AT+   +  P+N+ V +    L FK K E+  Y L + YLG++     
Sbjct  678  FRRTVTNVGQGAATYKAKLKAPKNTTVSVSPQTLVFKKKNEKQSYTLTIRYLGDEGQSRN  737

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             GS+TW++E+G + VRSPI  +P+I  W
Sbjct  738  VGSITWVEENGNHSVRSPIVTSPIIEIW  765



>ref|XP_006345401.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=761

 Score =   219 bits (557),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 143/208 (69%), Gaps = 6/208 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTA+P DNT KPIKD   N  +A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  559  SPSAIRSAMMTTADPLDNTRKPIKDSDIN-KAATPLDMGAGHVDPNRALDPGLVYDATPQ  617

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYVNLLCS+NFT+ Q  TI RS  N+   NP++DLNYPSFI LY +  + +     + + 
Sbjct  618  DYVNLLCSLNFTEEQFKTIARSSANHNCSNPSADLNYPSFIALYSIEGNFTL----LEQK  673

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG G AT+   +  P+NS + +    L FKNK E+  Y L + Y+G++     
Sbjct  674  FKRTVTNVGKGAATYKAKLKAPKNSTISVSPQTLVFKNKNEKQSYTLTIRYIGDEGQSRN  733

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             GS+TW++++G + VRSPI  +P+I  W
Sbjct  734  VGSITWVEQNGNHSVRSPIVTSPIIEVW  761



>ref|XP_011069662.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=769

 Score =   219 bits (557),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 141/204 (69%), Gaps = 5/204 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAI+SAM+TTAN  DNT +PIKD AF++  A+PL +GAGQVDPN ALNPGLIYDAT Q
Sbjct  568  SPAAIQSAMMTTANALDNTKQPIKDMAFDYRVATPLGIGAGQVDPNRALNPGLIYDATVQ  627

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNL+CSMNFT  Q  TI RS +Y    P+ DLNYP+FI LY V ++R+     + R F
Sbjct  628  DYVNLVCSMNFTPEQTRTIIRS-SYNCSTPSPDLNYPTFIALYEVQETRTT----LTRKF  682

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RT+T VGDG AT+ V V  P  S + +    L F+ KYE+  Y L + Y  N    +  
Sbjct  683  KRTLTNVGDGAATYKVKVKEPNGSTITVSPQTLVFRKKYEKQSYSLTIRYRSNSEFVITD  742

Query  541  GSLTWIDESGKYKVRSPIAVAPMI  612
            GS+TWI+E+GK+ VRSPI V+P +
Sbjct  743  GSITWIEENGKHTVRSPIVVSPGV  766



>ref|XP_008370912.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 138/204 (68%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNT  PI D   NF  ASPL+MGAG +DPN AL+PG IYDATPQ
Sbjct  565  SAAAIRSALMTTANPLDNTGNPILDDGDNFXFASPLAMGAGHIDPNXALDPGJIYDATPQ  624

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            +YVNLLCS NFT+ QIL+ITRS  Y    P+SDLNYPSFI LY  N  +++      +TF
Sbjct  625  EYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIALY-XNHHKTKKRV---QTF  680

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG A +   V+ P  SQV +    L F  KYE+  + + L +   + G    
Sbjct  681  QRTVTNVGDGAARYRASVTAPMGSQVTVSPEILIFAYKYEKQSFTVTLNFNAKKKGNASS  740

Query  541  GSLTWIDESGKYKVRSPIAVAPMI  612
            G+L WI+++GKY VRSPI V+P++
Sbjct  741  GALVWIEQNGKYTVRSPIVVSPLV  764



>ref|XP_009787984.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 141/205 (69%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTA+P DNT KPIKD   N  +A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  570  SPSAIRSAMMTTADPLDNTRKPIKDSDIN-KAATPLDMGAGHVDPNRALDPGLVYDATPQ  628

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYVNLLCS+NFT+ Q  TI RS  N+   NP++DLNYPSFI LYP+    +     + + 
Sbjct  629  DYVNLLCSLNFTEEQFKTIARSSDNHNCSNPSADLNYPSFIALYPLEGPFTL----LEQK  684

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG G AT+   +  P+N+ V +    L FK K E+  Y L + YLG++     
Sbjct  685  FRRTVTNVGKGAATYKAKIKAPKNTTVSVSPQTLMFKKKNEKQSYTLTIRYLGDEGQSRN  744

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
             GS+TW++E+G + VRSPI  +P+I
Sbjct  745  VGSITWVEENGSHSVRSPIVTSPII  769



>gb|KHN04972.1| Subtilisin-like protease [Glycine soja]
Length=454

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 142/203 (70%), Gaps = 7/203 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA+VTTANP DNT  PI+D A  F  ASPL+MGAG+++PN AL+PGLIYDATPQ
Sbjct  254  SAAAIRSALVTTANPLDNTQNPIRDNANLFQYASPLAMGAGEIEPNRALDPGLIYDATPQ  313

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFE-NPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            +YVNLLC++ +T  QIL+ITRS++Y    NP+SDLNYPSFI+LY  N++RS       R 
Sbjct  314  NYVNLLCALGYTNNQILSITRSRSYECSANPSSDLNYPSFIVLYS-NKTRSTV-----RE  367

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F R VT VGDG AT+ V V+ P+ S V++    L+F  K E+  Y + + Y  N+   + 
Sbjct  368  FRRIVTNVGDGAATYKVKVTQPKGSVVKVSPETLAFGYKNEKQSYSVTVKYTRNKKENIS  427

Query  538  FGSLTWIDESGKYKVRSPIAVAP  606
            FG + W+++ G   VRSPI VAP
Sbjct  428  FGDIVWVEDGGARTVRSPIVVAP  450



>ref|XP_011074393.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=767

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 143/201 (71%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAI+SAM+TTANP DNTN+PIKD AF++T+A+PL +G+G VDPN AL+PGLIYD + Q
Sbjct  565  SPAAIQSAMMTTANPLDNTNQPIKDMAFDYTAATPLGIGSGLVDPNRALDPGLIYDVSHQ  624

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            D VNL+CSMNFT+ Q  TI RS ++    P++DLNYPSF+ L+    S +E G  + R F
Sbjct  625  DLVNLVCSMNFTREQTQTIIRS-SHNCSTPSADLNYPSFVALF----SFAERGRTLTRRF  679

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG A + V +  P N+ V IQ   L F+ KYE+  Y L + Y  +   +   
Sbjct  680  QRTVTNVGDGAARYRVKLETPENTTVRIQPQTLVFQKKYEKKSYVLTIRYKADIETQNRD  739

Query  541  GSLTWIDESGKYKVRSPIAVA  603
            GSLTWI+E+GKY+VRSPI V+
Sbjct  740  GSLTWIEENGKYRVRSPIMVS  760



>ref|XP_003624105.1| Xylem serine proteinase [Medicago truncatula]
 gb|ABD28576.1| Protease-associated PA; Proteinase inhibitor I9, subtilisin propeptide 
[Medicago truncatula]
 gb|AES80323.1| subtilisin-like serine protease [Medicago truncatula]
Length=769

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 139/202 (69%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNT  PI+D  +    ASPL++GAG++DPN A+NPGLIYDATPQ
Sbjct  570  SAAAIRSALITTANPLDNTQNPIRDNGYPSQHASPLAIGAGEIDPNRAMNPGLIYDATPQ  629

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC + FTK QILTITRS +Y  ENP+ DLNYPSFI  Y  N++RS     +   F
Sbjct  630  DYVNLLCGLKFTKNQILTITRSNSYDCENPSLDLNYPSFIAFYS-NKTRS-----MVHKF  683

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             R VT VGDG AT+   V+ P+ S V +    L+FK K E+  Y +++ Y+  +   V F
Sbjct  684  KRIVTNVGDGAATYRAKVTYPKGSVVTVSPDILTFKYKNEKQSYNIIIKYVMYKKENVSF  743

Query  541  GSLTWIDESGKYKVRSPIAVAP  606
            G L WI++ G + VRSPI VAP
Sbjct  744  GDLVWIEDGGAHIVRSPIVVAP  765



>emb|CDP01315.1| unnamed protein product [Coffea canephora]
Length=764

 Score =   216 bits (550),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 142/205 (69%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAA+RSAM+TTA   DNT  PIKD   +   A+PL++GAG VDPN AL+PGLIYDATPQ
Sbjct  561  SPAAVRSAMMTTATTLDNTRSPIKDTGRDNEVATPLAIGAGHVDPNRALDPGLIYDATPQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPV-NQSRSESGYGIRRT  357
            DY+N +CSMNFT+ Q L ITRS +Y   NP+SDLNYPSF+ LY   +Q++S+    + + 
Sbjct  621  DYINFICSMNFTRMQTLAITRSTSYNCSNPSSDLNYPSFVALYETSDQAKSK----LVKK  676

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RT+T VG+G AT+T  V+ P+ S V I    + F  KYE+  Y L ++Y GN+   V 
Sbjct  677  FRRTLTNVGNGAATYTAKVTAPKGSAVTISPKTIKFGKKYEKQSYSLTISYYGNENQIVS  736

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
             GS+TWI++ G + V SPI ++P +
Sbjct  737  SGSVTWIEDDGNHVVTSPIVISPRV  761



>gb|ACA64702.1| subtilase [Nicotiana tabacum]
Length=773

 Score =   216 bits (549),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 141/205 (69%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTA+P DNT KPIKD   N  +A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  570  SPSAIRSAMMTTADPLDNTRKPIKDSDIN-KAATPLDMGAGHVDPNRALDPGLVYDATPQ  628

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DY+NLLCS+NFT+ Q  TI RS  N+   NP++DLNYPSFI LYP+    +     + + 
Sbjct  629  DYLNLLCSLNFTEEQFKTIARSSDNHNCSNPSADLNYPSFIALYPLEGPFTL----LEQK  684

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG G AT+   +  P+N+ V +    L FK K E+  Y L + YLG++     
Sbjct  685  FRRTVTNVGKGAATYKAKIKAPKNTTVSVSPQTLMFKKKNEKQSYTLTIRYLGDEGQSRN  744

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
             GS+TW++E+G + VRSPI  +P+I
Sbjct  745  VGSITWVEENGSHSVRSPIVTSPII  769



>pdb|3I6S|A Chain A, Crystal Structure Of The Plant Subtilisin-Like Protease 
Sbt3
 pdb|3I6S|B Chain B, Crystal Structure Of The Plant Subtilisin-Like Protease 
Sbt3
 pdb|3I74|A Chain A, Crystal Structure Of The Plant Subtilisin-Like Protease 
Sbt3 In Complex With A Chloromethylketone Inhibitor
 pdb|3I74|B Chain B, Crystal Structure Of The Plant Subtilisin-Like Protease 
Sbt3 In Complex With A Chloromethylketone Inhibitor
Length=649

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 144/208 (69%), Gaps = 6/208 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTA+P DNT KPIKD + N  +A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  447  SPSAIRSAMMTTADPLDNTRKPIKD-SDNNKAATPLDMGAGHVDPNRALDPGLVYDATPQ  505

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYVNLLCS+NFT+ Q  TI RS  ++   NP++DLNYPSFI LY +  + +     + + 
Sbjct  506  DYVNLLCSLNFTEEQFKTIARSSASHNCSNPSADLNYPSFIALYSIEGNFTL----LEQK  561

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG G AT+   +  P+NS + +    L FKNK E+  Y L + Y+G++     
Sbjct  562  FKRTVTNVGKGAATYKAKLKAPKNSTISVSPQILVFKNKNEKQSYTLTIRYIGDEGQSRN  621

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             GS+TW++++G + VRSPI  +P+I  W
Sbjct  622  VGSITWVEQNGNHSVRSPIVTSPIIEVW  649



>emb|CAA59964.1| subtilisin-like protease [Alnus glutinosa]
Length=761

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 141/206 (68%), Gaps = 9/206 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTANP DNT  PI +    F  ASPL+MGAG +DPN AL+PGL+YDATPQ
Sbjct  558  SPAAIRSAMMTTANPLDNTLNPIHENGKKFHLASPLAMGAGHIDPNRALDPGLVYDATPQ  617

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFEN-PNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DY+NLLCSMN+ K QIL I RS +YT  N P+SDLNYPSFI  +     RS +      T
Sbjct  618  DYINLLCSMNYNKAQILAIVRSDSYTCSNDPSSDLNYPSFIAFHNSTCRRSVN------T  671

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQT--GE  531
            F RTVT VGDG AT+   V+ P++S+V +    L+F +KYE+  Y L +      T   +
Sbjct  672  FQRTVTNVGDGAATYKATVTAPKDSRVIVSPQTLAFGSKYEKQSYNLTIINFTRDTKRKD  731

Query  532  VEFGSLTWIDESGKYKVRSPIAVAPM  609
            + FG+L W +E+GK+ VRSPI V+P+
Sbjct  732  ISFGALVWANENGKHMVRSPIVVSPL  757



>gb|EYU36340.1| hypothetical protein MIMGU_mgv1a001790mg [Erythranthe guttata]
Length=759

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 144/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AI+SAM+TTAN  D+TN+PIKD A N+ +A+PL +G+GQVDPN AL+PGL+YDA+PQ
Sbjct  557  SPSAIQSAMMTTANHLDSTNQPIKDSASNYRNATPLGIGSGQVDPNRALDPGLVYDASPQ  616

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            D+VNL+CS NFT+ Q  TITR+ +Y   +P+SDLNYPSFI L+    +  E G    RTF
Sbjct  617  DFVNLVCSRNFTREQTQTITRT-SYNCSSPSSDLNYPSFIALF----NNDEIGMTFNRTF  671

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT V DG AT+ V +  P N++V IQ   L F+ KYE+  Y L + Y G+       
Sbjct  672  HRTVTNVADGAATYKVKLEKPANTRVRIQPKTLVFQKKYEKQSYSLNIRYRGDNNAFPRH  731

Query  541  GSLTWIDESGKYKVRSPIAVA  603
            GSLTW++E+GK+ VRSPI V+
Sbjct  732  GSLTWVEETGKHVVRSPIVVS  752



>gb|EYU36342.1| hypothetical protein MIMGU_mgv1a001789mg [Erythranthe guttata]
Length=759

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 145/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AI+SAM+TTAN  DNTN+PIKD AFN+++A+PL +G+GQVDPN AL+PGLIYDA+PQ
Sbjct  557  SPSAIQSAMMTTANHLDNTNQPIKDSAFNYSNATPLGIGSGQVDPNRALDPGLIYDASPQ  616

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            D+VNL+CSMN T+ +  TITRS  Y    P+SDLNYPSFI ++    +  E G    +TF
Sbjct  617  DFVNLVCSMNLTREETQTITRS-TYNCSTPSSDLNYPSFIAVF----NNDERGMMFNQTF  671

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT V +G AT+ V +  P N++V IQ   L F+ KYE+  Y L + Y G+      +
Sbjct  672  HRTVTNVANGAATYKVKLEKPENTRVRIQPKTLVFQKKYEKQSYTLNIRYRGDIDAFPTY  731

Query  541  GSLTWIDESGKYKVRSPIAVA  603
            GSLTW++++GK+ VRSPI V+
Sbjct  732  GSLTWVEKTGKHLVRSPIVVS  752



>ref|NP_001234774.1| subtilisin-like protease precursor [Solanum lycopersicum]
 emb|CAA06997.1| subtilisin-like protease [Solanum lycopersicum]
 emb|CAA07001.1| subtilisin-like protease [Solanum lycopersicum]
Length=761

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 144/208 (69%), Gaps = 6/208 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTA+P DNT KPIKD + N  +A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  559  SPSAIRSAMMTTADPLDNTRKPIKD-SDNNKAATPLDMGAGHVDPNRALDPGLVYDATPQ  617

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYVNLLCS+NFT+ Q  TI RS  ++   NP++DLNYPSFI LY +  + +     + + 
Sbjct  618  DYVNLLCSLNFTEEQFKTIARSSASHNCSNPSADLNYPSFIALYSIEGNFTL----LEQK  673

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG G AT+   +  P+NS + +    L FKNK E+  Y L + Y+G++     
Sbjct  674  FKRTVTNVGKGAATYKAKLKAPKNSTISVSPQILVFKNKNEKQSYTLTIRYIGDEGQSRN  733

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             GS+TW++++G + VRSPI  +P+I  W
Sbjct  734  VGSITWVEQNGNHSVRSPIVTSPIIEVW  761



>ref|XP_007147252.1| hypothetical protein PHAVU_006G108700g [Phaseolus vulgaris]
 gb|ESW19246.1| hypothetical protein PHAVU_006G108700g [Phaseolus vulgaris]
Length=765

 Score =   214 bits (546),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 141/202 (70%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S +A+RSA+ TTA+P DNT KPI++    F  ASPL+MGAG +DPN AL+PGLIYDATPQ
Sbjct  563  SASAVRSALTTTASPLDNTGKPIEENGELFQRASPLAMGAGLIDPNRALDPGLIYDATPQ  622

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC+MNFT+ QIL ITRSK+Y   +P+ D+NYPSF+  + V++S       + R F
Sbjct  623  DYVNLLCAMNFTQAQILAITRSKDYNCSSPSYDVNYPSFV-AFSVDKS-----VAVERKF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             R+VTYVGDG A +T  VS    +Q+ +    L FK KYE+ ++ L+L     +   V F
Sbjct  677  RRSVTYVGDGSAVYTARVSSSNGTQISVSPNRLVFKAKYEKRKFSLMLKSEMKKENVVPF  736

Query  541  GSLTWIDESGKYKVRSPIAVAP  606
            GSL W++E+G++ VRSP+ V P
Sbjct  737  GSLEWVEETGRHVVRSPLVVLP  758



>ref|XP_009342993.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   213 bits (542),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 138/205 (67%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNT  PI D   NF  ASPL+MGAG +DPN AL+PGLIYDATPQ
Sbjct  565  SAAAIRSALMTTANPLDNTGNPILDDGDNFNFASPLAMGAGHIDPNRALDPGLIYDATPQ  624

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIR-RT  357
            +YVNLLCS NFT+ QIL+ITRS  Y    P+SDLNYPSFI L     S ++     R +T
Sbjct  625  EYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIAL-----SNNDHKTKTRVQT  679

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VGDG A +   V  P+ SQV +    L F  KYE+  + + + +   + G   
Sbjct  680  FQRTVTNVGDGAARYMASVIAPKGSQVTVSPEILIFAYKYEKQSFTVTINFNAKKKGNAS  739

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
             G+L WI+++GKY VRSPI V+P++
Sbjct  740  SGALVWIEQNGKYTVRSPIVVSPLV  764



>ref|XP_009337959.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Pyrus 
x bretschneideri]
Length=798

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 138/205 (67%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNT  PI D   NF  ASPL+MGAG +DPN AL+PGLIYDATPQ
Sbjct  599  SAAAIRSALMTTANPLDNTGNPILDDGDNFNFASPLAMGAGHIDPNRALDPGLIYDATPQ  658

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIR-RT  357
            +YVNLLCS NFT+ QIL+ITRS  Y    P+SDLNYPSFI L     S ++     R +T
Sbjct  659  EYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIAL-----SNNDHKTKTRVQT  713

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VGDG A +   V  P+ SQV +    L F  KYE+  + + + +   + G   
Sbjct  714  FQRTVTNVGDGAARYMASVIAPKGSQVTVSPEILIFAYKYEKQSFTVTINFNAKKKGNAS  773

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
             G+L WI+++GKY VRSPI V+P++
Sbjct  774  SGALVWIEQNGKYTVRSPIVVSPLV  798



>ref|XP_007143987.1| hypothetical protein PHAVU_007G119500g [Phaseolus vulgaris]
 gb|ESW15981.1| hypothetical protein PHAVU_007G119500g [Phaseolus vulgaris]
Length=763

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 141/203 (69%), Gaps = 7/203 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSAMVTTA P+DNT  PI+D       ASPL+MGAG++DPN AL+PG IYDATP+
Sbjct  563  SAAAIRSAMVTTATPFDNTQSPIRDNGNPLQYASPLAMGAGEIDPNKALDPGFIYDATPE  622

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTF-ENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYVNLLC++ +++ QILTITRSK Y   +NP+SDLNYPSFI+LY  N++RS       + 
Sbjct  623  DYVNLLCALGYSQNQILTITRSKTYKCSDNPSSDLNYPSFIVLYS-NKTRSTV-----KK  676

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VGDG AT+ V V  P+ + V++    L+F  + E+  Y + + Y  N+   + 
Sbjct  677  FRRTVTNVGDGAATYRVKVKQPKGAAVKVSPETLTFGYRNEKQNYSVTIKYRRNKKESIP  736

Query  538  FGSLTWIDESGKYKVRSPIAVAP  606
            FG + W+++ G  KVRSPI VAP
Sbjct  737  FGDIVWVEDGGARKVRSPIVVAP  759



>gb|KHN14785.1| Subtilisin-like protease [Glycine soja]
Length=683

 Score =   210 bits (534),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 140/204 (69%), Gaps = 7/204 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA+VTTANP DNT  PI+D       ASPL+MGAG++DPN AL+PGLIYDATPQ
Sbjct  481  SAAAIRSALVTTANPLDNTQNPIRDNGNPLQYASPLAMGAGEIDPNRALDPGLIYDATPQ  540

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTF--ENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DYVNLLC++ +T  QILTITRSK+Y      P+SDLNYPSFI+LY  N+++S +     R
Sbjct  541  DYVNLLCALGYTHNQILTITRSKSYNCPANKPSSDLNYPSFIVLYS-NKTKSAT----VR  595

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VGDG AT+ V V+ P+ S V++    L+F  K E+  Y +++ Y  N+   +
Sbjct  596  EFRRTVTNVGDGAATYKVKVTQPKGSVVKVSPETLAFGYKNEKQSYSVIIKYTRNKKENI  655

Query  535  EFGSLTWIDESGKYKVRSPIAVAP  606
             FG + W+ +     VRSPI VAP
Sbjct  656  SFGDIVWVGDGDARTVRSPIVVAP  679



>ref|XP_003535388.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=769

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 140/204 (69%), Gaps = 7/204 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA+VTTANP DNT  PI+D       ASPL+MGAG++DPN AL+PGLIYDATPQ
Sbjct  567  SAAAIRSALVTTANPLDNTQNPIRDNGNPLQYASPLAMGAGEIDPNRALDPGLIYDATPQ  626

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTF--ENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DYVNLLC++ +T  QILTITRSK+Y      P+SDLNYPSFI+LY  N+++S +     R
Sbjct  627  DYVNLLCALGYTHNQILTITRSKSYNCPANKPSSDLNYPSFIVLYS-NKTKSAT----VR  681

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VGDG AT+ V V+ P+ S V++    L+F  K E+  Y +++ Y  N+   +
Sbjct  682  EFRRTVTNVGDGAATYKVKVTQPKGSVVKVSPETLAFGYKNEKQSYSVIIKYTRNKKENI  741

Query  535  EFGSLTWIDESGKYKVRSPIAVAP  606
             FG + W+ +     VRSPI VAP
Sbjct  742  SFGDIVWVGDGDARTVRSPIVVAP  765



>ref|XP_003552427.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=764

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 137/202 (68%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA+VTTA+P DNT  PI+D  +    ASPL++GAGQ+DPN AL+PGL+YDATPQ
Sbjct  565  SAAAIRSALVTTASPLDNTQNPIRDYGYPSQYASPLAIGAGQIDPNKALDPGLVYDATPQ  624

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++ +T+ QILTITRS +Y    P+ DLNYPSFI  Y  N +RS     +   F
Sbjct  625  DYVNLLCALKYTQKQILTITRSTSYNCAKPSFDLNYPSFIAFYR-NNTRS-----VVHKF  678

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG AT+   V+ P+ S V +    L+F+ K E+  Y +V+ Y   +   + F
Sbjct  679  RRTVTNVGDGAATYRAKVTQPKGSVVTVSPETLTFRYKNEKLSYDVVIKYSKYKKKNISF  738

Query  541  GSLTWIDESGKYKVRSPIAVAP  606
            G L W++E G + VRSPI VAP
Sbjct  739  GDLVWVEEGGTHSVRSPIVVAP  760



>gb|KHN40450.1| Subtilisin-like protease [Glycine soja]
Length=765

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 137/202 (68%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA+VTTA+P DNT  PI+D  +    ASPL++GAGQ+DPN AL+PGL+YDATPQ
Sbjct  566  SAAAIRSALVTTASPLDNTQNPIRDYGYPSQYASPLAIGAGQIDPNKALDPGLVYDATPQ  625

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++ +T+ QILTITRS +Y    P+ DLNYPSFI  Y  N +RS     +   F
Sbjct  626  DYVNLLCALKYTQKQILTITRSTSYNCAKPSFDLNYPSFIAFYR-NNTRS-----VVHKF  679

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG AT+   V+ P+ S V +    L+F+ K E+  Y +V+ Y   +   + F
Sbjct  680  RRTVTNVGDGAATYRAKVTQPKGSVVTVSPETLTFRYKNEKLSYDVVIKYSKYKKKNISF  739

Query  541  GSLTWIDESGKYKVRSPIAVAP  606
            G L W++E G + VRSPI VAP
Sbjct  740  GDLVWVEEGGTHSVRSPIVVAP  761



>ref|XP_003590866.1| Subtilisin-like protease [Medicago truncatula]
Length=752

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 137/205 (67%), Gaps = 9/205 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA+VTTANP+DN   PI D       ASPL+MGAGQ+DPN AL+PGLIYDATPQ
Sbjct  550  SSAAIRSAIVTTANPFDNMQNPIMDNGNPSQFASPLAMGAGQIDPNKALDPGLIYDATPQ  609

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC   +T +Q LTITRSK Y  +NP+SDLNYPSFI LY  N++RS     I + F
Sbjct  610  DYVNLLCDFGYTHSQTLTITRSKKYNCDNPSSDLNYPSFIALY-ANKTRS-----IEQKF  663

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE--V  534
            VRTVT VGDG A++ V V+ P+   V +    L F  K E+  Y LV+ Y      E  V
Sbjct  664  VRTVTNVGDGAASYNVKVTKPKGCVVTVVPEKLEFSVKNEKQSYSLVVKYKRKNKKELNV  723

Query  535  EFGSLTWIDE-SGKYKVRSPIAVAP  606
             FG + W+++  G + VRSPI VAP
Sbjct  724  LFGDIVWVEQGGGAHNVRSPIVVAP  748



>gb|AES61117.2| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 137/205 (67%), Gaps = 9/205 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA+VTTANP+DN   PI D       ASPL+MGAGQ+DPN AL+PGLIYDATPQ
Sbjct  564  SSAAIRSAIVTTANPFDNMQNPIMDNGNPSQFASPLAMGAGQIDPNKALDPGLIYDATPQ  623

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC   +T +Q LTITRSK Y  +NP+SDLNYPSFI LY  N++RS     I + F
Sbjct  624  DYVNLLCDFGYTHSQTLTITRSKKYNCDNPSSDLNYPSFIALY-ANKTRS-----IEQKF  677

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE--V  534
            VRTVT VGDG A++ V V+ P+   V +    L F  K E+  Y LV+ Y      E  V
Sbjct  678  VRTVTNVGDGAASYNVKVTKPKGCVVTVVPEKLEFSVKNEKQSYSLVVKYKRKNKKELNV  737

Query  535  EFGSLTWIDE-SGKYKVRSPIAVAP  606
             FG + W+++  G + VRSPI VAP
Sbjct  738  LFGDIVWVEQGGGAHNVRSPIVVAP  762



>ref|XP_006345406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 141/209 (67%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  DNT+KPI+    N   A+PL MGAG VDPN AL+PGLIYDATPQ
Sbjct  570  SPSAIRSAMMTTANHLDNTHKPIRRD--NNRVATPLEMGAGHVDPNKALDPGLIYDATPQ  627

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYT-FENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DY+NL+CS+NFT+ Q  T  RS  NY    NP++DLNYPSFI LYP +  R+ +   + +
Sbjct  628  DYINLICSLNFTEEQFKTFARSSANYNNCSNPSADLNYPSFIALYPFSIERNYTW--LEQ  685

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RT+T VG G AT+ V +  P+NS + +    L FK K ++  Y L + Y+G+     
Sbjct  686  KFRRTLTNVGKGGATYNVKIETPKNSTISVSPRTLVFKGKNDKQSYSLTIQYIGDSDQST  745

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             FGS+TW++E G + VRSP+  +P++  W
Sbjct  746  NFGSITWVEEKGNHSVRSPVVTSPIVEVW  774



>ref|XP_008370910.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=651

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 139/204 (68%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNT  PI D   NF  ASPL+MGAG +DPN AL+PGLIYDATPQ
Sbjct  452  SAAAIRSALMTTANPLDNTGNPILDDGDNFXFASPLAMGAGHIDPNXALDPGLIYDATPQ  511

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            +YVNLLCS NFT+ QIL+ITRS  Y    P+SDLNYPSFI LY  N  +++      +TF
Sbjct  512  EYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIALYN-NHHKTKKRV---QTF  567

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGD  A +   V+ P+ SQV +    L F  KYE+  + + L Y   + G+   
Sbjct  568  QRTVTNVGDXAARYRASVTAPKGSQVTVSPEILIFAYKYEKQSFTVTLNYKAKKKGKASS  627

Query  541  GSLTWIDESGKYKVRSPIAVAPMI  612
            G+L WI+++GKY  RSPI V+P++
Sbjct  628  GALVWIEQNGKYTXRSPIVVSPLV  651



>ref|XP_006345402.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=760

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 142/209 (68%), Gaps = 11/209 (5%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTA+P DNT KPI D   N   A+PL+MG+G V+PN AL+PGL+YDATPQ
Sbjct  561  SPSAIRSAMMTTADPLDNTGKPIIDSDIN-REATPLAMGSGHVNPNRALDPGLVYDATPQ  619

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGY-GIRR  354
            DYVNLLCSMNFT+ Q  TI RS  N+   +P++DLNYPSFI LY      +E  Y  + +
Sbjct  620  DYVNLLCSMNFTEEQFKTIARSSANHNCSDPSADLNYPSFIALY-----SNEGNYTWLEQ  674

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG G AT+   +  P+NS+V +    L +KNK E+  Y L + Y+G      
Sbjct  675  KFRRTVTNVGQGAATYKAKIKAPKNSKVSVSPQTLVYKNKNEKQSYTLTIRYIGPNW---  731

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             +GS+TW++E G + VRSPI ++P+I  W
Sbjct  732  NYGSITWVEEHGNHTVRSPIVISPIIDLW  760



>ref|XP_009608285.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score =   208 bits (529),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 140/213 (66%), Gaps = 14/213 (7%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFT-SASPLSMGAGQVDPNSALNPGLIYDATP  177
            SP+AIRSAM+TTANP DNT+KPIK P +     A+ L+MGAG VDPN A++PGLIYDATP
Sbjct  566  SPSAIRSAMMTTANPLDNTDKPIKTPDYMVKRDATSLAMGAGLVDPNRAVDPGLIYDATP  625

Query  178  QDYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYG---  345
            QDYVNLLCSMN T  Q  TI RS   +   NP++D+NYPSFI L+        S YG   
Sbjct  626  QDYVNLLCSMNLTVEQFKTIARSSAKHNCSNPSNDINYPSFIALF--------SPYGNYT  677

Query  346  -IRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQ  522
             + + F RTVT VG   AT+ V V  P+NS + I    L F+ KY++ +Y L + Y G  
Sbjct  678  WLEQKFKRTVTNVGAAAATYKVKVRAPKNSTISISPQTLVFEKKYQKQDYSLTIRYKGVA  737

Query  523  TGEVEFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
              + + GS+TW++E+G + VRSPI VAP I  W
Sbjct  738  EDQAQSGSITWVEENGHHTVRSPIVVAPEIDAW  770



>gb|ABD28577.1| Proteinase inhibitor I9, subtilisin propeptide [Medicago truncatula]
 gb|AES80322.2| subtilisin-like serine protease [Medicago truncatula]
Length=771

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 137/202 (68%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNT   I+D  +    ASPL++GAG++DPN A+NPGLIYDATPQ
Sbjct  572  SSAAIRSALITTANPLDNTKNLIRDNGYPSQYASPLAIGAGEIDPNRAMNPGLIYDATPQ  631

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVN LC + FTK QILTITRS +Y  ENP+ DLNYPSFI  Y   ++RS     +  TF
Sbjct  632  DYVNFLCGLKFTKNQILTITRSSSYGCENPSLDLNYPSFIAFYN-KKTRS-----MVHTF  685

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG AT++ +V+ P+   + +    L+FK + E+  Y LV+  +  +   V F
Sbjct  686  NRTVTNVGDGAATYSANVTHPKGCVMTVLPDILTFKYRNEKQSYSLVIKCVMYKKDNVSF  745

Query  541  GSLTWIDESGKYKVRSPIAVAP  606
            G L WI+  G + VRSPI VAP
Sbjct  746  GDLVWIEYGGAHTVRSPIVVAP  767



>ref|XP_010112176.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32842.1| Subtilisin-like protease [Morus notabilis]
Length=344

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 129/204 (63%), Gaps = 6/204 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTANP DNT  PI+D   N   A PL++GAGQ+D N AL+PGLIYDATPQ
Sbjct  145  SPAAIRSAMITTANPLDNTFNPIRDYGNNLQFAFPLAIGAGQIDSNRALDPGLIYDATPQ  204

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLCS NFTK QIL I  +  Y       DLNYPSFI LY       +    + + +
Sbjct  205  DYVNLLCSTNFTKKQILAIINTNKYDCPRAYYDLNYPSFIALY------HDHAKWMDQKY  258

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RT+T VG+   T+   V+ P  S+V +    L F  K+E   Y L + Y GN    V  
Sbjct  259  TRTLTNVGESVVTYKAMVTAPNFSEVVVSPNVLVFMKKHERKSYNLTIKYKGNMERRVSS  318

Query  541  GSLTWIDESGKYKVRSPIAVAPMI  612
            GSL W++++GK+ VRSPI V+P++
Sbjct  319  GSLVWVEDNGKHTVRSPIVVSPLV  342



>ref|XP_009343011.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 139/205 (68%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNT  PI D   NF  ASPL+MGAG +DPN AL+PGLIYDATPQ
Sbjct  565  SAAAIRSALMTTANPLDNTGNPILDDGDNFNFASPLAMGAGHIDPNRALDPGLIYDATPQ  624

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIR-RT  357
            +YVNLLCS NFT+ QIL+ITRS  Y    P+SDLNYPSFI L     S ++     R +T
Sbjct  625  EYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIAL-----SNNDHKTKTRVQT  679

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F R VT VGDG A +   V+ P+ SQV +    L F  KYE+  + + L Y   + G+  
Sbjct  680  FQRAVTNVGDGAARYRASVTSPKGSQVTVSPEILIFAYKYEKQSFTVTLNYKAKKKGKAS  739

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
             G+L WI+++GKY VRSPI V+P++
Sbjct  740  SGALVWIEQNGKYTVRSPIVVSPLV  764



>ref|XP_009338017.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 139/205 (68%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNT  PI D   NF  ASPL+MGAG +DPN AL+PGLIYDATPQ
Sbjct  565  SAAAIRSALMTTANPLDNTGNPILDDGDNFNFASPLAMGAGHIDPNRALDPGLIYDATPQ  624

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIR-RT  357
            +YVNLLCS NFT+ QIL+ITRS  Y    P+SDLNYPSFI L     S ++     R +T
Sbjct  625  EYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIAL-----SNNDHKTKTRVQT  679

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F R VT VGDG A +   V+ P+ SQV +    L F  KYE+  + + L Y   + G+  
Sbjct  680  FQRAVTNVGDGAARYRASVTSPKGSQVTVSPEILIFAYKYEKQSFTVTLNYKAKKKGKAS  739

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
             G+L WI+++GKY VRSPI V+P++
Sbjct  740  SGALVWIEQNGKYTVRSPIVVSPLV  764



>ref|XP_004229665.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 139/209 (67%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  DNT  PI+    N   A+PL MG+G VDPN AL+PGLIYDATPQ
Sbjct  570  SPSAIRSAMMTTANHLDNTQNPIRRD--NNRVATPLEMGSGHVDPNKALDPGLIYDATPQ  627

Query  181  DYVNLLCSMNFTKTQILTITRSK-NY-TFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DY+NL+CS+NFT+ Q  T  RS  NY    NP++DLNYPSFI LYP +  R+ +   + +
Sbjct  628  DYINLICSLNFTEEQFKTFARSSANYHNCSNPSADLNYPSFIALYPFSIERNYTW--LEQ  685

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RT+T VG G AT+ V +  P+NS + +    L FK K ++  Y L + Y+G+     
Sbjct  686  KFRRTLTNVGKGEATYKVKIETPKNSTISVSPRTLVFKGKNDKQSYSLTIRYIGDSDQST  745

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             FGS+TW++E G + VRSPI  +P+I  W
Sbjct  746  NFGSITWVEEKGNHSVRSPIVTSPIIEVW  774



>ref|XP_004229661.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=769

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 138/208 (66%), Gaps = 6/208 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTANP+DN  KPI+    N   A+ L MGAG VDPN AL+PGLIYD TPQ
Sbjct  567  SPSAIRSAMMTTANPWDNAQKPIRKSEDN-KPATSLDMGAGHVDPNRALDPGLIYDTTPQ  625

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYVNLLCS+NFT+ Q  TI RS  N+   NP+SD+NYPSFI  +    S   +   + + 
Sbjct  626  DYVNLLCSLNFTEEQFKTIARSSTNHNCSNPSSDINYPSFIAFF----SPEGNFTFLEQK  681

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F+RTVT VG   A + V V  PRNS+V +    L FK K ++  Y L + Y  +   EV+
Sbjct  682  FMRTVTNVGSAAAKYRVKVKAPRNSKVSVSPQTLVFKKKNQKLNYSLTIRYKDDAEQEVQ  741

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             GS+TW++E+G + VRSPI ++P I TW
Sbjct  742  SGSITWVEENGNHTVRSPIVISPEIETW  769



>ref|XP_007139760.1| hypothetical protein PHAVU_008G056700g [Phaseolus vulgaris]
 gb|ESW11754.1| hypothetical protein PHAVU_008G056700g [Phaseolus vulgaris]
Length=765

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 137/202 (68%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA+VTTA+P DNT  PI+D  +    ASPL+MGAGQ+DPN AL+PGLIYDATPQ
Sbjct  566  SAAAIRSALVTTASPLDNTQNPIRDYGYPSQYASPLAMGAGQIDPNKALDPGLIYDATPQ  625

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++++T+ QILTITRS +Y    P+ DLNYPSFI  Y  N++RS     + + F
Sbjct  626  DYVNLLCALHYTQKQILTITRSSSYNCAKPSFDLNYPSFIAFYS-NKTRS-----VVQKF  679

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG A + V  + P  S V +    L+F+ K E+  Y +++ Y   +   + +
Sbjct  680  KRTVTNVGDGGAIYRVKTTQPNGSVVTVSPETLAFRYKNEKLSYDVMIKYRKYKKENISY  739

Query  541  GSLTWIDESGKYKVRSPIAVAP  606
            G L WI++ G + VRSPI V P
Sbjct  740  GDLVWIEDGGAHSVRSPIVVGP  761



>ref|XP_009769989.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=771

 Score =   206 bits (523),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 141/213 (66%), Gaps = 14/213 (7%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTS-ASPLSMGAGQVDPNSALNPGLIYDATP  177
            SP+AIRSAM+TTANP DNT+KPIK P +   S A+ L+MGAG VDPN A++PGL+YD+TP
Sbjct  566  SPSAIRSAMMTTANPLDNTDKPIKTPDYMVKSDATSLAMGAGLVDPNRAVDPGLVYDSTP  625

Query  178  QDYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYG---  345
            QDYVNLLCSMN T  Q  TI RS   +   NP++D+NYPSFI L+        S YG   
Sbjct  626  QDYVNLLCSMNLTVAQFRTIARSSAKHNCSNPSNDINYPSFIALF--------SPYGNYT  677

Query  346  -IRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQ  522
             + + F RTVT VG G AT+ V V  P+NS + I    L F+ K ++ +Y L + Y G  
Sbjct  678  WLEQKFKRTVTNVGVGAATYKVKVKAPKNSTISISPQTLVFEKKNQKQDYYLTIRYKGIA  737

Query  523  TGEVEFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
              + + GS+TW++E+G + VRSPI VAP I  W
Sbjct  738  EDQAQSGSITWVEENGHHTVRSPIVVAPEIDAW  770



>ref|XP_009608286.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=765

 Score =   204 bits (520),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 138/212 (65%), Gaps = 14/212 (7%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTANP DNT KPIK  A N   A+ L+MGAG VDPN A++PGLIYDATPQ
Sbjct  562  SPSAIRSAMMTTANPLDNTEKPIKS-ADNDKDATSLAMGAGLVDPNRAVDPGLIYDATPQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYG----  345
            DYVNLLCSMN T  Q  TI RS   +   NP++D+NYPSFI L+        S YG    
Sbjct  621  DYVNLLCSMNLTVEQFKTIARSSAKHNCSNPSNDINYPSFIALF--------SPYGNYTW  672

Query  346  IRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQT  525
            + + F RTVT VG G AT+ V V  P NS + I    L F+ K ++ +Y L + Y G   
Sbjct  673  LEQKFKRTVTNVGVGAATYKVKVRAPENSSISISPQTLVFEKKNQKQDYTLTIRYKGVAE  732

Query  526  GEVEFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             + + GS+TW++E+G + VRSPI VAP I  W
Sbjct  733  DQAQSGSITWVEENGHHTVRSPIVVAPQIDAW  764



>ref|XP_004249504.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score =   204 bits (520),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 139/206 (67%), Gaps = 6/206 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTS-ASPLSMGAGQVDPNSALNPGLIYDATP  177
            SP+AIRSAM+TTANP DNT KPIK   +  TS A+ LSMGAG VDPN A++PGLIYDATP
Sbjct  563  SPSAIRSAMMTTANPLDNTEKPIKTIDYLRTSYATSLSMGAGLVDPNRAVDPGLIYDATP  622

Query  178  QDYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            QDYVNLLCSMNFT  Q  TI RS   +  ENP+ D+NYPSFI LY  N   +     + +
Sbjct  623  QDYVNLLCSMNFTAKQFKTIARSSAKHNCENPSDDINYPSFIALYVPNGDYAW----LEQ  678

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG G A + V V  P NS + I    L F+ K+++ +Y L + Y G +  + 
Sbjct  679  KFKRTVTNVGPGAAIYKVKVKAPINSTISISPQTLVFEKKHQKQDYTLTIRYRGIEFDQA  738

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMI  612
            + GS+TW++++G + VRSPI VAP +
Sbjct  739  QSGSVTWVEKNGHHTVRSPIVVAPAL  764



>gb|EYU19442.1| hypothetical protein MIMGU_mgv1a001731mg [Erythranthe guttata]
Length=768

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 137/201 (68%), Gaps = 6/201 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAI+SAM+TTANP DNTN+PI++   + T A+PL +G+GQVDPN AL+PGLIYDAT Q
Sbjct  567  SPAAIQSAMMTTANPLDNTNQPIRE--VDGTVATPLGIGSGQVDPNRALDPGLIYDATTQ  624

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            D VNL+CSMNFT  Q  TI RS NY   NP+SDLNYPSF+ L     +  + G  + R F
Sbjct  625  DLVNLVCSMNFTSEQTQTIVRSTNYNCSNPSSDLNYPSFVALI----NFEDIGRVLTRRF  680

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGD  A + V V  P N+ V ++   L F+ K E+  Y + + Y G+   +   
Sbjct  681  ERTVTNVGDAAAKYRVKVEAPVNTTVRVRPQTLVFQKKNEKQSYTVTIRYNGDIETQHRP  740

Query  541  GSLTWIDESGKYKVRSPIAVA  603
            GSLTWI++SGKY VRSPI V+
Sbjct  741  GSLTWIEQSGKYTVRSPIMVS  761



>gb|EYU25438.1| hypothetical protein MIMGU_mgv1a001996mg [Erythranthe guttata]
Length=729

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 140/206 (68%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    PAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQD  183
            PAAIRSAM+TTA+  DNT KPIKD   ++  A+PL MGAGQVDPN AL+PGLIYDATPQD
Sbjct  529  PAAIRSAMMTTASTLDNTGKPIKDMGNDYKGATPLDMGAGQVDPNRALDPGLIYDATPQD  588

Query  184  YVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLY-PVNQSRSESGYGIRRTF  360
            YVNL+C++N+T+ Q  TI RS NY   NP+ DLNYP+F+ LY P+ +  +++     R F
Sbjct  589  YVNLVCALNYTREQTRTIIRS-NYNCSNPSLDLNYPAFVALYDPLEEVSTKT-----RRF  642

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG AT+ V V  P++S + +    L F+ K ++  + L ++Y   +   +  
Sbjct  643  RRTVTNVGDGAATYKVSVKRPKDSVITVSPEKLVFQKKNQKLSFSLTISYKTYRDYVINH  702

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPT  618
            GS+ W +E GK+ VRSPI V P  P+
Sbjct  703  GSIIWAEEKGKHTVRSPIVVTPAEPS  728



>ref|XP_008355893.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   203 bits (517),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 135/204 (66%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNT  PI D   NF  ASPL+MGAG +DPN AL+PGLIYDATPQ
Sbjct  565  SAAAIRSALMTTANPLDNTGNPILDDGDNFXFASPLAMGAGHIDPNXALDPGLIYDATPQ  624

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            +YVNLLCS NFT+ QIL+ITRS  Y    P+SDLNYPSFI LY  +    +      +TF
Sbjct  625  EYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIALYNNHHKTKKR----XQTF  680

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGD  A +   V+ P  SQV +    L F  KYE+  + + L     + G+   
Sbjct  681  QRTVTNVGDXAARYRASVTAPXGSQVTVSPEILIFAYKYEKQSFTVTLNXXAKKKGKASS  740

Query  541  GSLTWIDESGKYKVRSPIAVAPMI  612
            G+L WI+++GKY  RSPI V+P++
Sbjct  741  GALVWIEQNGKYTXRSPIVVSPLV  764



>ref|XP_011069660.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=762

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 138/206 (67%), Gaps = 5/206 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTANP DNT KPIKD    +  A+PL MGAGQVDPN AL+PGLIYD T Q
Sbjct  562  SPAAIRSAMMTTANPIDNTQKPIKDMGHRYDIATPLDMGAGQVDPNRALDPGLIYDVTAQ  621

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNL+C++N+T+ Q  +I RS  Y   +P++DLNYP+F+ LY   Q R+     + + F
Sbjct  622  DYVNLVCALNYTREQTQSIIRS-TYNCSSPSTDLNYPAFVALYDPLQERTT----LTQKF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G AT+ V V  P++S + +    L F+ K E+  + L + Y       +  
Sbjct  677  QRTVTNVGNGAATYKVKVKRPKDSVITVSPEKLVFQKKNEKQRFSLTIRYKSYDEYVINH  736

Query  541  GSLTWIDESGKYKVRSPIAVAPMIPT  618
            GS+TW++E+GK+ VRSPI V P  P+
Sbjct  737  GSITWVEENGKHNVRSPIVVTPPEPS  762



>ref|XP_004496012.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=761

 Score =   203 bits (516),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 136/202 (67%), Gaps = 7/202 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNTN PI D       ASPL+MGAG++DPN AL+PG IYDATPQ
Sbjct  561  SAAAIRSAIITTANPNDNTNNPIMDNGNLSQFASPLAMGAGEIDPNKALDPGFIYDATPQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC   +T  QILTITRSK Y  +NP+SDLNYPSFI+LY  N+ R+     + + F
Sbjct  621  DYVNLLCDFGYTHKQILTITRSKVYNCDNPSSDLNYPSFIVLYG-NKKRT-----MVQKF  674

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTG-EVE  537
            +R+VT VGDG A++ V V+ P+   V +    L+F  K E+  Y + + Y  N+    V 
Sbjct  675  LRSVTNVGDGAASYKVKVTKPKGCVVTVLPEKLTFNYKNEKLSYTVEIKYKRNKKELNVS  734

Query  538  FGSLTWIDESGKYKVRSPIAVA  603
            FG + WI+E G   VRSPI VA
Sbjct  735  FGDIVWIEEGGARTVRSPIVVA  756



>ref|XP_007139763.1| hypothetical protein PHAVU_008G057000g [Phaseolus vulgaris]
 gb|ESW11757.1| hypothetical protein PHAVU_008G057000g [Phaseolus vulgaris]
Length=739

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 137/202 (68%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA+VTTA+P DNT  PI+D  +    ASPL MGAGQ+DPN AL+PGLIYDATPQ
Sbjct  540  SAAAIRSALVTTASPLDNTQNPIRDYGYPSQYASPLDMGAGQIDPNKALDPGLIYDATPQ  599

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++N+T  QIL +TRS +Y    P+ DLNYPSFI +Y  N++ S     +   F
Sbjct  600  DYVNLLCALNYTLKQILALTRSGSYNCAKPSFDLNYPSFIAIYS-NKTMS-----VVHKF  653

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG G AT+   V+ P+ S V +    L+F+ K E+  Y +++ Y   +  ++ +
Sbjct  654  RRTVTNVGVGAATYRAKVTQPKGSVVTVSPETLAFRYKNEKLSYDVMIKYRKYKKEDISY  713

Query  541  GSLTWIDESGKYKVRSPIAVAP  606
            G L WI++ G ++VRSPI +AP
Sbjct  714  GDLIWIEDGGAHRVRSPIVLAP  735



>ref|XP_009771925.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=781

 Score =   202 bits (515),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 139/209 (67%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  DN+ KPI++   +   A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  573  SPSAIRSAMMTTANHLDNSQKPIRED--DGMVATPLDMGAGHVDPNKALDPGLVYDATPQ  630

Query  181  DYVNLLCSMNFTKTQILTITRSK-NY-TFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DY+NL+CSMNFT+ Q  T  RS  NY    NP++DLNYPSFI LYP   S   +   + +
Sbjct  631  DYINLICSMNFTEEQFKTFARSSANYHNCSNPSADLNYPSFIALYPF--SLEGNFTWLEQ  688

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RT+T VG G AT+ V +  P+NS V +    L FK K E+  Y L + Y+G++    
Sbjct  689  KFRRTLTNVGKGGATYKVKIETPKNSTVSMSPKTLVFKKKNEKQSYTLTIRYIGDENQSR  748

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
              GS+TW++E+G + VRSPI V  +I  W
Sbjct  749  NVGSITWVEENGNHSVRSPIVVTRIIALW  777



>gb|EYU36336.1| hypothetical protein MIMGU_mgv1a019012mg, partial [Erythranthe 
guttata]
Length=733

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 133/200 (67%), Gaps = 7/200 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAI+SAM+TTANP DNTN+PIK+   +   A P  +G+GQVDPN ALNPGLIYDA+ Q
Sbjct  534  SPAAIQSAMMTTANPLDNTNQPIKE--VDRMLAVPTGIGSGQVDPNRALNPGLIYDASTQ  591

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            D VNL+CSMNFT+ Q  TITRS N+    P  DLNYPSFI LY   Q+    G  + R+F
Sbjct  592  DLVNLVCSMNFTREQTETITRS-NFNCSTPYPDLNYPSFIALYEFAQT----GRRLTRSF  646

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RT+T VG G AT+ V V  P N+ V ++   L F+ KYE+  Y L + YL         
Sbjct  647  KRTLTNVGKGGATYRVKVEAPSNATVRVRPKTLVFREKYEKLSYSLSIRYLAGFFPPATP  706

Query  541  GSLTWIDESGKYKVRSPIAV  600
            GS+TW DE+GKY VRSPI V
Sbjct  707  GSITWTDETGKYSVRSPIQV  726



>gb|KHN43135.1| Subtilisin-like protease [Glycine soja]
Length=610

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 138/214 (64%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S +AIRSA+ TTANP DNT KPI++       ASPL+MGAG +DPN AL+PGLIYDA+PQ
Sbjct  403  SASAIRSALTTTANPLDNTGKPIEESGDWPQRASPLAMGAGLIDPNRALDPGLIYDASPQ  462

Query  181  DYVNLLCSMNFTKTQILTITRSKNYT-FENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYVNLLC+MN T+ QI+ ITRSK Y+     + DLNYPSF+  Y     + E+       
Sbjct  463  DYVNLLCAMNLTQAQIMAITRSKAYSNCSRASYDLNYPSFVAFYADKSVKVET------K  516

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F R VTYVGDGPA +T  VS    + + +    L FKNK+E+ ++ L      ++  +V 
Sbjct  517  FRRIVTYVGDGPAVYTARVSSYNGTAISVSPNRLVFKNKHEKRKFTLSFKSQMDKDYDVA  576

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPTW*FLGRI  639
            FGSL W++E+G++ VRSP+ + P    + F  RI
Sbjct  577  FGSLQWVEETGRHLVRSPVVLVPRNVAFNFQTRI  610



>emb|CAA07059.1| SBT4B protein [Solanum lycopersicum]
Length=777

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 139/209 (67%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  D+T KPI++   +   A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  569  SPSAIRSAMMTTANHLDSTQKPIRED--DNMIATPLDMGAGHVDPNRALDPGLVYDATPQ  626

Query  181  DYVNLLCSMNFTKTQILTITRSK-NY-TFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DY+NL+CSMNFT+ Q  T  RS  NY    NP++DLNYPSFI LYP   S   +   + +
Sbjct  627  DYINLICSMNFTEEQFKTFARSSANYNNCSNPSADLNYPSFIALYPF--SLEGNFTWLEQ  684

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RT+T VG G AT+ V +  P+NS V +    L FK K ++  Y L + Y+G+     
Sbjct  685  KFRRTLTNVGKGGATYKVKIETPKNSTVSVSPRTLVFKGKNDKQSYNLTIRYIGDSDQSK  744

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             FGS+TW++E+G + VRSPI  + +I  W
Sbjct  745  NFGSITWVEENGNHTVRSPIVTSTIIEVW  773



>ref|XP_006345494.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=754

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 136/209 (65%), Gaps = 8/209 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTANP DNT KPI+    N   A+ L MGAG VDPN AL+PGLIYD TPQ
Sbjct  552  SPSAIRSAMMTTANPLDNTQKPIRKSEDN-KPATSLDMGAGHVDPNRALDPGLIYDTTPQ  610

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYG-IRR  354
            DYVNLLCS+NFT+ Q  TI RS  N+   NP+SD+NYPSFI  +       E  +  + +
Sbjct  611  DYVNLLCSLNFTEEQFKTIARSSANHNCSNPSSDINYPSFIAFF-----SPEGNFTFLEQ  665

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG   A + V V  PRNS+V +    L F+ K ++  Y L + Y  +   EV
Sbjct  666  KFRRTVTNVGSAAAKYRVKVKAPRNSKVSVSPQTLVFRKKNQKLSYSLTIRYKDDAQQEV  725

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
            + GS+TW++E+  + VRSPI ++P I TW
Sbjct  726  QSGSITWVEENRNHTVRSPIVISPEIETW  754



>gb|AAY63882.1| subtilisin-like serine protease [Solanum tuberosum]
Length=656

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 140/209 (67%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  D++ KPI++   +   A+PL MGAG +DPN AL+PGL+YDATPQ
Sbjct  452  SPSAIRSAMMTTANHLDSSQKPIRED--DNMIATPLDMGAGHIDPNRALDPGLVYDATPQ  509

Query  181  DYVNLLCSMNFTKTQILTITRSK-NY-TFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DY+NL+CSMNFT+ Q  T  RS  NY    NP++DLNYPSFI LYP   S   +   + +
Sbjct  510  DYINLICSMNFTEEQFKTFARSSANYDNCSNPSADLNYPSFIALYPF--SLEGNFTWLEQ  567

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RT+T VG G A++ V +  P+NS V +    L FK K ++  Y L + Y+G+     
Sbjct  568  KFRRTLTNVGKGGASYKVKIETPKNSTVSVSPRTLVFKEKNDKQSYNLTIRYIGDSDQSR  627

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             FGS+TWI+++G + VRSPI  +P+I  W
Sbjct  628  NFGSITWIEQNGNHTVRSPIVTSPIIEVW  656



>ref|XP_003624104.1| Subtilisin-like protease [Medicago truncatula]
Length=1278

 Score =   203 bits (516),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 135/200 (68%), Gaps = 6/200 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DNT   I+D  +    ASPL++GAG++DPN A+NPGLIYDATPQ
Sbjct  572  SSAAIRSALITTANPLDNTKNLIRDNGYPSQYASPLAIGAGEIDPNRAMNPGLIYDATPQ  631

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVN LC + FTK QILTITRS +Y  ENP+ DLNYPSFI  Y   ++RS     +  TF
Sbjct  632  DYVNFLCGLKFTKNQILTITRSSSYGCENPSLDLNYPSFIAFYN-KKTRS-----MVHTF  685

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG AT++ +V+ P+   + +    L+FK + E+  Y LV+  +  +   V F
Sbjct  686  NRTVTNVGDGAATYSANVTHPKGCVMTVLPDILTFKYRNEKQSYSLVIKCVMYKKDNVSF  745

Query  541  GSLTWIDESGKYKVRSPIAV  600
            G L WI+  G + VRSPI V
Sbjct  746  GDLVWIEYGGAHTVRSPIVV  765


 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 105/174 (60%), Gaps = 13/174 (7%)
 Frame = +1

Query  106   LSMGAGQVDP-------NSALNPGLIYDATPQDYVNLLCSMNFTKTQILTITRSKNYTFE  264
             L++ AG  D         +A+NPGL+YD TPQDYVN LC + FTK QILTITRS ++  E
Sbjct  1107  LTVAAGTTDRTFGSLVLGNAMNPGLVYDCTPQDYVNFLCGLKFTKRQILTITRSSSHGCE  1166

Query  265   NPNSDLNYPSFILLYPVNQSRSESGYGIRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEI  444
             N + DLNYPSFI  Y   ++RS     +  TF RTVT VGDG AT++  V+ P+   V +
Sbjct  1167  NTSLDLNYPSFIAFYN-KKTRS-----MVHTFNRTVTNVGDGAATYSAKVTQPKGCVVRV  1220

Query  445   QNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEFGSLTWIDESGKYKVRSPIAVAP  606
                 L+F  + E+  Y +++     +   V FG L WI++ G + VRSPI VAP
Sbjct  1221  LPEILTFSYRNEKQSYYIIIKCDMYKKKYVSFGDLVWIEDGGVHTVRSPIVVAP  1274



>gb|EYU36337.1| hypothetical protein MIMGU_mgv1a020902mg, partial [Erythranthe 
guttata]
Length=734

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 135/201 (67%), Gaps = 6/201 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAI+SAM+TTAN  DNTN+PI++   N T A+PL +G+GQVDPN ALNPGLIYDA  Q
Sbjct  533  SPAAIQSAMMTTANHLDNTNQPIRE--VNGTVATPLGIGSGQVDPNRALNPGLIYDANIQ  590

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            D VNL+CSMNFT+ Q  TI +S NY   NP+SDLNYPSF+ L       ++ G  + R F
Sbjct  591  DLVNLVCSMNFTRKQTQTIVKSTNYNCSNPSSDLNYPSFVAL----THSADIGRFVTRRF  646

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG A + V V  P N+ V ++   L F+ K E+  Y + + Y  +       
Sbjct  647  KRTVTNVGDGAAKYRVKVEVPANTTVRVRPHTLVFQKKNEKLSYIVKIRYNADIDTLHRA  706

Query  541  GSLTWIDESGKYKVRSPIAVA  603
            GSLTWI++SGKY VRSPI V+
Sbjct  707  GSLTWIEQSGKYTVRSPIMVS  727



>ref|XP_004229664.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=781

 Score =   200 bits (508),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 136/209 (65%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  D+  KPI+D   N   A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  573  SPSAIRSAMMTTANHLDSIKKPIRDD--NNWVATPLDMGAGHVDPNRALDPGLVYDATPQ  630

Query  181  DYVNLLCSMNFTKTQILTITRSK-NY-TFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DY+NL+CSMNFT+ Q  T  RS  NY    NP++DLNYPSFI LYP   S   +   + +
Sbjct  631  DYINLICSMNFTEEQFKTFARSSANYENCSNPSADLNYPSFIALYP--YSLEGNFTWLEQ  688

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RT+T VG G A + V +  P+NS V +    L FK K +   Y L + Y+G+     
Sbjct  689  KFRRTLTNVGKGGAIYKVKIETPKNSTVSVSPQTLVFKGKNDRQSYNLTIRYIGDSDQGR  748

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             FGS+TW++E+G + VRSPI  A +I  W
Sbjct  749  NFGSITWVEENGNHTVRSPIVTATIIEVW  777



>ref|XP_009595146.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=781

 Score =   199 bits (506),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 140/209 (67%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  DNT KPI++   +   A+PL MGAG V+PN AL+PGL+YDATPQ
Sbjct  573  SPSAIRSAMMTTANHLDNTQKPIRED--DGMVATPLDMGAGHVNPNRALDPGLVYDATPQ  630

Query  181  DYVNLLCSMNFTKTQILTITRSK-NY-TFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DY+NL+CSMNFT+ Q  T  RS  NY    +P++DLNYPSFI LYP +   + +   +++
Sbjct  631  DYINLICSMNFTEEQFKTFARSSANYNNCSSPSADLNYPSFIALYPFSLEGNFT--WLKQ  688

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RT+T VG G  T+ V +  P+NS V +    L FK K E+  Y L + Y+G++    
Sbjct  689  KFRRTLTNVGKGGTTYKVKIETPKNSTVSVSPKTLVFKKKNEKQSYTLTIRYIGDENQSR  748

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
              GS+TW++E+G + VRSPI +  +I  W
Sbjct  749  NVGSITWVEENGNHSVRSPIVITRIIAVW  777



>ref|XP_011069661.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=781

 Score =   199 bits (506),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 135/201 (67%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAI+SAM+TTANP DN N+PIKD  F +  A+PL +GAGQVDPN AL+PGLIYDAT Q
Sbjct  584  SPAAIQSAMMTTANPLDNANQPIKDMGFGYQVATPLGIGAGQVDPNRALDPGLIYDATMQ  643

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV+L+CSMNFT  Q  TI RS +Y    P+SDLNYPSFI+LY   ++ + S     R F
Sbjct  644  DYVDLVCSMNFTTAQTQTILRS-SYNCSTPSSDLNYPSFIVLYETQETTTTS----TRKF  698

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RT+T VG+GPA + V V  P  S + +    L F  K E+  Y L + Y  +    +  
Sbjct  699  RRTLTNVGNGPAAYKVKVEEPNGSTIAVSPQTLMFTRKDEKQSYSLTIRYTISSEFVLAP  758

Query  541  GSLTWIDESGKYKVRSPIAVA  603
            GS+TWI+E+G + VRSPI V+
Sbjct  759  GSITWIEENGNHTVRSPIVVS  779



>ref|XP_009604890.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=755

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 133/200 (67%), Gaps = 6/200 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT+N  DNT  PI+D      +A+PL+MGAG +DPN AL+PGLIYDATPQ
Sbjct  546  SPAAIRSAMMTTSNAMDNTQSPIRDIGSKNAAATPLAMGAGHIDPNKALDPGLIYDATPQ  605

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT-  357
            DYVNLLC++NFT  QI TITRS +YT  NP+ DLNYPSFI  +  N S S+     RR  
Sbjct  606  DYVNLLCALNFTSKQIKTITRSSSYTCSNPSLDLNYPSFIGFFNGNSSESDP----RRIQ  661

Query  358  -FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT +GDG + +T  ++     +V +    L FK KYE+  YKL +         V
Sbjct  662  EFQRTVTNIGDGMSVYTAKLTTMGKFKVNLVPEKLVFKEKYEKLSYKLRIEGPLVMDDIV  721

Query  535  EFGSLTWIDESGKYKVRSPI  594
             +GSL+W++  GKY VRSPI
Sbjct  722  VYGSLSWVETEGKYVVRSPI  741



>ref|XP_003553772.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=763

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 138/214 (64%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S +AIRSA+ TTANP DNT KPI++       ASPL+MGAG +DPN AL+PGL+YDA+PQ
Sbjct  556  SASAIRSALTTTANPLDNTGKPIEESGDWPQRASPLAMGAGLIDPNRALDPGLVYDASPQ  615

Query  181  DYVNLLCSMNFTKTQILTITRSKNYT-FENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYVNLLC+MN T+ QI+ ITRSK Y+     + DLNYPSF+  Y      ++    +   
Sbjct  616  DYVNLLCAMNLTQAQIMAITRSKAYSNCSRASYDLNYPSFVAFY------ADKSVKVETK  669

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F R VTYVGDGPA +T  VS    + + +    L FKNK+E+ ++ L      ++  +V 
Sbjct  670  FRRIVTYVGDGPAVYTARVSSYNGTAISVSPNRLVFKNKHEKRKFTLSFKSQMDKDYDVA  729

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPTW*FLGRI  639
            FGSL W++E+G++ VRSP+ + P    + F  RI
Sbjct  730  FGSLQWVEETGRHLVRSPVVLVPRNVAFNFQTRI  763



>ref|XP_004492811.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=758

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 132/202 (65%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSAM+TTA+  DNT  PI+D  +   SASP ++GAG++DPN A+NPGLIYDATPQ
Sbjct  560  SAAAIRSAMMTTASFLDNTKTPIRDSGYLLQSASPFAIGAGEIDPNRAMNPGLIYDATPQ  619

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC +N+TK QIL+ITRS +Y  +NP+ DLNYPSFI  +    S +       + F
Sbjct  620  DYVNLLCGLNYTKEQILSITRSSHYNCDNPSLDLNYPSFIAFFSNKTSLT------GQKF  673

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG A++ V V+ P+   V +    L F    E+  Y + +  +      V F
Sbjct  674  KRTVTNVGDGGASYRVKVTQPKGYVVTVSPDILDFSYGNEKKSYYVFIKCVVYNEENVSF  733

Query  541  GSLTWIDESGKYKVRSPIAVAP  606
            G L WI++ GK+ VRSPI VAP
Sbjct  734  GDLVWIEDGGKHSVRSPIVVAP  755



>gb|ACA64704.1| subtilase [Nicotiana tabacum]
Length=781

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 139/209 (67%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  DNT KPI++   +   A+PL MGAG V+PN AL+PGL+YDATPQ
Sbjct  573  SPSAIRSAMMTTANHLDNTQKPIRED--DGMVATPLDMGAGHVNPNRALDPGLVYDATPQ  630

Query  181  DYVNLLCSMNFTKTQILTITRSK-NY-TFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DY+NL+CSMNFT+ Q  T  RS  NY    +P +DLNYPSFI LYP +   + +   +++
Sbjct  631  DYINLICSMNFTEEQFKTFARSSANYNNCSSPCADLNYPSFIALYPFSLEGNFT--WLKQ  688

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RT+T VG G  T+ V +  P+NS V +    L FK K E+  Y L + Y+G++    
Sbjct  689  KFRRTLTNVGKGGTTYKVKIETPKNSTVSVSPKTLVFKKKNEKQSYTLTIRYIGDENQSR  748

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
              GS+TW++E+G + VRSPI +  +I  W
Sbjct  749  NVGSITWVEENGNHSVRSPIVITRIIAVW  777



>emb|CDP01316.1| unnamed protein product [Coffea canephora]
Length=759

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 138/205 (67%), Gaps = 8/205 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDP-AFNFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRS+MVTTANP DNT  PI++   FN   ASPLSMGAGQV+PNSAL+PGLIYDAT 
Sbjct  557  SPAAIRSSMVTTANPLDNTGNPIREINGFNNPIASPLSMGAGQVNPNSALDPGLIYDATA  616

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            QDY+ LLCS+N+T+ QI TITRS +Y     +SDLNYPSF+ LY    + S       + 
Sbjct  617  QDYMELLCSINYTRKQIRTITRS-SYNCSKASSDLNYPSFVSLYTSGTNAST------QN  669

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F R VT VGDG AT+   V+ P  S V +    L F+ KYE+  Y L +    ++  +V 
Sbjct  670  FKRIVTNVGDGAATYKAKVTPPEGSVVTVFPETLVFRKKYEKRSYSLTIHTKIDENNQVT  729

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
            +G++ W++++GK+ VRSPI V P I
Sbjct  730  YGAVIWVEDNGKHSVRSPIVVTPKI  754



>ref|XP_011074394.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=761

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 141/205 (69%), Gaps = 8/205 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAI+SAM+TTANP DNTN+PIK+   + T A PL MG+G VDPN AL+PGL+YDA+ Q
Sbjct  561  SPAAIQSAMMTTANPLDNTNQPIKEQ--DNTVALPLGMGSGLVDPNRALDPGLVYDASQQ  618

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            D VNL+CSMNFT  Q  TI RS +Y    P+S+LNYPSFI +Y    +  + G  + R F
Sbjct  619  DLVNLVCSMNFTLEQTQTIIRS-SYNCSTPSSNLNYPSFIAIY----NSPDQGRTLTRRF  673

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLG-NQTGEVE  537
             RT+T VGDG AT+ V +  P+N++++I+   L FK KYE+  Y L +T+   + T    
Sbjct  674  QRTLTNVGDGAATYRVKLEKPKNTKIQIRPQILVFKKKYEKQSYSLTITFKAPDFTTGAP  733

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
             GS+TWID  GKY VRSPI ++P +
Sbjct  734  DGSITWIDNRGKYSVRSPIMLSPGV  758



>gb|EYU45084.1| hypothetical protein MIMGU_mgv1a001942mg [Erythranthe guttata]
Length=736

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 137/201 (68%), Gaps = 6/201 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AI+SA++TTANP DNT KPI+D   NF +A+PL+MG+G +DPN AL+PGLIY+ T  
Sbjct  538  SPSAIKSAIMTTANPLDNTRKPIRDSLLNFEAATPLAMGSGHIDPNRALDPGLIYNVTRH  597

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNL+CSMNFT+ Q  +I RS +Y    P+SDLNYP+FI +Y  N+     G  + R F
Sbjct  598  DYVNLVCSMNFTREQTKSILRS-SYDCSTPSSDLNYPAFIAIYKQNR----EGTVMTRVF  652

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             R VT V DGP+++ V +  P+ ++V ++   L F  KYEE  Y+L ++Y G        
Sbjct  653  KRRVTNVWDGPSSYRVELQLPKYTKVTVRPTTLVFNKKYEELSYQLTVSYSGGNGSLPAH  712

Query  541  GSLTWIDESG-KYKVRSPIAV  600
            GS+TW +E+G K+ VRSPI +
Sbjct  713  GSITWTEEAGRKHSVRSPIVI  733



>ref|XP_010059917.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66393.1| hypothetical protein EUGRSUZ_F00207 [Eucalyptus grandis]
Length=768

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 130/198 (66%), Gaps = 4/198 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT+   D+TN PIKD   ++  ASP+ MGAG VDPN AL+PGLIYD TPQ
Sbjct  561  SPAAIRSAMMTTSYTRDSTNSPIKDIGNDYKPASPVGMGAGHVDPNKALDPGLIYDVTPQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNL+C+MN+T  QI  +TRS +Y   NP+ DLNYPSFI  +  N S S +     + F
Sbjct  621  DYVNLMCAMNYTSKQIQMVTRSSSYNCSNPSLDLNYPSFIAFFSSNSSDSLT----VQDF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG G +T+T  V+     +V +    L+FK KYE+  YKL +         V  
Sbjct  677  YRTVTNVGAGASTYTAEVNPMEEFKVSVVPDKLTFKEKYEKLSYKLTIEGPKQMKQTVVS  736

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W+D+ GKY V+SPI
Sbjct  737  GSLSWMDDGGKYVVKSPI  754



>ref|XP_006345400.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 138/209 (66%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  ++  KPI++   NF  A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  569  SPSAIRSAMMTTANHLNSAQKPIREDD-NFV-ATPLDMGAGHVDPNKALDPGLVYDATPQ  626

Query  181  DYVNLLCSMNFTKTQILTITRSK-NY-TFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DY+NL+CSMNFT+ Q  T  RS  NY    NP++DLNYPSFI LYP   S   +   + +
Sbjct  627  DYINLICSMNFTEEQFKTFARSSANYDNCSNPSADLNYPSFIALYPF--SLEGNFTWLEQ  684

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RT+T  G G AT+ V +  P+NS V +    L FK K ++  Y L + Y+G+     
Sbjct  685  KFRRTLTNAGKGRATYKVKIETPKNSTVSVSPRTLVFKEKNDKQSYTLSIRYIGDSDQSR  744

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
              GS+TW++E+G + VRSPI ++ +I  W
Sbjct  745  NVGSITWVEENGNHSVRSPIVISRIIDVW  773



>ref|XP_009769987.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009769988.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
Length=765

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 135/212 (64%), Gaps = 14/212 (7%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTANP DNT KPIK    N   A+ L+MGAG VDPN A++PGLIYDATPQ
Sbjct  562  SPSAIRSAMMTTANPLDNTEKPIKTADDN-KDATSLAMGAGVVDPNRAVDPGLIYDATPQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYG----  345
             YVNLLCSMN T  Q  TI RS   +   NP++D+NYPSFI L+        S YG    
Sbjct  621  HYVNLLCSMNLTVEQFKTIARSSAKHNCSNPSNDINYPSFIALF--------SPYGNYTW  672

Query  346  IRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQT  525
            + + F RTVT VG G AT+ V V  P NS + +    L F+ K ++ EY L + Y G   
Sbjct  673  LEQKFKRTVTNVGAGAATYKVKVKAPENSTISLFPQTLVFEKKNQKQEYTLTIRYKGVVE  732

Query  526  GEVEFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             + + G++TW++E+G + V SPI VAP I  W
Sbjct  733  DQAQSGAITWVEENGHHTVSSPIVVAPEIDAW  764



>ref|XP_010059916.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=768

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 129/198 (65%), Gaps = 4/198 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT+   D+TN PIKD   ++  ASP+ MGAG VDPN AL+PGLIYD TPQ
Sbjct  561  SPAAIRSAMMTTSYTRDSTNSPIKDIGNDYKPASPVGMGAGHVDPNKALDPGLIYDVTPQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNL+C+MN+T  QI  +TRS +Y   NP+ DLNYPSFI  +  N S S     + + F
Sbjct  621  DYVNLMCAMNYTSKQIQMVTRSSSYNCSNPSLDLNYPSFIAFFGSNSSDSP----MVQEF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG G +T+   V+     +V I    L+FK KYE+  YKL +         V  
Sbjct  677  YRTVTNVGAGASTYRAEVNPMEGFKVSIVPDKLTFKEKYEKLSYKLTIEGPKQMKQTVVS  736

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W+D+ GKY V+SPI
Sbjct  737  GSLSWMDDGGKYAVKSPI  754



>ref|XP_010059918.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66394.1| hypothetical protein EUGRSUZ_F00208 [Eucalyptus grandis]
Length=768

 Score =   194 bits (492),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 135/198 (68%), Gaps = 4/198 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT+   D+TN PIKD   ++  ASPL++GAG VDPN AL+PGLIYDATPQ
Sbjct  561  SPAAIRSAMMTTSYSTDSTNAPIKDIGDDYKPASPLAIGAGHVDPNKALDPGLIYDATPQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NL+C+MN+T  QI T+TRS +Y   + + DLNYPSFI  +    S + SG  + + F
Sbjct  621  DYINLMCAMNYTSKQIQTVTRSSSYNCSDSSMDLNYPSFIAFF----SPNSSGSLMVQEF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDGP+T+   V+     ++E+    L+FK KYE+  YKL +         + F
Sbjct  677  FRTVTNVGDGPSTYIAKVTPMEGFKIEVAPDKLTFKEKYEKLRYKLTIEGPKQMNEPLVF  736

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W+D  GK+ V+SPI
Sbjct  737  GSLSWMDNGGKHVVKSPI  754



>ref|XP_006339058.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=765

 Score =   193 bits (491),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 136/210 (65%), Gaps = 10/210 (5%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  DNT  PIK    N  + S L+MGAG VDPN A++PGLIYDATPQ
Sbjct  562  SPSAIRSAMMTTANHLDNTKNPIKTEDGNSNTTS-LAMGAGLVDPNRAVDPGLIYDATPQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLY-PVNQ-SRSESGYGIR  351
            DYVNLLCSMNFT  Q  TI RS   +   NP+ D+NYPSFI L+ P+ + SR E      
Sbjct  621  DYVNLLCSMNFTLEQFNTIARSSAKHNCSNPSDDINYPSFIALFSPIGKYSRLE------  674

Query  352  RTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE  531
            + F RTVT VG G A +   V  P++S + I    L F+ K ++ +Y L + Y G    +
Sbjct  675  KKFRRTVTNVGAGAAKYVAKVIAPKSSTISISPQTLVFEKKNQKQDYTLTIRYKGIADDQ  734

Query  532  VEFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             + GS+TW++E+G + VRSPI VAP +  W
Sbjct  735  AQSGSITWVEENGHHTVRSPIVVAPALDAW  764



>ref|XP_010687642.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=782

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 134/203 (66%), Gaps = 6/203 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTANP DNT   IKD   N   A+PL+MG+GQ+DPN AL+PGL+YD TPQ
Sbjct  577  SPAAIRSAIMTTANPLDNTGSAIKDNGSNLGPATPLAMGSGQIDPNRALDPGLVYDLTPQ  636

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NL+CSMNFT+ Q+L+I RS  +     +SDLNYPSFI  Y  + +++ +      TF
Sbjct  637  DYMNLICSMNFTRNQMLSIIRSNKHNCSASSSDLNYPSFIAYYNYDSTKTAA-----MTF  691

Query  361  VRTVTYVG-DGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
             RTVT VG DG   +   V+ P+ ++V +    L F  + E+  Y+L + Y       + 
Sbjct  692  YRTVTNVGKDGFTAYKAVVTAPKGARVRVHPRTLVFNRRNEKQSYQLRIKYKSVDKLGIS  751

Query  538  FGSLTWIDESGKYKVRSPIAVAP  606
            FGS+ W++ +G++ VRSPI ++P
Sbjct  752  FGSIVWMENNGQHSVRSPIVISP  774



>gb|KCW62487.1| hypothetical protein EUGRSUZ_H05125 [Eucalyptus grandis]
Length=768

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 129/198 (65%), Gaps = 4/198 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT+   D+TN PIKD   ++  ASP+ MGAG VDPN AL+PGLIYD  PQ
Sbjct  561  SPAAIRSAMMTTSYTRDSTNSPIKDIGNDYKPASPIGMGAGHVDPNKALDPGLIYDVMPQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNL+C+MN+T  QI  +TRS +Y   NP+ DLNYPSFI  +  N S S +     + F
Sbjct  621  DYVNLMCAMNYTSKQIQMVTRSSSYNCSNPSLDLNYPSFIAFFSSNSSDSPT----VQEF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG G +T+T  V+     +V +    L+FK KYE+  YKL +         V  
Sbjct  677  YRTVTNVGAGGSTYTAEVNPMEGFKVSVVPDKLTFKVKYEKLSYKLTIEGPKQMKQTVVS  736

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W+D+ GKY V+SPI
Sbjct  737  GSLSWMDDGGKYVVKSPI  754



>ref|XP_010025755.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=759

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 129/198 (65%), Gaps = 4/198 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT+   D+TN PIKD   ++  ASP+ MGAG VDPN AL+PGLIYD  PQ
Sbjct  552  SPAAIRSAMMTTSYTRDSTNSPIKDIGNDYKPASPIGMGAGHVDPNKALDPGLIYDVMPQ  611

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNL+C+MN+T  QI  +TRS +Y   NP+ DLNYPSFI  +  N S S +     + F
Sbjct  612  DYVNLMCAMNYTSKQIQMVTRSSSYNCSNPSLDLNYPSFIAFFSSNSSDSPT----VQEF  667

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG G +T+T  V+     +V +    L+FK KYE+  YKL +         V  
Sbjct  668  YRTVTNVGAGGSTYTAEVNPMEGFKVSVVPDKLTFKVKYEKLSYKLTIEGPKQMKQTVVS  727

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W+D+ GKY V+SPI
Sbjct  728  GSLSWMDDGGKYVVKSPI  745



>ref|XP_009771086.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=772

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 132/198 (67%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++  DNT  PI+D      +A+PL+MGAG +DPN AL+PGLIYDATPQ
Sbjct  563  SPAAIRSAMMTTSSALDNTQSPIRDIGSRNAAATPLAMGAGHIDPNKALDPGLIYDATPQ  622

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++NFT  QI TITRS +YT  NP+ DLNYPSFI  +  N +  ES     + F
Sbjct  623  DYVNLLCALNFTSKQIKTITRSSSYTCSNPSLDLNYPSFIGFF--NGNSRESDPKRIQEF  680

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT + DG + +T +++     +V +    L FK KYE+  YKL +         V +
Sbjct  681  KRTVTNLQDGTSVYTANLTPMGKFKVSVVPEKLVFKEKYEKLSYKLRIEGPIVMDDNVVY  740

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W++  GKY VRSPI
Sbjct  741  GSLSWVETGGKYVVRSPI  758



>ref|XP_011029618.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=775

 Score =   191 bits (486),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 128/207 (62%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFN--FTSASPLSMGAGQVDPNSALNPGLIYDAT  174
            SPAAIRSAM+TTA+  DNT +PIKD  F      A+PL MGAGQV+PN AL+PGLIYD  
Sbjct  565  SPAAIRSAMITTADTMDNTMEPIKDIGFGNRINPATPLDMGAGQVNPNKALDPGLIYDVN  624

Query  175  PQDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
              DYV LLC+ NFT+ QI  ITRS +    NP+SDLNYPSFI  +  N+  S S   I R
Sbjct  625  STDYVRLLCATNFTEKQIQVITRSSSTDCSNPSSDLNYPSFIAYF--NEKNSPSNLTIVR  682

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG+G  T+TV V+     +V +    L FK KYE+  YKL +         V
Sbjct  683  EFHRTVTNVGEGTCTYTVSVTPMSGLKVNVMPDKLEFKTKYEKLSYKLTIEGPALLDETV  742

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIP  615
             FG L W D  GK+ V+SPIA   + P
Sbjct  743  TFGYLNWADAGGKHVVKSPIAATSLSP  769



>emb|CAA07062.1| SBT4E protein [Solanum lycopersicum]
Length=777

 Score =   191 bits (485),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 136/209 (65%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  ++  KPI++   NF  A+PL MGAG VDPN AL+PGL+YDATPQ
Sbjct  569  SPSAIRSAMMTTANHLNSAQKPIREDD-NFV-ATPLDMGAGHVDPNRALDPGLVYDATPQ  626

Query  181  DYVNLLCSMNFTKTQILTITRSKNY--TFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            D++NL+CSMNFT+ Q  T  RS        NP++DLNYPSFI LYP   S  E+   + +
Sbjct  627  DHINLICSMNFTEEQFKTFARSSASYDNCSNPSADLNYPSFIALYPF--SLEENFTWLEQ  684

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RT+T VG G AT+ V    P+NS V +    L FK K ++  Y L +  +G+     
Sbjct  685  KFRRTLTNVGKGGATYKVQTETPKNSIVSVSPRTLVFKEKNDKQSYTLSIRSIGDSDQSR  744

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
              GS+TW++E+G + VRSPI ++ +I  W
Sbjct  745  NVGSITWVEENGNHSVRSPIVISRIIDVW  773



>gb|KDP31945.1| hypothetical protein JCGZ_12406 [Jatropha curcas]
Length=569

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFN-FTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRSA++T+ANP DNTN PIKD A +   +A+PL +GAG +DPN AL PGLIYDA  
Sbjct  365  SPAAIRSALMTSANPLDNTNSPIKDEADDKIPAATPLDIGAGHIDPNKALEPGLIYDAKT  424

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            +DY+  LC+MN TK QI  ITRS ++   N + DLNYPSFI  +  ++S+S +G  + + 
Sbjct  425  EDYIKFLCAMNLTKKQIQFITRSSHHNCLNKSLDLNYPSFIAYFTGDESKS-NGKMVVQE  483

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG+G + +T  ++     +V ++   L+FK K E+  YKL++        +V 
Sbjct  484  FPRTVTNVGEGISNYTAKLTKMNGIKVSVEPQKLAFKKKNEKLRYKLIIEGPKLLEEDVV  543

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIP  615
            +GSL+W+ + GKY VRSPI    ++P
Sbjct  544  YGSLSWVHDGGKYVVRSPIVATNLVP  569



>ref|XP_004249505.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=765

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 132/209 (63%), Gaps = 8/209 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  DNT  PIK    N  + S L+MGAG VDPN A++PGLIYDATPQ
Sbjct  562  SPSAIRSAMMTTANHLDNTKNPIKTEDNNSDTTS-LAMGAGLVDPNRAVDPGLIYDATPQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLY-PVNQSRSESGYGIRR  354
            DYVNLLCSMNFT  Q  TI RS   +   NP+ D+NYPSFI L+ P+          + +
Sbjct  621  DYVNLLCSMNFTSDQFKTIARSSAKHNCSNPSDDINYPSFIALFNPIGNYT-----WLEK  675

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG   A +   V  P+NS + I    L F+ K ++ +Y L + Y G    + 
Sbjct  676  KFRRTVTNVGASAAKYVAKVIAPKNSTISISPQTLVFEKKNQKQDYTLTIRYKGIADDQA  735

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
            + GS+TW++E+G + VRSPI VAP +  W
Sbjct  736  QSGSITWVEENGHHTVRSPIVVAPALDAW  764



>gb|KCW66398.1| hypothetical protein EUGRSUZ_F00212 [Eucalyptus grandis]
Length=728

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 132/198 (67%), Gaps = 4/198 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT+   D+TN PIKD    F  ASPL+MGAG V+PN AL+PGLIYD TPQ
Sbjct  521  SPAAIRSAMMTTSYSTDSTNAPIKDSGSGFEPASPLAMGAGHVNPNKALDPGLIYDVTPQ  580

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV+L+C+MN+T  QI  +TRS +Y   + + DLNYPSFI  +  N   S +     + F
Sbjct  581  DYVDLMCAMNYTSKQIQIVTRSSSYNCSDSSLDLNYPSFIAFFSSNSLVSPTA----QEF  636

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDGP+T+   V+     ++ ++   L+FK KYE+  YKL +        ++ F
Sbjct  637  FRTVTNVGDGPSTYVAKVTPMEGYKINVKPDKLTFKEKYEKLRYKLTIEGPKQMNQKLMF  696

Query  541  GSLTWIDESGKYKVRSPI  594
            GS++W+D+ GKY V+SPI
Sbjct  697  GSVSWMDKGGKYVVKSPI  714



>ref|XP_006374913.1| subtilase family protein [Populus trichocarpa]
 gb|ERP52710.1| subtilase family protein [Populus trichocarpa]
Length=775

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 127/207 (61%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFN--FTSASPLSMGAGQVDPNSALNPGLIYDAT  174
            SPAA+RSAM+TTA+  DNT +PIKD  F      A+PL MGAGQV+PN AL+PGLIYD  
Sbjct  565  SPAAMRSAMITTADTMDNTMEPIKDIGFGNRINPATPLDMGAGQVNPNKALDPGLIYDVN  624

Query  175  PQDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
              DYV LLC+ NFT+ QI  ITRS +    NP+SDLNYPSFI  +  N  +S S   I R
Sbjct  625  STDYVRLLCATNFTEKQIQVITRSSSIDCSNPSSDLNYPSFIAYF--NDKKSPSNLTIVR  682

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG+G   +T  V+     ++ +    L FK KYE+  YKL +         V
Sbjct  683  EFHRTVTNVGEGTCIYTASVTPMSGLKINVIPDKLEFKTKYEKLSYKLTIEGPALLDETV  742

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIP  615
             FGSL W D  GK+ VRSPIA   + P
Sbjct  743  TFGSLNWADAGGKHVVRSPIAATSLSP  769



>gb|ACT34764.1| subtilisin-like protease preproenzyme [Nicotiana tabacum]
Length=763

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 132/198 (67%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT +PI+D   N  +ASPL+MGAG ++PN AL+PGLIYD T Q
Sbjct  558  SPAAIRSAMMTTADALDNTQRPIRDIGRNNNAASPLAMGAGHINPNKALDPGLIYDITSQ  617

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC+++FT  QI  ITRS  Y+  NP+ DLNYPSFI  +  N S+S+      + F
Sbjct  618  DYINLLCALDFTSQQIKAITRSSAYSCSNPSLDLNYPSFIGYFNYNSSKSDPKR--IQEF  675

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG + +T  ++     +V +    L FK KYE+  YKL +         + +
Sbjct  676  QRTVTNVGDGMSVYTAKLTSMDEYKVSVAPDKLVFKEKYEKQSYKLRIEGPLLVDNYLVY  735

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W++ SGKY V+SPI
Sbjct  736  GSLSWVETSGKYVVKSPI  753



>ref|XP_010059919.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=766

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 132/198 (67%), Gaps = 4/198 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT+   D+TN PIKD    F  ASPL+MGAG V+PN AL+PGLIYD TPQ
Sbjct  559  SPAAIRSAMMTTSYSTDSTNAPIKDSGSGFEPASPLAMGAGHVNPNKALDPGLIYDVTPQ  618

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV+L+C+MN+T  QI  +TRS +Y   + + DLNYPSFI  +  N   S +     + F
Sbjct  619  DYVDLMCAMNYTSKQIQIVTRSSSYNCSDSSLDLNYPSFIAFFSSNSLVSPTA----QEF  674

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDGP+T+   V+     ++ ++   L+FK KYE+  YKL +        ++ F
Sbjct  675  FRTVTNVGDGPSTYVAKVTPMEGYKINVKPDKLTFKEKYEKLRYKLTIEGPKQMNQKLMF  734

Query  541  GSLTWIDESGKYKVRSPI  594
            GS++W+D+ GKY V+SPI
Sbjct  735  GSVSWMDKGGKYVVKSPI  752



>ref|XP_009595649.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=763

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 131/198 (66%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT +PI+D   N  +A PL+MGAG ++PN AL+PGLIYD T Q
Sbjct  558  SPAAIRSAMMTTADALDNTQRPIRDIGRNNNAAIPLAMGAGHINPNKALDPGLIYDITSQ  617

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC++NFT  QI  ITRS  Y+  NP+ DLNYPSFI  +  N S+S+      + F
Sbjct  618  DYINLLCALNFTSQQIKAITRSSAYSCSNPSLDLNYPSFIGYFNYNSSKSDPKR--IQEF  675

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGDG + +T  ++     +V +    L FK KYE+  YKL +         + +
Sbjct  676  QRTVTNVGDGMSVYTAKLTSMDEYKVSVAPDKLVFKEKYEKQSYKLRIEGPLLVDNYLVY  735

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W++ SGKY V+SPI
Sbjct  736  GSLSWVETSGKYVVKSPI  753



>ref|XP_006374911.1| subtilase family protein [Populus trichocarpa]
 gb|ERP52708.1| subtilase family protein [Populus trichocarpa]
Length=778

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 129/207 (62%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKD--PAFNFTSASPLSMGAGQVDPNSALNPGLIYDAT  174
            SPAAIRSAM+TTA+  DNT +PIKD         ASPL MGAGQV+PN AL+PGLIYDA 
Sbjct  564  SPAAIRSAMMTTADITDNTMEPIKDIGSGNRINPASPLDMGAGQVNPNKALDPGLIYDAN  623

Query  175  PQDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
              DYV LLC+ NFT+ +I  ITRS +    NP+SDLNYPSFI  +  N+  S S     R
Sbjct  624  STDYVRLLCATNFTEKEIQVITRSSSTDCSNPSSDLNYPSFIAYF--NERFSPSNLTTVR  681

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG+G +T+TV V+     +V +    L FK KYE+  YKL +         V
Sbjct  682  EFHRTVTNVGEGISTYTVSVTPMSGLKVNVMPDKLEFKTKYEKLSYKLTIEGPALLDEAV  741

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIP  615
             FG L+W D  GK+ VRSPI    +IP
Sbjct  742  TFGYLSWADAGGKHVVRSPIVATTLIP  768



>ref|XP_011029640.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 129/207 (62%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKD--PAFNFTSASPLSMGAGQVDPNSALNPGLIYDAT  174
            SPAAIRSAM+TTA+  DNT +PIKD         ASPL+MGAGQV+PN AL+PGLIYDA 
Sbjct  564  SPAAIRSAMMTTADITDNTMEPIKDIGSGNRINPASPLAMGAGQVNPNKALDPGLIYDAN  623

Query  175  PQDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
              DYV LLC+ NFT+ QI  ITRS +    NP++DLNYPSFI  +  N+  S S     R
Sbjct  624  STDYVRLLCATNFTEKQIQVITRSSSTDCSNPSTDLNYPSFIAYF--NERFSPSNLTSVR  681

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG+G +T+TV V+     +V +    L FK KYE+  YKL +         V
Sbjct  682  EFHRTVTNVGEGISTYTVSVTPMSGLKVNVMPDKLEFKTKYEKLSYKLTIVGPALLDEAV  741

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIP  615
             FG L+W D  GK+ VRSPI     IP
Sbjct  742  TFGYLSWADAGGKHVVRSPIVATSFIP  768



>ref|XP_009800439.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 131/198 (66%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT  PI+D   N  +ASPL+MGAG ++PN AL+PGLIYD T Q
Sbjct  559  SPAAIRSAMMTTADAVDNTQMPIRDIGRNNNAASPLAMGAGHINPNKALDPGLIYDITSQ  618

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY NLLC++NFT  QI +ITRS  Y+  NP+ DLNYPSFI  +  N S+S+      + F
Sbjct  619  DYNNLLCALNFTSQQIKSITRSSAYSCSNPSLDLNYPSFIGYFNYNSSKSDPKR--IQEF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G + +T  ++     +V +    L FK KYE+  YKL +         + +
Sbjct  677  QRTVTNVGEGMSVYTAKLTSMDEYKVSVAPDKLVFKEKYEKQSYKLRIEGPLLVDNYLVY  736

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W++ SGKY V+SPI
Sbjct  737  GSLSWVETSGKYVVKSPI  754



>gb|EYU25437.1| hypothetical protein MIMGU_mgv1a002005mg [Erythranthe guttata]
Length=728

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 131/206 (64%), Gaps = 3/206 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTS-ASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAA+RSAM+TTA   DNTN PIK+   N    A P  +G+G +DPN AL+PGL+YDAT 
Sbjct  525  SPAAVRSAMMTTAYVLDNTNNPIKEIGSNGGQFADPFGIGSGHIDPNKALDPGLVYDATS  584

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            +DY+NL+C++NFT+ QI TITRS  Y   NP+ DLNYPSFI  +  N + SE      R 
Sbjct  585  EDYINLICALNFTENQIKTITRSTAYNCSNPSLDLNYPSFIAFFNPNGTSSEK--LAVRE  642

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG G + ++  ++     +V +    L F +KYE+  YKL +         + 
Sbjct  643  FRRTVTNVGVGKSVYSSELTTFDGLKVSVSPDRLEFSDKYEKKSYKLRIESQTLMKDSLV  702

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIP  615
            +GSLTWI+ SGKY+VRSPI    ++P
Sbjct  703  YGSLTWIESSGKYQVRSPIVATTLVP  728



>gb|AFW81832.1| putative subtilase family protein [Zea mays]
Length=500

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 131/205 (64%), Gaps = 13/205 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPA +RSAM+TTA+  DNT   IKD       ASPL+MG+G +DP  A++PGL+YDA P+
Sbjct  292  SPAMLRSAMMTTASALDNTGASIKDMGNRNHPASPLAMGSGHIDPARAVDPGLVYDAAPE  351

Query  181  DYVNLLCSMNFTKTQILTIT----RSKNYTFENPNS--DLNYPSFILLYPVNQSRSESGY  342
            DYV L+C+MN+T  QI T+      S +Y  +   +  DLNYPSFI  +  N      G 
Sbjct  352  DYVKLMCAMNYTAAQIRTVVAQSPSSSSYAVDCTGASLDLNYPSFIAFFDPN------GG  405

Query  343  GIRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGN  519
             + RTF RTVT VGDGPA+++V V G     V +    L+F  K E+ +Y LV+   + N
Sbjct  406  SVERTFTRTVTNVGDGPASYSVKVLGLSGLTVIVSPDKLAFGGKNEKQKYTLVIRGKMTN  465

Query  520  QTGEVEFGSLTWIDESGKYKVRSPI  594
            ++G+V  GSLTW+D++GKY VRSPI
Sbjct  466  KSGDVLHGSLTWVDDAGKYTVRSPI  490



>gb|ACL52543.1| unknown [Zea mays]
Length=500

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 131/205 (64%), Gaps = 13/205 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPA +RSAM+TTA+  DNT   IKD       ASPL+MG+G +DP  A++PGL+YDA P+
Sbjct  292  SPAMLRSAMMTTASALDNTGASIKDMGNRNHPASPLAMGSGHIDPARAVDPGLVYDAAPE  351

Query  181  DYVNLLCSMNFTKTQILTIT----RSKNYTFENPNS--DLNYPSFILLYPVNQSRSESGY  342
            DYV L+C+MN+T  QI T+      S +Y  +   +  DLNYPSFI  +  N      G 
Sbjct  352  DYVKLMCAMNYTAAQIRTVVAQSPSSSSYAVDCTGASLDLNYPSFIAFFDPN------GG  405

Query  343  GIRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGN  519
             + RTF RTVT VGDGPA+++V V G     V +    L+F  K E+ +Y LV+   + N
Sbjct  406  SVERTFTRTVTNVGDGPASYSVKVLGLSGLTVIVSPDKLAFGGKNEKQKYTLVIRGKMTN  465

Query  520  QTGEVEFGSLTWIDESGKYKVRSPI  594
            ++G+V  GSLTW+D++GKY VRSPI
Sbjct  466  KSGDVLHGSLTWVDDAGKYTVRSPI  490



>gb|ABK95622.1| unknown [Populus trichocarpa]
Length=778

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 128/207 (62%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKD--PAFNFTSASPLSMGAGQVDPNSALNPGLIYDAT  174
            SPAAIRSAM+TTA+  DNT +PIKD         ASPL MGAGQV+PN AL+PGLIYDA 
Sbjct  564  SPAAIRSAMMTTADITDNTMEPIKDIGSGNRINPASPLDMGAGQVNPNKALDPGLIYDAN  623

Query  175  PQDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
              DYV LLC+ NFT+ +I  ITRS +    NP+SDLNYPSFI  +  N+  S S      
Sbjct  624  STDYVRLLCATNFTEKEIQVITRSSSTDCSNPSSDLNYPSFIAYF--NERFSPSNLTTVC  681

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG+G +T+TV V+     +V +    L FK KYE+  YKL +         V
Sbjct  682  EFHRTVTNVGEGISTYTVSVTPMSGLKVNVMPDKLEFKTKYEKLSYKLTIEGPALLDEAV  741

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIP  615
             FG L+W D  GK+ VRSPI    +IP
Sbjct  742  TFGYLSWADAGGKHVVRSPIVATTLIP  768



>ref|XP_010320328.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=751

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 128/198 (65%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA   DNT  PI+D       A+PL+MGAG +DPN AL+PGLIYDATPQ
Sbjct  542  SPAAIRSAMMTTAYVLDNTQSPIQDVGLKNGVATPLAMGAGHIDPNKALDPGLIYDATPQ  601

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVN LC +NFT  QI TITRS  YT  NP+ DLNYPSFI  +  N++ S+S     + F
Sbjct  602  DYVNHLCGLNFTSKQIQTITRSSTYTCSNPSLDLNYPSFIGYF--NRNSSDSDPKRIQEF  659

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT + DG + +T  ++     +V +    L+FK KYE+  YKL +         V  
Sbjct  660  KRTVTNLQDGTSVYTAKLTPMGKFKVSVVPNKLTFKEKYEKQSYKLRIEGPIIMDDIVVD  719

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W++  GKY V+SPI
Sbjct  720  GSLSWMETRGKYIVKSPI  737



>ref|XP_009790288.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 130/198 (66%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT  PI+D   N  +ASPL+MGAG ++PN AL PGLIYD T Q
Sbjct  559  SPAAIRSAMMTTADAVDNTQMPIRDIGRNNNAASPLAMGAGHINPNKALEPGLIYDITSQ  618

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY NLLC+++FT  QI +ITRS  Y+  NP+ DLNYPSFI  +  N S+S+      + F
Sbjct  619  DYNNLLCALDFTSQQIKSITRSSAYSCSNPSLDLNYPSFIGYFNYNSSKSDPKR--IQEF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G + +T  ++     +V +    L FK KYE+  YKL +         + +
Sbjct  677  QRTVTNVGEGMSVYTAKLTSMDEYKVSVAPDKLVFKEKYEKQSYKLRIEGPLLVDNYLVY  736

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W++ SGKY V+SPI
Sbjct  737  GSLSWVETSGKYVVKSPI  754



>ref|XP_011069659.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=754

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 133/205 (65%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTAN  DNT  PIKD   N   A+PL+MGAG +DPN AL+PGLIYDA+ +
Sbjct  552  SPAAIRSAMMTTANVLDNTKSPIKDSGSNNKPATPLAMGAGHIDPNKALDPGLIYDASSE  611

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC++NFT  QI TITRS +Y  +NP+ DLNYPSFI  +  N + S S     + F
Sbjct  612  DYINLLCALNFTAKQIQTITRSTSYDCKNPSLDLNYPSFIAYFNTNDTNSTS--TTVKEF  669

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT +GD  + +   ++     +V +  G L F  KYE+  YKL +   G     +  
Sbjct  670  QRTVTNIGDENSIYIAKLTALDGLKVSVSPGRLEFSKKYEKKSYKLRIEGPGLMRDGLIH  729

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            GSLTWID SGKY VRSPI    +IP
Sbjct  730  GSLTWIDSSGKYSVRSPIVATNLIP  754



>ref|XP_006655358.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=761

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 128/201 (64%), Gaps = 8/201 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAA+RSAM+TTA+  DNTN PIKD       A+PL+MG+G +DPN A++PGL+YDA P+
Sbjct  556  SPAAVRSAMMTTASAVDNTNAPIKDMGRGNRGATPLAMGSGHIDPNRAVDPGLVYDAGPE  615

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNS--DLNYPSFILLYPVNQSRSESGYGIRR  354
            DYV L+C+MN+T+ QI T+ +S +   +   +  DLNYPSFI  +    +         R
Sbjct  616  DYVRLMCAMNYTEAQIKTVAQSPSAAVDCTGASLDLNYPSFIAFFDPGATAPAV-----R  670

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGNQTGE  531
            TF R VT VGD PA+++  V G     V +    L F  K+E  +Y +V+   +  +T E
Sbjct  671  TFTRVVTNVGDAPASYSAKVKGLGGLTVTVAPERLVFGGKHETQKYTVVIRGQMKKKTDE  730

Query  532  VEFGSLTWIDESGKYKVRSPI  594
            V  GSLTW+D+SGKY VRSPI
Sbjct  731  VLHGSLTWVDDSGKYTVRSPI  751



>gb|EAY98174.1| hypothetical protein OsI_20091 [Oryza sativa Indica Group]
Length=562

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 127/201 (63%), Gaps = 8/201 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAA+RSAM+TTA+  DNTN PIKD       A+PL+MG+G +DPN A++PGL+YDA   
Sbjct  357  SPAAVRSAMMTTASAVDNTNAPIKDMGRANRGATPLAMGSGHIDPNRAVDPGLVYDAGAD  416

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNS--DLNYPSFILLYPVNQSRSESGYGIRR  354
            DYV L+C+MN+T  QI T+ +S +   +   +  DLNYPSFI  +    +   +     R
Sbjct  417  DYVKLMCAMNYTAAQIKTVAQSPSSAVDCAGATLDLNYPSFIAFFDPGATAPAA-----R  471

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGNQTGE  531
            TF R VT VGD PA+++  V G     V +    L F  K+E  +Y +V+   + N+T E
Sbjct  472  TFTRAVTNVGDAPASYSAKVKGLGGLTVSVSPERLVFGRKHETQKYTVVIRGQMKNKTDE  531

Query  532  VEFGSLTWIDESGKYKVRSPI  594
            V  GSLTW+D++GKY VRSPI
Sbjct  532  VLHGSLTWVDDAGKYTVRSPI  552



>gb|AFW81831.1| putative subtilase family protein [Zea mays]
Length=774

 Score =   182 bits (462),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 131/205 (64%), Gaps = 13/205 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPA +RSAM+TTA+  DNT   IKD       ASPL+MG+G +DP  A++PGL+YDA P+
Sbjct  566  SPAMLRSAMMTTASALDNTGASIKDMGNRNHPASPLAMGSGHIDPARAVDPGLVYDAAPE  625

Query  181  DYVNLLCSMNFTKTQILTIT----RSKNYTFENPNS--DLNYPSFILLYPVNQSRSESGY  342
            DYV L+C+MN+T  QI T+      S +Y  +   +  DLNYPSFI  +  N      G 
Sbjct  626  DYVKLMCAMNYTAAQIRTVVAQSPSSSSYAVDCTGASLDLNYPSFIAFFDPN------GG  679

Query  343  GIRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGN  519
             + RTF RTVT VGDGPA+++V V G     V +    L+F  K E+ +Y LV+   + N
Sbjct  680  SVERTFTRTVTNVGDGPASYSVKVLGLSGLTVIVSPDKLAFGGKNEKQKYTLVIRGKMTN  739

Query  520  QTGEVEFGSLTWIDESGKYKVRSPI  594
            ++G+V  GSLTW+D++GKY VRSPI
Sbjct  740  KSGDVLHGSLTWVDDAGKYTVRSPI  764



>ref|NP_001145972.1| uncharacterized protein LOC100279499 precursor [Zea mays]
 gb|ACL52959.1| unknown [Zea mays]
Length=774

 Score =   182 bits (462),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 131/205 (64%), Gaps = 13/205 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPA +RSAM+TTA+  DNT   IKD       ASPL+MG+G +DP  A++PGL+YDA P+
Sbjct  566  SPAMLRSAMMTTASALDNTGASIKDMGNRNHPASPLAMGSGHIDPARAVDPGLVYDAAPE  625

Query  181  DYVNLLCSMNFTKTQILTIT----RSKNYTFENPNS--DLNYPSFILLYPVNQSRSESGY  342
            DYV L+C+MN+T  QI T+      S +Y  +   +  DLNYPSFI  +  N      G 
Sbjct  626  DYVKLMCAMNYTAAQIRTVVAQSPSSSSYAVDCTGASLDLNYPSFIAFFDPN------GG  679

Query  343  GIRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGN  519
             + RTF RTVT VGDGPA+++V V G     V +    L+F  K E+ +Y LV+   + N
Sbjct  680  SVERTFTRTVTNVGDGPASYSVKVLGLSGLTVIVSPDKLAFGGKNEKQKYTLVIRGKMTN  739

Query  520  QTGEVEFGSLTWIDESGKYKVRSPI  594
            ++G+V  GSLTW+D++GKY VRSPI
Sbjct  740  KSGDVLHGSLTWVDDAGKYTVRSPI  764



>emb|CAA07060.1| SBT4C protein [Solanum lycopersicum]
Length=779

 Score =   182 bits (461),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 137/209 (66%), Gaps = 7/209 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  ++  +PI +   +   ASPL +G+G VDPN AL+PGL+YDATPQ
Sbjct  572  SPSAIRSAMMTTANHLNSAQEPITED--DDMVASPLGIGSGHVDPNRALDPGLVYDATPQ  629

Query  181  DYVNLLCSMNFTKTQILTITRSK-NY-TFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DY+NL+CS+NFT+ Q  T  RS  NY    NP++DLNYPSFI  Y  +Q+ +     + +
Sbjct  630  DYINLICSLNFTEEQFKTFARSSANYHNCSNPSADLNYPSFIAFYSYSQAGNYP--WLEQ  687

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RT+T VG   AT+ V +  P+NS + +    L FKNK E+  Y L + Y G++ G  
Sbjct  688  KFRRTLTNVGKDGATYEVKIESPKNSTISVSPQTLVFKNKNEKQSYTLTIRYRGDEKGGQ  747

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
            + GS+TW++++G + VRSP+ +   +  W
Sbjct  748  D-GSITWVEKNGNHSVRSPMVITSTVDVW  775



>ref|XP_006345404.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=782

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 137/211 (65%), Gaps = 6/211 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AI+SA++TTANP DNT K I     N    +P  +G G +DPN AL+PGLIYDATPQ
Sbjct  571  SPSAIKSAIMTTANPLDNTQKRITVATTN-EPTTPYGIGPGLIDPNRALDPGLIYDATPQ  629

Query  181  DYVNLLCSMNFTKTQILTITRSK--NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DYVNLLCSMNFT+ +  TI RS   ++   N + DLNYPSF  LY  ++  +     +++
Sbjct  630  DYVNLLCSMNFTEDEFKTIARSATNHHNCSNASDDLNYPSFTALYEFDRDGNNYPLLVKK  689

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYL--GNQTG  528
             F RTVT VG G A +   V  P+N+ + +    L+F  KYE+  Y L + Y   G+++ 
Sbjct  690  -FTRTVTNVGSGAARYKALVEVPKNTSISVSPQVLTFGKKYEKKSYTLTIRYRGEGHESY  748

Query  529  EVEFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
               +GS+TW++++GK+ VRSPI+V+P+I  W
Sbjct  749  VFNYGSITWVEQNGKHTVRSPISVSPIILPW  779



>ref|NP_001055646.1| Os05g0435800 [Oryza sativa Japonica Group]
 gb|AAT58881.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF17560.1| Os05g0435800 [Oryza sativa Japonica Group]
 gb|EEE63841.1| hypothetical protein OsJ_18665 [Oryza sativa Japonica Group]
Length=761

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 127/201 (63%), Gaps = 8/201 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAA+RSAM+TTA+  DNTN PIKD       A+PL+MG+G +DPN A++PGL+YDA   
Sbjct  556  SPAAVRSAMMTTASAVDNTNAPIKDMGRANRGATPLAMGSGHIDPNRAVDPGLVYDAGAD  615

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNS--DLNYPSFILLYPVNQSRSESGYGIRR  354
            DYV L+C+MN+T  QI T+ +S +   +   +  DLNYPSFI  +    +   +     R
Sbjct  616  DYVKLMCAMNYTAAQIKTVAQSPSSAVDCAGATLDLNYPSFIAFFDPGATAPAA-----R  670

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGNQTGE  531
            TF R VT VGD PA+++  V G     V +    L F  K+E  +Y +V+   + N+T E
Sbjct  671  TFTRAVTNVGDAPASYSAKVKGLGGLTVSVSPERLVFGRKHETQKYTVVIRGQMKNKTDE  730

Query  532  VEFGSLTWIDESGKYKVRSPI  594
            V  GSLTW+D++GKY VRSPI
Sbjct  731  VLHGSLTWVDDAGKYTVRSPI  751



>gb|KCW66392.1| hypothetical protein EUGRSUZ_F00206 [Eucalyptus grandis]
Length=756

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 124/198 (63%), Gaps = 16/198 (8%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT+   D+TN PIKD   ++  ASP+ MGAG VDPN AL+PGLIYD TPQ
Sbjct  561  SPAAIRSAMMTTSYTRDSTNSPIKDIGNDYKPASPVGMGAGHVDPNKALDPGLIYDVTPQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNL+C+MN+T  QI  +TRS +Y   NP+ DLNYPSFI  +  N S S     + + F
Sbjct  621  DYVNLMCAMNYTSKQIQMVTRSSSYNCSNPSLDLNYPSFIAFFGSNSSDSP----MVQEF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG G +T+   V           N    FK KYE+  YKL +         V  
Sbjct  677  YRTVTNVGAGASTYRAEV-----------NPMEGFK-KYEKLSYKLTIEGPKQMKQTVVS  724

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W+D+ GKY V+SPI
Sbjct  725  GSLSWMDDGGKYAVKSPI  742



>ref|NP_001234780.1| subtilisin-like protease [Solanum lycopersicum]
 emb|CAA06998.1| subtilisin-like protease [Solanum lycopersicum]
Length=779

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 136/211 (64%), Gaps = 11/211 (5%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  ++   PI +   +   ASPL +G+G VDPN AL+PGL+YDATPQ
Sbjct  572  SPSAIRSAMMTTANHLNSAQDPITED--DDMVASPLGIGSGHVDPNRALDPGLVYDATPQ  629

Query  181  DYVNLLCSMNFTKTQILTITRSK-NY-TFENPNSDLNYPSFILLYPVNQSRSESGY-GIR  351
            DY+NL+CS+NFT+ Q  T  RS  NY    NP++DLNYPSFI  Y  +Q   E  Y  + 
Sbjct  630  DYINLICSLNFTEEQFKTFARSSANYHNCSNPSADLNYPSFIAFYSYSQ---EGNYPWLE  686

Query  352  RTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGN-QTG  528
            + F RT+T VG G AT+ V +  P+NS + +    L FKNK E+  Y L + Y G+  +G
Sbjct  687  QKFRRTLTNVGKGGATYKVKIESPKNSTISVSPQTLVFKNKNEKQSYTLTIRYRGDFNSG  746

Query  529  EVEFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
            +   GS+TW++++G   VRSPI +   +  W
Sbjct  747  QT--GSITWVEKNGNRSVRSPIVLTTTVDLW  775



>ref|XP_008785865.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=760

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 130/200 (65%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAF-NFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRSA+VTTAN  DNT  PI+D  + +   A+P+++G+GQ++PN AL+PGLIYDA+ 
Sbjct  553  SPAAIRSALVTTANNLDNTMMPIRDMGYADRPVATPMAIGSGQIEPNRALDPGLIYDAST  612

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
             DYV LLC+M +T  QI  IT++ ++   N + DLNYPSFI  +  N +++   Y + + 
Sbjct  613  DDYVRLLCAMKYTSKQIKMITKTYSFDCSNASLDLNYPSFIAFF--NPNKTAISYKVVQE  670

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGNQTGEV  534
            F RTVT VGD   T+   V   +  ++ +    L F  KYE+  + L++   +G +  EV
Sbjct  671  FQRTVTNVGDAVVTYNAKVVAMKGIEISVMPEKLVFHEKYEKKSFTLIMVGQMGKKADEV  730

Query  535  EFGSLTWIDESGKYKVRSPI  594
              GSL+W+D+ GKY VRSPI
Sbjct  731  LHGSLSWVDDKGKYVVRSPI  750



>ref|XP_002523603.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38798.1| Cucumisin precursor, putative [Ricinus communis]
Length=373

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 133/205 (65%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPA-FNFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRSA++TTANP DNT  PIKD +  +    SP+ +G+G +DPN +L+PGLIYDA+ 
Sbjct  168  SPAAIRSALMTTANPLDNTQSPIKDVSNKDLAPGSPIDVGSGHIDPNKSLDPGLIYDASV  227

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            +DY+ LLC+MN+T+ QI  IT+S  ++  N + DLNYPSFI  +  N   S+SG  +   
Sbjct  228  EDYIELLCAMNYTEKQIRNITKS-THSCLNKSLDLNYPSFIAYFIGND--SDSGKTVHE-  283

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG+  +++T  ++  +  +V +    L F+ KYE+  YKL L    +   +V 
Sbjct  284  FQRTVTNVGEAISSYTAKLTPMKGIKVSVVPKKLVFRKKYEKLSYKLTLEGPKSMKEDVV  343

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
             GSL+W+ + GKY VRSPI    ++
Sbjct  344  HGSLSWVHDEGKYVVRSPIVATDLV  368



>ref|XP_006345405.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=779

 Score =   179 bits (454),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 134/210 (64%), Gaps = 9/210 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP+AIRSAM+TTAN  ++  KPI +   +   ASPL +G+G VDPN AL+PGL+YDATPQ
Sbjct  572  SPSAIRSAMMTTANHLNSAQKPITED--DNMVASPLGIGSGHVDPNRALDPGLVYDATPQ  629

Query  181  DYVNLLCSMNFTKTQILTITRSK-NY-TFENPNSDLNYPSFILLYPVNQSRSESGY-GIR  351
            DY+NL+CS+NFT+ Q  T  RS  NY    NP++DLNYPSFI  Y  +Q   E  Y  + 
Sbjct  630  DYINLICSLNFTEEQFKTFARSSTNYDNCSNPSADLNYPSFIAFYSDSQ---EGNYPWLE  686

Query  352  RTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE  531
            + F RT+T VG G AT+ V +  PRNS + +    L F NK E+  Y L + Y G     
Sbjct  687  QKFKRTLTNVGKGGATYRVKIENPRNSTISVSPQTLVFMNKNEKQSYTLTIRYRGPFNSG  746

Query  532  VEFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
             + GS+TW++++G + VRSPI +   +  W
Sbjct  747  QD-GSITWVEKNGNHSVRSPIVLTSTVDLW  775



>ref|XP_009419397.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=761

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 128/207 (62%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTA+  DNT  PIKD       ASPL+MGAG +DPN AL PGL+YDA  +
Sbjct  554  SPAAIRSALMTTASHLDNTGAPIKDMGNGNKQASPLAMGAGHIDPNRALEPGLVYDADTK  613

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC+MNFT  Q+ TIT +      NP  DLNYPSFI  +  N++ S S   +R+ F
Sbjct  614  DYVNLLCAMNFTSKQLRTITGTATVDCSNPTLDLNYPSFIAYFDPNET-SASAPSVRQ-F  671

Query  361  VRTVTYVGDGP-ATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE-V  534
             RTVT VGD P AT+   +   +   V +    LSFK KY++  + L L     +  + V
Sbjct  672  RRTVTNVGDNPVATYIAKLVDIKGFTVSVVPEKLSFKEKYQKQSFTLTLKENTREKKDAV  731

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIP  615
              GSLTW+D+  KY VRSPI    + P
Sbjct  732  RHGSLTWVDDEEKYVVRSPIVATTVSP  758



>ref|XP_006386505.1| hypothetical protein POPTR_0002s12610g [Populus trichocarpa]
 gb|ERP64302.1| hypothetical protein POPTR_0002s12610g [Populus trichocarpa]
Length=739

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 129/207 (62%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTS--ASPLSMGAGQVDPNSALNPGLIYDAT  174
            SPAAIRSAM+TTA+  D+T KPI D  F   +  ASPL+MGAGQV+PN AL+PGLIYD  
Sbjct  532  SPAAIRSAMMTTADIMDHTMKPINDIGFGNKTQLASPLAMGAGQVNPNKALDPGLIYDVN  591

Query  175  PQDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
              DYV LLC++ FT+ QI  ITRS +    NP++DLNYPSFI  +  N   S S     R
Sbjct  592  SNDYVRLLCALKFTEKQIQAITRSSSTNCSNPSTDLNYPSFIAYF--NAKDSPSNLTTVR  649

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG   +T+TV+V+     +V +    L F+ KYE+  YKL++         V
Sbjct  650  EFQRTVTNVGAEMSTYTVNVTPMIGLKVSVIPDKLEFRAKYEKLSYKLIIEGPALLDETV  709

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIP  615
             FG L+W+D  GK+ VRSPI    + P
Sbjct  710  TFGYLSWVDVGGKHIVRSPIVSTSLSP  736



>ref|XP_007204261.1| hypothetical protein PRUPE_ppa001828mg [Prunus persica]
 gb|EMJ05460.1| hypothetical protein PRUPE_ppa001828mg [Prunus persica]
Length=759

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 131/205 (64%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTANP DNT KPI D + N   A+PL +GAG ++PN AL PGL+YD T +
Sbjct  555  SPAAIRSALMTTANPLDNTQKPIIDVSTNL-PATPLDIGAGHINPNKALEPGLVYDTTAE  613

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+ LLC+MN+T  QI  IT S  ++  N + DLNYPSFI  +  N   S+S   + + F
Sbjct  614  DYIKLLCAMNYTAKQIQVITGS-THSCVNRSIDLNYPSFIAYF--NSKGSKSSAKVVQEF  670

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+  + +T  ++     +V+++   L FKNKYE+  YKL L         V  
Sbjct  671  NRTVTNVGEQRSGYTAKLTAMAGLKVKVEPERLVFKNKYEKLSYKLTLEGPKLLKKVVVQ  730

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            GSL+W+D+ GKY VRSPI    ++P
Sbjct  731  GSLSWVDDGGKYVVRSPIVATNLVP  755



>ref|XP_006342632.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=749

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 132/198 (67%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT  PI+D   +  +A+PL+MGAG ++PN AL+PGLIYDATP+
Sbjct  544  SPAAIRSAMMTTADSLDNTQGPIRDIGRDNNAATPLAMGAGHINPNKALDPGLIYDATPE  603

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC ++FT  QI +ITRS +Y+   P+ DLNYPSFI  +  N S+S+      + F
Sbjct  604  DYVNLLCGLDFTSKQIKSITRSSSYSCSKPSLDLNYPSFIGYFNFNSSKSDPKR--IQEF  661

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT +GDG  T+T  ++      V +    L FK KYE+  YKL +         + +
Sbjct  662  NRTVTNLGDGQLTYTAKLTPMGKYTVSVAPDKLVFKEKYEKQSYKLRIEGPLLVDNYLVY  721

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W+D SGKY V+SPI
Sbjct  722  GSLSWVDTSGKYVVKSPI  739



>ref|XP_009610212.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=756

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 129/198 (65%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT  PI+D      +A+PL+MGAG ++PN A++PGLIYD T Q
Sbjct  555  SPAAIRSAMMTTADVLDNTQSPIQDIGQENAAATPLAMGAGHINPNKAIDPGLIYDTTRQ  614

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC++N T  QI TITRS +YT  NP+ DLNYPSFI  + VN S  +      + F
Sbjct  615  DYINLLCALNLTSEQIKTITRS-SYTCPNPSLDLNYPSFIAYFNVNSSELDPTR--IQEF  671

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G + +T  ++     +V +    L FK+KYE+  YKL +         +  
Sbjct  672  KRTVTNVGEGVSEYTAKLTAMPGLKVSVVPEKLVFKDKYEKQSYKLRVECSKLMNDFLVH  731

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W+++ GK  VRSPI
Sbjct  732  GSLSWVEKGGKRVVRSPI  749



>ref|XP_007047285.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOX91442.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=779

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 126/205 (61%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTAN  DNT  PIKDP+     A+PL +GAG ++P    +PGL+YDA PQ
Sbjct  578  SPAAIRSAIITTANLLDNTLSPIKDPSSYDLPATPLDIGAGHINPTKVFDPGLVYDAAPQ  637

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+ LLC+MN+T  QI   T S ++   + + DLNYPSFI L+      S S   + + F
Sbjct  638  DYIKLLCAMNYTSKQIRIFTNS-SHNCMSQSLDLNYPSFIALF--TDEHSTSNQKVVKEF  694

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG G   +T  ++G    +V ++   L FK +YE+  YKL L    +   EV F
Sbjct  695  QRTVTNVGKGGMAYTAKLAGMDGIKVMVKPEKLIFKQRYEKQSYKLSLEVPKSLKIEVIF  754

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            G L+W+D+ GKY VRSPI    + P
Sbjct  755  GYLSWVDDDGKYVVRSPIVATGVTP  779



>gb|EAY76626.1| hypothetical protein OsI_04578 [Oryza sativa Indica Group]
Length=551

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 119/196 (61%), Gaps = 6/196 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPA I+SAM+TTA   DNT +PI D      +ASPL++GAGQVDPN+A++PGL+YDA P+
Sbjct  357  SPAMIKSAMMTTATAVDNTFRPIGDAGHGDAAASPLAIGAGQVDPNAAMDPGLVYDAGPE  416

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            D+V LLCS NFT  QI+ ITRSK Y      +D+NYPSFI ++  N +  +        F
Sbjct  417  DFVELLCSTNFTAAQIMAITRSKAYNCSFSTNDMNYPSFIAVFGANDTSGD------MRF  470

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG G AT+      P N +V +    L F    + A + + L       GE  F
Sbjct  471  SRTVTNVGAGAATYRAFSVSPSNVEVTVSPETLVFTEVGQTASFLVDLNLTAPTGGEPAF  530

Query  541  GSLTWIDESGKYKVRS  588
            G++ W D SGKY+VR+
Sbjct  531  GAVIWADVSGKYEVRT  546



>ref|XP_010263512.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=767

 Score =   177 bits (448),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 128/198 (65%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTA+  DN   PI+   +   +ASPL+MGAG ++PN AL+PGLIYDA+  
Sbjct  562  SPAAIRSALMTTADFLDNALNPIQVAGYKNKAASPLAMGAGHINPNKALDPGLIYDASTD  621

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV+LLC++N+T  +I  ITRS ++   NP+ DLNYPSFI  +  N   S S   + + F
Sbjct  622  DYVSLLCALNYTMNEIKMITRSSDFNCSNPSLDLNYPSFIAFF--NAQDSGSDAKVVQEF  679

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G +T+T +++     QV +    L F+ KYE+  YKL +        +V  
Sbjct  680  QRTVTNVGEGMSTYTAYLTPMDGFQVAVVPDTLVFREKYEKLSYKLSIEGPTRMKEKVVH  739

Query  541  GSLTWIDESGKYKVRSPI  594
            GS++W D  GK+ VRSPI
Sbjct  740  GSISWTDSGGKHVVRSPI  757



>ref|XP_004252763.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score =   177 bits (448),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 133/198 (67%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT  PI+D   +  +A+PL+MGAG ++PN AL+PGLIYDATP+
Sbjct  570  SPAAIRSAMMTTADSLDNTQGPIRDIGRDNNAATPLAMGAGHINPNKALDPGLIYDATPE  629

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC ++FT  QI +ITRS +Y+   P+ DLNYPSFI  +  N S+S+      + F
Sbjct  630  DYVNLLCGLDFTSKQIKSITRSSSYSCSKPSLDLNYPSFIGYFNFNSSKSDPKR--IQVF  687

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT +GDG +T+T  ++      V +    L FK KYE+  YKL +         + +
Sbjct  688  NRTVTNLGDGQSTYTAKLTPMGEYTVSVTPDKLVFKEKYEKQSYKLRIEGPLLVDNYLVY  747

Query  541  GSLTWIDESGKYKVRSPI  594
            GSL+W++ SGKY V+SPI
Sbjct  748  GSLSWVETSGKYVVKSPI  765



>ref|XP_007017195.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14420.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=760

 Score =   176 bits (446),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 124/198 (63%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TT++  DNT  PIKD   N   ASPL+MGAG ++PN AL+PGLIYDAT +
Sbjct  557  SPAAIRSALMTTSDLIDNTGSPIKDTGDNLRPASPLAMGAGHINPNKALDPGLIYDATVE  616

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC +NFT  QI TIT+S N    NP  DLNYPSFI  +  N   ++      + F
Sbjct  617  DYVNLLCGLNFTAEQIKTITKSSN-NCSNPALDLNYPSFIAFF--NDRDAKRNSKTVKEF  673

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G +T+   V+     +V ++   L FK K ++  +KL +         V F
Sbjct  674  QRTVTNVGEGSSTYKATVTPINGVKVTVEPDQLVFKEKNDKKNFKLSVEAPSQLDEAVSF  733

Query  541  GSLTWIDESGKYKVRSPI  594
            G LTW D  GK+ VRSPI
Sbjct  734  GYLTWEDIGGKHVVRSPI  751



>ref|XP_002441162.1| hypothetical protein SORBIDRAFT_09g021490 [Sorghum bicolor]
 gb|EES19592.1| hypothetical protein SORBIDRAFT_09g021490 [Sorghum bicolor]
Length=744

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 128/205 (62%), Gaps = 12/205 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPA +RSAM+TTA+  DNT   IKD       ASPL+MG+G +DP  A++PGL+YDA P 
Sbjct  535  SPAMVRSAMMTTASALDNTGASIKDMGNRNHPASPLAMGSGHIDPTRAVDPGLVYDAAPG  594

Query  181  DYVNLLCSMNFTKTQILTIT----RSKNYTFENPNS--DLNYPSFILLYPVNQSRSESGY  342
            DYV L+C+MN+T  QI T+      S +Y  +   +  DLNYPSFI  +  N      G 
Sbjct  595  DYVKLMCAMNYTAAQIRTVVTQSPSSSSYAVDCTGATLDLNYPSFIAFFDPN-----GGA  649

Query  343  GIRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGN  519
             + RTF RTVT VG GPA++T  V+G     V +    L+F  K E+ +Y LV+   + +
Sbjct  650  VVERTFTRTVTNVGGGPASYTAKVTGLSGLTVIVSPEKLAFGGKNEKQKYTLVIRGKMTS  709

Query  520  QTGEVEFGSLTWIDESGKYKVRSPI  594
            ++G V  G+LTW+D++GKY VRSPI
Sbjct  710  KSGNVLHGALTWVDDAGKYTVRSPI  734



>ref|XP_009345959.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=767

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 126/205 (61%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTANP DN   PI D   N   ASPL +GAG + PN A++PGLIYDAT Q
Sbjct  563  SPAAIRSALMTTANPLDNEQNPIIDAQSNL-PASPLDIGAGHISPNKAIDPGLIYDATAQ  621

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC+MN+T   I  IT SKN   +  +  LNYPSFI  +  N   S S   + + F
Sbjct  622  DYINLLCAMNYTSKGIQVITGSKNNCTDR-SIHLNYPSFIAYF--NSEGSNSSAKVVQEF  678

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG   +++T  +      +V+++   L FK KYE+  YK+ L  L     +V  
Sbjct  679  RRTVTNVGGEKSSYTAKLMAMTGLKVKVEPQRLVFKKKYEKLSYKVTLEGLKLLKEDVVQ  738

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            GSL WID+ GKY VRSPI    ++P
Sbjct  739  GSLIWIDDGGKYVVRSPIVATNIVP  763



>ref|XP_009799242.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=757

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 129/199 (65%), Gaps = 4/199 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAF-NFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRSAM+TTA+  DNT  PI+D       +A+PL+MGAG ++PN A++PGLIYD TP
Sbjct  555  SPAAIRSAMMTTADVLDNTQNPIQDIGRPENAAATPLAMGAGHINPNKAIDPGLIYDTTP  614

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            QDY+NLLC++N T  QI TITRS +YT  NP+ DLNYPSFI  + VN S  +      + 
Sbjct  615  QDYINLLCALNLTSKQIKTITRS-SYTCPNPSLDLNYPSFIAYFNVNSSELDPTR--IQE  671

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG+  + +T  ++     +V I    L FK+KYE+  YKL +         + 
Sbjct  672  FKRTVTNVGERVSEYTAELTAMPGLKVSIVPEKLVFKDKYEKQSYKLRIECPKLMNDFLV  731

Query  538  FGSLTWIDESGKYKVRSPI  594
             GSL W+++ GKY VRSPI
Sbjct  732  HGSLRWMEKGGKYVVRSPI  750



>ref|XP_007047286.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOX91443.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=767

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 127/207 (61%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPA-FNFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRSA++TTA   DNT  PIKD + +NF  ASPL +GAG ++P  AL+PGL+YDA P
Sbjct  563  SPAAIRSAIITTAKLLDNTLSPIKDVSNYNF-PASPLDIGAGHINPTKALDPGLVYDAAP  621

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRS-ESGYGIRR  354
            +DY+ LLC+MN+T  QI     S +      + DLNYPSFI  +   QS S +    + +
Sbjct  622  EDYIKLLCAMNYTSKQIRVFANSSHNCLSR-SLDLNYPSFIAFFTDEQSTSNQKVVKVVK  680

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG G   +T  V+G    +V ++   L FK  YE+  YKL L    +   EV
Sbjct  681  EFRRTVTNVGKGGMAYTAMVTGMDGIKVMVEPQKLIFKQSYEKQSYKLSLEGPKSLKTEV  740

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIP  615
             FGSL+W+D+ GKY VRSPI    + P
Sbjct  741  IFGSLSWVDDDGKYMVRSPIVATSITP  767



>dbj|BAD82002.1| putative subtilase [Oryza sativa Japonica Group]
Length=757

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 119/196 (61%), Gaps = 6/196 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPA I+SAM+TTA   DNT +PI D      +ASPL++GAGQVDPN+A++PGL+YDA P+
Sbjct  563  SPAMIKSAMMTTATAVDNTFRPIGDAGHGDAAASPLAIGAGQVDPNAAMDPGLVYDAGPE  622

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            D+V LLCS NFT  QI+ ITRSK Y      +D+NYPSFI ++  N +  +        F
Sbjct  623  DFVELLCSTNFTAAQIMAITRSKAYNCSFSTNDMNYPSFIAVFGANDTSGD------MRF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG G AT+      P N +V +    L F    + A + + L       GE  F
Sbjct  677  SRTVTNVGAGAATYRAFSVSPSNVEVTVSPETLVFTEVGQTASFLVDLNLTAPTGGEPAF  736

Query  541  GSLTWIDESGKYKVRS  588
            G++ W D SGKY+VR+
Sbjct  737  GAVIWADVSGKYEVRT  752



>gb|EEE55729.1| hypothetical protein OsJ_04215 [Oryza sativa Japonica Group]
Length=715

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 119/196 (61%), Gaps = 6/196 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPA I+SAM+TTA   DNT +PI D      +ASPL++GAGQVDPN+A++PGL+YDA P+
Sbjct  521  SPAMIKSAMMTTATAVDNTFRPIGDAGHGDAAASPLAIGAGQVDPNAAMDPGLVYDAGPE  580

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            D+V LLCS NFT  QI+ ITRSK Y      +D+NYPSFI ++  N +  +        F
Sbjct  581  DFVELLCSTNFTAAQIMAITRSKAYNCSFSTNDMNYPSFIAVFGANDTSGD------MRF  634

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG G AT+      P N +V +    L F    + A + + L       GE  F
Sbjct  635  SRTVTNVGAGAATYRAFSVSPSNVEVTVSPETLVFTEVGQTASFLVDLNLTAPTGGEPAF  694

Query  541  GSLTWIDESGKYKVRS  588
            G++ W D SGKY+VR+
Sbjct  695  GAVIWADVSGKYEVRT  710



>ref|XP_006342631.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=755

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 135/200 (68%), Gaps = 6/200 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT   I+D   N  +A+PL+MGAG ++PN AL+PGLIYD TP+
Sbjct  550  SPAAIRSAMMTTADALDNTQGSIRDIGKNNNAANPLAMGAGHINPNKALDPGLIYDVTPE  609

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT-  357
            DY+NLLC ++FT  QI  ITRS +Y+  NP+ DLNYPSFI  +  N S+S++    +RT 
Sbjct  610  DYINLLCGLDFTSQQIKAITRSSSYSCSNPSLDLNYPSFIGYFNRNSSKSDT----KRTQ  665

Query  358  -FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT +GDG +T+T  ++     +V +    L FK KYE+  YKL +         +
Sbjct  666  EFQRTVTNLGDGMSTYTAKLTPMDEYKVSVAPHKLVFKEKYEKQNYKLRIEGPLLLDNYL  725

Query  535  EFGSLTWIDESGKYKVRSPI  594
             +GSL+W++ SGKY V+SPI
Sbjct  726  VYGSLSWVETSGKYVVKSPI  745



>ref|XP_011017184.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=772

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 127/207 (61%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTS--ASPLSMGAGQVDPNSALNPGLIYDAT  174
            SPAAIRSAM+TTA+  D+T KPI D  F   +  ASPL+MGAGQV+PN AL+PGLIYD  
Sbjct  565  SPAAIRSAMMTTADITDHTMKPINDIGFGNKTHPASPLAMGAGQVNPNKALDPGLIYDVN  624

Query  175  PQDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
              DYV LLC++ FT+ QI  ITRS +    NP++DLNYPSFI  +  N   S S     R
Sbjct  625  SNDYVRLLCALKFTEKQIQAITRSSSTNCSNPSTDLNYPSFIAYF--NAKDSPSNLTTVR  682

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG   +T+TV+++     +V +    L FK KYE+  YKL++         V
Sbjct  683  EFHRTVTNVGAEMSTYTVNMTPMIGLKVSVIPDKLEFKAKYEKLSYKLIIEGPALLDETV  742

Query  535  EFGSLTWIDESGKYKVRSPIAVAPMIP  615
             FG L W+D  GK+ V SPI    + P
Sbjct  743  TFGYLRWVDVGGKHIVSSPIVSTSLSP  769



>ref|XP_008241490.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=745

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 130/205 (63%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTANP DNT KPI D + N   A+PL +GAG ++PN AL PGL+YD T +
Sbjct  541  SPAAIRSALMTTANPLDNTQKPIIDVSTNH-PATPLDIGAGHINPNRALEPGLVYDTTAE  599

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+ LLC+MN+T  QI  IT S  ++  N + +LNYPSFI  +  N   S+S   + + F
Sbjct  600  DYIKLLCAMNYTAKQIQVITGS-THSCVNRSINLNYPSFIAYF--NSKGSKSSAKVVQEF  656

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+  + +T  ++     +V+++   L FKNKYE+  YKL L         V  
Sbjct  657  KRTVTNVGEQRSGYTAKLTAMAGLKVKVEPERLVFKNKYEKLSYKLTLEGPKLLKEVVVQ  716

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            GSL+W+D+ GKY VRSPI     +P
Sbjct  717  GSLSWVDDGGKYVVRSPIVATNFVP  741



>gb|EMT05720.1| Subtilisin-like protease [Aegilops tauschii]
Length=556

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 124/205 (60%), Gaps = 12/205 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFT-SASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAA+RSAM+TTA+  DNT  PIKD A     +A PL+MG+G +DPN +L+PGL+YDA P
Sbjct  353  SPAAVRSAMMTTASAVDNTLAPIKDRADGIQYAADPLAMGSGHIDPNRSLDPGLVYDAGP  412

Query  178  QDYVNLLCSMNFTKTQILTITRSKN-YTFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
             DY+ L+C+MNFT  QI T+ +S       +   DLNYPSFI  +  N        G  +
Sbjct  413  DDYIKLMCAMNFTAAQIKTVVQSSGPMDCASATLDLNYPSFIAFFDYN--------GGEK  464

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQT--G  528
            TF RTVT VGDGP  +   V G    +V      L    K+E+  Y +V+    +Q    
Sbjct  465  TFTRTVTNVGDGPVRYNATVEGLDGGKVRGVPNRLLLCGKHEKQRYTVVVRVGDSQIIPE  524

Query  529  EVEFGSLTWIDESGKYKVRSPIAVA  603
             V +GSLTW+D++GKY VRSPI VA
Sbjct  525  VVLYGSLTWVDDTGKYTVRSPIVVA  549



>ref|XP_008220244.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 126/198 (64%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++  DNT  PIKD    +  ASPL+MGAG V+PN AL+PGLIYDA  +
Sbjct  558  SPAAIRSAMMTTSDTLDNTLSPIKDIGDGYQPASPLAMGAGHVNPNKALDPGLIYDADIE  617

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC++N+T  QI TIT+S +    +P+ DLNYPSFI  +  N S+ +      + F
Sbjct  618  DYINLLCALNYTNKQIQTITKSASNNCSSPSLDLNYPSFIAFFNANDSKPD--VQTTQEF  675

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVTY+G G +T+   V+  +  +V +    L FK + E+  + L++         V F
Sbjct  676  RRTVTYIGKGQSTYVASVTPLKGFEVAVVPNTLKFKKEGEKLSFVLIIKGPRRTKETVAF  735

Query  541  GSLTWIDESGKYKVRSPI  594
            G LTW +  G++ VRSP+
Sbjct  736  GYLTWAESGGEHVVRSPV  753



>ref|XP_008785921.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=760

 Score =   174 bits (440),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 130/200 (65%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAF-NFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRSA++TTAN  DNT  PI+D  + +  +A+PL++G+G ++PN AL+PGL+YDA+ 
Sbjct  553  SPAAIRSALMTTANNLDNTMMPIRDMGYADRPAATPLAIGSGHIEPNRALDPGLVYDAST  612

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
             DYV LLC+M +T  QI TIT++ ++   + + DLNYPSFI  +  N +++ +   + + 
Sbjct  613  DDYVRLLCAMKYTSKQIKTITKTYSFDCSHASLDLNYPSFIAFF--NPNKTAASDEVVQE  670

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGNQTGEV  534
            F RTVT VGD   T+   V   +   + I    L F  KYE+  + L+L   +G +  EV
Sbjct  671  FRRTVTNVGDAVVTYNAKVVAMKGFAIRIVPEKLVFYEKYEKKSFALILVGQMGKKDDEV  730

Query  535  EFGSLTWIDESGKYKVRSPI  594
              GSL+W+D+ GKY VRSPI
Sbjct  731  LHGSLSWVDDKGKYVVRSPI  750



>ref|XP_002523606.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38801.1| Cucumisin precursor, putative [Ricinus communis]
Length=768

 Score =   174 bits (440),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 128/205 (62%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TT+N  DNT  PIKD + +   A+PL +GAG VDPN +L+PGLIYDAT  
Sbjct  564  SPAAIRSALMTTSNSLDNTRTPIKDASNHDLPANPLDIGAGHVDPNKSLDPGLIYDATAD  623

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+ LLC+MN+TK QI  ITRS N    N + DLNYPSFI  +  N   S+    + R F
Sbjct  624  DYMKLLCAMNYTKKQIQIITRS-NPNCVNKSLDLNYPSFIAYF--NNDDSDLNEKVVREF  680

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RT+T VG G ++++  V+     +  ++   L F+NKYE+  YKL L         V  
Sbjct  681  RRTLTNVGMGMSSYSAKVTPMYGVRATVEPKELVFRNKYEKLSYKLTLEGPKILEEMVVH  740

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            GSL+W+ + GKY V SPI    ++P
Sbjct  741  GSLSWVHDEGKYVVTSPIVATSLVP  765



>ref|XP_010912031.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=765

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 133/207 (64%), Gaps = 5/207 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA+VTT N  DNT  PIKD   +   A+PL+MG+G ++PN AL+PGL+YDA+  
Sbjct  560  SPAAIRSALVTTTNQLDNTMTPIKDMGDSNRPATPLAMGSGHIEPNRALDPGLVYDASSD  619

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV LLC+MN+T  QI TITR+ ++     + DLNYPSFI  +  N +++ +   + + F
Sbjct  620  DYVRLLCAMNYTIQQIKTITRTYSFDCSKASLDLNYPSFIAFF--NPNKTTTRDKVVQEF  677

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGNQTGEVE  537
             RTVT VGD  AT+   V   +   + +    L F  KYE+  + +++   +G +  EV 
Sbjct  678  RRTVTNVGDA-ATYYSKVVAMKGFSITVMPDMLVFHEKYEKKSFTIIIEGQMGKKKDEVL  736

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPT  618
             G+L+W+D+ GKY VRSPI VA  +P+
Sbjct  737  HGALSWVDDKGKYVVRSPI-VATTLPS  762



>gb|KDO79191.1| hypothetical protein CISIN_1g004824mg [Citrus sinensis]
Length=728

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 127/205 (62%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA+VTTA+P DNT   IKD + N   ASPL MGAG ++PN AL+PGL+YDAT +
Sbjct  524  SPAAIRSALVTTASPLDNTLSHIKDASNNNFPASPLDMGAGHINPNKALDPGLVYDATAE  583

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+ LLC+MN+   QI   T+S      N + DLNYPSFI  +  N   S S   + + F
Sbjct  584  DYIKLLCAMNYKPEQIRIFTKSSQKC-NNRSLDLNYPSFITFF--NDYDSSSDEKVVKEF  640

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT   +    +T  ++G    +V ++   L FK KYE+  YKL L        +V +
Sbjct  641  WRTVTNAEEVGTAYTAKLTGIDGLKVYVEPRRLVFKQKYEKQSYKLTLEGPKLLEKDVVY  700

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            GS++W+D+ G+Y+VRSPI    ++P
Sbjct  701  GSISWVDDDGRYEVRSPIVATNLVP  725



>ref|XP_006425911.1| hypothetical protein CICLE_v10024929mg [Citrus clementina]
 gb|ESR39151.1| hypothetical protein CICLE_v10024929mg [Citrus clementina]
Length=786

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 127/205 (62%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA+VTTA+P DNT   IKD + N   ASPL MGAG ++PN AL+PGL+YDAT +
Sbjct  582  SPAAIRSALVTTASPLDNTLSHIKDASNNNFPASPLDMGAGHINPNKALDPGLVYDATAE  641

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+ LLC+MN+   QI   T+S      N + DLNYPSFI  +  N   S S   + + F
Sbjct  642  DYIKLLCAMNYKPEQIRIFTKSSQKC-NNRSLDLNYPSFITFF--NDYDSSSDEKVVKEF  698

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT   +    +T  ++G    +V ++   L FK KYE+  YKL L        +V +
Sbjct  699  WRTVTNAEEVGTAYTAKLTGIDGLKVYVEPRRLVFKQKYEKQSYKLTLEGPKLLEKDVVY  758

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            GS++W+D+ G+Y+VRSPI    ++P
Sbjct  759  GSISWVDDDGRYEVRSPIVATNLVP  783



>ref|XP_002523602.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38797.1| Cucumisin precursor, putative [Ricinus communis]
Length=665

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 126/205 (61%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPA-FNFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRSA++TTANP DNT  PIKD +  +    SP+ +G+G +DPN +L+PGLIYDA  
Sbjct  459  SPAAIRSALMTTANPLDNTQSPIKDVSNIDLGPGSPIDIGSGHIDPNKSLDPGLIYDAAA  518

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            +DYV LLC+MN+T+ QI  IT S  Y   N + DLNYPSFI  +    S SE    I   
Sbjct  519  EDYVKLLCAMNYTEKQIQIITNS-TYNCANQSLDLNYPSFIAYFLGGDSDSEK---IVHE  574

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG+  +++T  ++      V ++   L F  +YE+  YKL L    +   +V 
Sbjct  575  FQRTVTNVGEAVSSYTAKLTPMNGINVTVEPKKLVFNKQYEKLSYKLTLEGPKSMKEDVV  634

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
             GSL+W+ + GKY VRSPI    ++
Sbjct  635  HGSLSWVHDEGKYVVRSPIVATNLV  659



>ref|XP_008785918.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=456

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 129/200 (65%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAF-NFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            S AAIRSA+VTTAN  DNT   I+D  + +  +A+PL++G+G ++PN AL+PGL+YDA+ 
Sbjct  249  SSAAIRSALVTTANNLDNTMMLIRDMGYADRPAATPLAIGSGHIEPNRALDPGLVYDAST  308

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            +DYV LLC+M +T  QI  IT++ ++   + + DLNYPSFI  +  N +++ +   + + 
Sbjct  309  EDYVRLLCAMKYTSKQIKMITKTYSFDCSHASLDLNYPSFIAFF--NPNKTAASDKVVQE  366

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGNQTGEV  534
            F RTVT VGD  A++   V   +   + +    L F  KYE+  + L+L   +G +  EV
Sbjct  367  FRRTVTNVGDAMASYNAKVVAMKGFAIRVVPEKLVFHEKYEKKSFALILVGQMGKKADEV  426

Query  535  EFGSLTWIDESGKYKVRSPI  594
              GSL+W+D+ GKY VRSPI
Sbjct  427  LHGSLSWVDDKGKYVVRSPI  446



>ref|XP_006466594.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=786

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 126/205 (61%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA+VTTA+P DNT   IKD + N   ASPL MGAG ++PN AL+PGL+YDAT +
Sbjct  582  SPAAIRSALVTTASPLDNTLSHIKDASNNNFPASPLDMGAGHINPNKALDPGLVYDATAE  641

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+ LLC+MN+   QI   T+S      + + DLNYPSFI  +  N   S S   + + F
Sbjct  642  DYIKLLCAMNYKPEQIRIFTKSSQEC-NDLSLDLNYPSFITFF--NDYDSSSAEKVVKEF  698

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT   +    +T  ++G    +V ++   L FK KYE+  YKL L        EV +
Sbjct  699  WRTVTNAEEVGTAYTAKLTGIDGLKVYVEPQRLVFKQKYEKQSYKLTLEGPKLLEKEVVY  758

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            GS++W+D+ G+Y VRSPI    ++P
Sbjct  759  GSISWVDDDGRYVVRSPIVATNLVP  783



>ref|XP_002310134.2| subtilase family protein [Populus trichocarpa]
 gb|EEE90584.2| subtilase family protein [Populus trichocarpa]
Length=757

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 130/205 (63%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTA+  DNT  PIKD + N   A+P+ +G+G ++PN +L+PGLIYDAT +
Sbjct  555  SPAAIRSALMTTADSLDNTLSPIKDASNNNLPATPIDIGSGHINPNKSLDPGLIYDATAE  614

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+ LLC+MN+T  QI  ITRS ++  +N + DLNYPSFI  +    S S+    +   F
Sbjct  615  DYIKLLCAMNYTNKQIQIITRSSHHDCKNRSLDLNYPSFIAYFDSYDSGSKE--KVVHKF  672

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RT+T VG+  +++T  + G    +V ++   L FK ++E+  Y L L    +   +V  
Sbjct  673  QRTLTNVGERMSSYTAKLLGMDGIKVSVEPQKLVFKKEHEKLSYTLTLEGPKSLEEDVIH  732

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            GSL+W+ + GKY VRSPI    + P
Sbjct  733  GSLSWVHDGGKYVVRSPIVATSVTP  757



>ref|XP_004291093.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=767

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 123/198 (62%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++  DNT +PIKD   +   ASPL+MGAG V+PN ALNPGLIYDAT  
Sbjct  555  SPAAIRSAMMTTSDILDNTLRPIKDIGDDLQPASPLAMGAGHVNPNKALNPGLIYDATID  614

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++N+T+  I  IT S +     P+ DLNYPSFI  +  N + S SG    + F
Sbjct  615  DYVNLLCALNYTQKHIQIITGSASNNCSTPSLDLNYPSFIAFF--NANDSMSGVQATQEF  672

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG G +T+   V+  +  +V +    L F  + E+  +K+ +           F
Sbjct  673  KRTVTNVGKGQSTYVASVTAMKGFEVGVVPNKLVFGREGEKLSFKMSIRGRRLMEETEAF  732

Query  541  GSLTWIDESGKYKVRSPI  594
            G LTW+D  G++ VRSPI
Sbjct  733  GYLTWVDSEGQHVVRSPI  750



>dbj|BAJ89456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=781

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 126/208 (61%), Gaps = 15/208 (7%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSAS-PLSMGAGQVDPNSALNPGLIYDATP  177
            SPAA+RSAM+TTA+  DNT  PIKD A     A+ PL+MG+G +DPN +L+PGL+YDA P
Sbjct  575  SPAAVRSAMMTTASAVDNTLAPIKDRADGIEYAAYPLAMGSGHIDPNRSLDPGLVYDAGP  634

Query  178  QDYVNLLCSMNFTKTQILTITRSKN--YTFENPNSDLNYPSFILLYPVNQSRSESGYGIR  351
             DY+ L+C+MNFT  QI T+ +S            DLNYPSFI  +  +        G  
Sbjct  635  DDYIKLMCAMNFTTAQIKTVAQSSGPVDCTGGATHDLNYPSFIAFFDYD--------GGE  686

Query  352  RTFVRTVTYVGDGPATFTVHVSGPRNSQVE--IQNGNLSFKNKYEEAEYKLVLTYLGNQT  525
            +TF R VT V DGPA +   V G    +V+  +    L F  K+E+  Y +V+   G Q 
Sbjct  687  KTFARAVTNVRDGPARYNATVEGLDGVKVKVSVMPNRLVFGGKHEKQRYTVVVRVGGRQI  746

Query  526  G--EVEFGSLTWIDESGKYKVRSPIAVA  603
               +V +GSLTW+D++GKY VRSPI VA
Sbjct  747  TPEQVLYGSLTWVDDTGKYTVRSPIVVA  774



>ref|XP_008220243.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   171 bits (433),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 124/198 (63%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++  DNT  PIKD    +  ASPL+MGAG V+PN AL+PGLIYDA  +
Sbjct  558  SPAAIRSAMMTTSDTLDNTLSPIKDIGDGYQPASPLAMGAGHVNPNKALDPGLIYDADIE  617

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC++N+T  QI TIT+S +     P+ DLNYPSFI  +  N S+ +      + F
Sbjct  618  DYINLLCALNYTNKQIQTITKSASNNCSTPSLDLNYPSFIAFFNTNDSKPD--VQTTQEF  675

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVTY+G G +T+   V+  +  +V +    L FK + E+  + L +         V F
Sbjct  676  RRTVTYIGKGQSTYVASVTPLKGFEVAVVPNTLKFKEEGEKLSFVLSIKGPRRTKETVAF  735

Query  541  GSLTWIDESGKYKVRSPI  594
            G LTW +  G++ VRSP+
Sbjct  736  GYLTWAESGGEHVVRSPV  753



>ref|XP_008785920.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=764

 Score =   171 bits (432),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 129/200 (65%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAF-NFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRSA+VTTAN  DNT  PI+D  + +  +A+PL++G+G ++PN  L+PGL+YDA+ 
Sbjct  557  SPAAIRSALVTTANNLDNTMMPIRDMGYADRPAATPLAIGSGLIEPNRVLDPGLVYDAST  616

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            +DYV LLC+M +T  QI  IT++ ++   + + DLNYPSFI  +  N++ +     + + 
Sbjct  617  EDYVRLLCAMKYTSKQIKMITKTYSFDCSHASLDLNYPSFIAFFDPNKTAASD--KVVQE  674

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGNQTGEV  534
            F RTVT +GD  A++   V   +   + +    L F  KYE+  + L+L   +G +  EV
Sbjct  675  FRRTVTNMGDAVASYNAKVVAMKGFAIRVVPEKLVFHEKYEKKSFALILVGQMGKKADEV  734

Query  535  EFGSLTWIDESGKYKVRSPI  594
              GSL+W+D+ GKY VRSPI
Sbjct  735  LHGSLSWMDDKGKYVVRSPI  754



>ref|XP_008221259.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 124/198 (63%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++  DNT  PIKD    +  ASPL+MGAG V+PN AL+PGLIYDA  +
Sbjct  558  SPAAIRSAMMTTSDTLDNTLSPIKDIGDGYQPASPLAMGAGHVNPNKALDPGLIYDADIE  617

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC++N+T  QI TIT+S +    +P+ DLNYPSFI  +  N S+ +      + F
Sbjct  618  DYINLLCALNYTNKQIQTITKSASNNCSSPSLDLNYPSFIAFFNANDSKPD--VQTTQEF  675

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVTY+G G +T+   V+  +  +V +      FK + E+  + L +         V F
Sbjct  676  RRTVTYIGKGQSTYVASVTPLKGFEVAVVPNTFKFKEEGEKLSFVLSIKGPRRTKETVAF  735

Query  541  GSLTWIDESGKYKVRSPI  594
            G LTW +  G++ VRSP+
Sbjct  736  GYLTWAESGGEHVVRSPV  753



>ref|XP_010263511.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 125/199 (63%), Gaps = 4/199 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT  PI         A+PLSMGAG ++PN AL+PGLIYDA  Q
Sbjct  564  SPAAIRSAMMTTADSLDNTLGPITQVVDKERPATPLSMGAGHINPNKALDPGLIYDANAQ  623

Query  181  DYVNLLCSMNFTKTQILTITRSKN-YTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DY  LLC++N+T+ Q+  ITRS + +   NP+ DLNYPSFI L   +         + R 
Sbjct  624  DYARLLCALNYTREQMNKITRSSSGHNCLNPSLDLNYPSFIALLRDDLPPDAK---VIRE  680

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VGDG A +T  ++     +++++   L FK+KYE+  YKL L   G+    V 
Sbjct  681  FRRTVTNVGDGMAEYTAELTPIDGFRLKVEPDRLVFKDKYEKQSYKLTLEGPGSVESGVV  740

Query  538  FGSLTWIDESGKYKVRSPI  594
             GSL W++  G++ VRSPI
Sbjct  741  HGSLNWVEVGGRHVVRSPI  759



>emb|CBI18429.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 126/205 (61%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    SPAAIRSA-MVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRSA M TT +  DNT  PIK+     + A+PL MGAG ++PN AL PGLIY+AT 
Sbjct  348  SPAAIRSAIMTTTTDSIDNTMNPIKNNLNLNSPATPLDMGAGLINPNKALEPGLIYNATA  407

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            QDY+NLLC M  TK +I  ITR+ ++   NP+ DLNYPSFI  +  N   S     I + 
Sbjct  408  QDYINLLCGMKLTKREIQVITRASSHKCLNPSLDLNYPSFIAYF--NDVGSSPNEQIVQV  465

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RT+T VG+G +++T  ++     +V+++   L F +KYE+  YKL+L        +V 
Sbjct  466  FSRTLTNVGEGGSSYTAKLTPMEGLKVKVEPRKLVFSHKYEKLSYKLILEGPKWMEEDVV  525

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
             G L+W+   GKY VRSPI    +I
Sbjct  526  HGHLSWVSSDGKYVVRSPIVATSII  550



>ref|XP_007221958.1| hypothetical protein PRUPE_ppa001770mg [Prunus persica]
 gb|EMJ23157.1| hypothetical protein PRUPE_ppa001770mg [Prunus persica]
Length=767

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 123/198 (62%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++  DNT  PIKD    +  ASPL+MGAG V+PN AL+PGLIYDA  +
Sbjct  558  SPAAIRSAMMTTSDTMDNTLSPIKDIGDGYQPASPLAMGAGHVNPNKALDPGLIYDAEIE  617

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC++N+T  QI TIT+S +     P+ DLNYPSFI  +  N S+        + F
Sbjct  618  DYINLLCALNYTNKQIQTITKSASNNCSTPSLDLNYPSFIAFFNANDSKPN--VQTTQEF  675

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVTY+G G +T+   V+  +  +V +    L FK + E+  + L +         + F
Sbjct  676  RRTVTYIGKGQSTYVASVTPLKGFEVAVVPNTLKFKEEGEKLSFVLSIKGPRRTKETLAF  735

Query  541  GSLTWIDESGKYKVRSPI  594
            G LTW +  G++ VRSP+
Sbjct  736  GYLTWAESGGEHVVRSPV  753



>emb|CDP17956.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 123/198 (62%), Gaps = 5/198 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNTN PI D   +  +A+PL+MG G ++PN AL+PGLIYDA  +
Sbjct  518  SPAAIRSAMMTTADILDNTNHPITDIGSDNEAANPLAMGTGHLNPNKALDPGLIYDAGIE  577

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++N+  +QI T+TRS ++    P+ DLNYPSFI  +  + +RS +     + F
Sbjct  578  DYVNLLCALNYNSSQIQTVTRSSSHNCSKPSLDLNYPSFIAYFAASGNRSTT-----QEF  632

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT +G   + +   +      +V +    LSF+ KYE+  YKL +         + F
Sbjct  633  SRTVTNIGSEMSVYVAKLVPLDGFKVSVTPDTLSFRQKYEKKSYKLTIEGFSVLKNSLVF  692

Query  541  GSLTWIDESGKYKVRSPI  594
            G L+W D  G + VRSPI
Sbjct  693  GYLSWEDTGGNHVVRSPI  710



>ref|XP_009343175.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=761

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 125/205 (61%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTAN  DN   PI D   N   ASPL +GAG + PN A++PGLIYDAT Q
Sbjct  557  SPAAIRSALMTTANSLDNEQNPIIDAHGNL-PASPLDIGAGHISPNKAIDPGLIYDATAQ  615

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC+MN+T   I  IT SKN    + +  LNYPSFI  + +  S S +   + + F
Sbjct  616  DYINLLCAMNYTSKGIQVITGSKN-NCTDRSIHLNYPSFIAYFNIEGSNSSA--KVVQEF  672

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG   +++T  +      +V+++   L FK KYE+  YK+ L        +V  
Sbjct  673  RRTVTNVGGEKSSYTAKLMAMTGLKVKVEPQRLVFKKKYEKLSYKVTLEGSKLLKEDVVQ  732

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            GSL WID+ GKY VRSPI    ++P
Sbjct  733  GSLIWIDDGGKYVVRSPIVATNIVP  757



>ref|XP_007206792.1| hypothetical protein PRUPE_ppa026679mg [Prunus persica]
 gb|EMJ07991.1| hypothetical protein PRUPE_ppa026679mg [Prunus persica]
Length=188

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 107/174 (61%), Gaps = 26/174 (15%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTANP DN+ +PI+D  +N T ASPL+MGAGQVDPN AL+PGLIYDAT Q
Sbjct  34   SAAAIRSALMTTANPVDNSRRPIRDQGYNSTVASPLAMGAGQVDPNRALDPGLIYDATRQ  93

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLCS N +K ++  ITRSK YT           S I+                + F
Sbjct  94   DYINLLCSSNLSKKRVFAITRSKKYT-----------STIM---------------DKQF  127

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQ  522
             RTVT VGDG AT+ V V+ P NS V      L F  KYE+  Y L + Y+ ++
Sbjct  128  KRTVTNVGDGSATYNVKVTAPNNSVVRGSPERLVFSKKYEKQNYTLRIEYMSSE  181



>dbj|BAJ90426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=737

 Score =   168 bits (426),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 125/204 (61%), Gaps = 13/204 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTS--ASPLSMGAGQVDPNSALNPGLIYDAT  174
            SPAA+RSAM+TTA+  DNT  PIKD +    +  ASPL+MG+G +DPN AL PGL+Y+A 
Sbjct  537  SPAAVRSAMMTTASAVDNTFAPIKDMSGGNQNGPASPLAMGSGHIDPNRALAPGLVYEAG  596

Query  175  PQDYVNLLCSMNFTKTQILTITRSKN-YTFENPNSDLNYPSFILLYPVNQSRSESGYGIR  351
            P DY+ L+C+MN+T  QI T+ +S         + DLNYPSFI  +              
Sbjct  597  PYDYIKLMCAMNYTTAQIKTVAQSSAPVDCVGASLDLNYPSFIAYFDTAG---------E  647

Query  352  RTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE  531
            +TF RTVT VGDGPA+++  V G    +V +    L F  K+E+  YK+V+        E
Sbjct  648  KTFARTVTNVGDGPASYSATVEGLDGLKVSVVPDRLVFGGKHEKQRYKVVVQVRDELMPE  707

Query  532  VEF-GSLTWIDESGKYKVRSPIAV  600
            V   GSLTW+D++GKY VRSP+ V
Sbjct  708  VVLHGSLTWVDDNGKYTVRSPVVV  731



>ref|XP_006434738.1| hypothetical protein CICLE_v10000411mg [Citrus clementina]
 gb|ESR47978.1| hypothetical protein CICLE_v10000411mg [Citrus clementina]
Length=729

 Score =   168 bits (426),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 130/206 (63%), Gaps = 10/206 (5%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TT++  DNTN  IKD   +   A+P++MGAG ++P+ AL+PGLIYDAT +
Sbjct  525  SPAAIRSAIMTTSDSTDNTNSDIKDIGDDNKPATPIAMGAGHINPDKALDPGLIYDATTE  584

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV+LLC++N T  +I TITRS +        DLNYPSFI  +  N+S+S       + F
Sbjct  585  DYVSLLCALNLTMKRIQTITRSYSVNCSTSALDLNYPSFIAFFNANESKSA------QEF  638

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE---  531
             RTVT VG+G +T+T  V+  +   V +    L+FK KY +  YKL +    NQ  E   
Sbjct  639  QRTVTNVGEGVSTYTASVTPLKGFNVSVDPDKLTFKGKYAKQSYKLRIEG-PNQMDEETV  697

Query  532  VEFGSLTWIDESGKYKVRSPIAVAPM  609
            V F  L+WI+  GK+ V+SPI V  +
Sbjct  698  VAFCYLSWIETGGKHVVKSPIVVTSL  723



>dbj|BAJ88973.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 125/204 (61%), Gaps = 13/204 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTS--ASPLSMGAGQVDPNSALNPGLIYDAT  174
            SPAA+RSAM+TTA+  DNT  PIKD +    +  ASPL+MG+G +DPN AL PGL+Y+A 
Sbjct  557  SPAAVRSAMMTTASAVDNTFAPIKDMSGGNQNGPASPLAMGSGHIDPNRALAPGLVYEAG  616

Query  175  PQDYVNLLCSMNFTKTQILTITRSKN-YTFENPNSDLNYPSFILLYPVNQSRSESGYGIR  351
            P DY+ L+C+MN+T  QI T+ +S         + DLNYPSFI  +              
Sbjct  617  PYDYIKLMCAMNYTTAQIKTVAQSSAPVDCVGASLDLNYPSFIAYFDTAG---------E  667

Query  352  RTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE  531
            +TF RTVT VGDGPA+++  V G    +V +    L F  K+E+  YK+V+        E
Sbjct  668  KTFARTVTNVGDGPASYSATVEGLDGLKVSVVPDRLVFGGKHEKQRYKVVVQVRDELMPE  727

Query  532  VEF-GSLTWIDESGKYKVRSPIAV  600
            V   GSLTW+D++GKY VRSP+ V
Sbjct  728  VVLHGSLTWVDDNGKYTVRSPVVV  751



>ref|XP_004514928.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=712

 Score =   168 bits (425),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 128/202 (63%), Gaps = 9/202 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TT++ +DNT +PIKD      +A+PL+MGAG V+PN AL+PGL+YDA  Q
Sbjct  515  SPAAIRSALMTTSDTFDNTKQPIKDIGDGNNAATPLAMGAGHVNPNRALDPGLVYDAGVQ  574

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++NFT+ QI TITRS +     P+ D+NYPSFI  +  N  +S S     + F
Sbjct  575  DYVNLLCALNFTQQQITTITRSSSNDCSKPSLDINYPSFIAFF--NSEKSSS----IQEF  628

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLG-NQTGEVE  537
             RTVT +G+G   +   V+  +   V +    L+F  K E+  YKL +   G  +   V 
Sbjct  629  HRTVTNLGEGKTVYVASVTPIKGFNVTVIPNKLTFNQKNEKMSYKLRIENTGTTKEKNVA  688

Query  538  FGSLTWIDESGKYKVRSPIAVA  603
            FG LTW D   K+ VRSPI V+
Sbjct  689  FGFLTWNDV--KHVVRSPIVVS  708



>ref|XP_007135313.1| hypothetical protein PHAVU_010G118800g [Phaseolus vulgaris]
 gb|ESW07307.1| hypothetical protein PHAVU_010G118800g [Phaseolus vulgaris]
Length=744

 Score =   168 bits (425),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 126/201 (63%), Gaps = 12/201 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TT++ +DNT   I+D       ASPL+MGAG ++PN AL+PGL+YD   Q
Sbjct  548  SPAAIRSAIMTTSDIFDNTKNLIRDIGEGEKPASPLAMGAGHINPNKALDPGLVYDVGAQ  607

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC+MNFT+  I  ITRS +Y    P+ DLNYPSFI  +  N S  ES   +   F
Sbjct  608  DYVNLLCAMNFTQENIKAITRSSSYNCSKPSLDLNYPSFIAFF--NDSSKES--TLTWEF  663

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE-  537
            VRTVTY G+G  ++T  ++  +   V I    L FK K E+  YKL +     +  ++E 
Sbjct  664  VRTVTYFGEGQTSYTASITPIKGFNVSIIPNKLVFKEKNEKQSYKLRI-----EGPKIEG  718

Query  538  FGSLTWIDESGKYKVRSPIAV  600
            FG +TW D   K+ VRSPI V
Sbjct  719  FGYITWTDV--KHVVRSPIVV  737



>ref|XP_002510196.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52383.1| Cucumisin precursor, putative [Ricinus communis]
Length=777

 Score =   168 bits (426),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 126/203 (62%), Gaps = 2/203 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+      +PI+D  +    A+PL MG+GQ++PN AL+PGLIYDA   
Sbjct  570  SPAAIRSAMMTTADTMTQAKEPIRDIDYGRQPATPLDMGSGQINPNKALDPGLIYDANLT  629

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
             Y+N LC++N T+ QI TIT+S N    +P+SDLNYPSF+  +  N   SE+     + +
Sbjct  630  SYINFLCALNLTQKQIQTITKSPNNDCSSPSSDLNYPSFLAYF--NADSSEANLTAVQEY  687

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGD  +T+T +++     +  +    L FK KYE+  YKL +        +V F
Sbjct  688  HRTVTNVGDPVSTYTANLTPINGIKASVVPNKLVFKAKYEKLSYKLSIQGPNPVPEDVVF  747

Query  541  GSLTWIDESGKYKVRSPIAVAPM  609
            G L+W+D  GKY V+SPI V  +
Sbjct  748  GYLSWVDSKGKYVVKSPITVTSL  770



>dbj|BAJ87233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 124/204 (61%), Gaps = 13/204 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTS--ASPLSMGAGQVDPNSALNPGLIYDAT  174
            SPAA+RSAM+TTA+  DNT  PIKD +    +  ASPL+MG+G +DPN ALNPGL+YDA 
Sbjct  547  SPAAVRSAMMTTASAVDNTFAPIKDMSGGNQNGPASPLAMGSGHLDPNRALNPGLVYDAG  606

Query  175  PQDYVNLLCSMNFTKTQILTITRSKN-YTFENPNSDLNYPSFILLYPVNQSRSESGYGIR  351
            P DY+ L+C+MN+T  QI T+ +S         + DLNYPSFI  +     R+       
Sbjct  607  PGDYIKLMCAMNYTTAQIKTVAQSSAPVDCAGASLDLNYPSFIAFFDTTGERA-------  659

Query  352  RTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE  531
              FVRTVT VGDGPA +   V G    +V +    L F  K E+  Y +++    +   +
Sbjct  660  --FVRTVTNVGDGPAGYNATVEGLDGLKVTVVPNRLVFDGKNEKQRYTVMIQVRDDLLPD  717

Query  532  VEF-GSLTWIDESGKYKVRSPIAV  600
            V   GSLTW+D++GKY VRSPI V
Sbjct  718  VVLHGSLTWMDDNGKYTVRSPIVV  741



>dbj|BAJ88882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score =   167 bits (424),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 124/204 (61%), Gaps = 13/204 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTS--ASPLSMGAGQVDPNSALNPGLIYDAT  174
            SPAA+RSAM+TTA+  DNT  PIKD +    +  ASPL+MG+G +DPN ALNPGL+YDA 
Sbjct  547  SPAAVRSAMMTTASAVDNTFAPIKDMSGGNQNGPASPLAMGSGHLDPNRALNPGLVYDAG  606

Query  175  PQDYVNLLCSMNFTKTQILTITRSKN-YTFENPNSDLNYPSFILLYPVNQSRSESGYGIR  351
            P DY+ L+C+MN+T  QI T+ +S         + DLNYPSFI  +     R+       
Sbjct  607  PGDYIKLMCAMNYTTAQIKTVAQSSAPVDCAGASLDLNYPSFIAFFDTTGERA-------  659

Query  352  RTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE  531
              FVRTVT VGDGPA +   V G    +V +    L F  K E+  Y +++    +   +
Sbjct  660  --FVRTVTNVGDGPAGYNATVEGLDGLKVTVVPNRLVFDGKNEKQRYTVMIQVRDDLLPD  717

Query  532  VEF-GSLTWIDESGKYKVRSPIAV  600
            V   GSLTW+D++GKY VRSPI V
Sbjct  718  VVLHGSLTWMDDNGKYTVRSPIVV  741



>ref|XP_002267740.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=762

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 126/205 (61%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    SPAAIRSA-MVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRSA M TT +  DNT  PIK+     + A+PL MGAG ++PN AL PGLIY+AT 
Sbjct  556  SPAAIRSAIMTTTTDSIDNTMNPIKNNLNLNSPATPLDMGAGLINPNKALEPGLIYNATA  615

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            QDY+NLLC M  TK +I  ITR+ ++   NP+ DLNYPSFI  +  N   S     I + 
Sbjct  616  QDYINLLCGMKLTKREIQVITRASSHKCLNPSLDLNYPSFIAYF--NDVGSSPNEQIVQV  673

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RT+T VG+G +++T  ++     +V+++   L F +KYE+  YKL+L        +V 
Sbjct  674  FSRTLTNVGEGGSSYTAKLTPMEGLKVKVEPRKLVFSHKYEKLSYKLILEGPKWMEEDVV  733

Query  538  FGSLTWIDESGKYKVRSPIAVAPMI  612
             G L+W+   GKY VRSPI    +I
Sbjct  734  HGHLSWVSSDGKYVVRSPIVATSII  758



>gb|EYU45081.1| hypothetical protein MIMGU_mgv1a002217mg [Erythranthe guttata]
Length=700

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 123/202 (61%), Gaps = 13/202 (6%)
 Frame = +1

Query  4    PAAIRSAMVTTANPYDNTNKPIKDPAFNFTS-ASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            PAA+RSAM+TT+   DN N  I+D     +  ASPL +GAG +DPN ALNPGL+YD + +
Sbjct  508  PAAVRSAMMTTSYVLDNMNNSIQDLGSQRSQPASPLGIGAGHIDPNKALNPGLVYDTSSE  567

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVN LC+MNFTK QI TITRS   +  NP+ DLNYPSFI     N + S       R F
Sbjct  568  DYVNFLCAMNFTKNQIQTITRSVISSCTNPSLDLNYPSFITFSDANGTNSV------REF  621

Query  361  VRTVTYVGDGPATFTVHVSG-PRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGNQTGEV  534
             RTVTYVG G + +T  +S       V +    + FK K+E+  + L +   + N+T   
Sbjct  622  RRTVTYVGQGSSVYTARISEFYEGLSVRVSPDTIEFKRKFEKKNFTLTIEGKMMNKT---  678

Query  535  EFGSLTWIDESGKYKVRSPIAV  600
             FGSL+W++  GK  VRSPI +
Sbjct  679  -FGSLSWVESKGKIVVRSPIVI  699



>ref|XP_011043530.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=757

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 128/205 (62%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTA+  DNT  PIKD + N   A+P+ +G+G ++PN +L+PGLIYDAT +
Sbjct  555  SPAAIRSALMTTADSLDNTLSPIKDVSNNNLPATPIDIGSGHINPNKSLDPGLIYDATAE  614

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+  LC+MN+T  QI  ITRS ++  +N + DLNYPSFI  +    S S+    +   F
Sbjct  615  DYIRFLCAMNYTNKQIQIITRSSHHDCKNRSLDLNYPSFIAYFESYDSGSKE--KVVHKF  672

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RT+T VG+  +++T  + G    +V ++   L F  ++E+  Y L L    +   ++  
Sbjct  673  QRTLTNVGERMSSYTAKLLGMDGIKVSVEPQKLVFNKEHEKLSYTLTLEGPKSLKEDIVH  732

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            GSL+W+ + GKY VRSPI    + P
Sbjct  733  GSLSWVHDGGKYVVRSPIVATSVTP  757



>ref|XP_007207718.1| hypothetical protein PRUPE_ppa1027200mg [Prunus persica]
 gb|EMJ08917.1| hypothetical protein PRUPE_ppa1027200mg [Prunus persica]
Length=331

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 124/204 (61%), Gaps = 9/204 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAA+RSA+VTTAN +DN+   I D   ++  A+PL+MG G ++PN AL+PGLIYDAT  
Sbjct  135  SPAALRSAIVTTANLFDNSYNRILD-GKSYRKANPLAMGLGLINPNKALDPGLIYDATSH  193

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLCS      QI  ITRS NY+  NP+ +LNYPSFILLY  ++ +        R F
Sbjct  194  DYVNLLCSY-LNSKQISEITRSNNYSCANPSKNLNYPSFILLYGNSKPKV-------RNF  245

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             R VT  G     + V V  P+N  V ++   L F+ K E+  Y +   Y G +   V  
Sbjct  246  ERIVTNAGKDSTRYKVVVKTPKNIVVVVRPEILVFERKNEKISYNVTSQYTGGEYKRVSS  305

Query  541  GSLTWIDESGKYKVRSPIAVAPMI  612
              + W++E+G++ VR+PI V+P I
Sbjct  306  RKIVWVEENGEHTVRNPIVVSPCI  329



>gb|KDO84130.1| hypothetical protein CISIN_1g004809mg [Citrus sinensis]
Length=729

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 130/206 (63%), Gaps = 10/206 (5%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TT++  DNTN  IKD   +   A+P++MGAG ++P+ AL+PGLIYDAT +
Sbjct  525  SPAAIRSAIMTTSDSTDNTNSDIKDIGDDNKPATPIAMGAGHINPDKALDPGLIYDATTE  584

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV+LLC++N T  +I TITRS +      + DLNYPSFI  +  N+S+S       + F
Sbjct  585  DYVSLLCALNLTMKRIQTITRSYSVNCSTSSLDLNYPSFIAFFNANESKS------VQEF  638

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE---  531
             RTVT VG+G +T+T  V+  +     +    L+FK KY +  YKL +    NQ  E   
Sbjct  639  QRTVTNVGEGVSTYTASVTPLKGFNFSVDPDKLTFKGKYAKQSYKLRIEG-PNQMDEETV  697

Query  532  VEFGSLTWIDESGKYKVRSPIAVAPM  609
            V F  L+WI+  GK+ V+SPI V  +
Sbjct  698  VAFCYLSWIETGGKHVVKSPIVVTSL  723



>gb|AFW84453.1| putative subtilase family protein [Zea mays]
Length=770

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 122/208 (59%), Gaps = 9/208 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPI-KDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPA I+SAM+TTA   DNT  PI  D   N T ASPL+MG+GQVDPN+A++PGL++DA P
Sbjct  566  SPAMIKSAMMTTATTADNTGNPITADVVGNTTVASPLAMGSGQVDPNAAMDPGLVFDAGP  625

Query  178  QDYVNLLCSMNFTKTQILTITRS--KNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIR  351
             D+V LLC+ N+TK Q++ ITRS    Y   + +SD+NYPSF+  +  N S         
Sbjct  626  GDFVALLCAANYTKAQVMAITRSSASAYNCSSASSDVNYPSFVAAFGFNASSGA------  679

Query  352  RTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE  531
              F RTVT VG G + +      P N+ V +  G L F    + A +++ +       GE
Sbjct  680  MQFRRTVTNVGVGASVYRASWVSPSNANVSVSPGTLEFSALGQTATFQVGIELTAPTGGE  739

Query  532  VEFGSLTWIDESGKYKVRSPIAVAPMIP  615
              FG + W D SGKY+VR+P  V   +P
Sbjct  740  PTFGDIVWADASGKYRVRTPYVVLSGLP  767



>ref|XP_008444560.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 132/204 (65%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT   IKD   N   A+PL+MG+G V+PN A++P LIYD   Q
Sbjct  561  SPAAIRSAMMTTADVVDNTQTSIKDIGNNNKFATPLAMGSGHVNPNKAVDPDLIYDVGIQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESG-YGIRRT  357
            DYVN+LC++N+T+ QI  ITRS +   ENP+ DLNYPSFI++   N S S++G   I   
Sbjct  621  DYVNVLCALNYTENQIRIITRSDSNNCENPSLDLNYPSFIII--ANSSDSKTGKRKILGE  678

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RT+T +G+  AT+   + G +  +V ++   L FK K ++  ++L +     ++  V 
Sbjct  679  FKRTLTKIGENRATYEAKLRGMKGFKVRVKPRILEFKRKNQKLSFELKIAGSAEES-NVV  737

Query  538  FGSLTWIDESGKYKVRSPIAVAPM  609
            FG L+W +  G++ V+SPI VA M
Sbjct  738  FGYLSWAEVGGRHIVQSPIVVAGM  761



>gb|KDP41713.1| hypothetical protein JCGZ_16120 [Jatropha curcas]
Length=767

 Score =   166 bits (420),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 124/203 (61%), Gaps = 2/203 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  D+T  PI+D       ASPL MGAG+V+P+ AL+PGLIYD    
Sbjct  560  SPAAIRSAMMTTADTADHTEGPIQDIGNENQPASPLDMGAGEVNPSKALDPGLIYDLNST  619

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV LLC +NFT  QI TITRS +    +P+ DLNYP+FI  +  N + S+ G      F
Sbjct  620  DYVKLLCGLNFTANQIKTITRSSSNDCSSPSLDLNYPAFIAFF--NSNESKLGLATVTEF  677

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+  + +T  V+     +V +    L FK+KYE+  YKLV+         V +
Sbjct  678  HRTVTNVGERTSIYTAKVTPMDGLKVSVVPDKLEFKSKYEKLSYKLVVESQSQLRQNVIY  737

Query  541  GSLTWIDESGKYKVRSPIAVAPM  609
            G L+W+   GKY V+SPI V  +
Sbjct  738  GYLSWVHSEGKYVVKSPIVVTSL  760



>ref|XP_002277899.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=769

 Score =   166 bits (419),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 128/205 (62%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTAN  DNT  P+K+ + +  +A  L MGAGQV+PN AL+PGLIY+AT +
Sbjct  561  SPAAIRSALMTTANTLDNTQNPVKEVSNDTVTA--LDMGAGQVNPNKALDPGLIYNATAE  618

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV LLC+M FT  +I  ITRS +Y   NP+ DLNYPSFI  +    S  +    + + F
Sbjct  619  DYVQLLCAMGFTAKEIQKITRS-SYECLNPSLDLNYPSFIAYFNDESSAPDE---LVQVF  674

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G + +T  ++  +  +V++    L F  K+E   Y L L    + T  + +
Sbjct  675  HRTVTNVGEGQSNYTAELTPLKGLKVKVDPEKLVFNCKHETLSYNLTLEGPKSMTEYLVY  734

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            G L+W+ + GKY VRSPI    M P
Sbjct  735  GHLSWVSDGGKYVVRSPIVATRMDP  759



>ref|XP_004514927.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=762

 Score =   165 bits (418),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 124/201 (62%), Gaps = 9/201 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPA IRSA++TT+N +DNT +PIKD      +A+PL+MGAG V+PN AL+PGL+YD   Q
Sbjct  563  SPAFIRSAIMTTSNIFDNTKEPIKDIGNGNNAATPLAMGAGHVNPNRALDPGLVYDVGVQ  622

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++NFT+ QI TITRS +     P+ DLNYPSFI  +    S S       + F
Sbjct  623  DYVNLLCALNFTQQQITTITRSSSNDCSKPSLDLNYPSFIAFFNAKNSSS------TQEF  676

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTY-LGNQTGEVE  537
             RTVT VG+G   +  +++  +   V +    L F  K E+  +KL +      +  +V 
Sbjct  677  HRTVTNVGEGQTIYVANITPIKGLSVSVMPNKLVFNEKNEKLSFKLRIEVPRMTKVKKVA  736

Query  538  FGSLTWIDESGKYKVRSPIAV  600
            FG LTW+D   K+ VRSPI V
Sbjct  737  FGYLTWMDV--KHVVRSPIVV  755



>ref|XP_009359804.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=765

 Score =   165 bits (418),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 125/204 (61%), Gaps = 2/204 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++  DNT  PIKD    + SASPL++GAG V+PN AL+PGLIYDA  +
Sbjct  563  SPAAIRSAMMTTSDILDNTGSPIKDIGDAYQSASPLAIGAGHVNPNKALDPGLIYDAKIE  622

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++N+T  QI TIT+  +     P+ DLNYPSFI  +  N ++  S       F
Sbjct  623  DYVNLLCALNYTNKQIQTITKYASNDCSTPSLDLNYPSFIAFF--NSNKRHSDVQTTHEF  680

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT +G GP+T+   V+  +   V +    L F    ++  + + +         V F
Sbjct  681  RRTVTNLGKGPSTYVASVAPLKGFVVGVVPEKLEFTEVGQKLSFVMSIKGPRVMKEAVVF  740

Query  541  GSLTWIDESGKYKVRSPIAVAPMI  612
            GSL+W++  G++ VRSP+  + +I
Sbjct  741  GSLSWVESEGEHVVRSPVVASSLI  764



>ref|XP_003566210.2| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=754

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 122/201 (61%), Gaps = 11/201 (5%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAA+RSA++TTA   DNT  PIKD   +  +A+PL+MG+G +DP  AL+PGL+YDA P+
Sbjct  552  SPAAVRSALMTTATAADNTFSPIKDMGRDNRAATPLAMGSGHIDPTRALDPGLVYDAGPE  611

Query  181  DYVNLLCSMNFTKTQILTITR--SKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            DY+ L+C+MN+T  QI T+ +  S        + DLNYPSFI  +        SG    +
Sbjct  612  DYIKLMCAMNYTAEQIKTVVKPPSSPVDCSGASLDLNYPSFIAYF------DPSGAAGEK  665

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
            TF R VT VGD PA+++  V G     V +    L F  K+E+  Y +V+   G    +V
Sbjct  666  TFNRVVTNVGDAPASYSAKVKGLSGLTVSVVPSRLVFGGKHEKQRYTVVIR--GQMKDDV  723

Query  535  EF-GSLTWIDESGKYKVRSPI  594
               GSLTW+D++ K+ VRSPI
Sbjct  724  VLHGSLTWVDDARKHTVRSPI  744



>emb|CBI21415.3| unnamed protein product [Vitis vinifera]
Length=822

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 128/205 (62%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTAN  DNT  P+K+ + +  +A  L MGAGQV+PN AL+PGLIY+AT +
Sbjct  362  SPAAIRSALMTTANTLDNTQNPVKEVSNDTVTA--LDMGAGQVNPNKALDPGLIYNATAE  419

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV LLC+M FT  +I  ITRS +Y   NP+ DLNYPSFI  +    S  +    + + F
Sbjct  420  DYVQLLCAMGFTAKEIQKITRS-SYECLNPSLDLNYPSFIAYFNDESSAPDE---LVQVF  475

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G + +T  ++  +  +V++    L F  K+E   Y L L    + T  + +
Sbjct  476  HRTVTNVGEGQSNYTAELTPLKGLKVKVDPEKLVFNCKHETLSYNLTLEGPKSMTEYLVY  535

Query  541  GSLTWIDESGKYKVRSPIAVAPMIP  615
            G L+W+ + GKY VRSPI    M P
Sbjct  536  GHLSWVSDGGKYVVRSPIVATRMDP  560



>ref|XP_002510195.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52382.1| Cucumisin precursor, putative [Ricinus communis]
Length=768

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 126/198 (64%), Gaps = 4/198 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+T+    D+T  PIKD   N   ASPL MGAGQV+P+ AL+PGLIYD    
Sbjct  563  SPAAIRSAMMTSVVTMDHTPGPIKDIGNNNQPASPLDMGAGQVNPSKALDPGLIYDLKST  622

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV LLC++NFT+ QI  ITRS +    +P+ DLNYPSFI  +  N S+S +     + F
Sbjct  623  DYVKLLCALNFTEKQIQIITRSSSNDCSSPSLDLNYPSFIAFFNSNVSKSST----VQEF  678

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G +T+T +++     +V +    L FK K E+  YKLV+         + F
Sbjct  679  HRTVTNVGEGMSTYTANLTPINGLKVSVVPDKLEFKAKNEKLSYKLVIEGPTMLKESIIF  738

Query  541  GSLTWIDESGKYKVRSPI  594
            G L+W+D+ GK+ V+SPI
Sbjct  739  GYLSWVDDEGKHTVKSPI  756



>emb|CDM85158.1| unnamed protein product [Triticum aestivum]
Length=764

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 122/208 (59%), Gaps = 14/208 (7%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNF------TSASPLSMGAGQVDPNSALNPGLI  162
            SPA I+SAM+TTA+  DNT  PI D    F      T+ASPL+MG+GQV PNSA++PGL+
Sbjct  562  SPAMIKSAMMTTASTNDNTLHPITDAGAGFDGNDNATAASPLAMGSGQVSPNSAMDPGLV  621

Query  163  YDATPQDYVNLLCSMNFTKTQILTITRSKN-YTFENPNSDLNYPSFILLYPVNQSRSESG  339
            YDA P+D+V LLCS N+T  QI  ITRS   Y     ++D+NYPSF+  +  N +  E  
Sbjct  622  YDAGPKDFVELLCSANYTNAQIAAITRSSTAYNCSFSSNDVNYPSFVASFGFNATSGE--  679

Query  340  YGIRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLG-  516
                  F RTVT VG GPAT+      P N  V +    L F    ++  +++ +     
Sbjct  680  ----MRFSRTVTSVGSGPATYHASWVSPSNVAVAVTPATLEFSGAGQKISFEVDIKLTAP  735

Query  517  NQTGEVEFGSLTWIDESGKYKVRSPIAV  600
               G+V +G+L W D SGKY+VR+P  +
Sbjct  736  TPGGKVAYGALVWTDTSGKYRVRTPYVI  763



>gb|EEC71868.1| hypothetical protein OsI_04579 [Oryza sativa Indica Group]
Length=557

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 117/202 (58%), Gaps = 7/202 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA   DNT + I D A    +A+PL+MG+G +DPN A +PGL+YDA P 
Sbjct  349  SPAAIRSAMMTTAATLDNTGRSINDMARAGHAATPLAMGSGHIDPNRAADPGLVYDAVPG  408

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNS---DLNYPSFILLYPVNQSRSESGYGIR  351
            DYV L+C+M +  + I  +T+   Y      +   DLNYPSFI  +     RS +     
Sbjct  409  DYVELMCAMGYNLSDIRAVTQWSTYAVNCSGALSPDLNYPSFIAYF---DRRSAAAAAET  465

Query  352  RTFVRTVTYVGDGPATFTVHVSGPRNS-QVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTG  528
            +TFVR VT VG G A++   V G      V +    L F  K E  +Y LVL        
Sbjct  466  KTFVRVVTNVGAGAASYRAKVKGNLGGLAVSVTPSRLVFGKKGETQKYTLVLRGKIKGAD  525

Query  529  EVEFGSLTWIDESGKYKVRSPI  594
            +V  GSLTW+D++GKY VRSPI
Sbjct  526  KVLHGSLTWVDDAGKYTVRSPI  547



>ref|XP_003626594.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES82812.1| subtilisin-like serine protease [Medicago truncatula]
Length=765

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 123/203 (61%), Gaps = 5/203 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++  DNT + I D    +  ASPL++GAG ++PN AL+PGL+YDA  Q
Sbjct  561  SPAAIRSAMMTTSDMLDNTKELITDIGNGYRPASPLALGAGHINPNRALDPGLVYDAGKQ  620

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++NFT+  I  ITRS      NP+ DLNYPSFI  +     +S+    I + F
Sbjct  621  DYVNLLCALNFTQKNIAAITRSSFNNCSNPSLDLNYPSFISFFNNASVKSKV---ITQEF  677

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+ P  +  +++      V +    L FK K E+  YKL +     +  +V F
Sbjct  678  QRTVTNVGEEPTIYVANITPIEGFHVSVIPNKLVFKEKNEKVAYKLRIEGPKMEENKVVF  737

Query  541  GSLTWIDESGKYKVRSPIAVAPM  609
            G LTW D   K+ VRSPI V  +
Sbjct  738  GYLTWTDS--KHNVRSPIVVTSL  758



>ref|XP_004494864.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=777

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 131/207 (63%), Gaps = 10/207 (5%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TT++  DNTN+ IKD   ++  +SPL++GAG ++PN AL+PGLIYDA  Q
Sbjct  570  SPAAIRSAIMTTSDILDNTNELIKDIGNDYKPSSPLALGAGYINPNRALDPGLIYDAQKQ  629

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSES-GYGIRRT  357
            DYVNLLC++NFT+  I+ ITRS      NP+ DLNYPSFI    VN + + + G  +++ 
Sbjct  630  DYVNLLCALNFTRKNIMAITRSFFNNCSNPSLDLNYPSFISF--VNAANNGTVGSKVKQE  687

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE--  531
            F RTVT VG+   T+   ++      V +    L FK + E+  YKL +   G +  E  
Sbjct  688  FHRTVTNVGEEATTYVAKITPIEGFHVNVIPKKLVFKERNEKVTYKLRIE--GRRILEKN  745

Query  532  -VEFGSLTWIDESGKYKVRSPIAVAPM  609
             V FG LTWID   K+ VRSPI V  +
Sbjct  746  KVAFGYLTWIDS--KHIVRSPIVVTSL  770



>ref|XP_010093626.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB54387.1| Subtilisin-like protease [Morus notabilis]
Length=724

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 124/207 (60%), Gaps = 6/207 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPA-FNFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAIRSA++TTANP DNT  PIKD A F+      L  GAG + PN A+ PGLIYDAT 
Sbjct  519  SPAAIRSAIMTTANPLDNTQNPIKDVARFDIPG---LETGAGHIVPNKAVEPGLIYDATA  575

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            +DY+ +LC MN+T  QI  IT+S +   +  + DLNYPSF+  +      S SG  + R 
Sbjct  576  EDYIKVLCGMNYTAKQIQIITKSDHKCVDR-SLDLNYPSFVAYFNGLGGSSPSGK-VVRE  633

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RTVT VG+  +T+   +       V+++   L FK KYE+  YKL L        E  
Sbjct  634  FKRTVTNVGEENSTYKAKLKAMNELNVKVEPEKLVFKKKYEKQSYKLTLEGPKLLKAETS  693

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPT  618
             GSL+W++++GKY VRSPI    + P+
Sbjct  694  LGSLSWVEDTGKYVVRSPILATNIDPS  720



>gb|KEH18578.1| subtilisin-like serine protease [Medicago truncatula]
Length=728

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 118/201 (59%), Gaps = 7/201 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++ +DNT + IKD       A+P + GAG ++PN ALNPGL+YD   Q
Sbjct  527  SPAAIRSAMMTTSDIFDNTKELIKDIGKGNNVATPFAQGAGHINPNKALNPGLVYDVGVQ  586

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++NFT+  I  ITRS       P+ DLNYPSFI  +    S S +     + F
Sbjct  587  DYVNLLCALNFTQKNITIITRSSTNDCSKPSLDLNYPSFIAFFNAANSSSRT----TQEF  642

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKL-VLTYLGNQTGEVE  537
             RT+T VG G + +  H++      V +    L F  K E+  YKL +      Q  EV 
Sbjct  643  HRTITNVGQGKSIYVAHITRIEGFHVRVIPNKLVFNKKNEKLSYKLRIEDARVAQKNEVS  702

Query  538  FGSLTWIDESGKYKVRSPIAV  600
            FG LTW D  GK+ VRSPI V
Sbjct  703  FGYLTWQD--GKHVVRSPIVV  721



>gb|KDP41714.1| hypothetical protein JCGZ_16121 [Jatropha curcas]
Length=724

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 127/204 (62%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT  P++D  F    A+PL MGAGQV+PN AL+PGL+YD    
Sbjct  514  SPAAIRSAMMTTADTTDNTLGPVRDIGFKNAPATPLGMGAGQVNPNKALDPGLVYDVNTS  573

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV LLC++NFT+ QI  IT++ N    +P+ DLNYPSF+  +    + SE        F
Sbjct  574  DYVKLLCALNFTQKQIQIITKTANNDCSSPSLDLNYPSFLGFF---NNESEPNPRKVVEF  630

Query  361  VRTVTYVGDGPATFTVHVSGPRNS-QVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
             RTV  VGD  AT+T  ++   +   V +    L FK++ ++  +KLV+        ++ 
Sbjct  631  HRTVMNVGDAAATYTAKLTQLNHGLNVTVVPNKLVFKSRNQKLSFKLVIEGPRKVDEDIV  690

Query  538  FGSLTWIDESGKYKVRSPIAVAPM  609
            FG L+W++ +GK+ V+SPIAV  +
Sbjct  691  FGYLSWVESNGKHIVKSPIAVTSL  714



>ref|XP_010540359.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=768

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 128/212 (60%), Gaps = 9/212 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPI-----KDPAFNFTSASPLSMGAGQVDPNSALNPGLIY  165
            SP AIRSA++T+++  DN+  PI      D   NF  A+PL+MGAG ++PN AL PGL+Y
Sbjct  554  SPEAIRSAIMTSSDATDNSGNPIGDLGSDDNGDNFLPATPLAMGAGHINPNRALKPGLVY  613

Query  166  DATPQDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYG  345
            DAT QDY+NL+C+MN T  QI  +T S +    +P+ DLNYPSFI  +  N ++      
Sbjct  614  DATTQDYINLMCAMNLTPKQINVVTGSSSPDCSSPSLDLNYPSFIAFFDGNNTKKTEDSS  673

Query  346  IRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQT  525
            + + F RTVT VG+G A +   V+     +VE++   L F  K E+  +++ +   G + 
Sbjct  674  VEKVFKRTVTNVGEGAARYEAKVTAIEGFKVEVKPEKLVFAEKKEKKSFEVRIE--GPRF  731

Query  526  GEVE--FGSLTWIDESGKYKVRSPIAVAPMIP  615
             EV+  FG L W DE GKY VRSPI V  + P
Sbjct  732  MEVDKLFGFLIWEDEEGKYMVRSPIVVTRLSP  763



>ref|XP_010267360.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=772

 Score =   163 bits (412),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 128/200 (64%), Gaps = 3/200 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT KPI +   N   ASPL+MGAGQ++PN AL+PGL+YDA  +
Sbjct  565  SPAAIRSAMMTTADSLDNTLKPITELVDNEGPASPLAMGAGQLNPNKALDPGLVYDANAE  624

Query  181  DYVNLLCSMNFTKTQILTITRSKNYT-FENPNSDLNYPSFILLYPVNQSRSESGYGIRRT  357
            DYV LLC++N+TK +I  ITRS +     NP  DLNYPSFI +   + S       + + 
Sbjct  625  DYVRLLCALNYTKKEIKKITRSSSKADCSNPLLDLNYPSFIAILHEDSSILPLNTKVVKE  684

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTY-LGNQTGEV  534
            F RTVT VG+G AT+   ++     +++++   L FK KY++  +KL L      + G+V
Sbjct  685  FSRTVTNVGEGMATYVAKLAPIDGFKLKVKPDRLVFKEKYQKLSFKLTLKGPRVVENGDV  744

Query  535  EFGSLTWIDESGKYKVRSPI  594
              G L+W +  GK+ VRSPI
Sbjct  745  H-GYLSWEEVGGKHVVRSPI  763



>ref|XP_004156411.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=757

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 133/204 (65%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT   IKD   N   A+PL+MG+G V+PN A++P LIYD   Q
Sbjct  554  SPAAIRSAMMTTADILDNTQTYIKDFGNNNKFATPLAMGSGHVNPNKAIDPDLIYDVGIQ  613

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSES-GYGIRRT  357
            DYVN+LC++N+T+ QI  ITRS +   ENP+ DLNYPSFI++  VN S S++    I   
Sbjct  614  DYVNVLCALNYTENQIRIITRSDSNNCENPSLDLNYPSFIMI--VNSSDSKTRKRKISGE  671

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RT+T +G+  AT+   ++G +  +V ++   L+FK K ++  ++L +     ++  + 
Sbjct  672  FKRTLTKIGEHRATYEAKLTGMKGFKVRVKPNKLNFKRKNQKLSFELKIAGSARES-NIV  730

Query  538  FGSLTWIDESGKYKVRSPIAVAPM  609
            FG L+W +  G + ++SPI V+ M
Sbjct  731  FGYLSWAEVGGGHIIQSPIVVSGM  754



>ref|XP_004143027.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN62450.1| hypothetical protein Csa_2G354760 [Cucumis sativus]
Length=757

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 133/204 (65%), Gaps = 4/204 (2%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT   IKD   N   A+PL+MG+G V+PN A++P LIYD   Q
Sbjct  554  SPAAIRSAMMTTADILDNTQTYIKDFGNNNKFATPLAMGSGHVNPNKAIDPDLIYDVGIQ  613

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSES-GYGIRRT  357
            DYVN+LC++N+T+ QI  ITRS +   ENP+ DLNYPSFI++  VN S S++    I   
Sbjct  614  DYVNVLCALNYTENQIRIITRSDSNNCENPSLDLNYPSFIMI--VNSSDSKTRKRKISGE  671

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE  537
            F RT+T +G+  AT+   ++G +  +V ++   L+FK K ++  ++L +     ++  + 
Sbjct  672  FKRTLTKIGEHRATYEAKLTGMKGFKVRVKPNKLNFKRKNQKLSFELKIAGSARES-NIV  730

Query  538  FGSLTWIDESGKYKVRSPIAVAPM  609
            FG L+W +  G + ++SPI V+ M
Sbjct  731  FGYLSWAEVGGGHIIQSPIVVSGM  754



>ref|XP_008351993.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=764

 Score =   162 bits (411),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 123/204 (60%), Gaps = 2/204 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++  DNT  PIKD    +  ASPL++GAG V+PN AL+PGLIYDA  +
Sbjct  562  SPAAIRSAMMTTSDILDNTGSPIKDIGDAYQPASPLAIGAGHVNPNKALDPGLIYDAKIE  621

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++N+T  QI TIT+  +     P+ DLNYPSFI  +  N +   S       F
Sbjct  622  DYVNLLCALNYTNKQIQTITKYASNNCSTPSLDLNYPSFIAFF--NSNNKHSDVQTTHEF  679

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT +G GP+T+   V+  +   V +    L F    E+  + + +         V F
Sbjct  680  RRTVTNLGRGPSTYVASVTPLKGFVVGVVPEKLEFTEVGEKLSFVMSIKGPRVMKEAVVF  739

Query  541  GSLTWIDESGKYKVRSPIAVAPMI  612
            GSL+W++  G++ VRSP+  + +I
Sbjct  740  GSLSWVESGGEHVVRSPVVASSLI  763



>emb|CBI19502.3| unnamed protein product [Vitis vinifera]
Length=188

 Score =   153 bits (386),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 107/166 (64%), Gaps = 2/166 (1%)
 Frame = +1

Query  97   ASPLSMGAGQVDPNSALNPGLIYDATPQDYVNLLCSMNFTKTQILTITRSKNYTFENPNS  276
            ASPL+MG+G ++PN AL+PG IYD   +D++NLLC++N++  QI  ITRS +YT  +P+ 
Sbjct  15   ASPLAMGSGHINPNKALDPGFIYDVNLEDHINLLCALNYSTKQIQIITRSSSYTCSDPSL  74

Query  277  DLNYPSFILLYPVNQSRSESGYGIRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGN  456
            DLNYPSFI  +  N SRS+S     + F RTVT VG+  +T+   ++G    QV +    
Sbjct  75   DLNYPSFIASFDANDSRSDS--KTVQEFRRTVTNVGEAMSTYNAKLTGMDGFQVSVVPDK  132

Query  457  LSFKNKYEEAEYKLVLTYLGNQTGEVEFGSLTWIDESGKYKVRSPI  594
            L FK+KY++  YKL +         V FGSL+W+D   K+ VRSPI
Sbjct  133  LVFKDKYQKLSYKLRIEGPSLMKETVAFGSLSWVDVEAKHVVRSPI  178



>gb|EPS63009.1| subtilisin-like protease preproenzyme [Genlisea aurea]
Length=716

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 117/200 (59%), Gaps = 5/200 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++  DNT +PIKD   N   A+P  +G+G ++P  ALNPGLIYDA  +
Sbjct  520  SPAAIRSAMMTTSSDLDNTGEPIKDSGINNEFANPFGIGSGHINPTRALNPGLIYDAGTE  579

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+NLLC +NFT  QI TI RSK  +   P+ DLNYPSFI  +  N      G    + F
Sbjct  580  DYINLLCGLNFTARQIKTIARSKPRSCSKPSLDLNYPSFIAYFDGN-----GGGKTVKAF  634

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VGD  + +   +S      + +    L F  K+ +  + + +         V +
Sbjct  635  RRTVTNVGDVDSVYVARLSKFNGVNLTVSPERLEFDEKHRKRRFTVRIEGRKRSINSVIY  694

Query  541  GSLTWIDESGKYKVRSPIAV  600
            G LTW+D +GKY V++PI +
Sbjct  695  GYLTWVDTNGKYTVKTPIVI  714



>ref|XP_008393790.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=766

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 124/204 (61%), Gaps = 2/204 (1%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++  DNT  PIKD    +  ASPL++GAG V+PN AL+PGLIYDA  +
Sbjct  564  SPAAIRSAMMTTSDILDNTGSPIKDIGDAYQPASPLAIGAGHVNPNKALDPGLIYDAKIE  623

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++N+T  QI TIT+  +     P+ DLNYPSFI  +  N ++  S       F
Sbjct  624  DYVNLLCALNYTNKQIQTITKYASNNCSTPSLDLNYPSFIAFF--NSNKKHSDVQTTHEF  681

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT +G GP+T+   ++  +   V +    L F    E+  + + +         V F
Sbjct  682  RRTVTNLGKGPSTYVASLTPLKGFVVGVVPEKLEFTEVGEKLSFVMSIKGPRVMKETVVF  741

Query  541  GSLTWIDESGKYKVRSPIAVAPMI  612
            GSL+W++  G++ VRSP+  + ++
Sbjct  742  GSLSWVESGGEHVVRSPVVASSLM  765



>gb|KEH18574.1| subtilisin-like serine protease [Medicago truncatula]
Length=763

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 119/201 (59%), Gaps = 7/201 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TT+N YDNT + IKD       A+PL++GAG VDPN AL+PGL+YD   Q
Sbjct  562  SPAAIRSAIMTTSNIYDNTKEHIKDIEKGNEVATPLALGAGYVDPNRALDPGLVYDVGVQ  621

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++NFT+  I TITRS       P+ DLNYPSFI  +    S S +     + F
Sbjct  622  DYVNLLCALNFTQKNITTITRSSFNDCSKPSLDLNYPSFIAFFNAGNSSSRA----IQEF  677

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTY-LGNQTGEVE  537
             RTVT VG+G A +   +      +V      L F  K E   YKL +      Q  EV 
Sbjct  678  HRTVTNVGEGQAIYVASIMPVEGYRVSAIPNKLMFNKKNEMLSYKLRIEGPRMTQNNEVA  737

Query  538  FGSLTWIDESGKYKVRSPIAV  600
            FG +TW D  GK+ VRSPI V
Sbjct  738  FGYITWQD--GKHVVRSPIVV  756



>ref|XP_004961962.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=762

 Score =   160 bits (404),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 124/202 (61%), Gaps = 7/202 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPA +RSAM+TTA+  DNT   IKD       ASPL+MG+G +DP+ A++PGL+YDA P+
Sbjct  554  SPAMVRSAMMTTASALDNTGASIKDMGNRNHPASPLAMGSGHIDPSRAVDPGLVYDAAPE  613

Query  181  DYVNLLCSMNFTKTQILTITR-SKNYTFENPNS--DLNYPSFILLYPVNQSRSESGYGIR  351
            DYV L+C+MNFT  QI T+ + S +Y  +   +  DLNYPSFI L+  N   S +G    
Sbjct  614  DYVKLMCAMNFTAEQIRTVAQTSSSYAVDCAGASLDLNYPSFIALF--NPDGSGAGERTF  671

Query  352  RTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-YLGNQTG  528
                     VG  PA+++  V G +   V +    L F  K E+ +Y LV+   + + TG
Sbjct  672  TFTRTVTN-VGGVPASYSAKVVGLKGLTVAVTPDRLVFNGKNEKQKYTLVIRGQMNSNTG  730

Query  529  EVEFGSLTWIDESGKYKVRSPI  594
            +V  GSLTW+D++GKY VRSPI
Sbjct  731  DVLQGSLTWVDDAGKYTVRSPI  752



>gb|KHN06360.1| Subtilisin-like protease [Glycine soja]
Length=902

 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 119/188 (63%), Gaps = 6/188 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TT++ +DNT + IKD A ++  ASPL+MG+G V+PN AL+PGL+YD   Q
Sbjct  522  SPAAIRSAIMTTSDQFDNTKEHIKDIATDYRPASPLAMGSGHVNPNKALDPGLVYDVQVQ  581

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++NFT+  I  ITRS +    NP+ DLNYPSFI  Y  N S +         F
Sbjct  582  DYVNLLCALNFTQQNITIITRSSSNNCSNPSLDLNYPSFIAFYSGNASSNHESRVNNWEF  641

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE-  537
             RTVT VG+G  T+T  V+  +   V +  G L+FK K E   YKL +     +   +E 
Sbjct  642  QRTVTNVGEGRTTYTASVTFIKGFNVSVIPGKLAFKKKSERLSYKLRI-----EGPRIEG  696

Query  538  FGSLTWID  561
            FG LTW D
Sbjct  697  FGHLTWTD  704



>ref|NP_001044922.1| Os01g0868900 [Oryza sativa Japonica Group]
 dbj|BAB89803.1| putative subtilisin-like protease [Oryza sativa Japonica Group]
 dbj|BAF06836.1| Os01g0868900 [Oryza sativa Japonica Group]
Length=760

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 118/202 (58%), Gaps = 6/202 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA   DNT + I D A    +A+PL+MG+G +DPN A +PGL+YDA P 
Sbjct  551  SPAAIRSAMMTTAATLDNTGRSINDMARAGHAATPLAMGSGHIDPNRAADPGLVYDAVPG  610

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNS---DLNYPSFILLYPVNQSRSESGYGIR  351
            DYV L+C+M +  + I  +T+   Y      +   DLNYPSFI  +  ++  + +     
Sbjct  611  DYVELMCAMGYNLSDIRAVTQWSTYAVNCSGASSPDLNYPSFIAYF--DRRSAAAAAAET  668

Query  352  RTFVRTVTYVGDGPATFTVHVSGPRNS-QVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTG  528
            +TFVR VT VG G A++   V G      V +    L F  K E  +Y LVL        
Sbjct  669  KTFVRVVTNVGAGAASYRAKVKGNLGGLAVSVTPSRLVFGKKGETQKYTLVLRGKIKGAD  728

Query  529  EVEFGSLTWIDESGKYKVRSPI  594
            +V  GSLTW+D++GKY VRSPI
Sbjct  729  KVLHGSLTWVDDAGKYTVRSPI  750



>gb|KHN15890.1| Subtilisin-like protease [Glycine soja]
Length=757

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 127/207 (61%), Gaps = 10/207 (5%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TT++ +DNT + IKD A ++  ASPL++G+G  +PN AL+PGL+YD   Q
Sbjct  555  SPAAIRSAIMTTSDIFDNTKELIKDIADDYKPASPLALGSGHANPNKALDPGLVYDVGVQ  614

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC+M+ T+  I  ITRS      NP+ DLNYPSFI  +  N S +ES   +   F
Sbjct  615  DYVNLLCAMSSTQQNISIITRSSTNNCSNPSLDLNYPSFIGFFSSNGSSNES--RVAWEF  672

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVE-  537
             RTVT VG+    ++ +V+  +   V +    L FK K E+  YKL +     +   VE 
Sbjct  673  QRTVTNVGEKQTIYSANVTPIKGFNVSVVPSKLVFKEKNEKLSYKLRI-----EGPMVEG  727

Query  538  FGSLTWIDESGKYKVRSPIAVAPMIPT  618
            FG LTW D   K+ VRSPI V    P+
Sbjct  728  FGYLTWTDM--KHAVRSPIVVTNQAPS  752



>ref|XP_010927458.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=733

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 123/201 (61%), Gaps = 8/201 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTAN  DNT++PI D       A+PL  GAG ++PN A++PGLIYD   Q
Sbjct  535  SPAAIRSAIMTTANVVDNTHQPITDLETGL-PATPLDFGAGHINPNKAMDPGLIYDIGFQ  593

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV+ LC +N++ + +  I R  +YT +  N DLNYPSFI++     S +      RR+F
Sbjct  594  DYVDFLCGLNYSSSDVRIIIRRSDYTCQ-ANLDLNYPSFIVISDRMASIA------RRSF  646

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             R +T V DGP+T+ V V+ P   +V ++   L+F  KY + E+ + L      + +  +
Sbjct  647  KRVLTSVMDGPSTYRVVVAAPVGMRVVVEPHTLTFDGKYSKQEFSVSLEVEVRSSSQGSY  706

Query  541  GSLTWIDESGKYKVRSPIAVA  603
            G L+W +  GK+ VRSPI  A
Sbjct  707  GFLSWSEVGGKHVVRSPIVFA  727



>ref|XP_006847107.1| hypothetical protein AMTR_s00017p00219220 [Amborella trichopoda]
 gb|ERN08688.1| hypothetical protein AMTR_s00017p00219220 [Amborella trichopoda]
Length=757

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 124/206 (60%), Gaps = 15/206 (7%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPI----KDPAFNFTSASPLSMGAGQVDPNSALNPGLIYD  168
            SPAAIRSA++TTAN  DNTNKPI    K+P      A+PL MGAG V+PNSA++PGLIYD
Sbjct  550  SPAAIRSALMTTANLVDNTNKPIGASDKEPG---VPATPLDMGAGHVNPNSAMDPGLIYD  606

Query  169  ATPQDYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGI  348
            A P+DYVNLLC++N+T+ QI TITR  NYT   P+ DLNYP+F+          ++   +
Sbjct  607  AGPEDYVNLLCALNYTQNQIKTITRGSNYTCSKPSLDLNYPAFVAF-------CDNSDQV  659

Query  349  RRTFVRTVTYVGDGPATFTVH-VSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQT  525
             + F R +T VGD  + + V   +G     V++    L F+ +YE+ E+ + +       
Sbjct  660  SQAFKRVLTNVGDRVSVYNVRTTTGLEGFTVKVVPETLIFERRYEKREFSVSIEGKLTSD  719

Query  526  GEVEFGSLTWIDESGKYKVRSPIAVA  603
              V  G + W     K+ VR+P+ VA
Sbjct  720  SPVIHGYVIWEAAYSKHVVRTPVVVA  745



>ref|XP_009405278.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=751

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 120/211 (57%), Gaps = 12/211 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA+  DNT  PIKD A N + A+PL++GAG VDPN AL+PGL+YDA   
Sbjct  547  SPAAIRSAMMTTAHQLDNTGDPIKDSATN-SEATPLAIGAGHVDPNRALHPGLVYDAGEV  605

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV+ LCS  F++ QI+ I    +Y   +P+  LNYPSFI  +P      +  +   ++F
Sbjct  606  DYVSFLCSQGFSQEQIMAIVGVDSYDCSSPSPHLNYPSFIAFFP-----PQPLWPGPQSF  660

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQ--TGEV  534
            +RTVT V   PA +   V  P    V +Q   L F           VLT + N+     V
Sbjct  661  MRTVTNVDTKPAVYRAFVRQPVGFTVSVQPEELVFNATMATNTANFVLTIVQNEEPVTVV  720

Query  535  EFGSLTWIDESGKYKVRSPIAV----APMIP  615
              GSLTW+ E   Y VRSPI V    AP  P
Sbjct  721  SSGSLTWVHEEFTYTVRSPIVVVAERAPAFP  751



>emb|CDM85157.1| unnamed protein product [Triticum aestivum]
Length=603

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 119/203 (59%), Gaps = 12/203 (6%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAF----NFTSASPLSMGAGQVDPNSALNPGLIYD  168
            SPA I+SAM+TTA   DN  +PI D       N T+ASPL+MG+G V PNSA++PGL+YD
Sbjct  403  SPAMIKSAMMTTATTNDNAFRPIMDAGASRKGNSTAASPLAMGSGHVSPNSAMDPGLVYD  462

Query  169  ATPQDYVNLLCSMNFTKTQILTITRSKN-YTFENPNSDLNYPSFILLYPVNQSRSESGYG  345
            A P+D+V LLC+ N+T  QI  IT S   Y   + ++D NYPSF+ ++  N +  E  +G
Sbjct  463  AGPKDFVALLCAANYTGAQIAAITGSSTAYNCSSSSNDANYPSFVAIFGTNATTGEMRFG  522

Query  346  IRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLG-NQ  522
                  RTVT VG  PAT+      P N  V +    L F    ++A +++ +       
Sbjct  523  ------RTVTSVGADPATYHASWDSPSNVVVAVTPATLEFGGAGQKASFEVDIKLTAPTP  576

Query  523  TGEVEFGSLTWIDESGKYKVRSP  591
             GE  +G++ W D SGKY+VR+P
Sbjct  577  GGEPAYGAVMWTDTSGKYRVRTP  599



>gb|KEH42928.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 125/204 (61%), Gaps = 8/204 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TT++ +DN+ + IKD   +  +A+P ++GAG V+PN AL+PGL+YD   Q
Sbjct  560  SPAAIRSAIMTTSDIFDNSKEQIKDIGTD-KAATPFALGAGHVNPNRALDPGLVYDVGVQ  618

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++ +++  I TITRS +     P+ DLNYPSFI  +    S S       + F
Sbjct  619  DYVNLLCALKYSQKNITTITRSSSNDCSKPSLDLNYPSFIAFFNDGNSSSRP----IQEF  674

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLG-NQTGEVE  537
             RTVT VGDG A +   ++  +  +V +   NL F  K E+  YKL +      +  +V 
Sbjct  675  RRTVTNVGDGQAIYVASIAPIKGFRVTVIPNNLVFNEKNEKLSYKLRIEVASMTKLKKVA  734

Query  538  FGSLTWIDESGKYKVRSPIAVAPM  609
            FG LTW+D   K+ VRSPI V  +
Sbjct  735  FGYLTWMDV--KHVVRSPIVVTTL  756



>ref|XP_010028239.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=762

 Score =   155 bits (391),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 123/208 (59%), Gaps = 8/208 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            +PAA+RSA++TTA   DNT  PIKD A     ASPL+ G+G +DPN AL+PGL+YD   +
Sbjct  555  TPAAVRSALMTTAYALDNTGSPIKDAANFDLPASPLATGSGHIDPNKALDPGLVYDLQAE  614

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPN---SDLNYPSFILLYPVNQSRSESGYG-I  348
            DY+NLLC+M +++ +I  I +S +   +  N   S  NYPSFI L+       E+G G +
Sbjct  615  DYLNLLCAMKYSQKKIKIIAKSSHSCRDASNSSRSSFNYPSFIALF----GDGEAGSGAV  670

Query  349  RRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTG  528
             R F R VT VG+  ++++  V G    +V +    L F+ + E+  YKL +        
Sbjct  671  VREFRREVTNVGEDQSSYSARVVGMEGWKVRVDPPRLVFRQRNEKKRYKLTVEGPRVLRD  730

Query  529  EVEFGSLTWIDESGKYKVRSPIAVAPMI  612
             +  GSL+W+D+ GKY VRSPI    ++
Sbjct  731  GLVHGSLSWVDDRGKYIVRSPIVATSLV  758



>gb|KEH18576.1| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score =   154 bits (390),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 120/201 (60%), Gaps = 7/201 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP AIRSAM+TT++ +DNT + IKD   +  +A+P ++GAG ++PN AL+PGL+YD   Q
Sbjct  563  SPTAIRSAMMTTSDIFDNTKELIKDIGKDNIAATPFALGAGHINPNKALDPGLVYDIGVQ  622

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVN LC++NFT+  I  ITRS +    NP+  LNYPSFI  +    S   +     + F
Sbjct  623  DYVNFLCALNFTQKHITAITRSSSNDCSNPSLHLNYPSFIAFFNAGNSSPRTA----QEF  678

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLG-NQTGEVE  537
             RTVT VG+G   +   ++      V +    L F  K E+  Y+L + +    Q  E+ 
Sbjct  679  HRTVTNVGEGQTVYVASITPIEGFNVGVIPNRLVFNEKNEKLSYRLRIEHRRMTQKNELS  738

Query  538  FGSLTWIDESGKYKVRSPIAV  600
            FG LTW  ++GK+ VRSPI V
Sbjct  739  FGYLTW--KNGKHVVRSPIVV  757



>ref|XP_010927456.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=762

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 124/201 (62%), Gaps = 8/201 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTAN +DNT++ I D       A+PL  GAG ++PN A++PGLIYD   Q
Sbjct  567  SPAAIRSAIMTTANVHDNTHQTITDLETGL-PATPLDFGAGHINPNKAMDPGLIYDIGFQ  625

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV+ LC +N++ ++I  I R  +YT +  N DLNYPSFI++     S +      RR+F
Sbjct  626  DYVDFLCGLNYSSSEIRIIIRRNDYTCQA-NLDLNYPSFIVISDRKASIA------RRSF  678

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             R +T V DGP+T+ V V+ P   +V ++   LSF  KY + ++ + +      + +  +
Sbjct  679  NRVLTSVIDGPSTYRVVVAAPVGMKVVVEPQTLSFDGKYSKQKFSVSVEVQVGSSSQGSY  738

Query  541  GSLTWIDESGKYKVRSPIAVA  603
            G L+W +  G++ VRSPI  A
Sbjct  739  GFLSWSEVGGRHVVRSPIVFA  759



>ref|XP_010112177.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32843.1| Subtilisin-like protease [Morus notabilis]
Length=767

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 125/198 (63%), Gaps = 3/198 (2%)
 Frame = +1

Query  4    PAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQD  183
            PAAIRSA++T+++ YDNT  PIKD  FN   A+PL++G+G ++PN AL+PGLIYD   QD
Sbjct  561  PAAIRSALMTSSDVYDNTLSPIKDIGFNNQPATPLAIGSGHINPNKALDPGLIYDVEIQD  620

Query  184  YVNLLCSMNFTKTQILTITRSKNYT-FENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            YVN+LC++N+T   I  IT+S +      P+ DLNYPSFI  +  N S+S++     + F
Sbjct  621  YVNVLCALNYTVEHIKVITKSSSLVDCSKPSLDLNYPSFIAFFNANDSKSDA--KTVKDF  678

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             RTVT VG+G +T+   V+     +V +    L FK K E+ ++KL +         V F
Sbjct  679  QRTVTNVGEGKSTYIASVTSMEGLKVNVVPKKLVFKEKNEKKKFKLSIEGPRMMKQRVVF  738

Query  541  GSLTWIDESGKYKVRSPI  594
            G LTW+D   K+ VRSPI
Sbjct  739  GYLTWVDNDNKHVVRSPI  756



>gb|KEH18575.1| subtilisin-like serine protease [Medicago truncatula]
Length=762

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 122/204 (60%), Gaps = 7/204 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TT++  DNT + IKD   +  +A+P ++GAG V+PN AL+PGLIYD   Q
Sbjct  564  SPAAIRSAIMTTSDIIDNTKEHIKDIGNDNKAATPFALGAGHVNPNRALDPGLIYDVGVQ  623

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++++++  I  ITRS +     P+ DLNYPSFI  +    S S +     + F
Sbjct  624  DYVNLLCALSYSQKNITAITRSSSNDCSEPSLDLNYPSFIAFFDNGNSSSRT----TQEF  679

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKL-VLTYLGNQTGEVE  537
             RT+T VG+G   +   ++      V +    L F  K E+  YKL +      +  +V 
Sbjct  680  HRTITNVGEGETVYVSSITQVEGFHVSVIPNKLVFNEKNEKLSYKLRIEVARTTKMKKVA  739

Query  538  FGSLTWIDESGKYKVRSPIAVAPM  609
            FG LTW+D   K+ VRSPI VA +
Sbjct  740  FGYLTWMDT--KHVVRSPIVVAIL  761



>ref|XP_008793983.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=769

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 120/201 (60%), Gaps = 8/201 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSA++TTA+  D T++PI D       A+PL  GAG ++PN A +PGLIYD   Q
Sbjct  571  SPAAIRSAIMTTADVLDTTHQPITDLETGLP-ATPLDFGAGHINPNKAKDPGLIYDIGLQ  629

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYV+ LC +N++ ++I  ITR  +YT +  N DLNYPSFI++     S +      RR+F
Sbjct  630  DYVDFLCGLNYSSSEIRVITRRSDYTCQA-NLDLNYPSFIVVSDRKASIA------RRSF  682

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEVEF  540
             R +T V DGP+ +   V+ P   +V ++   L+F  KY   E+ + +        +  +
Sbjct  683  RRVLTSVMDGPSIYRAMVAAPAGMRVVVEPQTLAFDGKYSRQEFSVSVEVEVGSDSQGSY  742

Query  541  GSLTWIDESGKYKVRSPIAVA  603
            G L+W +  GK+ VRSP+A A
Sbjct  743  GFLSWSEVGGKHVVRSPMAFA  763



>ref|XP_006495263.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=785

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 124/216 (57%), Gaps = 26/216 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSAM+TTA+  DN    I D +    + +PL  GAG ++PN A++PGL+YD   Q
Sbjct  580  SSAAIRSAMMTTADVLDNAYDMITDISTG-AAGTPLDFGAGHINPNKAMDPGLVYDIEIQ  638

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC+MN+T  QI  +T + ++T E+ N DLNYPSFI++  +N S + S      TF
Sbjct  639  DYLNYLCAMNYTSQQIRIVTGTSDFTCEHGNLDLNYPSFIII--LNNSNTAS-----FTF  691

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL------------  504
             R +T V D  +T+T  V  P    V ++   LSF  K+ +AE+ L +            
Sbjct  692  KRVLTNVADTRSTYTAAVKAPVGMTVTLEPATLSFAGKFSKAEFNLTVNINLGNAFSPKS  751

Query  505  TYLGNQTGEVEFGSLTWIDESGKYKVRSPIAVAPMI  612
             +LGN      FG LTW +  GK+ VRSPI  A +I
Sbjct  752  NFLGN------FGYLTWYEVKGKHTVRSPIVAALLI  781



>ref|XP_003548151.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=750

 Score =   152 bits (383),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 121/204 (59%), Gaps = 9/204 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TT++ +DNT   IKD   ++  A+PL+MGAG V+PN AL+PGL+YD   Q
Sbjct  551  SVAAIRSAIMTTSDMFDNTMGLIKDVGDDYKPATPLAMGAGHVNPNRALDPGLVYDVGVQ  610

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++ +T+  I  IT + +     P+ DLNYPSFI  +  N S +       + F
Sbjct  611  DYVNLLCALGYTQKNITVITGTSSNDCSKPSLDLNYPSFIAFFKSNSSSTT------QEF  664

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTY-LGNQTGEVE  537
             RTVT VG+G   +   V+  +   V +    L FK K E+  YKL +   +  +   V 
Sbjct  665  ERTVTNVGEGQTIYVASVTPVKGYHVSVIPKKLVFKEKNEKQSYKLRIEGPIKKKEKNVA  724

Query  538  FGSLTWIDESGKYKVRSPIAVAPM  609
            FG LTW D   K+ +RSPI V+ +
Sbjct  725  FGYLTWTDL--KHVIRSPIVVSTL  746



>gb|KDO37430.1| hypothetical protein CISIN_1g039556mg, partial [Citrus sinensis]
Length=515

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 120/213 (56%), Gaps = 26/213 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSAM+TTA   DN N  I D      S +PL  G+G V+PN A++PGL+YD   Q
Sbjct  311  SSAAIRSAMMTTAYLLDNANSTITDIRIG-VSGTPLDFGSGHVNPNKAMDPGLVYDIEVQ  369

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC++N+T  QI  +T + N+T EN N DLNYPSF+++  +N ++S S      TF
Sbjct  370  DYINYLCALNYTSLQIRVLTGTSNFTCENANLDLNYPSFMII--LNNTKSAS-----FTF  422

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-----------  507
               +T V D  +  T  V  P   +V +Q    +F  KY +AE+ L L+           
Sbjct  423  KWVLTNVDDTSSVNTAAVKAPAGMKVVVQPETATFDRKYSKAEFNLTLSIDLGITVSPKC  482

Query  508  -YLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
             YLGN      FG LTW +  GK+ VRSPI  A
Sbjct  483  NYLGN------FGYLTWHENIGKHMVRSPIVSA  509



>gb|KHN15886.1| Subtilisin-like protease [Glycine soja]
Length=712

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 120/204 (59%), Gaps = 9/204 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TT++ +DNT   IKD   ++  A+PL+MGAG V+PN AL+PGL+YD   Q
Sbjct  513  SVAAIRSAIMTTSDMFDNTMGLIKDVGDDYKPATPLAMGAGHVNPNRALDPGLVYDVGVQ  572

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++ +T+  I  IT + +     P+ DLNYPSFI  +  N S +       + F
Sbjct  573  DYVNLLCALGYTQKNITVITGTSSNDCSKPSLDLNYPSFIAFFKSNSSSTT------QEF  626

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTY-LGNQTGEVE  537
             RTVT VG+G   +   V+  +   V +    L FK K E+  YKL +      +   V 
Sbjct  627  ERTVTNVGEGQTIYVASVTPVKGYHVSVIPKKLVFKEKNEKQSYKLRIEGPRKKKEKNVA  686

Query  538  FGSLTWIDESGKYKVRSPIAVAPM  609
            FG LTW D   K+ +RSPI V+ +
Sbjct  687  FGYLTWTDL--KHVIRSPIVVSTL  708



>ref|XP_002511772.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF50441.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=744

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 120/216 (56%), Gaps = 25/216 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKD-PAFNFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPAAI+SA++TTA   DN N PI D  A N  SA+P + G+G VDP SA +PGLIYD T 
Sbjct  544  SPAAIKSALMTTAYVLDNKNLPIADLGANNSASATPFAFGSGHVDPESASDPGLIYDITT  603

Query  178  QDYVNLLCSMNFTKTQILTITRSKNYTFENPN------SDLNYPSFILLYPVNQSRSESG  339
            +DY+N LCS+N+T  Q+  ++R +   F  PN       DLNYPSF + +  N       
Sbjct  604  EDYLNYLCSLNYTSAQVFQVSRRR---FSCPNNTIIQPGDLNYPSFAVNFAGNAQN----  656

Query  340  YGIRRTFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGN  519
              I +TF RTVT VG    T+ V V  P      +    L F+N  E+  YK+    L  
Sbjct  657  --ISKTFKRTVTNVGTPSCTYAVQVQEPNGVSTVVNPKILRFRNSGEKLSYKVTFIGLKE  714

Query  520  QTGEV--EFGSLTWIDESGKYKVRSPIAVAPMIPTW  621
            +       FGSL W+  SGKYKV+SPIAV     TW
Sbjct  715  RDSRESHSFGSLVWV--SGKYKVKSPIAV-----TW  743



>ref|XP_006487124.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=793

 Score =   150 bits (378),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 122/213 (57%), Gaps = 26/213 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSAM+TTA+  DN    I D +    + +PL  GAG ++PN A++PGL+YD   Q
Sbjct  580  SSAAIRSAMMTTADVLDNAYDMITDISTG-AAGTPLDFGAGHINPNKAMDPGLVYDIEIQ  638

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC+MN+T  QI  +T + ++T E+ N DLNYPSFI++  +N S + S      TF
Sbjct  639  DYLNYLCAMNYTSQQIRIVTGTSDFTCEHGNLDLNYPSFIII--LNNSNTAS-----FTF  691

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL------------  504
             R +T V D  +T+T  V  P    V ++   LSF  K+ +AE+ L +            
Sbjct  692  KRVLTNVADTRSTYTAAVKAPVGMTVTLEPATLSFAGKFSKAEFNLTVNINLGNAFSPKS  751

Query  505  TYLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
             +LGN      FG LTW +  GK+ VRSPI  A
Sbjct  752  NFLGN------FGYLTWYEVKGKHTVRSPIVSA  778



>ref|XP_006487123.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=778

 Score =   149 bits (377),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 123/213 (58%), Gaps = 26/213 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTA+  DN    I D +    + +PL  GAG ++PN A++PGL+YD   Q
Sbjct  571  SSAAIRSALMTTADVLDNAYGMITDKSTG-VAGTPLDFGAGHINPNKAMDPGLVYDIEVQ  629

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC++N+T  QI  +T + ++T +  N DLNYPSFI++  +N + + S      TF
Sbjct  630  DYINYLCALNYTTQQIRVLTGTSDFTCQYANLDLNYPSFIII--LNNTNTAS-----FTF  682

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL------------  504
             R +T V D  + +T  V  P   +V++Q   LSF  KY +AE+ L +            
Sbjct  683  KRVLTNVADTKSAYTAAVKAPAGMKVKVQPATLSFAGKYSKAEFSLTVNINLGSAVSPKS  742

Query  505  TYLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
             +LGN      FG LTW D +GK+ VRSPI  A
Sbjct  743  NFLGN------FGYLTWYDVNGKHLVRSPIVSA  769



>ref|XP_008357385.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   149 bits (376),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 117/194 (60%), Gaps = 6/194 (3%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TT++  DNT  PIKD  +    ASPL++GAG V+PN AL+PGL+YD    
Sbjct  562  SPAAIRSAMMTTSDILDNTGSPIKDIGYANQPASPLAIGAGHVNPNKALDPGLLYDVNID  621

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRT-  357
            DYVNLLC++N+T  QI TIT+S +     P+ DLNYPSFI  +  N S S+    ++ T 
Sbjct  622  DYVNLLCALNYTNKQIQTITKSXSNNCSTPSLDLNYPSFIAFFNSNDSNSD----VQSTH  677

Query  358  -FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTV  +G G +T+   V+  +   V +    L FK + E+  + L +         V
Sbjct  678  EFRRTVXNIGKGLSTYVASVTPLKGFVVGVVPKKLEFKEEGEKLSFVLSIKGPRVMKEAV  737

Query  535  EFGSLTWIDESGKY  576
             FG L+W++  G++
Sbjct  738  VFGYLSWVESGGQH  751



>emb|CBI32395.3| unnamed protein product [Vitis vinifera]
Length=687

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 124/219 (57%), Gaps = 27/219 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAA+RSAM+TTA   DNT  PI D      + +PL  GAG ++PN A++PGL+YD   Q
Sbjct  483  SPAAVRSAMMTTAYLLDNTQGPIMDMTTG-VAGTPLDFGAGHINPNMAMDPGLVYDIEAQ  541

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC +N+T  QI  ITR   ++ +  N DLNYPSF++L  +N + + S      TF
Sbjct  542  DYINFLCGLNYTSKQIKIITRRSKFSCDQANLDLNYPSFMVL--LNNTNTTS-----YTF  594

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-----------  507
             R +T V +  + +   V  P   +V +Q   +SF  KY +AE+ + +            
Sbjct  595  KRVLTNVENTHSVYHASVKLPSGMKVSVQPSVVSFAGKYSKAEFNMTVEINLGDARPQSD  654

Query  508  YLGNQTGEVEFGSLTWIDESGKYKVRSPI--AVAPMIPT  618
            Y+GN      FG LTW + +G + V SPI  A+AP+I T
Sbjct  655  YIGN------FGYLTWWEANGTHVVSSPIVSAIAPIIRT  687



>ref|XP_006422999.1| hypothetical protein CICLE_v10027863mg [Citrus clementina]
 gb|ESR36239.1| hypothetical protein CICLE_v10027863mg [Citrus clementina]
Length=778

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 122/213 (57%), Gaps = 26/213 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TTA+  DN    I D +    + +PL  GAG ++PN A++PGL+YD   Q
Sbjct  571  SSAAIRSALMTTADVLDNAYGMITDKSTG-VAGTPLDFGAGHINPNKAMDPGLVYDIEVQ  629

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC++N+T  QI  +T + +YT +  N DLNYPSFI++  +N + + S      TF
Sbjct  630  DYINYLCALNYTSQQIRVLTGTSDYTCQYANLDLNYPSFIII--LNNTNTAS-----FTF  682

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL------------  504
             R +T V D  + +T  V  P    V++Q   LSF  KY +AE+ L +            
Sbjct  683  KRVLTNVADTKSAYTAAVKAPAGMTVKVQPATLSFAGKYSKAEFSLTVNINLGSAVSPKS  742

Query  505  TYLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
             +LGN      FG LTW + +GK+ VRSPI  A
Sbjct  743  NFLGN------FGYLTWYEVNGKHLVRSPIVSA  769



>ref|XP_002282304.3| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=732

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 123/219 (56%), Gaps = 27/219 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA   DNT  PI D      + +PL  GAG ++PN A++PGL+YD   Q
Sbjct  528  SPAAIRSAMMTTAYLLDNTQGPIMDMTTG-VAGTPLDFGAGHINPNMAMDPGLVYDIEAQ  586

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC +N+T  QI  ITR   ++ +  N DLNYPSF++L  +N + + S      TF
Sbjct  587  DYINFLCGLNYTSKQIKIITRRSKFSCDQANLDLNYPSFMVL--LNNTNTTS-----YTF  639

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-----------  507
             R +T V +    +   V  P   +V +Q   +SF  KY +AE+ + +            
Sbjct  640  KRVLTNVENTHTVYHASVKQPSGMKVSVQPSIVSFAGKYSKAEFNMTVEINLGDARPQSD  699

Query  508  YLGNQTGEVEFGSLTWIDESGKYKVRSPI--AVAPMIPT  618
            Y+GN      FG LTW + +G + V SPI  A+AP+I T
Sbjct  700  YIGN------FGYLTWWEANGTHVVSSPIVSAIAPIIRT  732



>ref|XP_006422997.1| hypothetical protein CICLE_v10027850mg [Citrus clementina]
 gb|ESR36237.1| hypothetical protein CICLE_v10027850mg [Citrus clementina]
Length=793

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 121/213 (57%), Gaps = 26/213 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSAM+TTA+  DN    I D +    + +PL  GAG ++PN A++PGL+YD   Q
Sbjct  580  SSAAIRSAMMTTADVLDNAYDMITDISTG-AAGTPLDFGAGHINPNKAMDPGLVYDIEIQ  638

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC+MN+T  QI  +T + ++T E+ N DLNYPSFI++  +N S + S      TF
Sbjct  639  DYLNYLCAMNYTSQQIRVVTGTSDFTCEHGNLDLNYPSFIII--LNNSNTAS-----FTF  691

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL------------  504
             R +T V D  +T+T  V  P    V ++   LSF  K+ +AE+ L +            
Sbjct  692  KRVLTNVADTRSTYTAAVKAPVGMTVTVEPATLSFAGKFSKAEFSLTVNINLGNAFSPKS  751

Query  505  TYLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
             +LGN      FG LTW +   K+ VRSPI  A
Sbjct  752  NFLGN------FGYLTWYEVKRKHTVRSPIVAA  778



>gb|KDO59723.1| hypothetical protein CISIN_1g046220mg [Citrus sinensis]
Length=774

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 122/213 (57%), Gaps = 26/213 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSAM+TTA+  DN    I D +    + +PL  GAG ++PN A++PGL+YD   Q
Sbjct  569  SSAAIRSAMMTTADVLDNAYDMIADISTG-VAGTPLDFGAGHINPNKAMDPGLVYDIEVQ  627

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC++N+T  QI  +T + N+T E+ N DLNYPSFI++  +N + + S      TF
Sbjct  628  DYINYLCALNYTSQQIRVLTGTSNFTCEHGNLDLNYPSFIII--LNNTNTAS-----FTF  680

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL------------  504
             R +T V    + +T  V  P    V +Q   LSF  K+ +AE+ L +            
Sbjct  681  KRVLTNVAVTRSVYTAVVKAPAGMTVAVQPVTLSFDEKHSKAEFNLTVNINLGNDVSPKR  740

Query  505  TYLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
             YLGN      FG LTW + +GK++VRSPI  A
Sbjct  741  NYLGN------FGYLTWFEVNGKHQVRSPIVSA  767



>ref|XP_010647741.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=732

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 124/219 (57%), Gaps = 27/219 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAA+RSAM+TTA   DNT  PI D      + +PL  GAG ++PN A++PGL+YD   Q
Sbjct  528  SPAAVRSAMMTTAYLLDNTQGPIMDMTTG-VAGTPLDFGAGHINPNMAMDPGLVYDIEAQ  586

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC +N+T  QI  ITR   ++ +  N DLNYPSF++L  +N + + S      TF
Sbjct  587  DYINFLCGLNYTSKQIKIITRRSKFSCDQANLDLNYPSFMVL--LNNTNTTS-----YTF  639

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-----------  507
             R +T V +  + +   V  P   +V +Q   +SF  KY +AE+ + +            
Sbjct  640  KRVLTNVENTHSVYHASVKLPSGMKVSVQPSVVSFAGKYSKAEFNMTVEINLGDARPQSD  699

Query  508  YLGNQTGEVEFGSLTWIDESGKYKVRSPI--AVAPMIPT  618
            Y+GN      FG LTW + +G + V SPI  A+AP+I T
Sbjct  700  YIGN------FGYLTWWEANGTHVVSSPIVSAIAPIIRT  732



>ref|XP_006487072.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=775

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 122/213 (57%), Gaps = 26/213 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSAM+TTA+  DN    I D +    + +PL  GAG ++PN A++PGL+YD   Q
Sbjct  570  SSAAIRSAMMTTADVLDNAYDMIADISTG-VAGTPLDFGAGHINPNKAMDPGLVYDIEVQ  628

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC++N+T  QI  +T + N+T E+ N DLNYPSFI++  +N + + S      TF
Sbjct  629  DYINYLCALNYTSQQIRVLTGTSNFTCEHGNLDLNYPSFIII--LNNTNTAS-----FTF  681

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL------------  504
             R +T V    + +T  V  P    V +Q   LSF  K+ +AE+ L +            
Sbjct  682  KRVLTNVAVTRSVYTAVVKAPAGMTVAVQPVTLSFDEKHSKAEFNLTVNINLGNDVSPKR  741

Query  505  TYLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
             YLGN      FG LTW + +GK++VRSPI  A
Sbjct  742  NYLGN------FGYLTWFEVNGKHQVRSPIVSA  768



>gb|KCW63764.1| hypothetical protein EUGRSUZ_G01428 [Eucalyptus grandis]
Length=665

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 122/212 (58%), Gaps = 25/212 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA   DNTN+PI D      S +PL  GAG +DP  A +PGLIYD  P+
Sbjct  465  SPAAIRSAMMTTAYILDNTNEPIIDMTTQ-ASGTPLDFGAGHIDPEKASDPGLIYDIEPE  523

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVN LC MN++  QI  I+   N++  +   D+NYPSF+++  +N++ + S      TF
Sbjct  524  DYVNFLCGMNYSANQIKIISGRSNFSCASATLDINYPSFMVI--LNKTNTTS-----VTF  576

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL-----------T  507
             R +T V DGPA++   V+ P + +   +   L F +KY+ AE+ L +            
Sbjct  577  KRVLTNVADGPASYQATVTTPSSMKATAKPSELWFTSKYDRAEFNLTVEISLEGSIPRRN  636

Query  508  YLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
            Y+GN      +G ++W + +G   VRSPI  A
Sbjct  637  YIGN------YGYISWKEINGTRVVRSPIVSA  662



>gb|KCW63766.1| hypothetical protein EUGRSUZ_G01430 [Eucalyptus grandis]
Length=682

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 122/212 (58%), Gaps = 25/212 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA   DNTN+PI D      S +PL  GAG +DP  A +PGLIYD  P+
Sbjct  482  SPAAIRSAMMTTAYILDNTNEPIIDMTTQ-ASGTPLDFGAGHIDPEKASDPGLIYDIEPE  540

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVN LC MN++  QI  I+   N++  +   D+NYPSF+++  +N++ + S      TF
Sbjct  541  DYVNFLCGMNYSANQIKIISGRSNFSCASATLDINYPSFMVI--LNKTNTTS-----VTF  593

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL-----------T  507
             R +T V DGPA++   V+ P + +   +   L F +KY+ AE+ L +            
Sbjct  594  KRVLTNVADGPASYRATVTTPSSMKAAAKPSELWFTSKYDRAEFNLTVEISLEGSIPRRN  653

Query  508  YLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
            Y+GN      +G ++W + +G   VRSPI  A
Sbjct  654  YIGN------YGYISWKEINGTRVVRSPIVSA  679



>ref|XP_004972264.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 123/202 (61%), Gaps = 8/202 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDP-AFNFTSASPLSMGAGQVDPNSALNPGLIYDATP  177
            SPA I+SAM+TTA   DNT+ PI D  + N T ASPL+MG+G VDPN+A++PGL++DA P
Sbjct  564  SPAMIKSAMMTTATTTDNTDSPITDAGSGNATIASPLAMGSGHVDPNAAMDPGLVFDAGP  623

Query  178  QDYVNLLCSMNFTKTQILTITRSK-NYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRR  354
            +D+V LLC+ N+T  QI+ ITRS   Y   + +SD+NYPSF+ ++  N + S+       
Sbjct  624  EDFVALLCAANYTNAQIMAITRSSAAYNCSSASSDVNYPSFVAIFGANATSSD------M  677

Query  355  TFVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGEV  534
             F RTVT VG G   +      PRN  V +    L F    + A +++ +       GE 
Sbjct  678  RFKRTVTNVGAGSTVYHASWVSPRNVDVSVSPATLEFSTVGQTASFEVDIKLSAPTGGEP  737

Query  535  EFGSLTWIDESGKYKVRSPIAV  600
             FG++ W D SGKY+VR+P  V
Sbjct  738  AFGAVVWADVSGKYRVRTPYVV  759



>gb|KCW63761.1| hypothetical protein EUGRSUZ_G01423 [Eucalyptus grandis]
Length=740

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 121/212 (57%), Gaps = 25/212 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA    NTN+ I D      S +PL  GAG +DP  A +PGLIYD  P+
Sbjct  540  SPAAIRSAMMTTAYILGNTNETIIDMTTR-ASGTPLDFGAGHIDPEKASDPGLIYDIEPE  598

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVN LC MN++  QI  I+R  N++  +   D+NYPSFI++  +N + + S      TF
Sbjct  599  DYVNFLCGMNYSANQIKIISRRLNFSCASATLDINYPSFIVI--LNNTNTTSA-----TF  651

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL-----------T  507
             R +T V DGPA++   V+ P + +   +   L F +KY+ AE+ L +            
Sbjct  652  KRILTNVADGPASYQATVTTPSSMKATAEPSELWFTSKYDRAEFNLTVEISLEGSIPQSN  711

Query  508  YLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
            Y+GN      +G +TW + +G + VRSPI  A
Sbjct  712  YIGN------YGYITWKEINGTHVVRSPIVSA  737



>gb|KCW63767.1| hypothetical protein EUGRSUZ_G01432 [Eucalyptus grandis]
Length=682

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 121/212 (57%), Gaps = 25/212 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA   DN N+ I D      S +PL +GAG +DP  AL+PGLIYD  P+
Sbjct  482  SPAAIRSAMMTTAYILDNANETIIDMTTQ-ASGTPLDLGAGHIDPEKALDPGLIYDIVPE  540

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC MN++  +I  I+   N++  +   D+NYPSF+++  +N + + S      TF
Sbjct  541  DYINFLCGMNYSAKKIKIISGRSNFSCASATLDINYPSFMVI--LNNTNTTS-----VTF  593

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL-----------T  507
             R +T V DGPA++   V  P + +   +   L F +KY+ AE+ L +            
Sbjct  594  KRVLTNVADGPASYRATVMTPSSMKATAKPSELCFTSKYDRAEFNLTVEISLEGSIPRSN  653

Query  508  YLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
            Y+GN      +G +TW + +G + VRSPI  A
Sbjct  654  YIGN------YGYITWKEINGTHVVRSPIVSA  679



>ref|XP_010068464.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=763

 Score =   146 bits (369),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 122/212 (58%), Gaps = 25/212 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA   DNTN+PI D      S +PL  GAG +DP  A +PGLIYD  P+
Sbjct  563  SPAAIRSAMMTTAYILDNTNEPIIDMTTQ-ASGTPLDFGAGHIDPEKASDPGLIYDIEPE  621

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVN LC MN++  QI  I+   N++  +   D+NYPSF+++  +N++ + S      TF
Sbjct  622  DYVNFLCGMNYSANQIKIISGRSNFSCASATLDINYPSFMVI--LNKTNTTS-----VTF  674

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL-----------T  507
             R +T V DGPA++   V+ P + +   +   L F +KY+ AE+ L +            
Sbjct  675  KRVLTNVADGPASYRATVTTPSSMKAAAKPSELWFTSKYDRAEFNLTVEISLEGSIPRRN  734

Query  508  YLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
            Y+GN      +G ++W + +G   VRSPI  A
Sbjct  735  YIGN------YGYISWKEINGTRVVRSPIVSA  760



>ref|XP_010647877.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=693

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 123/219 (56%), Gaps = 27/219 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA   DNT  PI D      + +PL  GAG ++PN A++PGL+YD   Q
Sbjct  489  SPAAIRSAMMTTAYLLDNTQGPIMDMTTG-VAGTPLDFGAGHINPNMAMDPGLVYDIEAQ  547

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DY+N LC +N+T  QI  ITR   ++ +  N DLNYPSF++L  +N + + S      TF
Sbjct  548  DYINFLCGLNYTSKQIKIITRRSKFSCDQANLDLNYPSFMVL--LNNTNTTS-----YTF  600

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLT-----------  507
             R +T V D  + +   V  P   +V +    +SF  +Y +AE+ + +            
Sbjct  601  KRVLTNVEDTYSVYQASVKQPSGMKVTVLPSTVSFTGRYSKAEFNMTVEINLGDAGPQSD  660

Query  508  YLGNQTGEVEFGSLTWIDESGKYKVRSPI--AVAPMIPT  618
            Y+GN      +G LTW + +G + VRSPI  A+AP I T
Sbjct  661  YIGN------YGYLTWREVNGTHVVRSPIVSAIAPYIRT  693



>ref|XP_010068463.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=746

 Score =   146 bits (368),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 122/212 (58%), Gaps = 25/212 (12%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SPAAIRSAM+TTA   DNTN+PI D      S +PL  GAG +DP  A +PGLIYD  P+
Sbjct  546  SPAAIRSAMMTTAYILDNTNEPIIDMTTQ-ASGTPLDFGAGHIDPEKASDPGLIYDIEPE  604

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVN LC MN++  QI  I+   N++  +   D+NYPSF+++  +N++ + S      TF
Sbjct  605  DYVNFLCGMNYSANQIKIISGRSNFSCASATLDINYPSFMVI--LNKTNTTS-----VTF  657

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVL-----------T  507
             R +T V DGPA++   V+ P + +   +   L F +KY+ AE+ L +            
Sbjct  658  KRVLTNVADGPASYQATVTTPSSMKATAKPSELWFTSKYDRAEFNLTVEISLEGSIPRRN  717

Query  508  YLGNQTGEVEFGSLTWIDESGKYKVRSPIAVA  603
            Y+GN      +G ++W + +G   VRSPI  A
Sbjct  718  YIGN------YGYISWKEINGTRVVRSPIVSA  743



>ref|XP_003529873.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=753

 Score =   146 bits (368),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 117/204 (57%), Gaps = 9/204 (4%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            S AAIRSA++TT++ +DNT   IKD    +  ASPL++GAG V+PN  L+PGL+YD   Q
Sbjct  554  SVAAIRSAIMTTSDMFDNTMGLIKDIGDGYKQASPLALGAGHVNPNRGLDPGLVYDVRVQ  613

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPVNQSRSESGYGIRRTF  360
            DYVNLLC++ +T+  I  IT + +     P+ DLNYPSFI     N S +       + F
Sbjct  614  DYVNLLCALGYTQKNITIITGTSSNDCSKPSLDLNYPSFIAFINSNGSSAA------QEF  667

Query  361  VRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTYLGNQTGE-VE  537
             RTVT VG+G   +   V+  +   + +    L FK K E+  YKL +     +  E V 
Sbjct  668  QRTVTNVGEGKTIYDASVTPVKGYHLSVIPKKLVFKEKNEKLSYKLTIEGPTKKKVENVA  727

Query  538  FGSLTWIDESGKYKVRSPIAVAPM  609
            FG LTW D   K+ VRSPI V  +
Sbjct  728  FGYLTWTDV--KHVVRSPIVVTTL  749



>ref|XP_003595551.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES65802.1| subtilisin-like serine protease [Medicago truncatula]
Length=762

 Score =   146 bits (368),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 121/202 (60%), Gaps = 10/202 (5%)
 Frame = +1

Query  1    SPAAIRSAMVTTANPYDNTNKPIKDPAFNFTSASPLSMGAGQVDPNSALNPGLIYDATPQ  180
            SP++IRSA++TT++  DNT + IKD      +A+P ++GAG ++PN AL+PGL+YD   Q
Sbjct  562  SPSSIRSAIMTTSDILDNTKEHIKDIGNGNRAATPFALGAGHINPNRALDPGLVYDIGVQ  621

Query  181  DYVNLLCSMNFTKTQILTITRSKNYTFENPNSDLNYPSFILLYPV-NQSRSESGYGIRRT  357
            DY+NLLC++NFT+  I  ITRS       P+ DLNYPSFI      N SR+ +       
Sbjct  622  DYINLLCALNFTQKNISAITRSSFNDCSKPSLDLNYPSFIAFSNARNSSRTTN------E  675

Query  358  FVRTVTYVGDGPATFTVHVSGPRNSQVEIQNGNLSFKNKYEEAEYKLVLTY-LGNQTGEV  534
            F RTVT VG+   T+   ++  +  +V +    L FK K E+  YKL +      Q  +V
Sbjct  676  FHRTVTNVGEKKTTYFASITPIKGFRVTVIPNKLVFKKKNEKISYKLKIEGPRMTQKNKV  735

Query  535  EFGSLTWIDESGKYKVRSPIAV  600
             FG L+W D  GK+ VRSPI V
Sbjct  736  AFGYLSWRD--GKHVVRSPIVV  755



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1549013027184