BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17116_g1_i1 len=1472 path=[1:0-125 127:126-1471]

Length=1472
                                                                      Score     E

ref|XP_009799604.1|  PREDICTED: MATE efflux family protein FRD3         543   0.0      
ref|XP_009606692.1|  PREDICTED: MATE efflux family protein FRD3         538   0.0      
ref|XP_004229626.1|  PREDICTED: MATE efflux family protein FRD3         533   0.0      
ref|XP_006345453.1|  PREDICTED: MATE efflux family protein FRD3-like    523   4e-178   
ref|XP_006345501.1|  PREDICTED: MATE efflux family protein FRD3-like    517   5e-176   
ref|XP_002299942.2|  FERRIC REDUCTASE DEFECTIVE 3 family protein        496   5e-168   Populus trichocarpa [western balsam poplar]
ref|XP_011093550.1|  PREDICTED: MATE efflux family protein FRD3-like    489   1e-164   
ref|XP_011047405.1|  PREDICTED: MATE efflux family protein FRD3-l...    489   2e-164   
ref|XP_011047404.1|  PREDICTED: MATE efflux family protein FRD3-l...    486   2e-163   
ref|XP_002275374.2|  PREDICTED: MATE efflux family protein FRD3-like    485   5e-163   Vitis vinifera
ref|XP_002532163.1|  DNA-damage-inducible protein f, putative           483   2e-162   Ricinus communis
ref|XP_007052534.1|  MATE efflux family protein                         482   9e-162   
gb|KDP43472.1|  hypothetical protein JCGZ_16759                         476   9e-160   
ref|XP_010659528.1|  PREDICTED: MATE efflux family protein FRD3         476   1e-159   
gb|EYU27049.1|  hypothetical protein MIMGU_mgv1a004702mg                475   1e-159   
ref|XP_002313305.2|  FERRIC REDUCTASE DEFECTIVE 3 family protein        473   2e-158   Populus trichocarpa [western balsam poplar]
ref|XP_011087661.1|  PREDICTED: MATE efflux family protein FRD3         472   8e-158   
emb|CBI24885.3|  unnamed protein product                                471   1e-157   
ref|XP_011025438.1|  PREDICTED: MATE efflux family protein FRD3-like    466   9e-156   
dbj|BAM68466.1|  multi drugs and toxic compounds exclusion protein      463   1e-154   
ref|XP_010695268.1|  PREDICTED: MATE efflux family protein FRD3         461   8e-154   
ref|XP_002532164.1|  DNA-damage-inducible protein f, putative           459   3e-153   Ricinus communis
ref|XP_010032432.1|  PREDICTED: MATE efflux family protein FRD3         459   5e-153   
gb|KHG20807.1|  MATE efflux family protein FRD3                         456   1e-151   
ref|XP_010067872.1|  PREDICTED: MATE efflux family protein FRD3-like    456   2e-151   
emb|CDP07775.1|  unnamed protein product                                455   3e-151   
ref|XP_009354745.1|  PREDICTED: MATE efflux family protein FRD3-l...    456   3e-151   
gb|EPS63682.1|  hypothetical protein M569_11101                         454   4e-151   
ref|XP_008364709.1|  PREDICTED: MATE efflux family protein FRD3-l...    456   4e-151   
ref|XP_009354744.1|  PREDICTED: MATE efflux family protein FRD3-l...    456   4e-151   
ref|XP_008364707.1|  PREDICTED: MATE efflux family protein FRD3-l...    455   9e-151   
ref|XP_006482881.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    453   1e-150   
gb|KHG10301.1|  MATE efflux family protein FRD3                         449   4e-150   
ref|XP_009348951.1|  PREDICTED: MATE efflux family protein 1-like       450   1e-149   
ref|XP_009366106.1|  PREDICTED: MATE efflux family protein 1-like       450   1e-149   
ref|XP_002884678.1|  hypothetical protein ARALYDRAFT_478146             450   1e-149   
ref|XP_009364984.1|  PREDICTED: MATE efflux family protein FRD3-like    452   1e-149   
ref|XP_008449716.1|  PREDICTED: MATE efflux family protein 1            449   4e-149   
ref|XP_008461288.1|  PREDICTED: MATE efflux family protein FRD3         449   5e-149   
ref|XP_010257243.1|  PREDICTED: MATE efflux family protein 1            447   1e-148   
ref|XP_007220832.1|  hypothetical protein PRUPE_ppa027104mg             448   2e-148   
ref|XP_004142114.1|  PREDICTED: MATE efflux family protein 1-like       447   2e-148   
ref|XP_009778889.1|  PREDICTED: MATE efflux family protein 1-like...    447   2e-148   
ref|XP_010673638.1|  PREDICTED: MATE efflux family protein 1            445   5e-148   
ref|XP_011080338.1|  PREDICTED: MATE efflux family protein 1            444   1e-147   
dbj|BAM68465.1|  multi drugs and toxic compounds exclusion protein      446   2e-147   
ref|XP_010534647.1|  PREDICTED: MATE efflux family protein FRD3         445   2e-147   
ref|XP_004136118.1|  PREDICTED: MATE efflux family protein FRD3-like    444   2e-147   
dbj|BAN67819.1|  citrate transporting MATE                              443   5e-147   
ref|XP_010067871.1|  PREDICTED: MATE efflux family protein FRD3-like    445   6e-147   
ref|XP_010906079.1|  PREDICTED: MATE efflux family protein 1 isof...    441   6e-147   
ref|XP_010557794.1|  PREDICTED: MATE efflux family protein FRD3-like    443   8e-147   
ref|XP_010906076.1|  PREDICTED: MATE efflux family protein 1 isof...    441   2e-146   
ref|XP_009778890.1|  PREDICTED: MATE efflux family protein 1-like...    441   3e-146   
ref|NP_187461.1|  protein FERRIC REDUCTASE DEFECTIVE 3                  441   3e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010906073.1|  PREDICTED: MATE efflux family protein 1 isof...    441   4e-146   
emb|CCH27266.1|  ferric reductase defective 3                           441   4e-146   
ref|XP_009613882.1|  PREDICTED: MATE efflux family protein 1-like...    440   7e-146   
ref|XP_004173219.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    438   8e-146   
ref|XP_006361750.1|  PREDICTED: MATE efflux family protein 1-like       439   9e-146   
ref|XP_008231283.1|  PREDICTED: MATE efflux family protein FRD3         439   2e-145   
ref|XP_007220450.1|  hypothetical protein PRUPE_ppa019216mg             439   9e-145   
ref|XP_004306534.1|  PREDICTED: MATE efflux family protein FRD3-like    439   2e-144   
emb|CDY28001.1|  BnaC05g44030D                                          436   6e-144   
ref|XP_009596395.1|  PREDICTED: MATE efflux family protein 1-like...    435   7e-144   
ref|XP_008240868.1|  PREDICTED: MATE efflux family protein 1-like       434   1e-143   
ref|XP_009343718.1|  PREDICTED: MATE efflux family protein 1-like...    434   1e-143   
ref|XP_008231300.1|  PREDICTED: MATE efflux family protein FRD3-like    434   1e-143   
ref|XP_009613884.1|  PREDICTED: MATE efflux family protein 1-like...    434   2e-143   
ref|XP_009396611.1|  PREDICTED: MATE efflux family protein 1-like       433   2e-143   
ref|XP_009394393.1|  PREDICTED: MATE efflux family protein 1-like...    434   2e-143   
ref|XP_008363572.1|  PREDICTED: MATE efflux family protein 1-like       434   2e-143   
ref|XP_009394394.1|  PREDICTED: MATE efflux family protein 1-like...    433   2e-143   
ref|XP_010088236.1|  MATE efflux family protein FRD3                    435   3e-143   
emb|CCH27267.1|  ferric reductase defective 3                           434   3e-143   
ref|XP_008801942.1|  PREDICTED: MATE efflux family protein 1 isof...    433   3e-143   
ref|XP_009375048.1|  PREDICTED: MATE efflux family protein 1            433   3e-143   
ref|XP_008801941.1|  PREDICTED: MATE efflux family protein 1 isof...    433   4e-143   
gb|KHN19386.1|  MATE efflux family protein FRD3                         433   9e-143   
ref|XP_010479604.1|  PREDICTED: MATE efflux family protein 1-like...    431   1e-142   
ref|XP_010315164.1|  PREDICTED: MATE efflux family protein 1-like       432   1e-142   
ref|XP_006407769.1|  hypothetical protein EUTSA_v10020489mg             432   1e-142   
ref|NP_001236876.1|  ferric reductase defective 3b                      432   2e-142   
ref|XP_006586606.1|  PREDICTED: ferric reductase defective 3b iso...    432   2e-142   
ref|XP_007203966.1|  hypothetical protein PRUPE_ppa023647mg             431   2e-142   
ref|XP_010461411.1|  PREDICTED: MATE efflux family protein FRD3-l...    432   2e-142   
ref|NP_001238722.1|  aluminum-activated citrate transporter             432   2e-142   
gb|KDP22091.1|  hypothetical protein JCGZ_25922                         431   2e-142   
ref|XP_006493919.1|  PREDICTED: MATE efflux family protein 1-like       431   2e-142   
ref|XP_010461208.1|  PREDICTED: MATE efflux family protein FRD3-l...    431   2e-142   
ref|XP_010479603.1|  PREDICTED: MATE efflux family protein 1-like...    431   3e-142   
gb|KFK38257.1|  hypothetical protein AALP_AA3G089700                    431   4e-142   
ref|XP_011075217.1|  PREDICTED: MATE efflux family protein 1-like       430   5e-142   
ref|XP_006366538.1|  PREDICTED: MATE efflux family protein 1-like       430   6e-142   
ref|XP_004250944.1|  PREDICTED: MATE efflux family protein 1            429   9e-142   
ref|XP_009343721.1|  PREDICTED: MATE efflux family protein 1-like...    429   9e-142   
ref|XP_006421437.1|  hypothetical protein CICLE_v10004816mg             429   1e-141   
gb|KHN39937.1|  MATE efflux family protein FRD3                         431   2e-141   
ref|NP_001236057.1|  ferric reductase defective 3a                      430   2e-141   
gb|KCW51178.1|  hypothetical protein EUGRSUZ_J00768                     429   2e-141   
ref|XP_004499881.1|  PREDICTED: MATE efflux family protein FRD3-like    429   3e-141   
ref|XP_010908478.1|  PREDICTED: MATE efflux family protein 1-like...    429   3e-141   
ref|XP_007150365.1|  hypothetical protein PHAVU_005G147400g             428   3e-141   
ref|XP_006299121.1|  hypothetical protein CARUB_v10015261mg             428   3e-141   
dbj|BAM68467.1|  multi drugs and toxic compounds exclusion protein      427   5e-141   
ref|XP_003599150.1|  Ferric reductase defective 3b                      428   6e-141   
gb|KDO45405.1|  hypothetical protein CISIN_1g010889mg                   426   8e-141   
ref|XP_010909110.1|  PREDICTED: MATE efflux family protein 1-like       430   1e-140   
ref|XP_009123959.1|  PREDICTED: MATE efflux family protein FRD3-like    427   2e-140   
ref|XP_009777234.1|  PREDICTED: MATE efflux family protein 1-like...    426   2e-140   
ref|XP_010057429.1|  PREDICTED: MATE efflux family protein 1-like       426   2e-140   
gb|KDP26018.1|  hypothetical protein JCGZ_21051                         425   3e-140   
ref|XP_007015048.1|  MATE efflux family protein isoform 1               425   4e-140   
ref|XP_010486385.1|  PREDICTED: MATE efflux family protein FRD3         426   5e-140   
gb|AGU16976.1|  aluminum activated citrate transporter                  425   7e-140   
ref|XP_006597260.1|  PREDICTED: MATE efflux family protein 1-like...    426   9e-140   
ref|XP_010461964.1|  PREDICTED: MATE efflux family protein 1-like...    423   1e-139   
ref|XP_006593314.1|  PREDICTED: aluminum-activated citrate transp...    426   1e-139   
emb|CDX74014.1|  BnaA03g30330D                                          424   2e-139   
ref|XP_010461961.1|  PREDICTED: MATE efflux family protein 1-like...    423   2e-139   
gb|AEM55566.1|  multidrug resistance pump                               424   2e-139   
ref|XP_009144907.1|  PREDICTED: MATE efflux family protein 1-like...    423   3e-139   
ref|XP_010534745.1|  PREDICTED: MATE efflux family protein 1-like       423   3e-139   
ref|XP_008461796.1|  PREDICTED: MATE efflux family protein FRD3-like    425   3e-139   
ref|XP_011025531.1|  PREDICTED: MATE efflux family protein 1            423   4e-139   
ref|XP_009135020.1|  PREDICTED: MATE efflux family protein FRD3-like    423   4e-139   
ref|XP_008227303.1|  PREDICTED: MATE efflux family protein 1            422   5e-139   
ref|XP_009135017.1|  PREDICTED: MATE efflux family protein FRD3         423   5e-139   
ref|XP_007133823.1|  hypothetical protein PHAVU_011G211900g             423   8e-139   
gb|KEH19074.1|  MATE efflux family protein                              422   1e-138   
gb|EYU46259.1|  hypothetical protein MIMGU_mgv1a004792mg                421   1e-138   
ref|XP_010651236.1|  PREDICTED: MATE efflux family protein 1            421   2e-138   
ref|XP_009596394.1|  PREDICTED: MATE efflux family protein 1-like...    422   2e-138   
ref|XP_004293176.1|  PREDICTED: MATE efflux family protein 1-like       420   2e-138   
emb|CDY29628.1|  BnaA05g15420D                                          421   2e-138   
ref|XP_007213927.1|  hypothetical protein PRUPE_ppa004360mg             421   2e-138   
ref|XP_002891631.1|  mate efflux family protein                         421   2e-138   
emb|CDY07957.1|  BnaC03g35660D                                          421   2e-138   
ref|XP_008801950.1|  PREDICTED: MATE efflux family protein 1-like       424   3e-138   
ref|XP_010461965.1|  PREDICTED: MATE efflux family protein 1-like       421   3e-138   
ref|XP_010479600.1|  PREDICTED: MATE efflux family protein 1            420   3e-138   
ref|XP_002313336.1|  MATE efflux family protein                         419   4e-138   Populus trichocarpa [western balsam poplar]
ref|XP_010464452.1|  PREDICTED: MATE efflux family protein FRD3-l...    421   5e-138   
ref|XP_010464456.1|  PREDICTED: MATE efflux family protein FRD3-l...    420   5e-138   
ref|XP_003547162.1|  PREDICTED: MATE efflux family protein 1-like...    421   5e-138   
ref|XP_010500702.1|  PREDICTED: MATE efflux family protein 1-like...    419   5e-138   
ref|NP_564588.2|  MATE efflux family protein                            419   7e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004166240.1|  PREDICTED: MATE efflux family protein FRD3-like    419   7e-138   
gb|AFL69846.1|  aluminum-activated citrate transporter isoform A        419   8e-138   
ref|XP_006307279.1|  hypothetical protein CARUB_v10008894mg             419   8e-138   
emb|CDY35980.1|  BnaA05g29700D                                          420   1e-137   
ref|XP_010500701.1|  PREDICTED: MATE efflux family protein 1-like...    419   1e-137   
gb|KCW90221.1|  hypothetical protein EUGRSUZ_A02386                     414   1e-137   
ref|XP_003638284.1|  Ferric reductase defective 3a                      421   1e-137   
emb|CDY07959.1|  BnaC03g35640D                                          419   1e-137   
ref|XP_009147006.1|  PREDICTED: MATE efflux family protein FRD3-l...    419   1e-137   
ref|NP_974000.1|  MATE efflux family protein                            418   2e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006850216.1|  hypothetical protein AMTR_s00022p00252850          418   2e-137   
ref|XP_004486970.1|  PREDICTED: MATE efflux family protein 1-like       418   2e-137   
gb|EEC72043.1|  hypothetical protein OsI_04949                          421   3e-137   Oryza sativa Indica Group [Indian rice]
ref|NP_001169974.1|  hypothetical protein                               419   3e-137   Zea mays [maize]
ref|XP_009147004.1|  PREDICTED: MATE efflux family protein FRD3-l...    420   4e-137   
ref|XP_003539638.1|  PREDICTED: MATE efflux family protein FRD3-like    418   5e-137   
ref|XP_006651171.1|  PREDICTED: MATE efflux family protein 1-like       419   5e-137   
ref|XP_008645641.1|  PREDICTED: hypothetical protein isoform X4         419   5e-137   
gb|EYU18756.1|  hypothetical protein MIMGU_mgv1a007641mg                413   7e-137   
ref|XP_009147005.1|  PREDICTED: MATE efflux family protein FRD3-l...    419   7e-137   
ref|NP_001049386.2|  Os03g0216700                                       419   9e-137   Oryza sativa Japonica Group [Japonica rice]
emb|CBI24884.3|  unnamed protein product                                417   1e-136   
ref|XP_010500705.1|  PREDICTED: MATE efflux family protein 1-like       416   1e-136   
emb|CBI29870.3|  unnamed protein product                                416   1e-136   
ref|XP_010908479.1|  PREDICTED: MATE efflux family protein 1-like...    414   1e-136   
gb|AFW19998.1|  aluminum-activated citrate transporter                  416   2e-136   
ref|XP_004985179.1|  PREDICTED: MATE efflux family protein 1-like       417   3e-136   
ref|XP_010278990.1|  PREDICTED: MATE efflux family protein 1-like       414   4e-136   
ref|XP_004149599.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    415   4e-136   
gb|KDO45406.1|  hypothetical protein CISIN_1g010889mg                   409   4e-136   
ref|XP_002465638.1|  hypothetical protein SORBIDRAFT_01g042740          416   5e-136   Sorghum bicolor [broomcorn]
ref|XP_006662259.1|  PREDICTED: MATE efflux family protein 1-like       415   5e-136   
emb|CDY03629.1|  BnaC03g68880D                                          414   7e-136   
gb|ACJ85750.1|  unknown                                                 414   9e-136   Medicago truncatula
gb|KHN37617.1|  MATE efflux family protein FRD3                         414   9e-136   
ref|XP_003597421.1|  Multidrug export protein mepA                      413   1e-135   
ref|XP_008363703.1|  PREDICTED: MATE efflux family protein 1            410   2e-135   
dbj|BAD87624.1|  MATE efflux family protein-like                        414   3e-135   Oryza sativa Japonica Group [Japonica rice]
dbj|BAL41687.1|  citrate efflux MATE transporter                        416   3e-135   
ref|XP_007145626.1|  hypothetical protein PHAVU_007G254800g             413   3e-135   
gb|ABS89149.1|  MATE                                                    416   3e-135   Sorghum bicolor [broomcorn]
ref|XP_009777232.1|  PREDICTED: MATE efflux family protein 1-like...    413   5e-135   
ref|XP_002322704.2|  hypothetical protein POPTR_0016s05400g             412   5e-135   Populus trichocarpa [western balsam poplar]
gb|KHN19450.1|  MATE efflux family protein FRD3                         413   6e-135   
ref|XP_008345011.1|  PREDICTED: MATE efflux family protein 1-like       412   6e-135   
gb|ACI46131.1|  aluminum activated citrate transporter                  412   1e-134   Secale cereale
gb|ACI46129.1|  aluminum activated citrate transporter                  412   1e-134   Secale cereale
ref|XP_009107201.1|  PREDICTED: MATE efflux family protein 1 isof...    411   1e-134   
gb|ADK70243.1|  aluminum activated citrate transporter 1-5              412   1e-134   
gb|ACI46130.1|  aluminum activated citrate transporter                  412   1e-134   Secale cereale
gb|AFZ61904.1|  MATE1D                                                  412   3e-134   
ref|XP_003558487.1|  PREDICTED: MATE efflux family protein 1-like       412   3e-134   
gb|AIS76465.1|  Al-activated citrate transporter                        412   3e-134   
gb|KEH19073.1|  MATE efflux family protein                              410   4e-134   
gb|AHA98249.1|  MATE1                                                   411   5e-134   
gb|ADK70244.1|  aluminum activated citrate transporter 1                410   6e-134   
gb|AFZ61901.1|  MATE1A                                                  410   6e-134   
emb|CDY65471.1|  BnaA08g29560D                                          409   7e-134   
gb|AGD81027.1|  MATE1 protein                                           410   9e-134   
dbj|BAF75822.1|  aluminum activated citrate transporter                 410   9e-134   Hordeum vulgare [barley]
dbj|BAF75823.1|  aluminum activated citrate transporter                 410   1e-133   Hordeum vulgare [barley]
ref|XP_003597420.1|  Multidrug export protein mepA                      408   1e-133   
gb|ADK70245.1|  aluminum activated citrate transporter 1-4              410   1e-133   
ref|XP_010906077.1|  PREDICTED: MATE efflux family protein 1 isof...    408   1e-133   
ref|XP_009107199.1|  PREDICTED: MATE efflux family protein 1 isof...    408   2e-133   
gb|AFZ61900.1|  MATE1B                                                  409   2e-133   
gb|AHA98253.1|  MATE1                                                   409   3e-133   
dbj|BAJ61742.1|  putative citrate efflux MATE transporter               407   3e-133   
ref|XP_003638283.1|  Ferric reductase defective 3a                      408   3e-133   
ref|XP_002444946.1|  hypothetical protein SORBIDRAFT_07g001800          408   3e-133   Sorghum bicolor [broomcorn]
gb|AET02174.2|  MATE efflux family protein                              410   4e-133   
gb|KEH19072.1|  MATE efflux family protein                              408   5e-133   
ref|XP_006446116.1|  hypothetical protein CICLE_v10014936mg             407   8e-133   
gb|KGN58591.1|  hypothetical protein Csa_3G696860                       409   8e-133   
gb|AHA98248.1|  MATE1                                                   407   1e-132   
ref|XP_006645235.1|  PREDICTED: MATE efflux family protein 1-like       408   1e-132   
gb|AHA98250.1|  MATE1                                                   407   1e-132   
gb|ACN35041.1|  unknown                                                 401   1e-132   Zea mays [maize]
gb|KHN33350.1|  MATE efflux family protein 1                            406   2e-132   
ref|XP_010278987.1|  PREDICTED: MATE efflux family protein 1-like       407   2e-132   
ref|XP_007028822.1|  MATE efflux family protein isoform 1               405   2e-132   
gb|AHA98252.1|  MATE1                                                   407   2e-132   
gb|AHA98251.1|  MATE1                                                   406   4e-132   
ref|XP_003627698.1|  Aluminum activated citrate transporter             408   6e-132   
ref|XP_004510956.1|  PREDICTED: MATE efflux family protein FRD3-l...    404   7e-132   
ref|XP_010906085.1|  PREDICTED: MATE efflux family protein 1-like...    407   8e-132   
dbj|BAO45881.1|  MATE family transporter                                403   9e-132   
ref|XP_008645634.1|  PREDICTED: hypothetical protein isoform X3         405   1e-131   
ref|XP_008645624.1|  PREDICTED: hypothetical protein isoform X2         405   1e-131   
ref|XP_010257242.1|  PREDICTED: MATE efflux family protein 1-like       402   1e-131   
ref|XP_006306101.1|  hypothetical protein CARUB_v10011528mg             402   5e-131   
gb|EEC66697.1|  hypothetical protein OsI_33017                          402   6e-131   Oryza sativa Indica Group [Indian rice]
ref|NP_001064314.1|  Os10g0206800                                       402   8e-131   Oryza sativa Japonica Group [Japonica rice]
emb|CDX74015.1|  BnaA03g30320D                                          401   1e-130   
ref|XP_007132021.1|  hypothetical protein PHAVU_011G060000g             400   2e-130   
ref|XP_007133824.1|  hypothetical protein PHAVU_011G211900g             400   4e-130   
ref|XP_004516070.1|  PREDICTED: MATE efflux family protein 1-like...    399   5e-130   
ref|XP_004510957.1|  PREDICTED: MATE efflux family protein FRD3-l...    397   8e-130   
emb|CDP18659.1|  unnamed protein product                                398   1e-129   
ref|XP_010234680.1|  PREDICTED: MATE efflux family protein 1-like...    398   1e-129   
gb|KHN13754.1|  MATE efflux family protein 1                            398   1e-129   
gb|AAD30646.1|AC006085_19  Hypothetical protein                         397   3e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010906078.1|  PREDICTED: MATE efflux family protein 1 isof...    396   3e-129   
ref|XP_004510955.1|  PREDICTED: MATE efflux family protein FRD3-l...    397   5e-129   
ref|XP_010654317.1|  PREDICTED: putative pentatricopeptide repeat...    413   1e-128   
ref|XP_002456841.1|  hypothetical protein SORBIDRAFT_03g043890          400   1e-128   Sorghum bicolor [broomcorn]
ref|XP_008354795.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    395   1e-128   
ref|XP_009778887.1|  PREDICTED: MATE efflux family protein 1-like...    397   2e-128   
gb|AFW74381.1|  MATE1                                                   397   2e-128   
ref|XP_009414745.1|  PREDICTED: MATE efflux family protein 1-like       395   3e-128   
gb|ACM47309.1|  MATE1                                                   396   3e-128   Zea mays [maize]
ref|XP_006575246.1|  PREDICTED: MATE efflux family protein 1-like       394   3e-128   
ref|XP_004982714.1|  PREDICTED: MATE efflux family protein 1-like       395   5e-128   
ref|XP_008648010.1|  PREDICTED: MATE family protein isoform X1          396   6e-128   
ref|NP_001164052.1|  MATE family protein                                395   7e-128   Zea mays [maize]
gb|AFL69847.1|  aluminum-activated citrate transporter isoform B        392   8e-128   
gb|EPS69570.1|  hypothetical protein M569_05197                         391   3e-127   
ref|XP_006593306.1|  PREDICTED: MATE efflux family protein FRD3-like    393   4e-127   
ref|XP_010234681.1|  PREDICTED: MATE efflux family protein 1-like...    390   6e-127   
ref|XP_006393064.1|  hypothetical protein EUTSA_v10011401mg             391   1e-126   
ref|XP_009778888.1|  PREDICTED: MATE efflux family protein 1-like...    391   2e-126   
emb|CAN71654.1|  hypothetical protein VITISV_019548                     389   5e-126   Vitis vinifera
gb|EEC74769.1|  hypothetical protein OsI_10537                          386   1e-124   Oryza sativa Indica Group [Indian rice]
ref|XP_009144911.1|  PREDICTED: MATE efflux family protein 1-like...    384   3e-124   
dbj|BAN59993.1|  multidrug and toxic compound extrusion transporter     385   4e-124   
gb|EEE58593.1|  hypothetical protein OsJ_09924                          386   2e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003535165.1|  PREDICTED: MATE efflux family protein 1-like       394   5e-123   
ref|XP_008348185.1|  PREDICTED: MATE efflux family protein FRD3-like    374   7e-123   
gb|AAW30732.1|  multi drug and toxin extrusion protein                  382   7e-123   Lupinus albus
ref|XP_008777221.1|  PREDICTED: MATE efflux family protein 1-like       374   7e-123   
ref|XP_008801943.1|  PREDICTED: MATE efflux family protein 1 isof...    379   2e-122   
gb|EMS52414.1|  MATE efflux family protein 1                            380   2e-122   
ref|XP_010544216.1|  PREDICTED: MATE efflux family protein 1-like...    377   2e-121   
gb|EYU29027.1|  hypothetical protein MIMGU_mgv1a025922mg                367   3e-119   
emb|CAN71653.1|  hypothetical protein VITISV_019547                     374   4e-119   
ref|XP_002513506.1|  DNA-damage-inducible protein f, putative           371   5e-119   
ref|XP_010031792.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    367   3e-117   
ref|XP_006379071.1|  hypothetical protein POPTR_0009s05830g             363   9e-117   
ref|XP_006379069.1|  hypothetical protein POPTR_0009s05830g             363   1e-116   
ref|XP_007148878.1|  hypothetical protein PHAVU_005G021900g             364   3e-116   
dbj|BAM68468.1|  multi drugs and toxic compounds exclusion protein      364   4e-116   
ref|XP_009596396.1|  PREDICTED: MATE efflux family protein 1-like...    362   8e-116   
ref|XP_010544217.1|  PREDICTED: MATE efflux family protein 1-like...    361   2e-115   
gb|KGN45129.1|  hypothetical protein Csa_7G428170                       362   2e-115   
ref|XP_010102342.1|  MATE efflux family protein 1                       361   4e-115   
gb|KGN54178.1|  hypothetical protein Csa_4G291900                       359   1e-114   
gb|KCW51177.1|  hypothetical protein EUGRSUZ_J00768                     355   5e-113   
ref|XP_006379072.1|  hypothetical protein POPTR_0009s05830g             355   1e-112   
gb|KHG21612.1|  MATE efflux family protein 1                            348   2e-110   
gb|EEE50722.1|  hypothetical protein OsJ_31020                          345   1e-109   
ref|XP_007028823.1|  MATE efflux family protein isoform 2               341   2e-109   
gb|EEE55896.1|  hypothetical protein OsJ_04559                          338   4e-106   
ref|XP_007133822.1|  hypothetical protein PHAVU_011G211800g             335   3e-105   
ref|XP_010906087.1|  PREDICTED: MATE efflux family protein 1-like...    335   2e-104   
ref|XP_002526719.1|  DNA-damage-inducible protein f, putative           342   6e-104   
gb|EMS59851.1|  MATE efflux family protein 1                            329   4e-102   
gb|KCW90222.1|  hypothetical protein EUGRSUZ_A02386                     323   9e-102   
gb|AAM18145.1|AC092172_5  Putative membrane protein                     322   2e-100   
gb|EMT11800.1|  DNA-damage-inducible protein F                          318   5e-99    
gb|KCW51181.1|  hypothetical protein EUGRSUZ_J00768                     312   5e-97    
gb|KCW66111.1|  hypothetical protein EUGRSUZ_G03383                     308   2e-95    
ref|XP_007015049.1|  MATE efflux family protein isoform 2               307   5e-95    
gb|ABF94650.1|  MATE efflux family protein, putative, expressed         306   2e-94    
gb|KCW51182.1|  hypothetical protein EUGRSUZ_J00768                     301   3e-93    
gb|ACA61616.1|  hypothetical protein AP4_H06.1                          290   8e-91    
ref|XP_001781640.1|  predicted protein                                  296   3e-90    
ref|XP_010500703.1|  PREDICTED: MATE efflux family protein 1-like...    295   5e-90    
gb|KCW66110.1|  hypothetical protein EUGRSUZ_G03382                     293   2e-89    
ref|XP_006439119.1|  hypothetical protein CICLE_v10033633mg             288   2e-88    
ref|XP_010068976.1|  PREDICTED: MATE efflux family protein FRD3-like    289   4e-87    
ref|XP_002981773.1|  hypothetical protein SELMODRAFT_114940             287   5e-87    
ref|XP_002967571.1|  hypothetical protein SELMODRAFT_88488              285   2e-86    
gb|ACU23396.1|  unknown                                                 283   3e-86    
gb|KDO83401.1|  hypothetical protein CISIN_1g026802mg                   274   3e-85    
ref|XP_011046806.1|  PREDICTED: MATE efflux family protein 2, chl...    285   5e-85    
ref|XP_001753728.1|  predicted protein                                  282   3e-84    
ref|XP_010500704.1|  PREDICTED: MATE efflux family protein 1-like...    275   4e-83    
gb|AES67671.2|  aluminum-activated citrate transporter                  274   8e-83    
gb|KDP42017.1|  hypothetical protein JCGZ_03080                         279   1e-82    
ref|XP_010250617.1|  PREDICTED: MATE efflux family protein 2, chl...    278   1e-82    
gb|EYU41960.1|  hypothetical protein MIMGU_mgv1a006428mg                274   2e-82    
ref|XP_001766948.1|  predicted protein                                  281   2e-82    
ref|XP_004305106.1|  PREDICTED: MATE efflux family protein 2, chl...    275   2e-82    
gb|EYU38023.1|  hypothetical protein MIMGU_mgv1a003929mg                275   2e-81    
ref|XP_010250615.1|  PREDICTED: MATE efflux family protein 2, chl...    275   2e-81    
ref|XP_009109557.1|  PREDICTED: MATE efflux family protein 3, chl...    270   5e-81    
ref|XP_007207071.1|  hypothetical protein PRUPE_ppa026412mg             270   8e-81    
ref|XP_010431773.1|  PREDICTED: MATE efflux family protein 3, chl...    270   1e-80    
ref|XP_009109555.1|  PREDICTED: MATE efflux family protein 3, chl...    271   3e-80    
ref|XP_010431772.1|  PREDICTED: MATE efflux family protein 3, chl...    271   4e-80    
ref|XP_010250616.1|  PREDICTED: MATE efflux family protein 2, chl...    271   5e-80    
ref|XP_010529069.1|  PREDICTED: MATE efflux family protein 2, chl...    270   9e-80    
ref|XP_010431769.1|  PREDICTED: MATE efflux family protein 3, chl...    270   1e-79    
ref|XP_010446344.1|  PREDICTED: MATE efflux family protein 3, chl...    267   1e-79    
ref|XP_006422458.1|  hypothetical protein CICLE_v10028059mg             270   3e-79    
ref|XP_006486624.1|  PREDICTED: MATE efflux family protein 3, chl...    270   3e-79    
gb|KDO68292.1|  hypothetical protein CISIN_1g007548mg                   270   4e-79    
ref|XP_006422457.1|  hypothetical protein CICLE_v10028059mg             270   4e-79    
ref|XP_010431771.1|  PREDICTED: MATE efflux family protein 3, chl...    269   4e-79    
ref|XP_006486625.1|  PREDICTED: MATE efflux family protein 3, chl...    270   4e-79    
ref|XP_010436931.1|  PREDICTED: MATE efflux family protein 3, chl...    268   4e-79    
ref|XP_010653387.1|  PREDICTED: MATE efflux family protein 2, chl...    268   4e-79    
gb|KDO68290.1|  hypothetical protein CISIN_1g007548mg                   269   5e-79    
ref|XP_010250614.1|  PREDICTED: MATE efflux family protein 2, chl...    269   7e-79    
ref|XP_010446341.1|  PREDICTED: MATE efflux family protein 3, chl...    268   1e-78    
emb|CDY12082.1|  BnaC03g59980D                                          272   2e-78    
ref|XP_008244817.1|  PREDICTED: MATE efflux family protein 2, chl...    267   2e-78    
ref|XP_006411624.1|  hypothetical protein EUTSA_v10024830mg             266   4e-78    
ref|XP_006828761.1|  hypothetical protein AMTR_s00001p00077690          265   9e-78    
ref|XP_011095071.1|  PREDICTED: MATE efflux family protein 2, chl...    265   9e-78    
ref|XP_010555179.1|  PREDICTED: MATE efflux family protein 3, chl...    259   2e-77    
ref|XP_009621311.1|  PREDICTED: MATE efflux family protein 3, chl...    265   2e-77    
ref|XP_010242868.1|  PREDICTED: MATE efflux family protein 3, chl...    265   2e-77    
ref|XP_011045054.1|  PREDICTED: MATE efflux family protein 3, chl...    265   2e-77    
ref|XP_006285409.1|  hypothetical protein CARUB_v10006820mg             263   3e-77    
ref|XP_009764230.1|  PREDICTED: MATE efflux family protein 3, chl...    265   3e-77    
ref|XP_007041643.1|  LysM domain-containing GPI-anchored protein 2      264   3e-77    
ref|NP_195551.5|  MATE efflux family protein 3                          263   5e-77    
emb|CDX90273.1|  BnaA08g17110D                                          267   2e-76    
gb|KHG22462.1|  MATE efflux family protein 2, chloroplastic             261   2e-76    
ref|XP_010555177.1|  PREDICTED: MATE efflux family protein 3, chl...    262   2e-76    
ref|XP_007026574.1|  MATE efflux family protein 2 isoform 1             260   4e-76    
ref|XP_002305555.2|  hypothetical protein POPTR_0004s19430g             261   7e-76    
ref|XP_010505458.1|  PREDICTED: MATE efflux family protein 2, chl...    259   1e-75    
gb|KFK36731.1|  hypothetical protein AALP_AA4G162400                    258   2e-75    
ref|XP_002313675.2|  hypothetical protein POPTR_0009s14560g             260   2e-75    
ref|XP_010509185.1|  PREDICTED: MATE efflux family protein 2, chl...    258   2e-75    
ref|XP_010517127.1|  PREDICTED: MATE efflux family protein 2, chl...    257   3e-75    
ref|XP_009598827.1|  PREDICTED: MATE efflux family protein 3, chl...    258   4e-75    
ref|XP_003623384.1|  MATE efflux family protein expressed               258   4e-75    
ref|XP_010037468.1|  PREDICTED: MATE efflux family protein 2, chl...    257   7e-75    
ref|XP_009386162.1|  PREDICTED: MATE efflux family protein 3, chl...    258   9e-75    
ref|XP_010935243.1|  PREDICTED: MATE efflux family protein 3, chl...    258   1e-74    
ref|XP_008781265.1|  PREDICTED: MATE efflux family protein 3, chl...    258   2e-74    
ref|XP_002862903.1|  hypothetical protein ARALYDRAFT_497252             252   2e-74    
ref|XP_008781264.1|  PREDICTED: MATE efflux family protein 3, chl...    257   2e-74    
ref|NP_181367.2|  MATE efflux family protein                            255   3e-74    
ref|XP_009598828.1|  PREDICTED: MATE efflux family protein 3, chl...    255   3e-74    
ref|XP_006411623.1|  hypothetical protein EUTSA_v10024830mg             255   4e-74    
ref|XP_006411047.1|  hypothetical protein EUTSA_v10016494mg             254   4e-74    
ref|XP_006364532.1|  PREDICTED: MATE efflux family protein 3, chl...    256   5e-74    
ref|XP_004231084.1|  PREDICTED: MATE efflux family protein 3, chl...    256   5e-74    
ref|XP_009598830.1|  PREDICTED: MATE efflux family protein 3, chl...    254   5e-74    
ref|XP_002972510.1|  hypothetical protein SELMODRAFT_97796              250   7e-74    
ref|XP_006364530.1|  PREDICTED: MATE efflux family protein 3, chl...    256   7e-74    
ref|XP_006293927.1|  hypothetical protein CARUB_v10022917mg             254   9e-74    
ref|XP_009133248.1|  PREDICTED: MATE efflux family protein 2, chl...    253   1e-73    
gb|KHN19449.1|  MATE efflux family protein FRD3                         252   2e-73    
gb|KDP43739.1|  hypothetical protein JCGZ_22366                         254   2e-73    
ref|XP_004148605.1|  PREDICTED: MATE efflux family protein 2, chl...    253   3e-73    
ref|XP_011088695.1|  PREDICTED: MATE efflux family protein 3, chl...    253   3e-73    
ref|XP_011046285.1|  PREDICTED: MATE efflux family protein 3, chl...    253   6e-73    
ref|XP_010646249.1|  PREDICTED: MATE efflux family protein 3, chl...    253   6e-73    
ref|XP_009373086.1|  PREDICTED: MATE efflux family protein 2, chl...    252   8e-73    
ref|XP_008464231.1|  PREDICTED: MATE efflux family protein 2, chl...    251   1e-72    
ref|XP_002868844.1|  hypothetical protein ARALYDRAFT_490600             251   1e-72    
ref|XP_010238464.1|  PREDICTED: MATE efflux family protein 3, chl...    251   1e-72    
ref|XP_004233576.1|  PREDICTED: MATE efflux family protein 3, chl...    250   3e-72    
ref|XP_002891632.1|  hypothetical protein ARALYDRAFT_337281             246   3e-72    
ref|XP_009798015.1|  PREDICTED: MATE efflux family protein 3, chl...    249   5e-72    
ref|XP_009373087.1|  PREDICTED: MATE efflux family protein 2, chl...    249   5e-72    
ref|XP_008370187.1|  PREDICTED: MATE efflux family protein 2, chl...    249   5e-72    
gb|AET01062.2|  MATE efflux family protein                              249   6e-72    
ref|XP_006367157.1|  PREDICTED: MATE efflux family protein 3, chl...    249   6e-72    
ref|XP_007140203.1|  hypothetical protein PHAVU_008G092900g             249   6e-72    
ref|XP_010111728.1|  MATE efflux family protein 3                       250   7e-72    
ref|XP_003618103.1|  Transporter, putative                              249   1e-71    
gb|AET01063.2|  MATE efflux family protein                              249   1e-71    
ref|XP_009798018.1|  PREDICTED: MATE efflux family protein 3, chl...    248   2e-71    
ref|XP_006583674.1|  PREDICTED: MATE efflux family protein 2, chl...    246   2e-71    
gb|KHN12555.1|  MATE efflux family protein 2, chloroplastic             247   3e-71    
gb|KDP22829.1|  hypothetical protein JCGZ_00416                         247   4e-71    
ref|XP_006583672.1|  PREDICTED: MATE efflux family protein 2, chl...    247   4e-71    
ref|XP_002526679.1|  DNA-damage-inducible protein f, putative           246   9e-71    
ref|XP_010645205.1|  PREDICTED: MATE efflux family protein 3, chl...    246   2e-70    
ref|XP_010033567.1|  PREDICTED: MATE efflux family protein 3, chl...    246   2e-70    
ref|XP_010040212.1|  PREDICTED: MATE efflux family protein 3, chl...    245   3e-70    
gb|KCW45372.1|  hypothetical protein EUGRSUZ_L00936                     245   4e-70    
ref|XP_009764227.1|  PREDICTED: MATE efflux family protein 3, chl...    246   4e-70    
ref|XP_006481109.1|  PREDICTED: MATE efflux family protein 2, chl...    244   9e-70    
ref|XP_006429489.1|  hypothetical protein CICLE_v10011401mg             244   9e-70    
ref|XP_002879741.1|  mate efflux family protein                         243   1e-69    
gb|AAC28771.1|  hypothetical protein                                    242   2e-69    
ref|XP_006383003.1|  hypothetical protein POPTR_0005s10580g             243   3e-69    
emb|CDY07737.1|  BnaA03g17740D                                          240   1e-68    
ref|XP_010028819.1|  PREDICTED: MATE efflux family protein 3, chl...    240   4e-68    
ref|XP_010922639.1|  PREDICTED: MATE efflux family protein 2, chl...    239   5e-68    
ref|XP_006467057.1|  PREDICTED: MATE efflux family protein 3, chl...    239   5e-68    
gb|KCW45371.1|  hypothetical protein EUGRSUZ_L00936                     239   5e-68    
ref|XP_006467054.1|  PREDICTED: MATE efflux family protein 3, chl...    239   6e-68    
gb|ABA95620.1|  MATE efflux family protein, expressed                   238   8e-68    
ref|XP_008799802.1|  PREDICTED: MATE efflux family protein 2, chl...    238   9e-68    
ref|XP_006595643.1|  PREDICTED: MATE efflux family protein 3, chl...    238   1e-67    
ref|NP_001065941.2|  Os12g0106600                                       238   1e-67    
gb|KCW55646.1|  hypothetical protein EUGRSUZ_I01509                     239   2e-67    
ref|XP_004290047.1|  PREDICTED: MATE efflux family protein 3, chl...    238   2e-67    
gb|KDO71436.1|  hypothetical protein CISIN_1g008290mg                   238   2e-67    
gb|EEE52615.1|  hypothetical protein OsJ_34946                          236   3e-67    
ref|XP_006595642.1|  PREDICTED: MATE efflux family protein 3, chl...    237   3e-67    
gb|KDO71437.1|  hypothetical protein CISIN_1g008290mg                   237   3e-67    
ref|XP_004161035.1|  PREDICTED: MATE efflux family protein 3, chl...    235   3e-67    
ref|XP_004492499.1|  PREDICTED: MATE efflux family protein 2, chl...    237   3e-67    
gb|KGN43328.1|  hypothetical protein Csa_7G024020                       238   3e-67    
tpg|DAA39337.1|  TPA: hypothetical protein ZEAMMB73_962252              237   4e-67    
ref|XP_006583673.1|  PREDICTED: MATE efflux family protein 2, chl...    236   4e-67    
emb|CDP01814.1|  unnamed protein product                                237   4e-67    
ref|XP_003545059.1|  PREDICTED: MATE efflux family protein 3, chl...    237   7e-67    
ref|XP_004144948.1|  PREDICTED: MATE efflux family protein 3, chl...    237   8e-67    
ref|XP_002521693.1|  DNA-damage-inducible protein f, putative           233   9e-67    
ref|XP_007046545.1|  MATE efflux family protein                         235   1e-66    
gb|KHN46873.1|  MATE efflux family protein 3, chloroplastic             231   2e-66    
ref|XP_007142564.1|  hypothetical protein PHAVU_008G291400g             234   2e-66    
ref|XP_006338968.1|  PREDICTED: MATE efflux family protein 2, chl...    234   4e-66    
ref|XP_008447864.1|  PREDICTED: MATE efflux family protein 3, chl...    235   4e-66    
ref|XP_009345466.1|  PREDICTED: MATE efflux family protein 3, chl...    231   4e-66    
ref|XP_010312309.1|  PREDICTED: MATE efflux family protein 2, chl...    234   4e-66    
dbj|BAK06759.1|  predicted protein                                      234   4e-66    
ref|XP_003618104.1|  Transporter, putative                              235   5e-66    
ref|XP_010676823.1|  PREDICTED: MATE efflux family protein 2, chl...    233   6e-66    
ref|XP_002525810.1|  DNA-damage-inducible protein f, putative           234   6e-66    
ref|XP_009384314.1|  PREDICTED: MATE efflux family protein 2, chl...    233   7e-66    
gb|EEC68698.1|  hypothetical protein OsI_37172                          235   9e-66    
ref|XP_004491639.1|  PREDICTED: MATE efflux family protein 3, chl...    233   1e-65    
ref|XP_002966347.1|  hypothetical protein SELMODRAFT_407816             230   1e-65    
ref|XP_006664273.1|  PREDICTED: MATE efflux family protein 2, chl...    231   2e-65    
ref|XP_004977617.1|  PREDICTED: MATE efflux family protein 2, chl...    231   3e-65    
ref|XP_010238819.1|  PREDICTED: MATE efflux family protein 2, chl...    231   3e-65    
ref|XP_006661506.1|  PREDICTED: MATE efflux family protein 3, chl...    228   3e-65    
ref|XP_010236195.1|  PREDICTED: MATE efflux family protein 3, chl...    231   4e-65    
ref|XP_003570740.1|  PREDICTED: MATE efflux family protein 3, chl...    231   4e-65    
gb|KHG25048.1|  MATE efflux family protein 1                            224   4e-65    
ref|XP_004967512.1|  PREDICTED: MATE efflux family protein 3, chl...    231   5e-65    
ref|XP_009344165.1|  PREDICTED: MATE efflux family protein 3, chl...    232   5e-65    
ref|XP_006662654.1|  PREDICTED: MATE efflux family protein 2, chl...    230   6e-65    
ref|XP_009344795.1|  PREDICTED: MATE efflux family protein 3, chl...    231   1e-64    
gb|EEC67511.1|  hypothetical protein OsI_34802                          229   2e-64    
ref|XP_002307222.2|  hypothetical protein POPTR_0005s10580g             229   2e-64    
gb|KHN05963.1|  MATE efflux family protein 1                            226   2e-64    
ref|XP_011022207.1|  PREDICTED: MATE efflux family protein 3, chl...    229   2e-64    
gb|EEE52608.1|  hypothetical protein OsJ_34937                          229   3e-64    
ref|XP_010690667.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    227   3e-64    
ref|XP_004967513.1|  PREDICTED: MATE efflux family protein 3, chl...    228   3e-64    
ref|XP_011022206.1|  PREDICTED: MATE efflux family protein 3, chl...    229   4e-64    
gb|ABA95621.2|  MATE efflux family protein, expressed                   221   2e-63    
ref|XP_004977618.1|  PREDICTED: MATE efflux family protein 2, chl...    226   2e-63    
ref|XP_008383538.1|  PREDICTED: MATE efflux family protein 3, chl...    228   3e-63    
ref|XP_006467058.1|  PREDICTED: MATE efflux family protein 3, chl...    226   4e-63    
ref|XP_008383539.1|  PREDICTED: MATE efflux family protein 3, chl...    228   4e-63    
gb|ACL53926.1|  unknown                                                 225   4e-63    
ref|XP_010250618.1|  PREDICTED: MATE efflux family protein 2, chl...    225   6e-63    
ref|XP_006603547.1|  PREDICTED: MATE efflux family protein 2, chl...    225   7e-63    
ref|XP_006649215.1|  PREDICTED: MATE efflux family protein 3, chl...    225   7e-63    
ref|XP_009782878.1|  PREDICTED: MATE efflux family protein 2, chl...    224   2e-62    



>ref|XP_009799604.1| PREDICTED: MATE efflux family protein FRD3 [Nicotiana sylvestris]
 ref|XP_009799605.1| PREDICTED: MATE efflux family protein FRD3 [Nicotiana sylvestris]
Length=545

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/445 (69%), Positives = 358/445 (80%), Gaps = 13/445 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENS-ELCDDGSKEVSAKVYSEEKVAEE-PGKDSDQLETMENGSLT-----  1313
             VNITTSFVAEE++    ++ +     +  SEEK   + P  D    E +E  + T     
Sbjct  93    VNITTSFVAEEDTVRRINEKAAIADLEKGSEEKNDTKLPLTDDTDHEKLEKCASTKVETK  152

Query  1312  ----IPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLA  1145
                  P++E K ++  S    S+   KVKR K  IPSASTA++MGCILG+LQT+FL  LA
Sbjct  153   DSAPAPAAEFKTTACKSPDNQSK--GKVKRVKRHIPSASTAILMGCILGLLQTIFLIFLA  210

Query  1144  KPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGD  965
             KP+L LMGVK GS ML+PA +YLTLR+LG+PAVLLSLA+QG+FRG KDT+TPLYAT AGD
Sbjct  211   KPILSLMGVKSGSAMLSPAKKYLTLRALGAPAVLLSLAMQGVFRGFKDTRTPLYATVAGD  270

Query  964   LVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFL  785
             L NI+LD IFI    WGVSGAAIAHV+SQY++ +ILL KL+ EVELLPPS+K LQ SKFL
Sbjct  271   LTNIVLDPIFIFVFRWGVSGAAIAHVLSQYLISIILLCKLMTEVELLPPSAKDLQFSKFL  330

Query  784   KNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAIL  605
             KNG WL ARVIA TFCVTLAASLAARLG+T MAAFQVCLQIWLTSSLLADGLA+AGQAIL
Sbjct  331   KNGFWLLARVIAVTFCVTLAASLAARLGATQMAAFQVCLQIWLTSSLLADGLAVAGQAIL  390

Query  604   ATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIP  425
             A++FA KDY+KAKAA  RVLQMGFV+G GLA+VVG+GLYFGSGVFSKDKNVIRLITI IP
Sbjct  391   ASSFAEKDYQKAKAAGVRVLQMGFVLGLGLALVVGIGLYFGSGVFSKDKNVIRLITIAIP  450

Query  424   FVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALA  245
             FVAGTQPINSLAFVLDGVNFGA+DF YSAYSMV+V A+T+  EF+  KSNG++GIWIAL 
Sbjct  451   FVAGTQPINSLAFVLDGVNFGANDFAYSAYSMVLVGALTVTCEFVLSKSNGYIGIWIALT  510

Query  244   IFMLLRTIAGLWRLATGTGPWCFLR  170
             IFM LRTIAGLWR+ TGTGPWCFLR
Sbjct  511   IFMALRTIAGLWRMGTGTGPWCFLR  535



>ref|XP_009606692.1| PREDICTED: MATE efflux family protein FRD3 [Nicotiana tomentosiformis]
 ref|XP_009606693.1| PREDICTED: MATE efflux family protein FRD3 [Nicotiana tomentosiformis]
Length=543

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/455 (68%), Positives = 358/455 (79%), Gaps = 24/455 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAK--VYSEEKVAEE------PGKDSDQLETMENGSL  1316
             VNITTSFVAEE      D  + +  K  +   EK +EE      P  D    E +E  + 
Sbjct  93    VNITTSFVAEE------DTVRRIKEKAAIADLEKGSEEKNDTKLPVTDDTDHEKLEKCAS  146

Query  1315  TIPSSETKGSSALSDLEAS-------ERDSKVKRGKLRIPSASTALMMGCILGILQTVFL  1157
             T    ETK S+  ++ + +       +   KVKR K  IPSASTA++MGCILGILQT+FL
Sbjct  147   T--KVETKESAPAAEFKTTACKSPDNQSKGKVKRVKRHIPSASTAILMGCILGILQTIFL  204

Query  1156  TVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYAT  977
               LAKP+L LMGVK GS ML+PA +YL LR+LG+PAVLLSLA+QG+FRG KDT+TPLYAT
Sbjct  205   IFLAKPILSLMGVKSGSAMLSPAKKYLILRALGAPAVLLSLAMQGVFRGFKDTRTPLYAT  264

Query  976   AAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQL  797
              AGDL NI+LD IFI    WGVSGAAIAHV+SQY++ +ILL KL+ EVELLPPS+K LQ 
Sbjct  265   VAGDLTNIVLDPIFIFVFRWGVSGAAIAHVLSQYLISIILLCKLMTEVELLPPSAKDLQF  324

Query  796   SKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAG  617
             SKFLKNG WL ARVIA TFCVTLAASLAARLG+T MAAFQVCLQIWLTSSLLADGLA+AG
Sbjct  325   SKFLKNGFWLLARVIAVTFCVTLAASLAARLGTTPMAAFQVCLQIWLTSSLLADGLAVAG  384

Query  616   QAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLIT  437
             QAILA++FA KDY+KAKAA  RVLQMGFV+G GLA+VVG+GLYFGSGVFSKDKNVIRLIT
Sbjct  385   QAILASSFAEKDYQKAKAAGVRVLQMGFVLGLGLALVVGIGLYFGSGVFSKDKNVIRLIT  444

Query  436   IGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIW  257
             I IPFVAGTQPINSLAFVLDGVNFGA+DF YSAYSMV+V A+T+  EF+  KSNG++GIW
Sbjct  445   IAIPFVAGTQPINSLAFVLDGVNFGANDFAYSAYSMVLVGALTVTCEFVLSKSNGYIGIW  504

Query  256   IALAIFMLLRTIAGLWRLATGTGPWCFLR-ASTQP  155
             IAL IFM LRTIAGLWR+ TGTGPW FLR  S+ P
Sbjct  505   IALTIFMALRTIAGLWRMGTGTGPWRFLRIPSSSP  539



>ref|XP_004229626.1| PREDICTED: MATE efflux family protein FRD3 [Solanum lycopersicum]
Length=525

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/435 (68%), Positives = 350/435 (80%), Gaps = 12/435 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             VNITTSFVAEE++            ++  +E +A+    DS +   + +G+     +ETK
Sbjct  92    VNITTSFVAEEDT----------VRRMNEKEGIADLEKNDSTKQLVLTDGN-NNDKTETK  140

Query  1291  GSSALSDLEASERDS-KVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
              +    + + ++ DS ++KR K  IPSASTA++MGCILG+LQT+FL  LAKP+L LMGVK
Sbjct  141   ETVLAQECKTTKCDSLELKRVKRHIPSASTAILMGCILGVLQTIFLIFLAKPILSLMGVK  200

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
              GS ML+PA +YLTLR++G+PAVLLSLA+QG+FRG KDTKTPL+AT  GDL NIILD IF
Sbjct  201   SGSAMLSPAKKYLTLRAIGAPAVLLSLAMQGVFRGFKDTKTPLFATVVGDLTNIILDPIF  260

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             I   HWGVSGAAIAHV+SQY++ +ILL KL+ EV LLPPS+K LQ SKFLKNG WL ARV
Sbjct  261   IFVFHWGVSGAAIAHVLSQYLISIILLCKLMTEVHLLPPSTKDLQFSKFLKNGFWLLARV  320

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTL+ASLAARLG+T MAAFQVCLQIWLTSSLLADGLA+AGQAILAT+FA KD++
Sbjct  321   IAVTFCVTLSASLAARLGTTQMAAFQVCLQIWLTSSLLADGLAVAGQAILATSFAEKDFQ  380

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             KAKAA  RVLQMG V+G GLA VV +GLYFGSGVFSKDKNVIRLI I IPFVAGTQPINS
Sbjct  381   KAKAAGVRVLQMGLVLGFGLAAVVAIGLYFGSGVFSKDKNVIRLIIIAIPFVAGTQPINS  440

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFVLDGVNFGASDF YSAYSM +V A+TI  EF+  K+NG++GIWIAL IFM+LRT AG
Sbjct  441   LAFVLDGVNFGASDFAYSAYSMALVGALTITSEFVLSKTNGYIGIWIALTIFMVLRTFAG  500

Query  214   LWRLATGTGPWCFLR  170
             LWR+ TGTGPW FLR
Sbjct  501   LWRMGTGTGPWRFLR  515



>ref|XP_006345453.1| PREDICTED: MATE efflux family protein FRD3-like [Solanum tuberosum]
Length=537

 Score =   523 bits (1347),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 297/441 (67%), Positives = 351/441 (80%), Gaps = 13/441 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENS-------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLT  1313
             VNITTSFVAEE++       E   D  K    K  S +++       +D+ ET E  ++ 
Sbjct  93    VNITTSFVAEEDTVRRISEKEAKADLEKGKMEKNDSTKQLILTGDNYNDKTETKE--TVL  150

Query  1312  IPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
              P  +T    +L +    + + K+K  K  IPSASTA++MGCILGILQT+FL  LAKP+L
Sbjct  151   APEFKTTKCESLDN----KSEGKLKHVKRHIPSASTAILMGCILGILQTIFLIFLAKPIL  206

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
              LMGVK  S ML+PA +YLTLR++G+PAVLLSLA+QG+FRG KDT+TPL+AT AGDL NI
Sbjct  207   SLMGVKSDSPMLSPAKKYLTLRAIGAPAVLLSLAMQGVFRGFKDTRTPLFATVAGDLTNI  266

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             ILD IFI    WGVSGAAIAHV+SQY++ +ILLFKL+ EV+LLPPS+K LQ SKFLKNG 
Sbjct  267   ILDPIFIFVFRWGVSGAAIAHVLSQYLISIILLFKLMTEVDLLPPSAKDLQFSKFLKNGF  326

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
             WL ARVIA TFCVTLAASLAARLG+T MAAFQVCLQIWLTSSLLADGLA+AGQAILA++F
Sbjct  327   WLLARVIAVTFCVTLAASLAARLGTTQMAAFQVCLQIWLTSSLLADGLAVAGQAILASSF  386

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
             A KD++KAKAA  RVLQMG V+G GLA+VV +GLYFGSGVFSKDKNVIR I I IPFVAG
Sbjct  387   AEKDFQKAKAAGVRVLQMGLVLGFGLAIVVAIGLYFGSGVFSKDKNVIRFIIIAIPFVAG  446

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFML  233
             TQPINS+AFVLDGVNFGA+DF YSAYSMV+V A+TI  EF+  K+NG++GIWIALAIFM+
Sbjct  447   TQPINSVAFVLDGVNFGANDFAYSAYSMVLVGALTITCEFVLSKTNGYIGIWIALAIFMV  506

Query  232   LRTIAGLWRLATGTGPWCFLR  170
             LRT AGLWR+ TGTGPW FLR
Sbjct  507   LRTFAGLWRMGTGTGPWRFLR  527



>ref|XP_006345501.1| PREDICTED: MATE efflux family protein FRD3-like [Solanum tuberosum]
Length=522

 Score =   517 bits (1332),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 294/436 (67%), Positives = 341/436 (78%), Gaps = 18/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAK--VYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             VNITTSFVAEE +       + +S K  +   EK  EE  K+  ++E +          E
Sbjct  93    VNITTSFVAEEET------VRRISEKEAIGDLEKGKEE--KNDTKVELVLTDDTDNDKKE  144

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
             TK        E +    K+KR K  IPSASTA++MGCILG+LQT+FL  LAKP+L LMGV
Sbjct  145   TK--------EIALAPGKLKRVKRHIPSASTAILMGCILGLLQTIFLIFLAKPILSLMGV  196

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML+PA +YLTLR++G+PAVLLSLA+QG+FRG KDT+TPLYA   GDL NIILD I
Sbjct  197   KSDSPMLSPAKKYLTLRAIGAPAVLLSLAMQGVFRGFKDTRTPLYAIVVGDLTNIILDPI  256

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             FI   +WGVSGAAIAHV+SQY++ +ILL KL+ EV LLPPS+K LQ SKFLKNG WL AR
Sbjct  257   FIFVLNWGVSGAAIAHVLSQYLISIILLCKLMTEVNLLPPSAKDLQFSKFLKNGFWLLAR  316

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             VIA TFCVTLAASLAARLG+T MAAFQVCLQIWLTSSLLADGLA+AGQAILA++FA KD+
Sbjct  317   VIAVTFCVTLAASLAARLGTTQMAAFQVCLQIWLTSSLLADGLAVAGQAILASSFAEKDF  376

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             +KAKAA  RVLQMG V+G GLA+VV +GLYFGSGVFSKDKNVIR I I IPFVAGTQPIN
Sbjct  377   QKAKAAGVRVLQMGLVLGFGLAIVVAIGLYFGSGVFSKDKNVIRFIIIAIPFVAGTQPIN  436

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             S+AFVLDGVNFGA+DF YSAYSMV+V A+TI  EF   K+NG+ GIWIAL IFM+LRT A
Sbjct  437   SVAFVLDGVNFGANDFAYSAYSMVLVGALTITSEFFLYKTNGYTGIWIALTIFMVLRTFA  496

Query  217   GLWRLATGTGPWCFLR  170
             GLWR+ TGTGPW FLR
Sbjct  497   GLWRMGTGTGPWRFLR  512



>ref|XP_002299942.2| FERRIC REDUCTASE DEFECTIVE 3 family protein, partial [Populus 
trichocarpa]
 gb|EEE84747.2| FERRIC REDUCTASE DEFECTIVE 3 family protein, partial [Populus 
trichocarpa]
Length=505

 Score =   496 bits (1277),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 280/439 (64%), Positives = 342/439 (78%), Gaps = 9/439 (2%)
 Frame = -2

Query  1471  VNITTSFVAEE-----NSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIP  1307
             V+ITTSFVAEE     N+++  + ++++     S E  A+E   + + LE++E GS T  
Sbjct  66    VSITTSFVAEEDTVHRNTKIEAEKAEDMKKDAKSGE--AKESVPNDEMLESLEKGSATNN  123

Query  1306  SSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
                 +   +LS+ E+   + K +R    IPSASTAL++G ILG++Q +FL   AKPLL +
Sbjct  124   EKNIENKYSLSEDESVNPEQKNER--RHIPSASTALIVGGILGLVQAIFLIFGAKPLLHI  181

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGVK GS MLNPA +YLTLR+LGSPAVLLSLA+QG+FRG KDTKTPLYAT  GDL NIIL
Sbjct  182   MGVKSGSAMLNPARKYLTLRALGSPAVLLSLAMQGVFRGFKDTKTPLYATVIGDLTNIIL  241

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI  C WGVSGAAIAHV+SQY++ +ILL++L+++++LLPP  K LQ S+FLKNG  L
Sbjct  242   DPIFIFVCRWGVSGAAIAHVVSQYLISVILLWRLMKKIDLLPPRVKDLQFSRFLKNGFLL  301

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
              ARVIAAT CVTLAAS AARLGST MAAFQ+CLQ+WLTSSLLADG A+AGQAI+A AFA 
Sbjct  302   LARVIAATICVTLAASRAARLGSTTMAAFQICLQVWLTSSLLADGFAVAGQAIIACAFAE  361

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY+KA  AA RVLQM F++G GLAVVVGL L+FG  +FSKD NV+R+I IGIPFVAGTQ
Sbjct  362   KDYQKATTAATRVLQMSFILGIGLAVVVGLALHFGDIIFSKDPNVLRIIAIGIPFVAGTQ  421

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PINS+AFV DGVNFGASDF YS+YSMV+VA  +I   F+F K+ GFVGIW+AL IFM LR
Sbjct  422   PINSIAFVFDGVNFGASDFAYSSYSMVLVATASIAAIFVFSKTGGFVGIWVALTIFMGLR  481

Query  226   TIAGLWRLATGTGPWCFLR  170
             T AG+WR+ TGTGPW FLR
Sbjct  482   TFAGVWRMGTGTGPWRFLR  500



>ref|XP_011093550.1| PREDICTED: MATE efflux family protein FRD3-like [Sesamum indicum]
Length=544

 Score =   489 bits (1258),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 292/468 (62%), Positives = 345/468 (74%), Gaps = 43/468 (9%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLE--TMENGSLTIPSSE  1298
             V+ITTSFVAEE +            +  S+EK   + G  +D LE  + +NG    P  +
Sbjct  88    VSITTSFVAEEET-----------VQRISQEK---QKGSSTDDLEKGSCKNGETEAPVGD  133

Query  1297  TKGS----SALSDL---EASERDSKVKRGKL--------------------RIPSASTAL  1199
                +    S + D+   E SE + K+   K                      IPSASTAL
Sbjct  134   HDPTMLENSDIEDVVKDETSEDECKMTTCKTVDAPCSSSSSTKKGKTKERRHIPSASTAL  193

Query  1198  MMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGI  1019
             ++G +LG++QTVFL  LAKP LG+MGVK GS ML PAL+YLT+RSLG+PAVLLSLA+QG+
Sbjct  194   VLGGVLGLMQTVFLIFLAKPCLGIMGVKSGSAMLPPALKYLTIRSLGAPAVLLSLAMQGV  253

Query  1018  FRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIR  839
             FRG KDTKTPLYAT AGDL+NI+LD I I AC  GV GAAIAHV+SQY++ ++LL KL++
Sbjct  254   FRGFKDTKTPLYATVAGDLMNIVLDPILIFACRLGVIGAAIAHVLSQYLISMVLLSKLMK  313

Query  838   EVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIW  659
             +V+LLPP+ K LQ SKFLKNG  L A+VIA T CVTLAAS+A RLGST MAAFQVCLQ+W
Sbjct  314   QVDLLPPTIKDLQFSKFLKNGFLLLAKVIATTICVTLAASMATRLGSTPMAAFQVCLQVW  373

Query  658   LTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGS  479
             LTSSLLADGLA+AGQAILA AFA KDYKKA AAA RVLQMGFVMG GLA+VVGLGL FGS
Sbjct  374   LTSSLLADGLAVAGQAILACAFAEKDYKKATAAAVRVLQMGFVMGLGLALVVGLGLQFGS  433

Query  478   GVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGF  299
             G+FSKDK+VI +I IGIPFVA TQPINSLAFV DGVNFGASDF YSAYSM++VA  TIG 
Sbjct  434   GIFSKDKSVIHIIAIGIPFVAATQPINSLAFVFDGVNFGASDFAYSAYSMILVAIPTIGS  493

Query  298   EFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
              F+  KSNGFVGIW+AL I+M LRT AG+WR+ TGTGPW FLR  + P
Sbjct  494   LFVLSKSNGFVGIWLALTIYMALRTFAGIWRMGTGTGPWSFLRGRSLP  541



>ref|XP_011047405.1| PREDICTED: MATE efflux family protein FRD3-like isoform X2 [Populus 
euphratica]
Length=547

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 277/450 (62%), Positives = 341/450 (76%), Gaps = 16/450 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCD---DGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSS  1301
             V+ITTSFVAEE++   +   +  K    K  S+   A+E   + + LE++E GS T    
Sbjct  93    VSITTSFVAEEDTVHRNTKIEAEKAEDLKKDSKSGEAKESVPNDEMLESLEKGSATKNEK  152

Query  1300  ETKGSSALSD-------------LEASERDSKVKRGKLRIPSASTALMMGCILGILQTVF  1160
               +   +LS+              +    + K    +  IPSASTAL++G ILG++Q +F
Sbjct  153   NIENKDSLSEDDCKTITSRSSTHTDTESVNPKQNNERRHIPSASTALIVGGILGLVQAIF  212

Query  1159  LTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYA  980
             L V AKP+L +MGVK GS MLNPA++YLTLR+LGSPAVLLSLA+QG+FRG KDTKTPLYA
Sbjct  213   LIVGAKPVLHIMGVKSGSAMLNPAMKYLTLRALGSPAVLLSLAMQGVFRGFKDTKTPLYA  272

Query  979   TAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQ  800
             T  GDL NIILD IFI  C WGVSGAAIAHV+SQY++ +ILL++L+++++L+PPS K LQ
Sbjct  273   TVIGDLTNIILDPIFIFVCRWGVSGAAIAHVLSQYLISVILLWRLMKKIDLVPPSVKDLQ  332

Query  799   LSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIA  620
              S+FLKNG  L ARVIAAT CVTLAAS AARLGST MAAFQ+CLQ+WLTSSLLADGLA+A
Sbjct  333   FSRFLKNGFLLLARVIAATICVTLAASRAARLGSTTMAAFQICLQVWLTSSLLADGLAVA  392

Query  619   GQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLI  440
             GQAI+A AFA KDY+KA  AAARVLQM F++G GLAVVVGL L+FG  +FSKD +V+R+I
Sbjct  393   GQAIIACAFAEKDYQKATTAAARVLQMSFILGLGLAVVVGLALHFGDMIFSKDPDVLRII  452

Query  439   TIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGI  260
              IGIPFVAGTQP+NS+AFV DGVNFGASDF YS+YSMV+VA  +I   F+  K+ GFVGI
Sbjct  453   AIGIPFVAGTQPLNSIAFVFDGVNFGASDFAYSSYSMVLVATASIAAIFVLSKTGGFVGI  512

Query  259   WIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             W+AL IFM LRT AG+WR+ TGTGPW FLR
Sbjct  513   WVALTIFMGLRTFAGVWRMGTGTGPWRFLR  542



>ref|XP_011047404.1| PREDICTED: MATE efflux family protein FRD3-like isoform X1 [Populus 
euphratica]
Length=554

 Score =   486 bits (1251),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 277/457 (61%), Positives = 341/457 (75%), Gaps = 23/457 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCD---DGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSS  1301
             V+ITTSFVAEE++   +   +  K    K  S+   A+E   + + LE++E GS T    
Sbjct  93    VSITTSFVAEEDTVHRNTKIEAEKAEDLKKDSKSGEAKESVPNDEMLESLEKGSATKNEK  152

Query  1300  ETKGSSALSD--------------------LEASERDSKVKRGKLRIPSASTALMMGCIL  1181
               +   +LS+                     +    + K    +  IPSASTAL++G IL
Sbjct  153   NIENKDSLSEDVSVFSPSDCKTITSRSSTHTDTESVNPKQNNERRHIPSASTALIVGGIL  212

Query  1180  GILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKD  1001
             G++Q +FL V AKP+L +MGVK GS MLNPA++YLTLR+LGSPAVLLSLA+QG+FRG KD
Sbjct  213   GLVQAIFLIVGAKPVLHIMGVKSGSAMLNPAMKYLTLRALGSPAVLLSLAMQGVFRGFKD  272

Query  1000  TKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLP  821
             TKTPLYAT  GDL NIILD IFI  C WGVSGAAIAHV+SQY++ +ILL++L+++++L+P
Sbjct  273   TKTPLYATVIGDLTNIILDPIFIFVCRWGVSGAAIAHVLSQYLISVILLWRLMKKIDLVP  332

Query  820   PSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLL  641
             PS K LQ S+FLKNG  L ARVIAAT CVTLAAS AARLGST MAAFQ+CLQ+WLTSSLL
Sbjct  333   PSVKDLQFSRFLKNGFLLLARVIAATICVTLAASRAARLGSTTMAAFQICLQVWLTSSLL  392

Query  640   ADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKD  461
             ADGLA+AGQAI+A AFA KDY+KA  AAARVLQM F++G GLAVVVGL L+FG  +FSKD
Sbjct  393   ADGLAVAGQAIIACAFAEKDYQKATTAAARVLQMSFILGLGLAVVVGLALHFGDMIFSKD  452

Query  460   KNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLK  281
              +V+R+I IGIPFVAGTQP+NS+AFV DGVNFGASDF YS+YSMV+VA  +I   F+  K
Sbjct  453   PDVLRIIAIGIPFVAGTQPLNSIAFVFDGVNFGASDFAYSSYSMVLVATASIAAIFVLSK  512

Query  280   SNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             + GFVGIW+AL IFM LRT AG+WR+ TGTGPW FLR
Sbjct  513   TGGFVGIWVALTIFMGLRTFAGVWRMGTGTGPWRFLR  549



>ref|XP_002275374.2| PREDICTED: MATE efflux family protein FRD3-like [Vitis vinifera]
 ref|XP_010659342.1| PREDICTED: MATE efflux family protein FRD3-like [Vitis vinifera]
 ref|XP_010659343.1| PREDICTED: MATE efflux family protein FRD3-like [Vitis vinifera]
Length=547

 Score =   485 bits (1248),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 284/448 (63%), Positives = 336/448 (75%), Gaps = 16/448 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSK-EVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSS  1301
             V+ITTSFVAEE++  +  ++  K E S K   +    +E   +   LE +E GS   P+S
Sbjct  97    VSITTSFVAEEDTVGKKGNEAPKGENSEKASVQNSETKELEDEDVILENLEKGS--NPNS  154

Query  1300  ETKGSSALSDLEA-----------SERDSKVKRGKLRIPSASTALMMGCILGILQTVFLT  1154
             E K      DL+            S    K+K+ +  IPSASTAL++G  LG+ QT+FL 
Sbjct  155   EMKELIPEDDLKTTTYKPPSVSTVSPNRVKLKKERRHIPSASTALVIGSFLGLFQTIFLI  214

Query  1153  VLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATA  974
               AKPLL  MGVK GS+ML PA RYLTLR+LG+PAVLLSLA+QG+FRG KDTKTPLYAT 
Sbjct  215   FAAKPLLSFMGVKSGSSMLTPARRYLTLRALGAPAVLLSLAMQGVFRGFKDTKTPLYATV  274

Query  973   AGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLS  794
              GDL NIILD IFI  C  GVSGAAIAHVISQY++ LILL +L++EV+LLPPS K LQ  
Sbjct  275   VGDLTNIILDPIFIFVCKLGVSGAAIAHVISQYLISLILLLRLMKEVDLLPPSLKDLQFR  334

Query  793   KFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQ  614
             +FLKNG+ L  RVIAATFCVTLAASLAARLGST MAAFQ+CLQ+W+TSSLLADGLA+AGQ
Sbjct  335   RFLKNGVLLLGRVIAATFCVTLAASLAARLGSTPMAAFQICLQVWMTSSLLADGLAVAGQ  394

Query  613   AILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITI  434
             AILA AFA  DY KA  AA RVLQMGF++G GLA++VGLGL FG+ VFSKD NV+ LI+I
Sbjct  395   AILACAFAENDYAKATNAATRVLQMGFILGLGLALLVGLGLQFGAKVFSKDVNVLHLISI  454

Query  433   GIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWI  254
             G+PFVA TQPINSLAFV DGVNFGASDF YSAYSM++VA ++I   F   KS G+VGIW+
Sbjct  455   GVPFVAATQPINSLAFVFDGVNFGASDFAYSAYSMILVAIVSIASLFCLSKSYGYVGIWV  514

Query  253   ALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             AL I+M LRT AG WR+ TGTGPW FLR
Sbjct  515   ALTIYMGLRTFAGFWRMGTGTGPWHFLR  542



>ref|XP_002532163.1| DNA-damage-inducible protein f, putative [Ricinus communis]
 gb|EEF30216.1| DNA-damage-inducible protein f, putative [Ricinus communis]
Length=546

 Score =   483 bits (1244),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 283/454 (62%), Positives = 341/454 (75%), Gaps = 15/454 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSK-EVSAKVYSEEKVAEEPGKDSDQLETMENGSLT----  1313
             V+ITTSFVAEE++   + ++    E S K   + +  +E   +   LE +E GS T    
Sbjct  93    VSITTSFVAEEDTFQRITNESQNGEGSEKDLPKTRDIKEVVPEDVMLENLEKGSATDSEK  152

Query  1312  ---IP-----SSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFL  1157
                IP      + T  S +  + ++ + + K  +G+  IPSASTAL++G ILG++Q +FL
Sbjct  153   KDSIPGDANCKATTCKSPSFFEGKSIKDEQKNNKGRRHIPSASTALIVGGILGLVQAIFL  212

Query  1156  TVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYAT  977
                AKPLL +MGVK GS ML PA +YLTLR+LGSPAVLLSLA+QG+FRG KDTKTPLYAT
Sbjct  213   IFCAKPLLSIMGVKSGSPMLTPARKYLTLRALGSPAVLLSLAMQGVFRGFKDTKTPLYAT  272

Query  976   AAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQL  797
              AGDL NIILD IFI  C  GVSGAAIAHV+SQY++ LILL++L++ V+LLPPS K LQ 
Sbjct  273   VAGDLANIILDPIFIFTCRLGVSGAAIAHVLSQYLISLILLWRLMKNVDLLPPSPKDLQF  332

Query  796   SKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAG  617
              +FLKNG  L ARVIAAT CVTLAAS AARLGST MAAFQ+CLQ+WLTSSLLADGLA+AG
Sbjct  333   GRFLKNGFLLLARVIAATICVTLAASRAARLGSTRMAAFQICLQVWLTSSLLADGLAVAG  392

Query  616   QAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLIT  437
             QAI+A AFA KDY+KA  AA RVLQM FV+G GLA VVG+GL+FG G+FSKD NV+ +I+
Sbjct  393   QAIIACAFAEKDYQKATTAATRVLQMSFVLGLGLAAVVGIGLHFGDGIFSKDPNVLDIIS  452

Query  436   IGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIW  257
             IGIPFVA TQPINS+AFV DGVNFGASDF YSAYSMV+VA  +I   F+  K+ GFVGIW
Sbjct  453   IGIPFVAATQPINSIAFVFDGVNFGASDFAYSAYSMVLVAVASIAAIFVLSKTGGFVGIW  512

Query  256   IALAIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
             IAL IFM LRT AG+WR+ TGTGPW FLR    P
Sbjct  513   IALTIFMGLRTFAGVWRMGTGTGPWNFLRGKLLP  546



>ref|XP_007052534.1| MATE efflux family protein [Theobroma cacao]
 gb|EOX96691.1| MATE efflux family protein [Theobroma cacao]
Length=544

 Score =   482 bits (1240),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 289/454 (64%), Positives = 346/454 (76%), Gaps = 24/454 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENS--------ELCDD----GSKEVSAKVYSEEKVAEE-----PGKDSDQ  1343
             V+ITTSFVAEE++        E C+D    G K+   K    E VA E        ++D 
Sbjct  96    VSITTSFVAEEDTLGKISPEAEKCEDLEKSGHKDNEMKELMPEDVAAENLEKGAATNTDT  155

Query  1342  LETMENGSLTIPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTV  1163
              E  E+GS T   S  K SSA +   +   +++VK+GK  IPSASTAL++G +LG+LQ +
Sbjct  156   KEP-EDGSNT---STCKSSSATA---SRAENTEVKKGKRHIPSASTALILGSMLGLLQAI  208

Query  1162  FLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLY  983
             FL   AK LLG+MGVKPGS ML PAL+YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLY
Sbjct  209   FLVFGAKILLGVMGVKPGSPMLKPALKYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLY  268

Query  982   ATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHL  803
             AT AGDL NIILD IFI     GVSGAAIAHV+SQY++ +ILL++L++ V LLPPS K L
Sbjct  269   ATVAGDLTNIILDPIFIFVLRLGVSGAAIAHVLSQYLITVILLWQLMKLVNLLPPSLKDL  328

Query  802   QLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAI  623
             Q  +FLKNG  L ARVIA TFCVTLAAS+AARLGST MAAFQ+CLQ+WLTSSLLADGLA+
Sbjct  329   QFGRFLKNGFLLLARVIAVTFCVTLAASMAARLGSTPMAAFQICLQVWLTSSLLADGLAV  388

Query  622   AGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRL  443
             AGQAILA AFA KDYKK  AAA RVLQM FV+G GLAVVVG+GLY+GSG+FSKD +V+ L
Sbjct  389   AGQAILACAFAEKDYKKVTAAATRVLQMSFVLGVGLAVVVGVGLYYGSGIFSKDASVLHL  448

Query  442   ITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVG  263
             I+IG+PFVA TQPINSLAFV DGVNFGASDF ++AYSMV+VA  +I    L  +SNG++G
Sbjct  449   ISIGVPFVAATQPINSLAFVFDGVNFGASDFAFTAYSMVLVAGGSIASILLLSRSNGYIG  508

Query  262   IWIALAIFMLLRTIAGLWRLATGTGPWCFLRAST  161
             IW+AL I+M LRT AG WR+ TGTGPW FL + +
Sbjct  509   IWVALTIYMALRTFAGAWRMGTGTGPWKFLTSRS  542



>gb|KDP43472.1| hypothetical protein JCGZ_16759 [Jatropha curcas]
Length=545

 Score =   476 bits (1226),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 281/460 (61%), Positives = 342/460 (74%), Gaps = 25/460 (5%)
 Frame = -2

Query  1471  VNITTSFVAEEN---------SELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGS  1319
             V+ITTSFVAEE+         S+  +D  K+ S+K+ +EEK   EP  + + LE +E G+
Sbjct  90    VSITTSFVAEEDTVQKVSNKESQKGEDLEKDKSSKI-TEEK---EPIPEDEMLEKLEKGT  145

Query  1318  LT--------IPSSETKG----SSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGI  1175
              T        IP+ + K     S + +D ++       K GK  IPSASTAL++G ILG+
Sbjct  146   STNNDEEKDSIPNDDCKAVTCKSPSFTDGKSINDKPTKKNGKRNIPSASTALIVGGILGL  205

Query  1174  LQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTK  995
             +Q + L   AKPLL +MGVK  S M  PA +YLTLR+LGSPAVLLSLA+QG+FRG KDTK
Sbjct  206   VQAILLIFCAKPLLHIMGVKSDSPMHTPARKYLTLRALGSPAVLLSLAMQGVFRGFKDTK  265

Query  994   TPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPS  815
             TPLYAT AGD+ NIILD IFI  C  GVSGAAIAHV+SQY++ LILL++L+++V+LLPPS
Sbjct  266   TPLYATVAGDVTNIILDPIFIFTCRLGVSGAAIAHVLSQYLISLILLWRLMKKVDLLPPS  325

Query  814   SKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLAD  635
             +K LQ S+FLKNG  L ARVIAAT CVTLAAS AARLG+T MAAFQVCLQ+WLTSSLLAD
Sbjct  326   AKDLQFSRFLKNGFLLLARVIAATICVTLAASRAARLGATPMAAFQVCLQVWLTSSLLAD  385

Query  634   GLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKN  455
             GLA+AGQAI+A AFA KDY+KA  AA RVLQM FV+G GLA  V  GL+FG G+FSKD +
Sbjct  386   GLAVAGQAIIACAFAEKDYQKATTAATRVLQMSFVLGLGLAAFVAAGLHFGDGIFSKDPH  445

Query  454   VIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN  275
             V+ +I+IGIPFVA TQPINS+AFV DGVNFGASDF YSAYSMV+VA +++       K+ 
Sbjct  446   VLHIISIGIPFVAATQPINSIAFVFDGVNFGASDFAYSAYSMVVVAIVSVAVILFLSKTG  505

Query  274   GFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
             GFVGIW+AL IFM LRT AG+WR+ TGTGPW FLR    P
Sbjct  506   GFVGIWVALTIFMGLRTFAGVWRMGTGTGPWKFLRGRLLP  545



>ref|XP_010659528.1| PREDICTED: MATE efflux family protein FRD3 [Vitis vinifera]
Length=542

 Score =   476 bits (1225),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 277/444 (62%), Positives = 339/444 (76%), Gaps = 10/444 (2%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSD-QLETMENGSL-----  1316
             V+ITTS VAEE++   + ++  K  +++  S++    +  KD+D  LE +E GS      
Sbjct  93    VSITTSLVAEEDTIERISNEVPKGENSEKVSDKNCETKELKDADAMLEILEEGSTKDSEM  152

Query  1315  --TIPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAK  1142
               ++P  ++K S+A          +K KR K  IPSASTAL++G +LG++QT+FL   AK
Sbjct  153   KASMPEDDSKTSAAPCVSTGGRNKAKSKREKRHIPSASTALVIGGLLGLIQTLFLIFAAK  212

Query  1141  PLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDL  962
             PLL  MGVK GS ML PAL+YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGDL
Sbjct  213   PLLSFMGVKSGSPMLPPALKYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDL  272

Query  961   VNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLK  782
              NIILD IFI  C  G+SGAAIAHVISQY++ LILL KL+  V LLPP  K LQ  +FLK
Sbjct  273   TNIILDPIFIFVCRLGISGAAIAHVISQYLISLILLLKLMTRVNLLPPRLKDLQFHRFLK  332

Query  781   NGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILA  602
             NG  L  RVIA TFCVTLAASLAARLGS  MAAFQ+CLQ+WLTSSLLADGLA+AGQAILA
Sbjct  333   NGFLLLWRVIAVTFCVTLAASLAARLGSIPMAAFQICLQVWLTSSLLADGLAVAGQAILA  392

Query  601   TafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPF  422
              AFA KDY KA AAA RVLQM FV+G GLA++VG+GL FG+GVF++D NV++LI+I IPF
Sbjct  393   CAFAEKDYGKATAAATRVLQMTFVLGLGLALLVGVGLKFGAGVFTRDPNVLQLISISIPF  452

Query  421   VAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAI  242
             +A TQPIN LAFV DGVNFGASDF Y+AYSM++V+ ++I   F   K+NGFVGIW+AL I
Sbjct  453   IAATQPINCLAFVFDGVNFGASDFAYTAYSMILVSILSIASLFYLSKTNGFVGIWVALTI  512

Query  241   FMLLRTIAGLWRLATGTGPWCFLR  170
             +M+LR +AG+WR+ TGTGPW FLR
Sbjct  513   YMVLRILAGIWRMGTGTGPWHFLR  536



>gb|EYU27049.1| hypothetical protein MIMGU_mgv1a004702mg [Erythranthe guttata]
Length=514

 Score =   475 bits (1222),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 284/434 (65%), Positives = 337/434 (78%), Gaps = 21/434 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEEN+            ++  E +  EE  K   + +T +  SL     E  
Sbjct  94    VSITTSFVAEENT----------VKRINDEHQKNEELEKGIGKSKTNKCKSL-----EAS  138

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
             GSS          ++K +R +  IPSASTAL +G +LG+LQT+FL  LAKP L +MGVK 
Sbjct  139   GSS-----NPQNEETKNER-RRNIPSASTALALGVVLGLLQTIFLVFLAKPFLSVMGVKS  192

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
             GS ML PA +YLT+RSLG+PAVLLSL++QG+FRG KDTKTPLYAT AGDL+NIILD IFI
Sbjct  193   GSPMLEPAQKYLTIRSLGAPAVLLSLSMQGVFRGFKDTKTPLYATVAGDLMNIILDPIFI  252

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
               C  GVSGAAIAHV+SQY++ LILL +L+++V+LLPPS K LQ SKFLKNG +L ARVI
Sbjct  253   FVCRLGVSGAAIAHVLSQYLITLILLIQLMKQVDLLPPSLKDLQFSKFLKNGFYLLARVI  312

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             AAT CVTLAAS+AARLG   MAAFQ+CLQ+W+TSSLLADGLA+AGQAILA AFA KDY+K
Sbjct  313   AATICVTLAASMAARLGPNPMAAFQICLQVWMTSSLLADGLAVAGQAILACAFAEKDYQK  372

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A AAAARVLQMGFV+G GLAV VG+GL FGSG+FSKDKNVI +I IG+PFVA TQPINSL
Sbjct  373   ATAAAARVLQMGFVLGLGLAVFVGVGLQFGSGIFSKDKNVIHMIAIGVPFVAATQPINSL  432

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVNFGASDF YSAYSMV+V+ ++IG  F+  KSNGFVGIW+AL I+M LRT AG 
Sbjct  433   AFVFDGVNFGASDFAYSAYSMVLVSIVSIGSLFMLSKSNGFVGIWLALTIYMGLRTFAGF  492

Query  211   WRLATGTGPWCFLR  170
             WR+ TGTGPW FL+
Sbjct  493   WRMGTGTGPWQFLK  506



>ref|XP_002313305.2| FERRIC REDUCTASE DEFECTIVE 3 family protein [Populus trichocarpa]
 gb|EEE87260.2| FERRIC REDUCTASE DEFECTIVE 3 family protein [Populus trichocarpa]
Length=525

 Score =   473 bits (1216),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 273/440 (62%), Positives = 333/440 (76%), Gaps = 14/440 (3%)
 Frame = -2

Query  1471  VNITTSFVAEE-----NSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIP  1307
             V+ITTSFVAEE     N E+  + + +++    +E   A+E   D + LE +E GS    
Sbjct  89    VSITTSFVAEEETLQRNREVEAEKAGDLNKD--AESGKAKESVPDEEMLENLEKGS----  142

Query  1306  SSETKGSSALSDLEASERDS-KVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
               +T     +   ++   D  K  + +L IPSASTAL++G ILG++QT+FL   AKPLL 
Sbjct  143   --DTNNEKNIEKKDSVPGDEPKRNKERLHIPSASTALIVGGILGLVQTIFLVFGAKPLLN  200

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
             +MGVK  S ML PA +YLTLR+LGSPAVLLSLA+QG+FRG KDT+TPLYAT  GDL NI+
Sbjct  201   IMGVKSDSAMLTPARKYLTLRALGSPAVLLSLAMQGVFRGFKDTRTPLYATVIGDLTNIV  260

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD IFI    WGVSGAAIAHV+SQY++ +ILL+KL+R+V LLPPS K LQ S+FLKNG  
Sbjct  261   LDPIFIFVFKWGVSGAAIAHVLSQYLISVILLWKLMRKVNLLPPSVKDLQFSRFLKNGFL  320

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L ARV+AAT CVTLAAS A RLGST MAAFQ+CLQ+WLTSSLLADGLA+AGQAI+A AFA
Sbjct  321   LLARVVAATICVTLAASRATRLGSTTMAAFQICLQVWLTSSLLADGLAVAGQAIIACAFA  380

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
              K+Y+KA  AA RVLQM F++G GLAV VGLGL+FG  +FSKD +V+ +I IGIPFVA T
Sbjct  381   EKNYQKATTAATRVLQMSFILGLGLAVFVGLGLHFGGVIFSKDPDVLHIIAIGIPFVAAT  440

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QPINS+AFV DGVNFGASDF YS+YSMV+VA  +I   F+  K+ GFVGIW+AL IFM L
Sbjct  441   QPINSIAFVFDGVNFGASDFAYSSYSMVLVAIASIPAIFVLSKTGGFVGIWVALTIFMGL  500

Query  229   RTIAGLWRLATGTGPWCFLR  170
             RT AG+WR+ TGTGPW FLR
Sbjct  501   RTFAGVWRMGTGTGPWRFLR  520



>ref|XP_011087661.1| PREDICTED: MATE efflux family protein FRD3 [Sesamum indicum]
 ref|XP_011087670.1| PREDICTED: MATE efflux family protein FRD3 [Sesamum indicum]
 ref|XP_011087679.1| PREDICTED: MATE efflux family protein FRD3 [Sesamum indicum]
Length=551

 Score =   472 bits (1214),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 292/452 (65%), Positives = 347/452 (77%), Gaps = 13/452 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENS--------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLE----TME  1328
             V+ITTSFVAEE++        +  DD  K  + K  ++  V  E    +  LE    TM+
Sbjct  94    VSITTSFVAEEDTVNRINAEQQKGDDLEKGSTKKTETKPAVVHENDATNKNLEKGTSTMK  153

Query  1327  NGSLTIPSS-ETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTV  1151
             + +       +T    +L    +S    K K  +  IPSASTAL +G +LG+LQT+FL  
Sbjct  154   DDAKDEDQELKTTICKSLDAPSSSPDKEKTKSERRHIPSASTALALGGVLGLLQTIFLIF  213

Query  1150  LAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAA  971
             LAKP L LMGVK GS ML+PA +YLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT A
Sbjct  214   LAKPFLSLMGVKSGSPMLSPAQKYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVA  273

Query  970   GDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSK  791
             GDL NIILD IFI AC  GVSGAAIAHV+SQY++ LILLFKL+++V+LLPPS K LQLSK
Sbjct  274   GDLTNIILDPIFIFACRLGVSGAAIAHVLSQYLISLILLFKLMKQVDLLPPSIKDLQLSK  333

Query  790   FLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQA  611
             FLKNG  L ARV+AAT CVTLAAS+AARLG T MAAFQVCLQ+W+TSSLLADGLA+AGQA
Sbjct  334   FLKNGFLLLARVVAATICVTLAASMAARLGPTPMAAFQVCLQVWMTSSLLADGLAVAGQA  393

Query  610   ILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIG  431
             ILA AFA KDY+KA AAAARVLQMGFV+G GLA++VGLGL FGSG+F+KDK+VI +I IG
Sbjct  394   ILACAFAEKDYQKATAAAARVLQMGFVLGLGLALLVGLGLQFGSGIFTKDKHVIHVIAIG  453

Query  430   IPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIA  251
             IPFVA TQPINSLAFV DGVNFGASDF YSAYSMV+V+  +IG  F+  K+NGFVGIW+A
Sbjct  454   IPFVAATQPINSLAFVFDGVNFGASDFAYSAYSMVLVSIASIGSLFVLSKTNGFVGIWLA  513

Query  250   LAIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
             L I+M LRT AG WR+ TGTGPW FL++ T P
Sbjct  514   LTIYMGLRTFAGFWRMGTGTGPWQFLKSRTLP  545



>emb|CBI24885.3| unnamed protein product [Vitis vinifera]
Length=536

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 278/440 (63%), Positives = 335/440 (76%), Gaps = 8/440 (2%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSD-QLETMENGSLTIPSS  1301
             V+ITTS VAEE++   + ++  K  +++  S++    +  KD+D  LE +E GS     S
Sbjct  93    VSITTSLVAEEDTIERISNEVPKGENSEKVSDKNCETKELKDADAMLEILEEGSTK--DS  150

Query  1300  ETKGS---SALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
             E K S    A          +K KR K  IPSASTAL++G +LG++QT+FL   AKPLL 
Sbjct  151   EMKASMPEDAPCVSTGGRNKAKSKREKRHIPSASTALVIGGLLGLIQTLFLIFAAKPLLS  210

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
              MGVK GS ML PAL+YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGDL NII
Sbjct  211   FMGVKSGSPMLPPALKYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDLTNII  270

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD IFI  C  G+SGAAIAHVISQY++ LILL KL+  V LLPP  K LQ  +FLKNG  
Sbjct  271   LDPIFIFVCRLGISGAAIAHVISQYLISLILLLKLMTRVNLLPPRLKDLQFHRFLKNGFL  330

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L  RVIA TFCVTLAASLAARLGS  MAAFQ+CLQ+WLTSSLLADGLA+AGQAILA AFA
Sbjct  331   LLWRVIAVTFCVTLAASLAARLGSIPMAAFQICLQVWLTSSLLADGLAVAGQAILACAFA  390

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
              KDY KA AAA RVLQM FV+G GLA++VG+GL FG+GVF++D NV++LI+I IPF+A T
Sbjct  391   EKDYGKATAAATRVLQMTFVLGLGLALLVGVGLKFGAGVFTRDPNVLQLISISIPFIAAT  450

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QPIN LAFV DGVNFGASDF Y+AYSM++V+ ++I   F   K+NGFVGIW+AL I+M+L
Sbjct  451   QPINCLAFVFDGVNFGASDFAYTAYSMILVSILSIASLFYLSKTNGFVGIWVALTIYMVL  510

Query  229   RTIAGLWRLATGTGPWCFLR  170
             R +AG+WR+ TGTGPW FLR
Sbjct  511   RILAGIWRMGTGTGPWHFLR  530



>ref|XP_011025438.1| PREDICTED: MATE efflux family protein FRD3-like [Populus euphratica]
 ref|XP_011025439.1| PREDICTED: MATE efflux family protein FRD3-like [Populus euphratica]
Length=547

 Score =   466 bits (1200),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 277/456 (61%), Positives = 336/456 (74%), Gaps = 29/456 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENS---------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGS  1319
             V+ITTSFVAEE +         E   D +K+  +      K  E PG   + LE +E GS
Sbjct  94    VSITTSFVAEEETLQRNCIVEAEKARDLNKDAESG-----KAKELPG--DEMLENLEKGS  146

Query  1318  LT-----------IPSSETKGSSALSDLEASERDSKVKRGK--LRIPSASTALMMGCILG  1178
              T           +P  + K +++ +         + KR K  L IPSASTAL++G ILG
Sbjct  147   ATNNEKNIEKKDSVPGDDCKATTSKTTTLTDTNSVEPKRNKERLHIPSASTALIVGGILG  206

Query  1177  ILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDT  998
             ++Q +FL V AKP+L +MGVK  S ML PA +YLTLR+LGSPAVLLSLA+QG+FRG KDT
Sbjct  207   LVQAIFLIVGAKPVLHIMGVKSDSAMLTPARKYLTLRALGSPAVLLSLAMQGVFRGFKDT  266

Query  997   KTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPP  818
             +TPLYAT  GDL NI+LD IFI   +WGVSGAAIAHV+SQY++ LILL++L+++V LLPP
Sbjct  267   RTPLYATVIGDLTNIVLDPIFIFVFNWGVSGAAIAHVLSQYLISLILLWRLMKKVNLLPP  326

Query  817   SSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLA  638
             S + LQ S+FLKNG  L ARV+AAT CVTLAAS AARLGST MAAFQ+CLQ+WLTSSLLA
Sbjct  327   SVQDLQFSRFLKNGFLLLARVVAATICVTLAASRAARLGSTTMAAFQICLQVWLTSSLLA  386

Query  637   DGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDK  458
             DGLA+AGQAI+A AFA KDY+KA  AA RVLQM F++G GLAV VGLGL+FG  +FSKD 
Sbjct  387   DGLAVAGQAIIACAFAEKDYQKATTAATRVLQMSFILGLGLAVFVGLGLHFGDVIFSKDP  446

Query  457   NVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKS  278
             +V+ +I IGIPFVA TQPINS+AFV DGVNFGASDF YS+YSMV+VA  +I   F+  K+
Sbjct  447   DVLHIIAIGIPFVAATQPINSIAFVFDGVNFGASDFAYSSYSMVLVAIASIPAIFVLSKT  506

Query  277   NGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
              GFVGIWIAL IFM LRT AG+WR+ TGTGPW FLR
Sbjct  507   GGFVGIWIALTIFMGLRTFAGVWRMGTGTGPWRFLR  542



>dbj|BAM68466.1| multi drugs and toxic compounds exclusion protein [Eucalyptus 
camaldulensis]
Length=546

 Score =   463 bits (1192),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 292/463 (63%), Positives = 339/463 (73%), Gaps = 36/463 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQL-------------ETM  1331
             V+ITTSFVAEE          E   +V +E    EEP K S +L             E +
Sbjct  93    VSITTSFVAEE----------ETVGRVGNESATGEEPEKGSIKLSEMKEVIAEDVALENL  142

Query  1330  ENGSLTIPSSETKGSSALSDLEASERDS---------KVKRGKLR--IPSASTALMMGCI  1184
             E GS T   SE K      D+  S  +S         K K  K R  IPSASTAL++GCI
Sbjct  143   EKGSAT--KSENKELMQEKDMIPSTCESPSGTDSDADKFKSCKERRHIPSASTALVIGCI  200

Query  1183  LGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLK  1004
             LG+LQT+ L + AK LLG MGVK  S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG K
Sbjct  201   LGLLQTLLLILGAKTLLGFMGVKSNSPMLAPAQKYLTLRSLGAPAVLLSLAMQGVFRGFK  260

Query  1003  DTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELL  824
             DTKTPLYAT  GD  NIILD IFI  C  GVSGAAIAHV+SQY++  ILL+KL+++V+LL
Sbjct  261   DTKTPLYATVIGDAANIILDPIFIFTCRLGVSGAAIAHVLSQYLISAILLWKLMKQVDLL  320

Query  823   PPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSL  644
             PPS K LQ  +FLKNG+ L ARVIA TFCVTLAAS AARLGST MAAFQ+CLQ+W+TSSL
Sbjct  321   PPSIKELQFHRFLKNGVLLLARVIAVTFCVTLAASKAARLGSTPMAAFQICLQVWMTSSL  380

Query  643   LADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSK  464
             LADGLA+AGQAILA+AFA KDY KA AAA+RVLQMGFV+G GLAVVVG+GL FG GVF+K
Sbjct  381   LADGLAVAGQAILASAFAEKDYSKATAAASRVLQMGFVLGLGLAVVVGVGLRFGLGVFTK  440

Query  463   DKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFL  284
             D NV ++I +G+PFVA TQPINSLAFV DGVNFGASDF YSAYSMV+VA ++I   FL  
Sbjct  441   DVNVQQIIFVGLPFVAATQPINSLAFVFDGVNFGASDFAYSAYSMVLVAIVSIASLFLLS  500

Query  283   KSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
             +SNGFVGIW+AL I+M LRT AG+WR+ TGTGPW FLR    P
Sbjct  501   RSNGFVGIWVALTIYMGLRTFAGVWRMGTGTGPWRFLRGQRTP  543



>ref|XP_010695268.1| PREDICTED: MATE efflux family protein FRD3 [Beta vulgaris subsp. 
vulgaris]
Length=538

 Score =   461 bits (1186),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 281/452 (62%), Positives = 338/452 (75%), Gaps = 25/452 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEE--KVAE-EPGKDSDQLETM---------E  1328
             V+ITTSFVA+E          E   K+ ++E  +VAE  P +  D +E M         E
Sbjct  95    VSITTSFVAQE----------ETIEKMSAQELNQVAEASPHQLGDSVEMMSQDDVLGKLE  144

Query  1327  NGSLTIPSSET---KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFL  1157
              GS TI + +    K      +L  S  +     GK  IPSASTAL +G  LG+ QT+FL
Sbjct  145   EGSTTIINKDDCLPKQDQKTKELAISSPEKVEVGGKRHIPSASTALFLGLFLGLCQTIFL  204

Query  1156  TVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYAT  977
                AK LL +MGVK  S ML PALRYLTLRS G+PAVLLSLA+QG+FRG KDT TPLYAT
Sbjct  205   FFGAKMLLQIMGVKHDSPMLKPALRYLTLRSFGAPAVLLSLAMQGVFRGFKDTTTPLYAT  264

Query  976   AAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQL  797
              A D  NI+LDA+ I  CH GVSGAAIAHV+SQY++  ILL++L REV LLPPS K LQL
Sbjct  265   VAADGANIVLDAVLIFGCHLGVSGAAIAHVLSQYLMSFILLWRLTREVYLLPPSLKELQL  324

Query  796   SKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAG  617
              +FLKNGL+LF RVIA TFCVTLAAS+AARLG+T MAAFQ+CLQ+WL SSL+ADGLA+AG
Sbjct  325   GRFLKNGLYLFTRVIAVTFCVTLAASMAARLGATPMAAFQICLQVWLASSLMADGLAVAG  384

Query  616   QAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLIT  437
             QAILA+AFA K+Y+KA AAA+RVLQMGFV+G GLAVVVGLGL FG+G+FS + NV+ LI+
Sbjct  385   QAILASAFAEKNYEKATAAASRVLQMGFVLGLGLAVVVGLGLQFGAGIFSNNVNVLGLIS  444

Query  436   IGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIW  257
             +G+PFVAGTQPINSL+FV DGVNFGASDF YSAYSMV+VA  ++   FL  KS GF+GIW
Sbjct  445   VGVPFVAGTQPINSLSFVFDGVNFGASDFAYSAYSMVLVAIASVTSLFLLYKSYGFIGIW  504

Query  256   IALAIFMLLRTIAGLWRLATGTGPWCFLRAST  161
             IAL I+M LRT+AG+WR+ TGTGPW FLR+ +
Sbjct  505   IALTIYMALRTLAGIWRMGTGTGPWRFLRSPS  536



>ref|XP_002532164.1| DNA-damage-inducible protein f, putative [Ricinus communis]
 gb|EEF30217.1| DNA-damage-inducible protein f, putative [Ricinus communis]
Length=518

 Score =   459 bits (1181),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 267/442 (60%), Positives = 322/442 (73%), Gaps = 19/442 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSEL---CDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSS  1301
             V ITTSFVAEE++      +  ++E S K   + +  +E   +   LE +E  S++    
Sbjct  93    VYITTSFVAEEDTVQRISIESQNREGSEKDLPKNRNMKEVAPEDAMLENLEKDSIS----  148

Query  1300  ETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
                           E   K  +G+  IPSAS AL++G +LG++Q +FL   AKPLL +MG
Sbjct  149   ------------GDEDKPKNNKGRRHIPSASIALIVGGVLGLMQAIFLIFCAKPLLSIMG  196

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             VK GS ML PA +YLTLR+LGSPAVLLSLA+QG+FRG KDTKTPLYAT AGDL NIILD 
Sbjct  197   VKSGSPMLTPARKYLTLRALGSPAVLLSLAMQGVFRGFKDTKTPLYATVAGDLANIILDP  256

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             IFI  C  GVSGAAIAHV+SQY++L ILL +L++ V+ LPPS K LQ  KFLKNG  L A
Sbjct  257   IFIFTCRLGVSGAAIAHVLSQYLILFILLLRLMKSVDFLPPSPKDLQFGKFLKNGFLLLA  316

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             R+IAAT    LAAS  ARLGST MAAFQ+CLQ+WLTSSLLADGL +AGQAI+A AFA KD
Sbjct  317   RIIAATIFKVLAASRGARLGSTPMAAFQICLQVWLTSSLLADGLTVAGQAIIACAFAEKD  376

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
             Y+KA AAA R+LQM FV+G GLA VVG+GL+FG G+FSKD NV+ +I+IGIPFVA TQ I
Sbjct  377   YQKATAAATRILQMSFVLGLGLAAVVGVGLHFGDGIFSKDPNVLDIISIGIPFVAATQHI  436

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTI  221
             NS+A V DGVNFGASDF YSAYSMV+VA  +I   F+  K+ GFVGIWIA+ IFM LRT+
Sbjct  437   NSIALVFDGVNFGASDFAYSAYSMVLVAIASIVAIFVLSKTAGFVGIWIAITIFMGLRTL  496

Query  220   AGLWRLATGTGPWCFLRASTQP  155
             AG+WR+ TGTGPW FLR    P
Sbjct  497   AGVWRMGTGTGPWNFLRGKLLP  518



>ref|XP_010032432.1| PREDICTED: MATE efflux family protein FRD3 [Eucalyptus grandis]
 ref|XP_010032433.1| PREDICTED: MATE efflux family protein FRD3 [Eucalyptus grandis]
 ref|XP_010032434.1| PREDICTED: MATE efflux family protein FRD3 [Eucalyptus grandis]
Length=546

 Score =   459 bits (1182),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 290/463 (63%), Positives = 336/463 (73%), Gaps = 36/463 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQL-------------ETM  1331
             V+ITTSFVAEE          E   +V +E    EEP K S +L             E +
Sbjct  93    VSITTSFVAEE----------ETVGRVGNESATGEEPEKGSIKLSEMKEVIAEDVALENL  142

Query  1330  ENGSLTIPSSETKGSSALSDLEASERDS---------KVKRGKLR--IPSASTALMMGCI  1184
             E GS T   SE K      D+  S  +S         K K  K R  IPSASTAL++GCI
Sbjct  143   EKGSAT--KSENKELMQEKDMIPSTCESPSGTDSDADKFKSCKERRHIPSASTALVIGCI  200

Query  1183  LGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLK  1004
             LG+LQT+ L + AK LLG MGVK  S ML PA +YLTLRSLG+PAVLLSLA QG+FRG K
Sbjct  201   LGLLQTLLLILGAKTLLGFMGVKSNSPMLAPAQKYLTLRSLGAPAVLLSLATQGVFRGFK  260

Query  1003  DTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELL  824
             DTKTPLYAT  GD  NIILD I I  C  GVSGAAIAHV+SQY++  ILL+KL+++V+LL
Sbjct  261   DTKTPLYATVIGDAANIILDPILIFTCRLGVSGAAIAHVLSQYLISAILLWKLMKQVDLL  320

Query  823   PPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSL  644
             PPS K LQ  +FLKNG+ L ARVIA TFCVTLAAS+AARLGST MAAFQ+CLQ+W+TSSL
Sbjct  321   PPSIKELQFHRFLKNGVLLLARVIAVTFCVTLAASMAARLGSTPMAAFQICLQVWMTSSL  380

Query  643   LADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSK  464
             LADGLA+AGQAILA+AFA KDY KA AAA+RVLQMGFV+G GLAVVVG+GL FG GVF+K
Sbjct  381   LADGLAVAGQAILASAFAEKDYSKATAAASRVLQMGFVLGLGLAVVVGVGLRFGLGVFTK  440

Query  463   DKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFL  284
             D NV  +I +G+PFVA TQPINSLAFV DGVNFGASDF YSAYSMV+VA ++I   FL  
Sbjct  441   DVNVQHIIFVGLPFVAATQPINSLAFVFDGVNFGASDFAYSAYSMVLVAIVSIASLFLLS  500

Query  283   KSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
             +SNGFVGIW+AL I+M LRT AG+WR+ TG GPW FLR    P
Sbjct  501   RSNGFVGIWVALTIYMGLRTFAGVWRMGTGIGPWRFLRGQRTP  543



>gb|KHG20807.1| MATE efflux family protein FRD3 [Gossypium arboreum]
Length=550

 Score =   456 bits (1172),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 282/454 (62%), Positives = 344/454 (76%), Gaps = 25/454 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETM----------ENG  1322
             V+ITTSFVAEE     D  +K     V SE+    EP K+++  E M          E+G
Sbjct  99    VSITTSFVAEE-----DTLAKISPEAVKSEDLEKNEP-KNNEMKELMRPEDVVAANLEDG  152

Query  1321  S-LTIPSSETK----GSSALSD----LEASERDSKVKRGKLRIPSASTALMMGCILGILQ  1169
                   +++TK    GSS  S     +++  ++++VK+GK  IPS STAL++G +LG+LQ
Sbjct  153   PGAAATNTDTKEPEDGSSNTSKDPPVVDSKAQNAQVKKGKRHIPSVSTALILGLMLGLLQ  212

Query  1168  TVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTP  989
              + L   AK LL +MGVKP S MLNPAL+YLTLRSLG+PAVLLSLA+QG+FRG KDTKTP
Sbjct  213   AICLVFGAKALLRVMGVKPDSPMLNPALKYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTP  272

Query  988   LYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSK  809
             LYAT AGDL NIILD IFI     GVSGAAIAHV+SQY++ LILL++L+++V LLPP+ K
Sbjct  273   LYATVAGDLTNIILDPIFIFVLKLGVSGAAIAHVLSQYLISLILLWRLMKQVNLLPPNMK  332

Query  808   HLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGL  629
              LQ  +FLKNG  L ARVIA TFCVTLAAS+AARLGST MAAFQ+CLQ+W+TSSLLADGL
Sbjct  333   DLQFGRFLKNGFLLLARVIAVTFCVTLAASMAARLGSTPMAAFQICLQVWMTSSLLADGL  392

Query  628   AIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVI  449
             A+AGQAILA AFA KDYKK  AA +RVLQM FV+G GLAVVVG GLYFGSG+FSKD +V+
Sbjct  393   AVAGQAILACAFAEKDYKKVTAATSRVLQMSFVLGVGLAVVVGAGLYFGSGIFSKDASVL  452

Query  448   RLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGF  269
              LI+IG+PFVA TQPINS+AFV DGVNFGASDF Y+AYSMV VA  +I   F+  KSNGF
Sbjct  453   HLISIGVPFVAATQPINSIAFVFDGVNFGASDFAYTAYSMVFVAGASIASLFILSKSNGF  512

Query  268   VGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRA  167
             +GIW+AL I+M+LR+ AG+ R+ T TGPW FLR+
Sbjct  513   IGIWVALTIYMVLRSFAGVLRMGTATGPWRFLRS  546



>ref|XP_010067872.1| PREDICTED: MATE efflux family protein FRD3-like [Eucalyptus grandis]
Length=575

 Score =   456 bits (1174),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 274/448 (61%), Positives = 332/448 (74%), Gaps = 16/448 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKV-AEEPGKDSDQLETMENGSLTIPSS  1301
             V+ITTSFVAEE +  + C    ++ + +  S + +  +E   D + LE +E GS    + 
Sbjct  129   VSITTSFVAEEETIGKTCASIEEDENPRTCSTKNIEKKESMPDDEMLENLERGSTN--NR  186

Query  1300  ETKGSSALSDLEASE-----------RDSKVKRGKLRIPSASTALMMGCILGILQTVFLT  1154
             E K      D  A+            + +K+ + +  IPSASTAL++G ILG+LQ +FL 
Sbjct  187   EVKDLVLEEDFSATSCKCAPLFSSKPKKAKLSKERRHIPSASTALILGAILGLLQALFLI  246

Query  1153  VLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATA  974
               AKPLL  MGVK  S M+ PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT 
Sbjct  247   FGAKPLLAFMGVKSDSPMMTPARKYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATV  306

Query  973   AGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLS  794
             AGDL NI+LD I I ACH GVSGAAIAHV+SQY++ LILL +L+++V LLPPS K LQ  
Sbjct  307   AGDLTNIVLDPILIFACHLGVSGAAIAHVLSQYLISLILLLRLMKQVNLLPPSRKDLQFR  366

Query  793   KFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQ  614
             +FLKNG  L ARVIAAT CVTLAAS+AARLGS  MAAFQVCLQ+W+TSSLLADGLA+AGQ
Sbjct  367   RFLKNGFLLLARVIAATICVTLAASMAARLGSIPMAAFQVCLQVWMTSSLLADGLAVAGQ  426

Query  613   AILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITI  434
             AILA+AFA KDY KA AA  RVLQMGFV G GLA++VG+GL FGSGVFSKD NV  LI +
Sbjct  427   AILASAFAEKDYDKATAAGVRVLQMGFVQGMGLAMLVGVGLRFGSGVFSKDINVQHLIFV  486

Query  433   GIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWI  254
             GIPF+  TQPIN LAFVLDGVNFGASDF YSAYSMV V+ ++I   FL  KSNG+VGIW+
Sbjct  487   GIPFITATQPINCLAFVLDGVNFGASDFAYSAYSMVTVSLISIASLFLLSKSNGYVGIWV  546

Query  253   ALAIFMLLRTIAGLWRLATGTGPWCFLR  170
              L I+M L+ + GLWR+ +GTGPW FL+
Sbjct  547   VLTIYMALQALVGLWRMGSGTGPWRFLK  574



>emb|CDP07775.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   455 bits (1170),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 272/450 (60%), Positives = 340/450 (76%), Gaps = 16/450 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             VNITTSFVAEE++   + D+   +   K   +    EE   +  ++E ++      P +E
Sbjct  93    VNITTSFVAEEDTVKRIADESQADDLEKGSVKINETEEQTPEDAKVEKLDTSG---PENE  149

Query  1297  TKGSSALSDLEA-----------SERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTV  1151
              K      D +            S  + K K  +  IPSASTAL++G +LG+LQTV L  
Sbjct  150   PKEFEKECDFKTASCKSSPVTKKSATEGKHKPERRHIPSASTALVVGGVLGLLQTVLLIF  209

Query  1150  LAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAA  971
             LAKP+LG MGVK GS ML PA +YLTLR+LGSPAV LSLA+QG+FRG KDTKTPLYAT A
Sbjct  210   LAKPILGFMGVKSGSPMLAPAQKYLTLRALGSPAVALSLAMQGVFRGFKDTKTPLYATVA  269

Query  970   GDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSK  791
             GD  NIILD IFI A H+GVSGAAIAHV+SQY++ +ILL KL+++V+LLPP++K +Q SK
Sbjct  270   GDTTNIILDPIFIFAFHFGVSGAAIAHVLSQYLISIILLCKLMKQVDLLPPTTKRMQFSK  329

Query  790   FLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQA  611
             FL++G  +  RV+AAT CVTL AS+AARLG T MAAFQVCLQ+WLTSSLLADGLA+AGQA
Sbjct  330   FLRSGSLILTRVLAATICVTLGASMAARLGPTPMAAFQVCLQVWLTSSLLADGLAVAGQA  389

Query  610   ILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIG  431
             ILA AFA KDY+K  AAA RVLQMG V+G GL +VVGLGLYFGSG+FSKDK+V+ +I+IG
Sbjct  390   ILACAFAEKDYEKTTAAARRVLQMGLVLGIGLGLVVGLGLYFGSGIFSKDKHVLAIISIG  449

Query  430   IPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIA  251
             +PFVAGTQPINS+AFV DG+N+G+ DF YSAYSMVMVAA++IG  FL  K++GF+GIWIA
Sbjct  450   VPFVAGTQPINSVAFVFDGINYGSFDFAYSAYSMVMVAALSIGCLFLLSKTHGFIGIWIA  509

Query  250   LAIFMLLRTIAGLWRLATGTGPWCFLRAST  161
             L I+M+LR  AGL R+ +GTGPW +LR ++
Sbjct  510   LTIYMVLRAFAGLLRVGSGTGPWRYLRGTS  539



>ref|XP_009354745.1| PREDICTED: MATE efflux family protein FRD3-like isoform X2 [Pyrus 
x bretschneideri]
Length=574

 Score =   456 bits (1172),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 265/435 (61%), Positives = 319/435 (73%), Gaps = 15/435 (3%)
 Frame = -2

Query  1447  AEENSELCDDG------SKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETKGS  1286
             AE  SE  D+G      SK+V  +  + E    +  K+S QLE   NGS T   +     
Sbjct  147   AEAESERSDEGLAKDIESKKVILENVNLENAERDAAKNSVQLE---NGSKTTVQNHP---  200

Query  1285  SALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGS  1106
                SDL  +   +K+++ K  I SASTAL+ G ILG+ Q +FL + AK LLG+MGVKPGS
Sbjct  201   ---SDLMNNSVKTKIRKKKRHIASASTALIFGAILGLFQAIFLMLTAKVLLGVMGVKPGS  257

Query  1105  TMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILA  926
              ML PA +YL +RS+G+PAVLL+LA+QGIFRG KDTKTPLY   AG  VNI LD + I  
Sbjct  258   PMLAPAQKYLRIRSIGAPAVLLTLAMQGIFRGFKDTKTPLYVIVAGYAVNIALDPLLIFV  317

Query  925   CHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAA  746
             C  G+ GAA+AHVISQY++ L+L   L  +V+LLPPS K LQ  +FLKNG  L ARV+A 
Sbjct  318   CGMGIRGAAMAHVISQYLMALVLFIILTTKVDLLPPSLKDLQFGRFLKNGTLLLARVVAV  377

Query  745   TFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykkak  566
             TFCVTLAASLAARLG T MAAFQ CLQ+WLTSSLLADGLA+AGQAILA AFA KDYKKA 
Sbjct  378   TFCVTLAASLAARLGPTPMAAFQTCLQVWLTSSLLADGLAVAGQAILACAFAEKDYKKAT  437

Query  565   aaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAF  386
             A A RVLQM F++G GLA VVG+GLYFG+G+FS+D NV+ LI IG+PFVA TQPINSL+F
Sbjct  438   ATATRVLQMSFILGVGLAFVVGIGLYFGAGIFSRDVNVLHLIKIGLPFVAATQPINSLSF  497

Query  385   VLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWR  206
             V DGVNFGASDF Y+AYS+V+VA  +I   FL  KS+GFVGIWIAL I+M LRT AG+WR
Sbjct  498   VFDGVNFGASDFAYAAYSLVLVAIASIVSLFLLSKSHGFVGIWIALTIYMALRTFAGVWR  557

Query  205   LATGTGPWCFLRAST  161
             + TGTGPW FL+  +
Sbjct  558   MGTGTGPWRFLKGRS  572



>gb|EPS63682.1| hypothetical protein M569_11101 [Genlisea aurea]
Length=537

 Score =   454 bits (1168),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 276/436 (63%), Positives = 336/436 (77%), Gaps = 3/436 (1%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++    +  ++     + E+ +++E   DS+      N      S    
Sbjct  95    VSITTSFVAEEDTVKRINDEQKRGGDDHLEKGLSQEQTDDSNNNNNNNNDDSCSSSPADS  154

Query  1291  GSSALSDLEASERDSKVKRGKL---RIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
             G        + + ++  K+GK+    IPSASTAL++G ILG++QT+ L  LAKPLL LMG
Sbjct  155   GKPTTPCKSSPQPNATPKKGKVGRRNIPSASTALLLGSILGLIQTIVLIFLAKPLLKLMG  214

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             +K GS ML PA +YLT+RSLG+PAVLLSL++QG+FRG KDTKTPLYAT AGDL+NI LD 
Sbjct  215   IKSGSPMLVPARKYLTIRSLGAPAVLLSLSMQGVFRGFKDTKTPLYATVAGDLMNIALDP  274

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             IFI  C  GV+GAAIAHV+SQY++ LILL KL+++V+LLPPS K +Q SKFLKNG  L A
Sbjct  275   IFIFVCRMGVAGAAIAHVLSQYLISLILLVKLMQQVDLLPPSIKDMQFSKFLKNGFLLLA  334

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             RVIAAT CVTLAAS+AARLG T MAAFQ+CLQ+W+TSSLLADGLA+AGQAILA AFA +D
Sbjct  335   RVIAATICVTLAASMAARLGPTPMAAFQICLQVWMTSSLLADGLAVAGQAILACAFAERD  394

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
             Y+KA  AAARVLQMGFV+G GL+VVVGLGL+FGSGVFS+DK V+R+IT+GIPFVA TQPI
Sbjct  395   YRKATCAAARVLQMGFVLGLGLSVVVGLGLWFGSGVFSRDKQVLRMITVGIPFVAATQPI  454

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTI  221
             NSLAFV DGVNFGASDF YSAYSMVMV+ ++IG  F   +  GFVGIW AL I+M LRT 
Sbjct  455   NSLAFVFDGVNFGASDFAYSAYSMVMVSLVSIGCLFGLSEEYGFVGIWFALTIYMGLRTF  514

Query  220   AGLWRLATGTGPWCFL  173
             AGLWR+ T TGPW FL
Sbjct  515   AGLWRMGTATGPWRFL  530



>ref|XP_008364709.1| PREDICTED: MATE efflux family protein FRD3-like isoform X2 [Malus 
domestica]
Length=574

 Score =   456 bits (1172),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 273/480 (57%), Positives = 328/480 (68%), Gaps = 43/480 (9%)
 Frame = -2

Query  1471  VNITTSFVAEE------------------NSELCDD---GSKEVSAKVYSEEKVAEEPGK  1355
             V+ITTSFVAEE                  NS++ DD   G+ +       +   AE  G+
Sbjct  93    VSITTSFVAEEDTVAKMNTESAKGEKREKNSDMLDDMEKGAAKPKGDDTPQNGAAEAEGE  152

Query  1354  DSDQ-----------------LETMENGSLTIPSSETKGSSAL-----SDLEASERDSKV  1241
              SD+                 LE  E G+         GS        SDL  +   +K+
Sbjct  153   RSDEGLAKDIESKKVILENVKLENAEKGAAKNSVQLENGSKTTMEKRPSDLMNNSVKTKI  212

Query  1240  KRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSL  1061
             ++ K  I SASTAL+ G ILG+ Q +FL + AK LLG+MGVKPGS ML PA +YL +RS+
Sbjct  213   RKKKRHIASASTALIFGAILGLFQAIFLMLTAKVLLGVMGVKPGSPMLAPAQKYLRIRSI  272

Query  1060  GSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVIS  881
             G+PAVLL+LA+QGIFRG KDTKTPLY   AG  VNI LD + I  C  G+ GAA+AHVIS
Sbjct  273   GAPAVLLTLAMQGIFRGFKDTKTPLYVIVAGYAVNIALDPLLIFVCGMGIRGAAMAHVIS  332

Query  880   QYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLG  701
             QY++ L+L   L  +V+LLPPS K LQ  +FLKNG  L ARV+A TFCVTLAASLAARLG
Sbjct  333   QYLMALVLFIILTTKVDLLPPSLKDLQFGRFLKNGTLLLARVVAVTFCVTLAASLAARLG  392

Query  700   STVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGH  521
              T MAAFQ CLQ+WLTSSLLADGLA+AGQAILA AFA KDYKKA A A RVLQM F++G 
Sbjct  393   PTPMAAFQTCLQVWLTSSLLADGLAVAGQAILACAFAEKDYKKATATATRVLQMSFILGV  452

Query  520   glavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYS  341
             GLA VVG+GLYFG+GVFS+D NV+ LI IG+PFVA TQPINSL+FV DGVNFGASDF Y+
Sbjct  453   GLAFVVGIGLYFGAGVFSRDVNVLHLIKIGLPFVAATQPINSLSFVFDGVNFGASDFAYA  512

Query  340   AYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRAST  161
             AYS+V+VA  +I   FL  KS+GFVGIWIAL I+M LRT AG+WR+ TGTGPW FL+  +
Sbjct  513   AYSLVLVAIASIVSLFLLSKSHGFVGIWIALTIYMALRTFAGVWRMGTGTGPWRFLKGRS  572



>ref|XP_009354744.1| PREDICTED: MATE efflux family protein FRD3-like isoform X1 [Pyrus 
x bretschneideri]
Length=577

 Score =   456 bits (1172),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 265/435 (61%), Positives = 319/435 (73%), Gaps = 15/435 (3%)
 Frame = -2

Query  1447  AEENSELCDDG------SKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETKGS  1286
             AE  SE  D+G      SK+V  +  + E    +  K+S QLE   NGS T   +     
Sbjct  150   AEAESERSDEGLAKDIESKKVILENVNLENAERDAAKNSVQLE---NGSKTTVQNHP---  203

Query  1285  SALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGS  1106
                SDL  +   +K+++ K  I SASTAL+ G ILG+ Q +FL + AK LLG+MGVKPGS
Sbjct  204   ---SDLMNNSVKTKIRKKKRHIASASTALIFGAILGLFQAIFLMLTAKVLLGVMGVKPGS  260

Query  1105  TMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILA  926
              ML PA +YL +RS+G+PAVLL+LA+QGIFRG KDTKTPLY   AG  VNI LD + I  
Sbjct  261   PMLAPAQKYLRIRSIGAPAVLLTLAMQGIFRGFKDTKTPLYVIVAGYAVNIALDPLLIFV  320

Query  925   CHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAA  746
             C  G+ GAA+AHVISQY++ L+L   L  +V+LLPPS K LQ  +FLKNG  L ARV+A 
Sbjct  321   CGMGIRGAAMAHVISQYLMALVLFIILTTKVDLLPPSLKDLQFGRFLKNGTLLLARVVAV  380

Query  745   TFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykkak  566
             TFCVTLAASLAARLG T MAAFQ CLQ+WLTSSLLADGLA+AGQAILA AFA KDYKKA 
Sbjct  381   TFCVTLAASLAARLGPTPMAAFQTCLQVWLTSSLLADGLAVAGQAILACAFAEKDYKKAT  440

Query  565   aaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAF  386
             A A RVLQM F++G GLA VVG+GLYFG+G+FS+D NV+ LI IG+PFVA TQPINSL+F
Sbjct  441   ATATRVLQMSFILGVGLAFVVGIGLYFGAGIFSRDVNVLHLIKIGLPFVAATQPINSLSF  500

Query  385   VLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWR  206
             V DGVNFGASDF Y+AYS+V+VA  +I   FL  KS+GFVGIWIAL I+M LRT AG+WR
Sbjct  501   VFDGVNFGASDFAYAAYSLVLVAIASIVSLFLLSKSHGFVGIWIALTIYMALRTFAGVWR  560

Query  205   LATGTGPWCFLRAST  161
             + TGTGPW FL+  +
Sbjct  561   MGTGTGPWRFLKGRS  575



>ref|XP_008364707.1| PREDICTED: MATE efflux family protein FRD3-like isoform X1 [Malus 
domestica]
 ref|XP_008364708.1| PREDICTED: MATE efflux family protein FRD3-like isoform X1 [Malus 
domestica]
Length=577

 Score =   455 bits (1170),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 275/483 (57%), Positives = 333/483 (69%), Gaps = 46/483 (10%)
 Frame = -2

Query  1471  VNITTSFVAEE------------------NSELCDDGSKEVS------AKVYSEEKVAEE  1364
             V+ITTSFVAEE                  NS++ DD  K  +          +E+  AE 
Sbjct  93    VSITTSFVAEEDTVAKMNTESAKGEKREKNSDMLDDMEKGAAKPKGDDTPQNAEKGAAEA  152

Query  1363  PGKDSDQ-----------------LETMENG----SLTIPS-SETKGSSALSDLEASERD  1250
              G+ SD+                 LE  E G    S+ + + S+T      SDL  +   
Sbjct  153   EGERSDEGLAKDIESKKVILENVKLENAEKGAAKNSVQLENGSKTTMEKRPSDLMNNSVK  212

Query  1249  SKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTL  1070
             +K+++ K  I SASTAL+ G ILG+ Q +FL + AK LLG+MGVKPGS ML PA +YL +
Sbjct  213   TKIRKKKRHIASASTALIFGAILGLFQAIFLMLTAKVLLGVMGVKPGSPMLAPAQKYLRI  272

Query  1069  RSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAH  890
             RS+G+PAVLL+LA+QGIFRG KDTKTPLY   AG  VNI LD + I  C  G+ GAA+AH
Sbjct  273   RSIGAPAVLLTLAMQGIFRGFKDTKTPLYVIVAGYAVNIALDPLLIFVCGMGIRGAAMAH  332

Query  889   VISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAA  710
             VISQY++ L+L   L  +V+LLPPS K LQ  +FLKNG  L ARV+A TFCVTLAASLAA
Sbjct  333   VISQYLMALVLFIILTTKVDLLPPSLKDLQFGRFLKNGTLLLARVVAVTFCVTLAASLAA  392

Query  709   RLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFV  530
             RLG T MAAFQ CLQ+WLTSSLLADGLA+AGQAILA AFA KDYKKA A A RVLQM F+
Sbjct  393   RLGPTPMAAFQTCLQVWLTSSLLADGLAVAGQAILACAFAEKDYKKATATATRVLQMSFI  452

Query  529   MGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDF  350
             +G GLA VVG+GLYFG+GVFS+D NV+ LI IG+PFVA TQPINSL+FV DGVNFGASDF
Sbjct  453   LGVGLAFVVGIGLYFGAGVFSRDVNVLHLIKIGLPFVAATQPINSLSFVFDGVNFGASDF  512

Query  349   FYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
              Y+AYS+V+VA  +I   FL  KS+GFVGIWIAL I+M LRT AG+WR+ TGTGPW FL+
Sbjct  513   AYAAYSLVLVAIASIVSLFLLSKSHGFVGIWIALTIYMALRTFAGVWRMGTGTGPWRFLK  572

Query  169   AST  161
               +
Sbjct  573   GRS  575



>ref|XP_006482881.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein FRD3-like 
[Citrus sinensis]
Length=535

 Score =   453 bits (1165),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 279/458 (61%), Positives = 322/458 (70%), Gaps = 34/458 (7%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGK-DSDQLETMENGSLTIPSSET  1295
             VNITTSFVAEE++              +   K  +EP + D D  +++E G     S  +
Sbjct  93    VNITTSFVAEEDT--------------FERIKKVKEPVQGDEDHNDSLEKGEAVKSSKRS  138

Query  1294  -----------KGSSAL-SDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTV  1151
                        KGSSA  SD E S   +KV + K  IPSASTAL MG ILG++Q +FL  
Sbjct  139   TEMKEPEDNLEKGSSAAQSDSEISSA-TKVTKKKRDIPSASTALFMGSILGLVQAIFLVF  197

Query  1150  LAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAA  971
              AK LL +MGVK  S M++PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT A
Sbjct  198   GAKVLLNIMGVKSDSPMMSPAKKYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVA  257

Query  970   GDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSK  791
             GDL NIILD IFI  C  GVSGAAIAHV+SQY++ LILL KL++EV LLPPS K LQ S+
Sbjct  258   GDLANIILDPIFIFVCRLGVSGAAIAHVLSQYLISLILLLKLMKEVHLLPPSLKDLQFSR  317

Query  790   FLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIW------LTSSLLADGL  629
             FLKNG WL  RVIA T CVTLAAS AA LGS  MAAFQ+CLQ+W       +  +     
Sbjct  318   FLKNGFWLLTRVIAVTICVTLAASRAATLGSIPMAAFQICLQVWYKFYIHFSWLINLLLX  377

Query  628   AIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVI  449
                 QAILA AFA KDYKKA  AA RVLQMGF++G GLA+VVGLGLYFGSG+FSKD NVI
Sbjct  378   ICILQAILAGAFAEKDYKKATLAATRVLQMGFILGLGLALVVGLGLYFGSGIFSKDVNVI  437

Query  448   RLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGF  269
              LI IGIPFVA TQPINSLAFV DGVNFGASDF YSAYSMV+VA  +I   F   K++GF
Sbjct  438   HLIHIGIPFVAATQPINSLAFVFDGVNFGASDFVYSAYSMVLVAIASIASIFFLSKTSGF  497

Query  268   VGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
             VGIW+AL I+M LRT AG+WR+ TGTGPW FLR    P
Sbjct  498   VGIWVALTIYMGLRTFAGVWRMGTGTGPWSFLRGRLLP  535



>gb|KHG10301.1| MATE efflux family protein FRD3 [Gossypium arboreum]
Length=479

 Score =   449 bits (1156),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 267/437 (61%), Positives = 320/437 (73%), Gaps = 21/437 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVA+E + L D                   P  D  + +      +  P    K
Sbjct  58    VSITTSFVAQEQT-LAD--------------TTIHAPKSDHPENDGGNKEQIITPQDLEK  102

Query  1291  GSSALSDLEASERD---SKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
              S  ++  +    D   S+VK+GK  IPSASTA++ G +LG+LQT+FL   AK LL +MG
Sbjct  103   VSGKITCKQPPCGDDVTSEVKKGKRHIPSASTAMVFGLVLGLLQTLFLVFGAKILLLVMG  162

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             VKP S M+ PAL+YLTLRS+G+PAVLLSLA+QGIFRG KDTKTPLYAT AGD+ NIILD 
Sbjct  163   VKPNSPMMKPALKYLTLRSMGAPAVLLSLAMQGIFRGFKDTKTPLYATVAGDVTNIILDP  222

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             IFI     GVSGAAIAHV+SQY++ LILL +L+++VELLP   K LQ  +FLKNG+ L  
Sbjct  223   IFIFVLRLGVSGAAIAHVLSQYLITLILLCQLVKQVELLPFRIKDLQFGRFLKNGVMLMG  282

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             RVIA TFCVTL+AS+AARLG T MAAFQ+CLQ+WLTSSLLADGLA+AGQAILA AFA KD
Sbjct  283   RVIAVTFCVTLSASMAARLGPTPMAAFQICLQVWLTSSLLADGLAVAGQAILACAFAEKD  342

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
             YKK  A A R   M FVMG GLAVVVG+GL+FGSG+FSKD  V+RLI+IG+ FVA TQPI
Sbjct  343   YKKVTAVAVR---MSFVMGMGLAVVVGVGLHFGSGIFSKDAAVLRLISIGVVFVASTQPI  399

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTI  221
             NSLAFV DGVNFG+SDF Y+AYSM++V   +I   FL  KSNGF+GIW+AL I+M LR  
Sbjct  400   NSLAFVCDGVNFGSSDFAYTAYSMILVGGASIASIFLLSKSNGFIGIWVALTIYMALRAF  459

Query  220   AGLWRLATGTGPWCFLR  170
             AG+WR+ TGTGPW FLR
Sbjct  460   AGIWRIVTGTGPWRFLR  476



>ref|XP_009348951.1| PREDICTED: MATE efflux family protein 1-like [Pyrus x bretschneideri]
 ref|XP_009348952.1| PREDICTED: MATE efflux family protein 1-like [Pyrus x bretschneideri]
Length=516

 Score =   450 bits (1157),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 264/440 (60%), Positives = 321/440 (73%), Gaps = 22/440 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLET-----MENGSLTIP  1307
             V++TTSFVAEE      D    VS K             D++ LET      E   L   
Sbjct  94    VSVTTSFVAEE------DAMGTVSPK-----------ANDNNYLETGSSMNDETQQLIPE  136

Query  1306  SSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             S+ T+ +     + AS    K +  K  +PSAS+A+++G ILG++Q +FL   AKPLL  
Sbjct  137   SNTTQNAYNSKSVVASFEIVKNEYQKRYMPSASSAMVIGSILGLIQAIFLIAGAKPLLNF  196

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGV   S ML PA +YL LRSLG+PAVLLSLA+QGIFRG KDTKTPLYAT AGD+ NIIL
Sbjct  197   MGVGSDSPMLKPAQQYLMLRSLGAPAVLLSLAMQGIFRGFKDTKTPLYATVAGDVTNIIL  256

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI   H GVSGAAIAHVISQY++  ILL +L  EV+LLPPS KHL+ S+FLKNG  L
Sbjct  257   DPIFIFVFHLGVSGAAIAHVISQYLICFILLRRLAAEVDLLPPSIKHLEFSRFLKNGFLL  316

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
               RVIAATFCVTLAASLAAR G T MAAFQVCLQIWL +SLLADGLA+AGQAILA+AFA 
Sbjct  317   LMRVIAATFCVTLAASLAARQGPTPMAAFQVCLQIWLATSLLADGLAVAGQAILASAFAK  376

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY KA A A+RVLQ+GFV+G  LA ++G+GL +G+ +F++D  V+ LI +GIPFVA TQ
Sbjct  377   KDYDKATATASRVLQLGFVLGLMLAAILGVGLQYGARLFTRDVGVLHLIGVGIPFVAATQ  436

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             P+N+LAFV DGVNFGASDF YSA+SM++VA ++I   F+   +NGF+GIW+ALAI+M LR
Sbjct  437   PLNTLAFVFDGVNFGASDFAYSAFSMILVAIVSILVLFVLSSTNGFIGIWVALAIYMSLR  496

Query  226   TIAGLWRLATGTGPWCFLRA  167
             T+AG WR+ T TGPW FLRA
Sbjct  497   TLAGFWRIGTRTGPWEFLRA  516



>ref|XP_009366106.1| PREDICTED: MATE efflux family protein 1-like [Pyrus x bretschneideri]
 ref|XP_009366107.1| PREDICTED: MATE efflux family protein 1-like [Pyrus x bretschneideri]
 ref|XP_009366108.1| PREDICTED: MATE efflux family protein 1-like [Pyrus x bretschneideri]
 ref|XP_009366109.1| PREDICTED: MATE efflux family protein 1-like [Pyrus x bretschneideri]
 ref|XP_009366110.1| PREDICTED: MATE efflux family protein 1-like [Pyrus x bretschneideri]
 ref|XP_009366111.1| PREDICTED: MATE efflux family protein 1-like [Pyrus x bretschneideri]
 ref|XP_009366112.1| PREDICTED: MATE efflux family protein 1-like [Pyrus x bretschneideri]
 ref|XP_009366113.1| PREDICTED: MATE efflux family protein 1-like [Pyrus x bretschneideri]
 ref|XP_009366114.1| PREDICTED: MATE efflux family protein 1-like [Pyrus x bretschneideri]
 ref|XP_009366115.1| PREDICTED: MATE efflux family protein 1-like [Pyrus x bretschneideri]
Length=516

 Score =   450 bits (1157),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 264/440 (60%), Positives = 320/440 (73%), Gaps = 22/440 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLET-----MENGSLTIP  1307
             V++TTSFVAEE      D    VS K             D+D LET      E   L   
Sbjct  94    VSVTTSFVAEE------DAMGTVSPK-----------ANDNDYLETGSSMNDETQQLIPE  136

Query  1306  SSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             S+ T+ +     + AS    K    K  +PSAS+A+++G ILG++Q +FL   AKPLL  
Sbjct  137   SNTTQNAYNSKSVVASFEIVKNDYQKRYMPSASSAMVIGSILGLIQAIFLIAGAKPLLNF  196

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGV   S ML PA +YL LRSLG+PAVLLSLA+QGIFRG KDTKTPLYAT AGD+ NIIL
Sbjct  197   MGVGSDSPMLKPAQQYLMLRSLGAPAVLLSLAMQGIFRGFKDTKTPLYATVAGDVTNIIL  256

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI   H GVSGAAIAHVISQY++  ILL +L  EV+LLPPS KHL+ S+FLKNG  L
Sbjct  257   DPIFIFVFHLGVSGAAIAHVISQYLICFILLRRLAAEVDLLPPSIKHLEFSRFLKNGFLL  316

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
               RVIAATFCVTLAASLAAR G T MAAFQVCLQIWL +SLLADGLA+AGQAILA+AFA 
Sbjct  317   LMRVIAATFCVTLAASLAARQGPTPMAAFQVCLQIWLATSLLADGLAVAGQAILASAFAK  376

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY KA A A+RVLQ+GFV+G  LA ++G+GL +G+ +F++D  V+ LI +GIPFVA TQ
Sbjct  377   KDYDKATATASRVLQLGFVLGLMLAAILGVGLQYGARLFTRDVGVLHLIGVGIPFVAATQ  436

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             P+N+LAFV DGVNFGASDF YSA+SM++VA ++I   ++   +NGF+GIW+ALAI+M LR
Sbjct  437   PLNTLAFVFDGVNFGASDFAYSAFSMILVAIVSILVLYVLSSTNGFIGIWVALAIYMSLR  496

Query  226   TIAGLWRLATGTGPWCFLRA  167
             T+AG WR+ T TGPW FLRA
Sbjct  497   TLAGFWRIGTRTGPWEFLRA  516



>ref|XP_002884678.1| hypothetical protein ARALYDRAFT_478146 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60937.1| hypothetical protein ARALYDRAFT_478146 [Arabidopsis lyrata subsp. 
lyrata]
Length=530

 Score =   450 bits (1158),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 255/438 (58%), Positives = 330/438 (75%), Gaps = 15/438 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTSFVAEE++  ++ ++ +K  ++ V++E  + ++         ++E G  +  S+ 
Sbjct  96    VSLTTSFVAEEDTMEKMKEEANK--ASLVHAETILVQD---------SLEKGISSPTSNN  144

Query  1297  TKGSSALS--DLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
             T     L   D +++  +   K+GK  I +AST++++G ILG++Q +FL   +K LLG M
Sbjct  145   TNQPQQLPALDTKSNSGNKATKKGKRTIRTASTSMILGLILGLVQAIFLIFSSKLLLGFM  204

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVKP S ML+PA +YL++R+LG+PA+LLSLA+QG+FRG KDTKTPL+AT   D++NI LD
Sbjct  205   GVKPNSPMLSPAHKYLSIRALGAPALLLSLAMQGVFRGFKDTKTPLFATVVADVINIALD  264

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     G+SGAAIAHVISQY + LIL   L ++V L+PP+   LQ  +FLKNG+ L 
Sbjct  265   PIFIFVLRLGISGAAIAHVISQYFMTLILFVCLAKKVNLIPPNFGDLQFGRFLKNGILLL  324

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
             AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLTSSLL DGLA+AGQAILA +FA K
Sbjct  325   ARTIAVTFCQTLAAAMAARLGTTPMAAFQICLQVWLTSSLLNDGLAVAGQAILACSFAEK  384

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             DY K  A A+RVLQMGFV+G GL+V VGLGLYFGSG+FSKD  VI L+TIGIPF+A TQP
Sbjct  385   DYNKVTAVASRVLQMGFVLGLGLSVFVGLGLYFGSGIFSKDPAVIHLMTIGIPFIAATQP  444

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             INSLAFVLDGVNFGASDF Y+AYSMV VAA++IG      K+NGF+GIWIAL I+M LR 
Sbjct  445   INSLAFVLDGVNFGASDFAYTAYSMVGVAAISIGAVIYMAKTNGFIGIWIALTIYMGLRA  504

Query  223   IAGLWRLATGTGPWCFLR  170
             I G+ R+ATGTGPW FLR
Sbjct  505   ITGIARMATGTGPWRFLR  522



>ref|XP_009364984.1| PREDICTED: MATE efflux family protein FRD3-like [Pyrus x bretschneideri]
Length=603

 Score =   452 bits (1164),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 265/435 (61%), Positives = 319/435 (73%), Gaps = 15/435 (3%)
 Frame = -2

Query  1447  AEENSELCDDG--SKEVSAKVYSEE---KVAEE-PGKDSDQLETMENGSLTIPSSETKGS  1286
             AE  SE  D+G      S KV SE     +AE    K+S QLE           S+T   
Sbjct  176   AEAKSEHSDEGLAKNTDSKKVISENVKPAIAENGAAKNSVQLEG---------GSKTTME  226

Query  1285  SALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGS  1106
                SDL  +   +K+++ K  I SASTAL+ G ILG+LQ +FL + AK LLG+MGVKPGS
Sbjct  227   KRPSDLMNNSLKTKIRKKKRHIASASTALIFGAILGLLQAIFLMLTAKVLLGVMGVKPGS  286

Query  1105  TMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILA  926
              ML PA +YLT+RS+G+PAVLL+LA+QGIFRG KDTKTPLY    G  +NI LD + I  
Sbjct  287   PMLAPAKKYLTIRSIGAPAVLLTLAMQGIFRGFKDTKTPLYVIVVGYAINIALDPLLIFV  346

Query  925   CHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAA  746
             C  G+ GAAIAHV+SQY++ L+L   L ++++LLPPS K LQ  +FLKNG  L ARV+A 
Sbjct  347   CGLGIRGAAIAHVLSQYLMALVLFIILTKKIDLLPPSLKDLQFGRFLKNGTLLLARVVAV  406

Query  745   TFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykkak  566
             TFCVTLAASLAARLG T MAAFQ CLQ+WLTSSLLADGLA+AGQAILA AFA KDYKKA 
Sbjct  407   TFCVTLAASLAARLGPTPMAAFQTCLQVWLTSSLLADGLAVAGQAILACAFAEKDYKKAT  466

Query  565   aaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAF  386
             A A RVLQM F++G GLA++VG+GLYFG+GVFS+D NV+ LI IG+PFVA TQPINSL+F
Sbjct  467   ATANRVLQMSFILGVGLALLVGIGLYFGAGVFSRDVNVLHLIKIGLPFVAATQPINSLSF  526

Query  385   VLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWR  206
             V DGVNFGASDF YSAYS+V+VA  +I   FL  KS+GFVGIWIAL I+M LR  AG+WR
Sbjct  527   VFDGVNFGASDFAYSAYSLVLVAIASIVSLFLLSKSHGFVGIWIALTIYMALRAFAGVWR  586

Query  205   LATGTGPWCFLRAST  161
             + TGTGPW FL+  +
Sbjct  587   MGTGTGPWRFLKGRS  601



>ref|XP_008449716.1| PREDICTED: MATE efflux family protein 1 [Cucumis melo]
 ref|XP_008449717.1| PREDICTED: MATE efflux family protein 1 [Cucumis melo]
Length=521

 Score =   449 bits (1154),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 263/437 (60%), Positives = 324/437 (74%), Gaps = 17/437 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++     GS  + A    E+    E G       T +  S  IP +  K
Sbjct  98    VSVTTSFVAEEDTI----GSVSIEA----EDNNDTETG-----FFTNDEKSSMIPQNG-K  143

Query  1291  GSSALSD---LEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
             G  A      L+ +  + KV+ G+  IPSAS+AL++G +LG++Q +FL   A+PLL  MG
Sbjct  144   GEDAHHSRKPLDTTFENGKVENGRRYIPSASSALVIGGVLGLIQAIFLISGARPLLNFMG  203

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             VK  S M+ PA +YLTLRSLG+PAVLLSLAIQG+FRG KDTKTPLYAT AGD  NIILD 
Sbjct  204   VKSDSLMMTPAQQYLTLRSLGAPAVLLSLAIQGVFRGFKDTKTPLYATVAGDATNIILDP  263

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             IFI     GVSGAAIAHVISQY++ LIL ++L+ +V+LLPPS KHLQ S+FLKNG  L  
Sbjct  264   IFIFIFRLGVSGAAIAHVISQYLIALILFWRLMGQVDLLPPSIKHLQFSRFLKNGFLLLM  323

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             RVIA TFCVTLAASLAAR GST MAAFQVCLQ+WLT+SLLADGLA+AGQAILATAFA  D
Sbjct  324   RVIAVTFCVTLAASLAARQGSTSMAAFQVCLQVWLTTSLLADGLAVAGQAILATAFAQND  383

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
             + KA AAA+RVLQ+G  +G  L+V +G+G+ FG+ +F+ D +V+R I IGIPFVA TQPI
Sbjct  384   HDKATAAASRVLQLGLFLGLMLSVFLGVGMTFGAKLFTSDVDVLRFIGIGIPFVAATQPI  443

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTI  221
             N+LAFV DG+NFGASDF YSAYSMV+VA ++I   F+   + GF+GIW+AL I+M LRT+
Sbjct  444   NALAFVFDGINFGASDFAYSAYSMVLVAIISIFCLFILSSTKGFIGIWVALTIYMSLRTL  503

Query  220   AGLWRLATGTGPWCFLR  170
             AG  R+ TGTGPW FLR
Sbjct  504   AGFGRIGTGTGPWYFLR  520



>ref|XP_008461288.1| PREDICTED: MATE efflux family protein FRD3 [Cucumis melo]
 ref|XP_008461289.1| PREDICTED: MATE efflux family protein FRD3 [Cucumis melo]
 ref|XP_008461290.1| PREDICTED: MATE efflux family protein FRD3 [Cucumis melo]
Length=557

 Score =   449 bits (1156),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 272/486 (56%), Positives = 330/486 (68%), Gaps = 53/486 (11%)
 Frame = -2

Query  1471  VNITTSFVAEENS-------------ELCDDGSKEVSAKVY------SEEKVA-------  1370
             V+ITTSFVAEE++             E C D    V  KVY      +EEK+A       
Sbjct  78    VSITTSFVAEEDTIGKAAKKAAKVDTEKCLDDDNSV--KVYVSEDHENEEKLAAKQEHAN  135

Query  1369  --EEP-------GKD----SDQLETMENGSLTIPSSETKGSSALSDLEAS-------ERD  1250
                EP       GKD    + +  + ENG+          + AL DLE            
Sbjct  136   LNHEPTRINISIGKDGVKENKESSSTENGT----KEPIPDNGALQDLEKDLSTKVLKSTS  191

Query  1249  SKVKRG-KLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLT  1073
             +K KR  K +I SASTAL+ G ILG++Q +FL   AK LL LMGVK  S M  PA +YLT
Sbjct  192   AKSKRKEKKQIASASTALIFGTILGLMQAIFLIFGAKSLLNLMGVKDNSPMFAPAHKYLT  251

Query  1072  LRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIA  893
             LRSLG+PAVLLSLA+QGIFRG KDT+TPLY   AG  VNIILD I I  CHWGV GAA A
Sbjct  252   LRSLGAPAVLLSLAMQGIFRGFKDTRTPLYVIVAGYTVNIILDPILIFVCHWGVKGAAAA  311

Query  892   HVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLA  713
             HV+SQY ++ IL ++L+++V L+PPS K LQ  +FLKNG  L ARV+A TFCVTLAASLA
Sbjct  312   HVLSQYFIVTILFWRLVQKVNLMPPSLKDLQFGRFLKNGGLLLARVVAVTFCVTLAASLA  371

Query  712   ARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGF  533
             ARLG T MAAFQ CLQ+W+TSSLL+DGLA+AGQAILA+AFA KDY+K  A A RVLQM F
Sbjct  372   ARLGPTPMAAFQTCLQVWMTSSLLSDGLAVAGQAILASAFAEKDYEKTTATATRVLQMSF  431

Query  532   VMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASD  353
             ++G  LA++VG+G++FG+G+FS+D +V  LI + IPFVA TQPINSLAFV DGVNFGASD
Sbjct  432   ILGVTLAIIVGIGMFFGAGIFSRDIHVQHLIHLAIPFVAATQPINSLAFVFDGVNFGASD  491

Query  352   FFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFL  173
             F YSAYS+V+VA  ++   FL  KSNGF+GIWIAL I+M LR   G+WR+ TGTGPW +L
Sbjct  492   FAYSAYSLVLVAIASVVSLFLLSKSNGFIGIWIALTIYMFLRAFVGVWRMGTGTGPWRYL  551

Query  172   RASTQP  155
             R    P
Sbjct  552   RTQRLP  557



>ref|XP_010257243.1| PREDICTED: MATE efflux family protein 1 [Nelumbo nucifera]
 ref|XP_010257244.1| PREDICTED: MATE efflux family protein 1 [Nelumbo nucifera]
 ref|XP_010257245.1| PREDICTED: MATE efflux family protein 1 [Nelumbo nucifera]
 ref|XP_010257246.1| PREDICTED: MATE efflux family protein 1 [Nelumbo nucifera]
Length=516

 Score =   447 bits (1150),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 264/435 (61%), Positives = 320/435 (74%), Gaps = 11/435 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE      D    VS +    E V +     S+  E +++      S+ T 
Sbjct  93    VSVTTSFVAEE------DTIGRVSIEEVEGENVEKGLAIQSEMKELIQHSD----SNRTV  142

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
               S     + S   SK + GK  IPSAS+AL++G ILG+LQ +FL   AKPLL  MGV  
Sbjct  143   HQSPSRSADNSNM-SKCENGKRHIPSASSALVIGGILGLLQAIFLISGAKPLLNFMGVNS  201

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S MLNPA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NI+LD I I
Sbjct  202   DSPMLNPARQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIVLDPILI  261

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GVSGAAIAHVISQY++ LILL++LI +V+LLPPS K LQ S+FLKNG  L ARVI
Sbjct  262   FVFRLGVSGAAIAHVISQYLISLILLWRLIEQVDLLPPSIKDLQFSRFLKNGFLLLARVI  321

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTLAAS+AA  GST MAAFQVCLQIWL +SLLADGLA+AGQAILA+AFA  DY K
Sbjct  322   AVTFCVTLAASMAAHQGSTSMAAFQVCLQIWLATSLLADGLAVAGQAILASAFARYDYDK  381

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+RVLQ+G V+G  L++++G GL F S +F+KD NV+ LI+IG+PFVA TQPIN+L
Sbjct  382   AIATASRVLQLGLVLGAFLSIILGFGLQFASRLFTKDINVLHLISIGVPFVAATQPINAL  441

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVNFGASDF YSA SMV+VA ++I   F+   + GF+GIW+AL I+M LRT AG 
Sbjct  442   AFVFDGVNFGASDFAYSACSMVLVAIVSILCLFILSSAYGFIGIWVALTIYMSLRTFAGF  501

Query  211   WRLATGTGPWCFLRA  167
             WR+ TGTGPW FLR+
Sbjct  502   WRIGTGTGPWSFLRS  516



>ref|XP_007220832.1| hypothetical protein PRUPE_ppa027104mg [Prunus persica]
 gb|EMJ22031.1| hypothetical protein PRUPE_ppa027104mg [Prunus persica]
Length=560

 Score =   448 bits (1153),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 268/473 (57%), Positives = 328/473 (69%), Gaps = 39/473 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENS-----------------ELCDDGSKEVSA-------------KVYSE  1382
             V+ITTSFVAEE++                 ++ DD  K  +              K  +E
Sbjct  93    VSITTSFVAEEDTVAKMNIKSEKGKQLQKADMLDDLEKGAAKPNGTAKENGKHLEKFSTE  152

Query  1381  EKVAEEPGKDSDQLETMENGSLTIPSSETKGSSALSDL----EASERDSKVKRGKLRIPS  1214
                 EE   + D+   +  G+L     E KG S+ + L    EA++  +K+K+ K  I S
Sbjct  153   NSKMEEASAEDDEHVAVGKGAL-----EAKGESSDNGLPESSEANKALAKIKKQKRHIAS  207

Query  1213  ASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSL  1034
             ASTAL+ G ILG+LQ +FL   AK LLG+MGVK  S ML PA +YL +RS+G+PAVLL+L
Sbjct  208   ASTALIFGAILGLLQAIFLMFTAKVLLGVMGVKSDSPMLAPAHKYLRIRSIGAPAVLLTL  267

Query  1033  AIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllill  854
             A+QGIFRG KDTKTPLY   AG  VNI LD + I  C  G+ GAAIAHV+SQY++ L+L 
Sbjct  268   AMQGIFRGFKDTKTPLYVIVAGYAVNIALDPLLIFVCGLGIRGAAIAHVLSQYLMALVLF  327

Query  853   fklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQV  674
               L  +++LLPPS K LQ  +FL+NG  L ARV+A TFCVTLAASLAAR G T MAAFQ 
Sbjct  328   IILTTKIDLLPPSIKDLQFGRFLRNGTLLLARVVAVTFCVTLAASLAAREGPTPMAAFQT  387

Query  673   CLQIWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglg  494
             CLQ+WLTSSLLADGLA+AGQAILA AFA KDYKKA A A RVLQM FV+G GLA +VG+G
Sbjct  388   CLQVWLTSSLLADGLAVAGQAILACAFAEKDYKKATATATRVLQMSFVLGVGLAFIVGIG  447

Query  493   LYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAA  314
             LYFG+G+FS+D NV+ LI IG+PFVA TQPINSL+FV DGVNFGASDF YSAYS+V+VA 
Sbjct  448   LYFGAGIFSRDVNVLHLIRIGLPFVAATQPINSLSFVFDGVNFGASDFAYSAYSLVLVAI  507

Query  313   MTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
              +I   FL  KS+GFVGIWIAL I+M LR  AG+WR+ TGTGPW FL+  + P
Sbjct  508   ASIVSLFLLSKSHGFVGIWIALTIYMALRAFAGVWRMGTGTGPWRFLKGRSPP  560



>ref|XP_004142114.1| PREDICTED: MATE efflux family protein 1-like [Cucumis sativus]
 ref|XP_004161692.1| PREDICTED: MATE efflux family protein 1-like [Cucumis sativus]
Length=521

 Score =   447 bits (1149),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 264/441 (60%), Positives = 326/441 (74%), Gaps = 25/441 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLE----TMENGSLTIPS  1304
             V++TTSFVAEE++     GS  + A+             D++ +E    T +  S  IP 
Sbjct  98    VSVTTSFVAEEDTI----GSVSIEAE-------------DNNDMESGFFTNDEKSSMIPQ  140

Query  1303  SETKGSSALSD---LEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
             +  KG  A      LE    +SKV+ G+  IPSAS+AL++G +LG++Q +FL   A+PLL
Sbjct  141   N-GKGEDAHHSRKPLEKKFENSKVENGRRYIPSASSALVIGGVLGLIQAIFLISGARPLL  199

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
               MGVK  S M+ PA +YLTLRSLG+PAVLLSLAIQG+FRG KDTKTPLYAT AGD  NI
Sbjct  200   NFMGVKSDSLMMTPAQQYLTLRSLGAPAVLLSLAIQGVFRGFKDTKTPLYATVAGDATNI  259

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             ILD IFI     GVSGAAIAHVISQY++ LIL ++L+ +V+LLPPS KHLQ S+FLKNG 
Sbjct  260   ILDPIFIFVFRLGVSGAAIAHVISQYLIALILFWRLMGQVDLLPPSIKHLQFSRFLKNGF  319

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L  RVIA TFCVTLAASL+AR GST MAAFQVCLQ+WLT+SLLADGLA+AGQAILATAF
Sbjct  320   LLLMRVIAVTFCVTLAASLSARQGSTSMAAFQVCLQVWLTTSLLADGLAVAGQAILATAF  379

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
             A  D+ KA AAA+RVLQ+G  +G  LAV +G+G+ FG+ +F+ D +V+RLI IGIPFVA 
Sbjct  380   AQNDHDKATAAASRVLQLGLFLGLMLAVFLGVGMTFGARLFTSDVDVLRLIGIGIPFVAA  439

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFML  233
             TQPIN+LAFV DG+NFGASDF YSA SMV+VA ++I   F+   + GF+GIW+AL I+M 
Sbjct  440   TQPINALAFVFDGINFGASDFAYSACSMVLVAIISIFCLFILSSTQGFIGIWVALTIYMS  499

Query  232   LRTIAGLWRLATGTGPWCFLR  170
             LRT+AG  R+ TGTGPW FLR
Sbjct  500   LRTLAGFGRIGTGTGPWYFLR  520



>ref|XP_009778889.1| PREDICTED: MATE efflux family protein 1-like isoform X3 [Nicotiana 
sylvestris]
Length=523

 Score =   447 bits (1149),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 253/436 (58%), Positives = 319/436 (73%), Gaps = 4/436 (1%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++      S+++      E+   +    D+D     E+ SL IP +++ 
Sbjct  91    VSVTTSFVAEEDT--ITKASQDLQNDKIKEQNEGDAEAMDTDSPSNSESKSL-IPKNDST  147

Query  1291  GSSALS-DLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
             GS   S  + +S    K K  K  IPSAS AL++G +LGI+Q  FL   AKPLL  MG+K
Sbjct  148   GSVCKSVKMASSFEVVKPKPEKRHIPSASAALIIGAVLGIIQAAFLIAGAKPLLKFMGIK  207

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
             PGS M  PA  YL LRSLG+PAVLLSLA+QG+FRG KDTKTPL+AT AGDL NIILD IF
Sbjct  208   PGSAMSKPAEDYLRLRSLGAPAVLLSLAMQGVFRGFKDTKTPLFATVAGDLANIILDPIF  267

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +   H GV GAAIAHVISQY++ +IL ++L+ +V+L+PPS K+LQ ++FL NG  L  RV
Sbjct  268   MFVFHLGVRGAAIAHVISQYLISVILFWRLMEKVDLVPPSLKYLQFARFLTNGFLLLVRV  327

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAASLAARLG+T MAAFQVCLQ+WL +SLLADGLAIAGQAILA+AFA +D+ 
Sbjct  328   IAVTFCVTLAASLAARLGATQMAAFQVCLQVWLATSLLADGLAIAGQAILASAFAQEDFT  387

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +  A A+RVLQ+G V+G  LA+ +G+ L++G+ VF+KD +V+ LI IGIPFVA TQPIN 
Sbjct  388   RCTATASRVLQLGVVLGLILALTLGVCLHYGARVFTKDVDVLHLIGIGIPFVAATQPINC  447

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DGVNFGA+DF YSAYSM+ VA  +I    +   S G +GIWIAL I+M LR +AG
Sbjct  448   LAFVFDGVNFGAADFAYSAYSMLTVAIFSIVLLLILSSSFGLIGIWIALTIYMSLRALAG  507

Query  214   LWRLATGTGPWCFLRA  167
               R+ TGTGPW FLR+
Sbjct  508   FGRIGTGTGPWKFLRS  523



>ref|XP_010673638.1| PREDICTED: MATE efflux family protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=511

 Score =   445 bits (1145),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 258/442 (58%), Positives = 322/442 (73%), Gaps = 30/442 (7%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++                      E G +  ++E +E+ S +  ++E K
Sbjct  93    VSVTTSFVAEEDA--------------------VAEVGSEQQKIECLESNSSS--NNEAK  130

Query  1291  ------GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
                   G S      +S      K  K  IPSAS+AL++G ILG+LQ +FL  LAKPLL 
Sbjct  131   ELLPQSGESTFKFKTSSFSVESSKPQKRHIPSASSALVIGAILGLLQAIFLISLAKPLLN  190

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
              MGVKP S ML PA RYLTLRSLG+PAVLLSLA+QGIFRG KDTKTPLYAT AGD+ NII
Sbjct  191   YMGVKPDSPMLPPAKRYLTLRSLGAPAVLLSLAMQGIFRGFKDTKTPLYATVAGDVTNII  250

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD IF+     GVSGAAI+HVISQY++ +IL ++LI+ V+LLPPS + L+  +FLKNG  
Sbjct  251   LDPIFMFVFRLGVSGAAISHVISQYLISIILFWRLIQLVDLLPPSIRDLKFGRFLKNGFL  310

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L  RVIA TFCVTLAAS+AARLG T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA
Sbjct  311   LLMRVIAVTFCVTLAASMAARLGPTQMAAFQVCLQVWLATSLLADGLAVAGQAILASAFA  370

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
               D+++A + A+RVLQ+GFV+G  L  ++G GL F + +F+KD +V+ LITIGIPFVA T
Sbjct  371   KNDFERATSTASRVLQLGFVLGLALCFMLGFGLKFAARLFTKDVDVLNLITIGIPFVALT  430

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN-GFVGIWIALAIFML  233
             QP+N+LAFV DG+NFGASDF YSA+SMVMVA M+I    +FL S+ GF+GIW+AL I+M 
Sbjct  431   QPVNALAFVFDGINFGASDFAYSAFSMVMVAVMSI-LCLMFLSSHYGFIGIWVALTIYMS  489

Query  232   LRTIAGLWRLATGTGPWCFLRA  167
             LR  AG WR+ TGTGPW FLR+
Sbjct  490   LRAFAGFWRIGTGTGPWSFLRS  511



>ref|XP_011080338.1| PREDICTED: MATE efflux family protein 1 [Sesamum indicum]
Length=513

 Score =   444 bits (1143),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 263/444 (59%), Positives = 319/444 (72%), Gaps = 32/444 (7%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGS-------LT  1313
             V++TTSFVAEE     D  +K+V+               D    E++ENGS       + 
Sbjct  91    VSVTTSFVAEE-----DTITKDVA---------------DCKDSESLENGSSLDSENKML  130

Query  1312  IPSSETKGSSALSDLEA---SERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAK  1142
             IP  +T     +  LE+   S   SK ++GK +I SAS+AL++G +LGILQ  FL + AK
Sbjct  131   IP--QTDSDKKMCKLESGGNSFEISKTEQGKKQIASASSALIIGAVLGILQAAFLILAAK  188

Query  1141  PLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDL  962
             PLL  MGVKP S M  PA +YL LRSLG+PAVLLSLA+QG+FRGLKDTKTPLYAT  GDL
Sbjct  189   PLLSFMGVKPDSEMSYPAQQYLKLRSLGAPAVLLSLAMQGVFRGLKDTKTPLYATVVGDL  248

Query  961   VNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLK  782
              NI+LD IF+     GV GAAIAHVISQY++ LIL+++L +EV L+PPS K+LQ  +F+K
Sbjct  249   ANIVLDPIFMFVFKLGVRGAAIAHVISQYLISLILIWRLKQEVNLIPPSLKYLQFERFIK  308

Query  781   NGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILA  602
             NG  L  RVIA TFCVTLAAS+AARLGST MAAFQVCLQ+WL +SLLADGLA+AGQAILA
Sbjct  309   NGFLLLTRVIAVTFCVTLAASMAARLGSTQMAAFQVCLQVWLATSLLADGLAVAGQAILA  368

Query  601   TafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPF  422
             +AFA KDY  A A A+RVLQ+G  +G  LAVV+G GL+FG+ +F++D  V+ LI +GIPF
Sbjct  369   SAFARKDYSWATATASRVLQLGIALGLVLAVVLGFGLHFGARIFTEDAGVLHLIGVGIPF  428

Query  421   VAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAI  242
             VA TQPIN+LAFV DGVNFGASDF YSAYSMV VA ++I        S GFVGIW AL I
Sbjct  429   VAATQPINTLAFVFDGVNFGASDFAYSAYSMVTVAIISIITLLALCSSGGFVGIWTALTI  488

Query  241   FMLLRTIAGLWRLATGTGPWCFLR  170
             +M LR  AG WR+ TGTGPW FLR
Sbjct  489   YMSLRAFAGFWRIGTGTGPWAFLR  512



>dbj|BAM68465.1| multi drugs and toxic compounds exclusion protein [Eucalyptus 
camaldulensis]
Length=582

 Score =   446 bits (1148),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 277/451 (61%), Positives = 336/451 (75%), Gaps = 12/451 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVA-EEPGKDSDQLETMENGSLT----  1313
             V+ITTSFVAEE +  + C    ++ + K  S + +  +E   D + LE +E GS      
Sbjct  129   VSITTSFVAEEETIGKTCASLEEDENPKKCSPKNIEMKELMPDDEMLEKLERGSTNNREV  188

Query  1312  ---IPSSETKGSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVL  1148
                +P+ +   ++  S    S +  K K  K R  IPSASTAL++G ILG+LQT+ L   
Sbjct  189   TDLVPTEDFSATTCKSTPIFSSKPKKAKLSKERRHIPSASTALVLGGILGLLQTLLLIFG  248

Query  1147  AKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAG  968
             AKPLL LMG+K GS M+ PA +YLTLR+LG+PAVLLSLA+QG+FRG KDTKTPLYAT AG
Sbjct  249   AKPLLSLMGIKSGSPMMTPARKYLTLRALGAPAVLLSLAMQGVFRGFKDTKTPLYATIAG  308

Query  967   DLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKF  788
             DL NI+LD I I  C  GVSGAAIAHV+SQY++ LILL +L+++V LLPPS K LQ  +F
Sbjct  309   DLTNIVLDPILIFVCGLGVSGAAIAHVLSQYLISLILLLRLMKQVNLLPPSCKDLQFRRF  368

Query  787   LKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAI  608
             LKNG+ L ARVIAAT CVTLAAS AARLGS  MAAFQVCLQ+W+TSSLLADGLA+AGQAI
Sbjct  369   LKNGILLLARVIAATICVTLAASTAARLGSIPMAAFQVCLQVWMTSSLLADGLAVAGQAI  428

Query  607   LATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGI  428
             LA+AFA KDY +A AA  RVLQMGFV+G GLAV+VG+GL FGSGVFSKD NV  LI +GI
Sbjct  429   LASAFAEKDYDRAIAAGVRVLQMGFVLGMGLAVLVGVGLRFGSGVFSKDINVQHLIFVGI  488

Query  427   PFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIAL  248
             PF+A TQPIN LAFVLDGVNFGASDF YSAYSMV V+ ++I   FL  KS G+VGIW+AL
Sbjct  489   PFIAATQPINCLAFVLDGVNFGASDFAYSAYSMVTVSLISIASLFLLSKSTGYVGIWVAL  548

Query  247   AIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
              I+M+LR + GL R+ TG+GPW F+R    P
Sbjct  549   TIYMVLRALVGLGRMGTGSGPWRFIREGLLP  579



>ref|XP_010534647.1| PREDICTED: MATE efflux family protein FRD3 [Tarenaya hassleriana]
Length=545

 Score =   445 bits (1145),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 272/451 (60%), Positives = 334/451 (74%), Gaps = 16/451 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGS-KEVSAKVYSEEKVAEEPGKDSDQLETMENG-------  1322
             V+ITTSFVAEE++  ++  + + K+VS  +   E+ AEE G+   + + ME G       
Sbjct  94    VSITTSFVAEEDTMEKMNKEAAEKKVSNAIVVPERNAEETGQSIPE-DAMEKGIVSSAAA  152

Query  1321  ----SLTIPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLT  1154
                 ++  P      S A +++  + +  K   GK  I SASTAL++G ILG LQ VFL 
Sbjct  153   AVKETIETPLPPKNDSEARTNISENNKAEK-GNGKRYIRSASTALILGLILGFLQAVFLI  211

Query  1153  VLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATA  974
               +K LLG+MGVK  S M  PA +YLTLRSLG+PAVLLSLA+QGIFRG KDT+TPLYAT 
Sbjct  212   FSSKGLLGIMGVKQNSPMFPPAKKYLTLRSLGAPAVLLSLAMQGIFRGFKDTRTPLYATV  271

Query  973   AGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLS  794
             AGDL+N++LD IFI     GVSGAAIAHV+SQY++ LIL  +L ++V+L+PPS   LQ S
Sbjct  272   AGDLMNVVLDPIFIFVLRLGVSGAAIAHVLSQYLICLILFLRLAKKVKLMPPSLGDLQFS  331

Query  793   KFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQ  614
             +FLKNG  L ARV+A TFCVTLAAS+A RLGS  MAAFQ+CLQ+WLTSSLLADGLA+AGQ
Sbjct  332   RFLKNGFLLLARVVAVTFCVTLAASMATRLGSNPMAAFQICLQVWLTSSLLADGLAVAGQ  391

Query  613   AILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITI  434
             AILA AFA +DY K  A A+RVLQMGF++G GLA+  GLGLYFGSG+FSKD NVI  ITI
Sbjct  392   AILACAFAERDYNKVTAVASRVLQMGFILGLGLALCTGLGLYFGSGMFSKDPNVIHYITI  451

Query  433   GIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWI  254
             GIPFVA TQPINSLAFV DGVNFGASDF Y+AYSMV VAA++I       KS+GFVGIW+
Sbjct  452   GIPFVAATQPINSLAFVFDGVNFGASDFAYTAYSMVAVAAVSIVAVIFLAKSSGFVGIWV  511

Query  253   ALAIFMLLRTIAGLWRLATGTGPWCFLRAST  161
             AL I+M LR IAG+ R+ TGTGPW F+R+ +
Sbjct  512   ALTIYMALRAIAGIARMGTGTGPWKFMRSQS  542



>ref|XP_004136118.1| PREDICTED: MATE efflux family protein FRD3-like [Cucumis sativus]
Length=532

 Score =   444 bits (1143),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 257/455 (56%), Positives = 317/455 (70%), Gaps = 16/455 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS-------------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETM  1331
             V+ITTSFVAEE++             E C      V   V  + +  E+     D     
Sbjct  78    VSITTSFVAEEDTIGKAAKKAAKVDAEKCLADVNSVKVCVPEDHENEEKLAAKQDHANLN  137

Query  1330  EN---GSLTIPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVF  1160
                   +++I     K +   S  E   ++      K +I SASTAL+ G ILG++Q +F
Sbjct  138   HEPTRSNISIGKDGVKENKESSSTENGTKEPIPDNEKKQIASASTALIFGTILGLMQAIF  197

Query  1159  LTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYA  980
             L   AK LL LMGVK  S M  PA +YLTLRSLG+PAVLLSLA+QGIFRG KDT+TPLY 
Sbjct  198   LIFGAKSLLNLMGVKDNSPMFAPAHKYLTLRSLGAPAVLLSLAMQGIFRGFKDTRTPLYV  257

Query  979   TAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQ  800
               AG  VNIILD I I  CHWGV GAA AHV+SQY ++ IL ++L+++V L+PPS K LQ
Sbjct  258   IVAGYTVNIILDPILIFVCHWGVKGAAAAHVLSQYFIVTILFWRLVQKVNLMPPSLKDLQ  317

Query  799   LSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIA  620
               +FLKNG  L ARV+A TFCVTLAASLAARLG T MAAFQ CLQ+W+TSSLL+DGLA+A
Sbjct  318   FGRFLKNGGLLLARVVAVTFCVTLAASLAARLGPTPMAAFQTCLQVWMTSSLLSDGLAVA  377

Query  619   GQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLI  440
             GQAILA+AFA KDY+K  A A RVLQM F++G GLA++VG+G++FG+G+FS+D +V  LI
Sbjct  378   GQAILASAFAEKDYEKTTATATRVLQMSFILGVGLAIIVGIGMFFGAGIFSRDIHVQHLI  437

Query  439   TIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGI  260
              + IPFVA TQPINSLAFV DGVNFGASDF YSAYS+V+VA  ++   FL  KSNGF+GI
Sbjct  438   HLAIPFVAATQPINSLAFVFDGVNFGASDFAYSAYSLVLVAIASVVSLFLLSKSNGFIGI  497

Query  259   WIALAIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
             WIAL I+MLLR   G+WR++TGTGPW +LR    P
Sbjct  498   WIALTIYMLLRAFVGVWRMSTGTGPWRYLRTQRLP  532



>dbj|BAN67819.1| citrate transporting MATE [Nicotiana tabacum]
Length=520

 Score =   443 bits (1140),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 253/436 (58%), Positives = 320/436 (73%), Gaps = 7/436 (2%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++      S+++      E+   +    D+D     E+ SL IP +   
Sbjct  91    VSVTTSFVAEEDT--ITKASQDLQNDKIKEQNEGDAEAMDTDSPSNSESKSL-IPKN---  144

Query  1291  GSSALSDLEASERDS-KVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
             GS   S+  AS  +  K K  K  IPSAS AL++G +LGI+Q  FL   AKPLL  MG+K
Sbjct  145   GSVCKSEKMASSFEVVKPKPEKRHIPSASAALIIGAVLGIIQAAFLIAGAKPLLKFMGIK  204

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
             PGS M  PA  YL LRSLG+PAVLLSLA+QG+FRG KDTKTPL+AT AGDL NIILD IF
Sbjct  205   PGSAMSKPAEDYLRLRSLGAPAVLLSLAMQGVFRGFKDTKTPLFATVAGDLANIILDPIF  264

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +   H GV GAAIAHVISQY++ +IL ++L+ +V+L+PPS K+LQ ++FL NG  L  RV
Sbjct  265   MFVFHLGVRGAAIAHVISQYLISVILFWRLMEKVDLVPPSLKYLQFARFLTNGFLLLVRV  324

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAASLAARLG T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA +D+ 
Sbjct  325   IAVTFCVTLAASLAARLGPTQMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAQEDFS  384

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +  A A++VLQ+G V+G  LA+ +G+GL++G+ VF++D +V+ LI IGIPFVA TQPIN 
Sbjct  385   RCTATASKVLQLGVVLGLVLALTLGVGLHYGARVFTQDVDVLHLIAIGIPFVAATQPINC  444

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DGVNFGASDF YSAYSM+ VA  +I F  +   S G++GIW+AL I+M LR +AG
Sbjct  445   LAFVFDGVNFGASDFAYSAYSMLTVAIFSIVFLLILSSSFGYIGIWVALTIYMSLRALAG  504

Query  214   LWRLATGTGPWCFLRA  167
               R+ TGTGPW FLR+
Sbjct  505   FGRIGTGTGPWKFLRS  520



>ref|XP_010067871.1| PREDICTED: MATE efflux family protein FRD3-like [Eucalyptus grandis]
 dbj|BAO56823.1| putative multi drugs and toxic compounds exclusion proteins [Eucalyptus 
grandis x Eucalyptus urophylla]
Length=582

 Score =   445 bits (1145),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 280/455 (62%), Positives = 337/455 (74%), Gaps = 20/455 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELC-----DDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLT  1313
             V+ITTSFVAEE +  + C     D+  K+ S K  +E K   E   D + L+ +E GS  
Sbjct  129   VSITTSFVAEEETIRKTCASLEEDENPKKCSTK-NTEMK---ELMPDDEMLKKLERGSTN  184

Query  1312  -------IPSSETKGSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVF  1160
                    +P+ +   ++  S    S +  K K  K R  IPSASTAL++G ILG+LQT+F
Sbjct  185   NREVKDLVPTEDFSATTCKSTPIFSSKPKKAKLSKERRHIPSASTALVLGGILGLLQTLF  244

Query  1159  LTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYA  980
             L   AK LL LMG+K  S M+ PA +YLTLR+LG+PAVLLSLA+QG+FRG KDTKTPLYA
Sbjct  245   LIFGAKLLLSLMGIKSDSPMMTPARKYLTLRALGAPAVLLSLAMQGVFRGFKDTKTPLYA  304

Query  979   TAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQ  800
             T AGDL NI+LD I I  C  GVSGAAIAHV+SQY++ LILL +L+++V LLPPS K LQ
Sbjct  305   TVAGDLTNIVLDPILIFVCGLGVSGAAIAHVLSQYLISLILLLRLMKQVNLLPPSCKDLQ  364

Query  799   LSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIA  620
               +FLKNG+ L ARVIAAT CVTLAAS AARLGS  MAAFQVCLQ+W+TSSLLADGLA+A
Sbjct  365   FRRFLKNGILLLARVIAATICVTLAASTAARLGSIPMAAFQVCLQVWMTSSLLADGLAVA  424

Query  619   GQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLI  440
             GQAILA+AFA KDY +A AA  RVLQMGFV+G GLAV+VG+GL FGSGVFSKD NV  LI
Sbjct  425   GQAILASAFAEKDYDRAIAAGVRVLQMGFVLGMGLAVLVGVGLRFGSGVFSKDINVQHLI  484

Query  439   TIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGI  260
              +GIPF+A TQPIN LAFVLDGVNFGASDF YSAYSMV V+ ++I   FL  KSNG+VGI
Sbjct  485   FVGIPFIAATQPINCLAFVLDGVNFGASDFAYSAYSMVTVSLISIASLFLLSKSNGYVGI  544

Query  259   WIALAIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
             W+AL I+M+LR + GL R+ TG+GPW F+R    P
Sbjct  545   WVALTIYMVLRALVGLGRMGTGSGPWRFIREGLLP  579



>ref|XP_010906079.1| PREDICTED: MATE efflux family protein 1 isoform X5 [Elaeis guineensis]
Length=471

 Score =   441 bits (1134),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 261/436 (60%), Positives = 319/436 (73%), Gaps = 13/436 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEE-KVAEEPGKDSDQLETMENGSLTIPSSET  1295
             V++TTSFVAEE++          + K+ SEE +  E+ G  S   E  E      P    
Sbjct  47    VSVTTSFVAEEDA----------TCKMASEEFECGEQEGTFSIDSEMKELIPRNDPERTV  96

Query  1294  KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
               SS  SD   S    K+ R +  IPSAS+AL +G ILG+LQ + L   A P+L  MGVK
Sbjct  97    HNSSPCSD--KSICTIKLGRERKHIPSASSALAIGGILGLLQALILIFGAIPILNFMGVK  154

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
             P S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD  NIILD IF
Sbjct  155   PDSPMLTPACQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDATNIILDPIF  214

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +   H GVSGAAIAHVISQY++ LILL++L+REV++LPPS K LQ S+FLKN   L ARV
Sbjct  215   MFVFHLGVSGAAIAHVISQYLIALILLWRLLREVDVLPPSIKDLQFSRFLKNSFLLLARV  274

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAAS+AAR GS  MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA +D+ 
Sbjct  275   IAVTFCVTLAASMAARQGSIPMAAFQICLQIWLATSLLADGLAVAGQAILASAFARRDHA  334

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +A AAA+RVLQ G ++G  L V++G+GL F S +F+KD NV++LI IGIPFVA TQPIN+
Sbjct  335   RATAAASRVLQWGVILGLVLCVILGIGLQFASRLFTKDANVLQLIHIGIPFVALTQPINA  394

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DG+NFGASDF YSAYSMV+VA ++I    +   S+GF+GIW+AL I+M LR  AG
Sbjct  395   LAFVFDGINFGASDFSYSAYSMVLVAIVSILCLVVLSSSHGFIGIWVALTIYMSLRMFAG  454

Query  214   LWRLATGTGPWCFLRA  167
              WR+ T  GPW FLR+
Sbjct  455   FWRIGTARGPWAFLRS  470



>ref|XP_010557794.1| PREDICTED: MATE efflux family protein FRD3-like [Tarenaya hassleriana]
Length=545

 Score =   443 bits (1140),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 272/451 (60%), Positives = 332/451 (74%), Gaps = 15/451 (3%)
 Frame = -2

Query  1471  VNITTSFVAEE------NSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLT-  1313
             V+ITTSFVAEE      N E+  D  K +++ +    + AEEP + + + ++ME G  + 
Sbjct  96    VSITTSFVAEEDTMDKMNDEVVPDSDKGLNSILVVPGRNAEEPEQSAPE-DSMEKGIASS  154

Query  1312  -------IPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLT  1154
                    +PS     +   + +  S +  K K GK  I SASTAL++G ILG+LQ + L 
Sbjct  155   AAAKVPSLPSENGSDTKTGNPMPKSSKAEKGKSGKRHIRSASTALILGLILGLLQAIILV  214

Query  1153  VLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATA  974
               +K LL +MGVK  S ML PA +YL LRS+G+PAVLLSLA+QGIFRG KDT+TPLYA  
Sbjct  215   FSSKVLLSVMGVKHNSPMLRPAHKYLILRSVGAPAVLLSLAMQGIFRGFKDTRTPLYAIV  274

Query  973   AGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLS  794
             AGD +NI+LD IFI     GVSGAAIAHV+SQY++ LIL  +L ++V L+PPS   LQ S
Sbjct  275   AGDAMNIVLDPIFIFVLRLGVSGAAIAHVLSQYLICLILFIRLAKKVNLMPPSLGDLQFS  334

Query  793   KFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQ  614
             +FLKNG+ L ARV+A TFCVTLAAS+AARLGST MAAFQ+CLQ+WLTSSLLADGLA+AGQ
Sbjct  335   RFLKNGVLLLARVVAVTFCVTLAASMAARLGSTPMAAFQICLQVWLTSSLLADGLAVAGQ  394

Query  613   AILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITI  434
             AILA AFA KDY K  AAA+RVLQMGFV+G GLA+  GLGLYFGSG+FSKD NVI LI +
Sbjct  395   AILACAFAEKDYNKVTAAASRVLQMGFVLGLGLALCTGLGLYFGSGIFSKDPNVIHLIVV  454

Query  433   GIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWI  254
             GIPFVA TQPINSLAFV DGVNFGASDF Y+AYSMV VAA+++    L  KS GFVGIW 
Sbjct  455   GIPFVAATQPINSLAFVFDGVNFGASDFAYTAYSMVAVAAVSVAAVILMAKSGGFVGIWS  514

Query  253   ALAIFMLLRTIAGLWRLATGTGPWCFLRAST  161
             AL I+M LR IAG+ RL +GTGPW F+R+ +
Sbjct  515   ALTIYMALRAIAGIARLGSGTGPWKFMRSRS  545



>ref|XP_010906076.1| PREDICTED: MATE efflux family protein 1 isoform X2 [Elaeis guineensis]
Length=509

 Score =   441 bits (1134),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 261/436 (60%), Positives = 319/436 (73%), Gaps = 13/436 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEE-KVAEEPGKDSDQLETMENGSLTIPSSET  1295
             V++TTSFVAEE++          + K+ SEE +  E+ G  S   E  E      P    
Sbjct  85    VSVTTSFVAEEDA----------TCKMASEEFECGEQEGTFSIDSEMKELIPRNDPERTV  134

Query  1294  KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
               SS  SD   S    K+ R +  IPSAS+AL +G ILG+LQ + L   A P+L  MGVK
Sbjct  135   HNSSPCSD--KSICTIKLGRERKHIPSASSALAIGGILGLLQALILIFGAIPILNFMGVK  192

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
             P S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD  NIILD IF
Sbjct  193   PDSPMLTPACQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDATNIILDPIF  252

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +   H GVSGAAIAHVISQY++ LILL++L+REV++LPPS K LQ S+FLKN   L ARV
Sbjct  253   MFVFHLGVSGAAIAHVISQYLIALILLWRLLREVDVLPPSIKDLQFSRFLKNSFLLLARV  312

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAAS+AAR GS  MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA +D+ 
Sbjct  313   IAVTFCVTLAASMAARQGSIPMAAFQICLQIWLATSLLADGLAVAGQAILASAFARRDHA  372

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +A AAA+RVLQ G ++G  L V++G+GL F S +F+KD NV++LI IGIPFVA TQPIN+
Sbjct  373   RATAAASRVLQWGVILGLVLCVILGIGLQFASRLFTKDANVLQLIHIGIPFVALTQPINA  432

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DG+NFGASDF YSAYSMV+VA ++I    +   S+GF+GIW+AL I+M LR  AG
Sbjct  433   LAFVFDGINFGASDFSYSAYSMVLVAIVSILCLVVLSSSHGFIGIWVALTIYMSLRMFAG  492

Query  214   LWRLATGTGPWCFLRA  167
              WR+ T  GPW FLR+
Sbjct  493   FWRIGTARGPWAFLRS  508



>ref|XP_009778890.1| PREDICTED: MATE efflux family protein 1-like isoform X4 [Nicotiana 
sylvestris]
Length=520

 Score =   441 bits (1134),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 251/435 (58%), Positives = 316/435 (73%), Gaps = 5/435 (1%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++      S+++      E+   +    D+D     E+ SL IP + + 
Sbjct  91    VSVTTSFVAEEDT--ITKASQDLQNDKIKEQNEGDAEAMDTDSPSNSESKSL-IPKNGSV  147

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
               S    + +S    K K  K  IPSAS AL++G +LGI+Q  FL   AKPLL  MG+KP
Sbjct  148   CKSV--KMASSFEVVKPKPEKRHIPSASAALIIGAVLGIIQAAFLIAGAKPLLKFMGIKP  205

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
             GS M  PA  YL LRSLG+PAVLLSLA+QG+FRG KDTKTPL+AT AGDL NIILD IF+
Sbjct  206   GSAMSKPAEDYLRLRSLGAPAVLLSLAMQGVFRGFKDTKTPLFATVAGDLANIILDPIFM  265

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                H GV GAAIAHVISQY++ +IL ++L+ +V+L+PPS K+LQ ++FL NG  L  RVI
Sbjct  266   FVFHLGVRGAAIAHVISQYLISVILFWRLMEKVDLVPPSLKYLQFARFLTNGFLLLVRVI  325

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTLAASLAARLG+T MAAFQVCLQ+WL +SLLADGLAIAGQAILA+AFA +D+ +
Sbjct  326   AVTFCVTLAASLAARLGATQMAAFQVCLQVWLATSLLADGLAIAGQAILASAFAQEDFTR  385

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
               A A+RVLQ+G V+G  LA+ +G+ L++G+ VF+KD +V+ LI IGIPFVA TQPIN L
Sbjct  386   CTATASRVLQLGVVLGLILALTLGVCLHYGARVFTKDVDVLHLIGIGIPFVAATQPINCL  445

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVNFGA+DF YSAYSM+ VA  +I    +   S G +GIWIAL I+M LR +AG 
Sbjct  446   AFVFDGVNFGAADFAYSAYSMLTVAIFSIVLLLILSSSFGLIGIWIALTIYMSLRALAGF  505

Query  211   WRLATGTGPWCFLRA  167
              R+ TGTGPW FLR+
Sbjct  506   GRIGTGTGPWKFLRS  520



>ref|NP_187461.1| protein FERRIC REDUCTASE DEFECTIVE 3 [Arabidopsis thaliana]
 ref|NP_001154595.1| protein FERRIC REDUCTASE DEFECTIVE 3 [Arabidopsis thaliana]
 sp|Q9SFB0.1|FRD3_ARATH RecName: Full=MATE efflux family protein FRD3; AltName: Full=MATE 
citrate transporter; AltName: Full=Protein DTX43; AltName: 
Full=Protein FERRIC REDUCTASE DEFECTIVE 3; Short=AtFRD3; 
AltName: Full=Protein MANGANESE ACCUMULATOR 1 [Arabidopsis 
thaliana]
 gb|AAF21214.1|AC013483_38 putative integral membrane protein [Arabidopsis thaliana]
 gb|AAG50830.1|AC074395_4 MATE efflux family protein, putative [Arabidopsis thaliana]
 gb|AAL86700.1|AF448231_1 ferric reductase defective [Arabidopsis thaliana]
 gb|AAL08295.1| T8G24.8/T8G24.8 [Arabidopsis thaliana]
 gb|AAL09757.1| T8G24.8/T8G24.8 [Arabidopsis thaliana]
 gb|AAM91482.1| At3g08040/T8G24.8 [Arabidopsis thaliana]
 gb|AAP21178.1| At3g08040/T8G24.8 [Arabidopsis thaliana]
 gb|AEE74634.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE74635.1| MATE efflux family protein [Arabidopsis thaliana]
Length=526

 Score =   441 bits (1135),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 253/438 (58%), Positives = 327/438 (75%), Gaps = 15/438 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTSFVAEE++  ++ ++ +K  +  V++E  + ++         ++E G  +  S++
Sbjct  92    VSLTTSFVAEEDTMEKMKEEANK--ANLVHAETILVQD---------SLEKGISSPTSND  140

Query  1297  TKGSS--ALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
             T         D +++  +   K+ K  I +ASTA+++G ILG++Q +FL   +K LLG+M
Sbjct  141   TNQPQQPPAPDTKSNSGNKSNKKEKRTIRTASTAMILGLILGLVQAIFLIFSSKLLLGVM  200

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVKP S ML+PA +YL++R+LG+PA+LLSLA+QGIFRG KDTKTPL+AT   D++NI+LD
Sbjct  201   GVKPNSPMLSPAHKYLSIRALGAPALLLSLAMQGIFRGFKDTKTPLFATVVADVINIVLD  260

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     G+ GAAIAHVISQY + LIL   L ++V L+PP+   LQ  +FLKNGL L 
Sbjct  261   PIFIFVLRLGIIGAAIAHVISQYFMTLILFVFLAKKVNLIPPNFGDLQFGRFLKNGLLLL  320

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
             AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLTSSLL DGLA+AGQAILA +FA K
Sbjct  321   ARTIAVTFCQTLAAAMAARLGTTPMAAFQICLQVWLTSSLLNDGLAVAGQAILACSFAEK  380

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             DY K  A A+RVLQMGFV+G GL+V VGLGLYFG+GVFSKD  VI L+ IGIPF+A TQP
Sbjct  381   DYNKVTAVASRVLQMGFVLGLGLSVFVGLGLYFGAGVFSKDPAVIHLMAIGIPFIAATQP  440

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             INSLAFVLDGVNFGASDF Y+AYSMV VAA++I       K+NGF+GIWIAL I+M LR 
Sbjct  441   INSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAVIYMAKTNGFIGIWIALTIYMALRA  500

Query  223   IAGLWRLATGTGPWCFLR  170
             I G+ R+ATGTGPW FLR
Sbjct  501   ITGIARMATGTGPWRFLR  518



>ref|XP_010906073.1| PREDICTED: MATE efflux family protein 1 isoform X1 [Elaeis guineensis]
 ref|XP_010906074.1| PREDICTED: MATE efflux family protein 1 isoform X1 [Elaeis guineensis]
 ref|XP_010906075.1| PREDICTED: MATE efflux family protein 1 isoform X1 [Elaeis guineensis]
Length=523

 Score =   441 bits (1134),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 261/436 (60%), Positives = 319/436 (73%), Gaps = 13/436 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEE-KVAEEPGKDSDQLETMENGSLTIPSSET  1295
             V++TTSFVAEE++          + K+ SEE +  E+ G  S   E  E      P    
Sbjct  99    VSVTTSFVAEEDA----------TCKMASEEFECGEQEGTFSIDSEMKELIPRNDPERTV  148

Query  1294  KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
               SS  SD   S    K+ R +  IPSAS+AL +G ILG+LQ + L   A P+L  MGVK
Sbjct  149   HNSSPCSD--KSICTIKLGRERKHIPSASSALAIGGILGLLQALILIFGAIPILNFMGVK  206

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
             P S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD  NIILD IF
Sbjct  207   PDSPMLTPACQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDATNIILDPIF  266

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +   H GVSGAAIAHVISQY++ LILL++L+REV++LPPS K LQ S+FLKN   L ARV
Sbjct  267   MFVFHLGVSGAAIAHVISQYLIALILLWRLLREVDVLPPSIKDLQFSRFLKNSFLLLARV  326

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAAS+AAR GS  MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA +D+ 
Sbjct  327   IAVTFCVTLAASMAARQGSIPMAAFQICLQIWLATSLLADGLAVAGQAILASAFARRDHA  386

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +A AAA+RVLQ G ++G  L V++G+GL F S +F+KD NV++LI IGIPFVA TQPIN+
Sbjct  387   RATAAASRVLQWGVILGLVLCVILGIGLQFASRLFTKDANVLQLIHIGIPFVALTQPINA  446

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DG+NFGASDF YSAYSMV+VA ++I    +   S+GF+GIW+AL I+M LR  AG
Sbjct  447   LAFVFDGINFGASDFSYSAYSMVLVAIVSILCLVVLSSSHGFIGIWVALTIYMSLRMFAG  506

Query  214   LWRLATGTGPWCFLRA  167
              WR+ T  GPW FLR+
Sbjct  507   FWRIGTARGPWAFLRS  522



>emb|CCH27266.1| ferric reductase defective 3 [Arabidopsis thaliana]
Length=526

 Score =   441 bits (1134),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 252/438 (58%), Positives = 327/438 (75%), Gaps = 15/438 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTSFVAEE++  ++ ++ +K  +  V++E  + ++         ++E G  +  S++
Sbjct  92    VSLTTSFVAEEDTMEKMKEEANK--ANLVHAETILVQD---------SLEKGISSPTSND  140

Query  1297  TKGSS--ALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
             T         D +++  +   K+ K  I +ASTA+++G ILG++Q +FL   +K LLG+M
Sbjct  141   TNQPQQPPAPDTKSNSGNKSNKKEKRTIRTASTAMILGLILGLVQAIFLIFSSKLLLGVM  200

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVKP S ML+PA +YL++R+LG+PA+LLSLA+QGIFRG KDTKTPL+AT   D++NI+LD
Sbjct  201   GVKPNSPMLSPAHKYLSIRALGAPALLLSLAMQGIFRGFKDTKTPLFATVVADVINIVLD  260

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     G+ GAAIAHVISQY + LIL   L ++V L+PP+   LQ  +FLKNGL L 
Sbjct  261   PIFIFVLRLGIIGAAIAHVISQYFMTLILFVFLAKKVNLIPPNFGDLQFGRFLKNGLLLL  320

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
             AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLTSSLL DGLA+AGQAILA +FA K
Sbjct  321   ARTIAVTFCQTLAAAMAARLGTTPMAAFQICLQVWLTSSLLNDGLAVAGQAILACSFAEK  380

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             DY K  A A+RVLQMGFV+G GL+V VGLGLYFG+G+FSKD  VI L+ IGIPF+A TQP
Sbjct  381   DYNKVTAVASRVLQMGFVLGLGLSVFVGLGLYFGAGIFSKDPAVIHLMAIGIPFIAATQP  440

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             INSLAFVLDGVNFGASDF Y+AYSMV VAA++I       K+NGF+GIWIAL I+M LR 
Sbjct  441   INSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAVIYMAKTNGFIGIWIALTIYMALRA  500

Query  223   IAGLWRLATGTGPWCFLR  170
             I G+ R+ATGTGPW FLR
Sbjct  501   ITGIARMATGTGPWRFLR  518



>ref|XP_009613882.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613883.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=520

 Score =   440 bits (1132),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 252/436 (58%), Positives = 320/436 (73%), Gaps = 7/436 (2%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++      S+++      E+   +    D+D     E+ SL IP +   
Sbjct  91    VSVTTSFVAEEDT--ITKASQDLQNDKIKEQNEGDAEAMDTDSPSNSESKSL-IPKN---  144

Query  1291  GSSALSDLEASERDS-KVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
             GS   S+  AS  +  K K  K  IPSAS+AL++G +LGI+Q  FL   AKPLL  MG+K
Sbjct  145   GSVCKSEKMASSFEVVKPKPEKRHIPSASSALIIGAVLGIIQAAFLIAGAKPLLKFMGIK  204

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
             PGS M  PA  YL LRSLG+PAVLLSLA+QG+FRG KDTKTPL+AT AGDL NIILD IF
Sbjct  205   PGSAMSKPAEDYLRLRSLGAPAVLLSLAMQGVFRGFKDTKTPLFATVAGDLANIILDPIF  264

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +     GV GAAIAHVISQY++ +IL ++L+ +V+L+PPS K+LQ ++FL NG  L  RV
Sbjct  265   MFVFRLGVRGAAIAHVISQYLISVILFWRLMEKVDLVPPSLKYLQFARFLTNGFLLLVRV  324

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAASLAARLG T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA +D+ 
Sbjct  325   IAVTFCVTLAASLAARLGPTQMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAQEDFS  384

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +  A A++VLQ+G V+G  LA+ +G+GL++G+ VF++D +V+ LI IGIPFVA TQPIN 
Sbjct  385   RCTATASKVLQLGVVLGLVLALTLGVGLHYGARVFTQDVDVLHLIAIGIPFVAATQPINC  444

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DGVNFGASDF YSAYSM+ VA  +I F  +   S G++GIW+AL I+M LR +AG
Sbjct  445   LAFVFDGVNFGASDFAYSAYSMLTVAIFSIVFLLILSSSFGYIGIWVALTIYMSLRALAG  504

Query  214   LWRLATGTGPWCFLRA  167
               R+ TGTGPW FLR+
Sbjct  505   FGRIGTGTGPWKFLRS  520



>ref|XP_004173219.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein FRD3-like, 
partial [Cucumis sativus]
Length=469

 Score =   438 bits (1127),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 257/445 (58%), Positives = 324/445 (73%), Gaps = 9/445 (2%)
 Frame = -2

Query  1471  VNITTSFVAEENS------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTI  1310
             V+ITTSFVAEE++      +     +++  A V S +    E  ++ ++L   ++ +  +
Sbjct  28    VSITTSFVAEEDTIGKAAKKAAKVDAEKCLADVNSVKVCVPEDHENEEKLAAKQDHA-NL  86

Query  1309  PSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
                 T+  S    LE++   SK K  K +I SASTAL+ G ILG++Q +FL   AK LL 
Sbjct  87    NHEPTRNLST-KVLESTSAKSKRKEKK-QIASASTALIFGTILGLMQAIFLIFGAKSLLN  144

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
             LMGVK  S M  PA +YLTLRSLG+PAVLLSLA+QGIFRG KDT+TPLY   AG  VNII
Sbjct  145   LMGVKDNSPMFAPAHKYLTLRSLGAPAVLLSLAMQGIFRGFKDTRTPLYVIVAGYTVNII  204

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD I I  C  GV GAA AHV+SQY ++ IL ++L+++V L+PPS K LQ  +FLKNG  
Sbjct  205   LDPILIFVCXLGVKGAAAAHVLSQYFIVTILFWRLVQKVNLMPPSLKDLQFGRFLKNGGL  264

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L ARV+A TFCVTLAASLAARLG T MAAFQ CLQ+W+TSSLL+DGLA+AGQAILA+AFA
Sbjct  265   LLARVVAVTFCVTLAASLAARLGPTPMAAFQTCLQVWMTSSLLSDGLAVAGQAILASAFA  324

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
              KDY+K  A A RVLQM F++G GLA++VG+G++FG+G+FS+D +V  LI + IPFVA T
Sbjct  325   EKDYEKTTATATRVLQMSFILGVGLAIIVGIGMFFGAGIFSRDIHVQHLIHLAIPFVAAT  384

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QPINSLAFV DGVNFGASDF YSAYS+V+VA  ++   FL  KSNGF+GIWIAL I+MLL
Sbjct  385   QPINSLAFVFDGVNFGASDFAYSAYSLVLVAIASVVSLFLLSKSNGFIGIWIALTIYMLL  444

Query  229   RTIAGLWRLATGTGPWCFLRASTQP  155
             R   G+WR++TGTGPW +LR    P
Sbjct  445   RAFVGVWRMSTGTGPWRYLRTQRLP  469



>ref|XP_006361750.1| PREDICTED: MATE efflux family protein 1-like [Solanum tuberosum]
Length=512

 Score =   439 bits (1130),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 262/443 (59%), Positives = 326/443 (74%), Gaps = 21/443 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENS------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTI  1310
             V++TTSFVAEE++      E  D+ S+++ ++        +  G D++     EN  L I
Sbjct  83    VSVTTSFVAEEDAITKVSPEPRDNESQDIQSQ--------DVEGLDTESQSNSENKEL-I  133

Query  1309  PSSET--KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPL  1136
             P + +  K  +  +  E      K K  K  IPSAS+AL++G ILG +Q VFL   AKP+
Sbjct  134   PQNRSVYKSKTTATSFEVV----KPKPEKKHIPSASSALIIGAILGFIQAVFLISGAKPI  189

Query  1135  LGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVN  956
             L  MGVK GS ML PA  YL LRSLG+PAVLLSLA+QG+FRG KDTKTPL+AT AGDL N
Sbjct  190   LSFMGVKHGSPMLKPAQEYLKLRSLGAPAVLLSLAMQGVFRGFKDTKTPLFATVAGDLTN  249

Query  955   IILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNG  776
             IILD IFI A H GV GAAIAHVISQY++ +IL ++L+ +V+LLPPS K++Q ++FL NG
Sbjct  250   IILDPIFIFAFHMGVRGAAIAHVISQYLISVILFWRLMEKVDLLPPSLKYMQFARFLTNG  309

Query  775   LWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATa  596
               L  RVIA TFCVTLAASLAARLG T MAAFQVCLQ+WLT+SLLADGLA+AGQAILA+A
Sbjct  310   FLLLMRVIAVTFCVTLAASLAARLGPTEMAAFQVCLQVWLTTSLLADGLAVAGQAILASA  369

Query  595   favkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVA  416
             FA  D+ +A A A+RVLQ+G V+G  LA+++G+GL+FG+ +F+KD NVI LI IGIPFVA
Sbjct  370   FAQNDFSRATATASRVLQLGLVLGLVLALILGVGLHFGARLFTKDVNVIHLIGIGIPFVA  429

Query  415   GTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFM  236
              TQPIN+LAFV DGVNFGASDF YSAYSMV VA  +I F F+   S  FVGIW+AL I+M
Sbjct  430   ATQPINALAFVFDGVNFGASDFAYSAYSMVTVALFSIVFLFILSSSYKFVGIWVALTIYM  489

Query  235   LLRTIAGLWRLATGTGPWCFLRA  167
              LR +AG WR+ T TGPW FL++
Sbjct  490   SLRALAGFWRIGTRTGPWKFLKS  512



>ref|XP_008231283.1| PREDICTED: MATE efflux family protein FRD3 [Prunus mume]
Length=526

 Score =   439 bits (1129),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 264/445 (59%), Positives = 325/445 (73%), Gaps = 17/445 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETME------NGSLTI  1310
             V+ITTSFVAEE++           AK+  + +  E+  K +D L+ +E      NG+   
Sbjct  93    VSITTSFVAEEDT----------VAKMNIKSEKGEQLQK-ADMLDDLEKGAAKPNGTAKE  141

Query  1309  PSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
               S T      SDL ++ + +K+K+ K  I SASTAL+ G ILG+LQ +FL   AK LLG
Sbjct  142   NGSRTTVDKRPSDLMSTNKKAKIKKQKRHIASASTALIFGAILGLLQAIFLMFTAKVLLG  201

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
             +MGVK  S ML PA +YL +RS+G+PAVLL+LA+QGIFRG KDTKTPLY   AG  VNI 
Sbjct  202   VMGVKSDSPMLAPAQKYLRIRSIGAPAVLLTLAMQGIFRGFKDTKTPLYVIVAGYAVNIA  261

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD + I  C  G+ GAA+AHV+SQY++ L+L   L  +++LLPPS K LQ  +FL+NG  
Sbjct  262   LDPLLIFVCGLGIRGAAMAHVLSQYLMALVLFIILTTKIDLLPPSIKDLQFGRFLRNGTL  321

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L ARV+A TFCVTLAASLAAR G T MAAFQ CLQ+WLTSSLLADGLA+AGQAILA AFA
Sbjct  322   LLARVVAVTFCVTLAASLAAREGPTPMAAFQTCLQVWLTSSLLADGLAVAGQAILACAFA  381

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
              KDYKKA A A+RVLQM F++G GLA VVG+GLYFG+G+FS+D NV+ LI IG+PFVA T
Sbjct  382   EKDYKKATATASRVLQMSFILGVGLAFVVGIGLYFGAGIFSRDVNVLHLIRIGLPFVAAT  441

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QPINSL+FV DGVNFGASDF YSAYS+V+VA  +I   FL  KS+GFVGIWIAL I+M L
Sbjct  442   QPINSLSFVFDGVNFGASDFAYSAYSLVLVAIASIVSLFLLSKSHGFVGIWIALTIYMAL  501

Query  229   RTIAGLWRLATGTGPWCFLRASTQP  155
             R  AG+WR+ TGTGPW FL+  + P
Sbjct  502   RAFAGVWRMGTGTGPWRFLKGRSPP  526



>ref|XP_007220450.1| hypothetical protein PRUPE_ppa019216mg [Prunus persica]
 gb|EMJ21649.1| hypothetical protein PRUPE_ppa019216mg [Prunus persica]
Length=558

 Score =   439 bits (1128),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 261/466 (56%), Positives = 326/466 (70%), Gaps = 27/466 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSEL-----CDDGSKEVSAKVYSE-EKVAEEP-GKDSDQLETMENGSLT  1313
             V+ITTSFVAEE++        + G +   A +  + EK A +P G   +  + + NG + 
Sbjct  93    VSITTSFVAEEDTVAKMNMKSEKGEQLQKADMLDDLEKGAAKPNGTAKENGKHLGNGKME  152

Query  1312  IPSSE-------------TKGSSALSDL-------EASERDSKVKRGKLRIPSASTALMM  1193
               S+E              KG S+ + L       +A E + K+K+ K  I SASTAL+ 
Sbjct  153   EASAEDDEHVAAGKGAPEAKGESSDNGLLESSEANKAIEENEKIKKQKRHIASASTALIF  212

Query  1192  GCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFR  1013
             G ILG+LQ +F+    K LLG+MGVK  S ML PA +YL +RS+G+PAVLL+LA+QGIFR
Sbjct  213   GTILGLLQAIFIIFSTKVLLGVMGVKSDSPMLAPAQKYLKIRSIGAPAVLLTLAMQGIFR  272

Query  1012  GLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREV  833
             G KDT+TPLY    G  VNI LD + I  C  G+ GAA+AHV+SQY++ L+L   L +++
Sbjct  273   GFKDTRTPLYVIVVGYGVNIALDPLLIFVCGLGIRGAALAHVLSQYLMALVLFIILTKKI  332

Query  832   ELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLT  653
             +LLPPS K LQ  +FL+NG  L ARV+A TFCVTLAASLAAR G T MAAFQ CLQ+WLT
Sbjct  333   DLLPPSIKDLQFGRFLRNGTLLLARVVAVTFCVTLAASLAAREGPTPMAAFQTCLQVWLT  392

Query  652   SSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGV  473
             SSLLADGLA+AGQAILA AFA KDYKKA A A RVLQM F++G GL  VVG+GLYFG+G+
Sbjct  393   SSLLADGLAVAGQAILACAFAEKDYKKAIATATRVLQMSFILGVGLTFVVGIGLYFGAGI  452

Query  472   FSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEF  293
             FS D NV+ LI IG+PFVA TQPINSL+FV DGVNFGASDF Y AYS+V+VA  +I   F
Sbjct  453   FSSDVNVLHLIRIGLPFVAATQPINSLSFVFDGVNFGASDFAYCAYSLVLVAIASIVSLF  512

Query  292   LFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
             L  KS+GF+GIWIAL I+M LRT AG+WR+ TGTGPW FL+  + P
Sbjct  513   LLSKSHGFIGIWIALTIYMALRTFAGVWRMGTGTGPWRFLKGRSTP  558



>ref|XP_004306534.1| PREDICTED: MATE efflux family protein FRD3-like [Fragaria vesca 
subsp. vesca]
Length=594

 Score =   439 bits (1129),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 258/431 (60%), Positives = 309/431 (72%), Gaps = 6/431 (1%)
 Frame = -2

Query  1441  ENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETKGSSALSDLEA  1262
             ENS+   D   E    +    K+      D    E  ENG  T   S   G S +     
Sbjct  169   ENSDRGLDEGSEPKKSILENAKLENGDKGDLKNSEPQENGPKT---SIENGPSVVRSKTK  225

Query  1261  SERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALR  1082
               +    KR    I SASTAL+ G ILG+LQ +FL + +K LLG+MGVK  S ML PAL+
Sbjct  226   KTKMKNKKR---NIASASTALIFGAILGLLQAIFLMLGSKVLLGVMGVKHDSPMLRPALK  282

Query  1081  YLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGA  902
             YLT+RS+G+PAVLL+LA+QGIFRG KDT TPLY   AG  +NI LD I I  C  G+ GA
Sbjct  283   YLTVRSIGAPAVLLTLAMQGIFRGFKDTTTPLYVIVAGYAINIALDPILIFICGLGIRGA  342

Query  901   AIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAA  722
             AIAHV+SQY++ L+L   L+R+V L+PPS K LQ  KFLKNG  L ARV+A TFCVTLAA
Sbjct  343   AIAHVLSQYLMALVLFLILMRKVNLMPPSIKDLQFGKFLKNGSLLLARVVAVTFCVTLAA  402

Query  721   SLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQ  542
             SLAARLG T MAAFQ CLQ+WLTSSLLADGLA+AGQAILA AFA KDYKKA A A RVLQ
Sbjct  403   SLAARLGPTPMAAFQTCLQVWLTSSLLADGLAVAGQAILACAFAEKDYKKATATATRVLQ  462

Query  541   MGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFG  362
             MGF++G GL++VVG+GLYFG+G+FS+D NV+ LI IG+PFVA TQPINSL+FV DGVNFG
Sbjct  463   MGFILGVGLSLVVGVGLYFGAGIFSRDVNVLHLIKIGLPFVAATQPINSLSFVFDGVNFG  522

Query  361   ASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPW  182
             ASDF YSAYS+V+VA  +I   FL  KS+GFVGIWIAL ++M LR  AG+WR+ TGTGPW
Sbjct  523   ASDFAYSAYSLVLVAIASIVSLFLLSKSDGFVGIWIALTLYMGLRAFAGIWRMGTGTGPW  582

Query  181   CFLRASTQPMI  149
              FL+  + P +
Sbjct  583   RFLKDRSSPQL  593



>emb|CDY28001.1| BnaC05g44030D [Brassica napus]
Length=530

 Score =   436 bits (1120),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 260/434 (60%), Positives = 316/434 (73%), Gaps = 1/434 (0%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++       +   A +     +A +   +     T  N     P     
Sbjct  95    VSVTTSFVAEEDTLEKMKEEEANKANLVHANTLAVQDSLEKGVASTTSNNK-NQPQQTPV  153

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              +   SD +++  +   K+GK  I SASTA+++G  LG++Q + L   +K L+G+MGVKP
Sbjct  154   DAKLTSDTKSNNGNKGKKKGKKTIKSASTAMIIGLTLGLVQAIVLIFSSKVLIGIMGVKP  213

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S +L+PA +YLT+RSLG+PA+LLSL++QGIFRG KDTKTPLYAT A D +NIILD IFI
Sbjct  214   NSAVLSPAQKYLTIRSLGAPALLLSLSMQGIFRGFKDTKTPLYATVASDGLNIILDPIFI  273

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GVSGAAIAHVISQY +LLILL +L +EV L+PP    LQ  KF++NG  + AR I
Sbjct  274   FVLRLGVSGAAIAHVISQYFMLLILLIRLAKEVNLMPPKFGDLQFGKFIRNGGLMLARTI  333

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFC TLAAS+AARLG+T MAAFQ+CLQ+WLTSS+LADGLA+AGQAILA  FA KDY K
Sbjct  334   AVTFCQTLAASMAARLGTTPMAAFQICLQVWLTSSMLADGLAVAGQAILACNFAEKDYNK  393

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
               AAA+RV+QM FV+G GL+V VGLGLYFGSGVFSKD  VI LI IGIPFVA TQPINSL
Sbjct  394   VTAAASRVIQMSFVLGLGLSVFVGLGLYFGSGVFSKDPAVIHLIAIGIPFVAATQPINSL  453

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
              FVLDGVNFGASDF Y+AYSMV VAA++I       KSNGFVGIWIAL I+M LR I G+
Sbjct  454   TFVLDGVNFGASDFAYTAYSMVGVAAVSIAAVIYMAKSNGFVGIWIALTIYMGLRAITGM  513

Query  211   WRLATGTGPWCFLR  170
              R+ATGTGPW FLR
Sbjct  514   GRMATGTGPWKFLR  527



>ref|XP_009596395.1| PREDICTED: MATE efflux family protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=520

 Score =   435 bits (1119),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 263/437 (60%), Positives = 321/437 (73%), Gaps = 9/437 (2%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTS VAEE++  ++  +     S  + S+E  AE  G D++     EN  L IP S 
Sbjct  91    VSVTTSMVAEEDTITKVSPESRDTESQDLQSQE--AE--GLDTESQSNSENKEL-IPQSR  145

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
             +   S    +  +    K K  K  IPSAS+AL++G ILG +Q  FL   AKP+L  MGV
Sbjct  146   SMYKS--ETIATTFEVLKPKPEKRHIPSASSALIIGAILGFIQAAFLISGAKPILNFMGV  203

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K GS ML PA  YL LRSLG+PAVLLSLA+QG+FRG KDTKTPL+AT AGDL NIILD I
Sbjct  204   KSGSPMLKPAQEYLKLRSLGAPAVLLSLAMQGVFRGFKDTKTPLFATVAGDLTNIILDPI  263

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             FI   H GV GAAIAHVISQY++ +IL ++L+ +V+LLPPS K+LQ ++FL NG  L  R
Sbjct  264   FIFVFHMGVRGAAIAHVISQYLISVILFWRLMEQVDLLPPSLKYLQFARFLTNGFLLLMR  323

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             VIA TFCVTLAASLAARLG T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA KD+
Sbjct  324   VIAVTFCVTLAASLAARLGPTEMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAQKDF  383

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
              +A A A+RVLQ+G V+G  LA+++G+GL+FG+ +F+ D NVI LI IGIPFVA TQPIN
Sbjct  384   SRATATASRVLQLGLVLGLVLALILGVGLHFGARLFTNDINVIHLIGIGIPFVAATQPIN  443

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DGVNFGASDF YSAYSMV VA  +I F F+   S  FVGIW+AL I+M LR  A
Sbjct  444   ALAFVFDGVNFGASDFAYSAYSMVTVALFSIIFLFILSSSYKFVGIWVALTIYMSLRAFA  503

Query  217   GLWRLATGTGPWCFLRA  167
             G WR+ TGTGPW FLR+
Sbjct  504   GFWRIGTGTGPWKFLRS  520



>ref|XP_008240868.1| PREDICTED: MATE efflux family protein 1-like [Prunus mume]
Length=494

 Score =   434 bits (1115),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 253/434 (58%), Positives = 316/434 (73%), Gaps = 21/434 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE      D ++E+ A     E+V E           +ENG+      E +
Sbjct  81    VSITTSFVAEE------DATEELRAN----EQVHEN----------VENGTPISMEMEME  120

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
                 L    +S    K++  +  IPSAS+AL++G +LG +Q VFL   AKP+L  MGV  
Sbjct  121   ELVPLVGKSSSTEMVKLEHVRRHIPSASSALVVGSVLGFIQAVFLIFAAKPILNYMGVDS  180

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD+ NIILD I +
Sbjct  181   NSPMLKPARQYLTLRSLGAPAVLLSLAVQGVFRGFKDTKTPLYATIVGDVANIILDPILM  240

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                H GV GAAIAHVISQY++ LIL++KL ++V+LL    K L+  +FLKNG  L  RVI
Sbjct  241   FVFHMGVRGAAIAHVISQYLISLILIWKLNKQVDLLTSGVKDLRFGQFLKNGFLLLVRVI  300

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             AATFCVTLAA+LAAR G T MAAFQVCLQIWL +SLLADGLA+AGQAILA+AFA KDY K
Sbjct  301   AATFCVTLAAALAARQGPTTMAAFQVCLQIWLAASLLADGLAVAGQAILASAFARKDYSK  360

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+RVLQ+  V+G  L++++ + L FGS +F+KD NV++LI++GIPFV+ TQPIN+L
Sbjct  361   AVATASRVLQLALVLGLMLSIILTVVLQFGSRIFTKDINVLQLISLGIPFVSVTQPINAL  420

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVN+GASDF YSAYSMV+VA ++I   FL L S+GFVGIW+AL++FM LR + G 
Sbjct  421   AFVFDGVNYGASDFAYSAYSMVLVALVSILCLFL-LSSHGFVGIWVALSVFMSLRALVGF  479

Query  211   WRLATGTGPWCFLR  170
             WR+ TGTGPW FLR
Sbjct  480   WRIGTGTGPWSFLR  493



>ref|XP_009343718.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009343719.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009343720.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009343727.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009343728.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009343729.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=515

 Score =   434 bits (1117),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 268/440 (61%), Positives = 320/440 (73%), Gaps = 22/440 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLET--MENGSLT--IPS  1304
             V++TTSFVAEE      D    VS +            KDSD LET    NG +   IP 
Sbjct  93    VSVTTSFVAEE------DTIGTVSPE-----------AKDSDYLETGSSTNGEMKQLIPE  135

Query  1303  SE-TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             S+ T+ +     +  S         K  IPSAS+A+++G ILG++Q +FL   AKPLL  
Sbjct  136   SDATQNAYNSKSVATSFEIVTTNHQKRYIPSASSAMVIGSILGLIQAIFLISGAKPLLNF  195

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGV   S ML PA +YL LRSLG+PAVLLSLA+QGIFRG KDTKTPLYAT  GD+ NIIL
Sbjct  196   MGVGSDSPMLKPAQQYLMLRSLGAPAVLLSLAMQGIFRGFKDTKTPLYATVVGDVTNIIL  255

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI   H GV+GAAIAHVISQY++  ILL++L+ +V LLPPS KHLQ S+FLKNG  L
Sbjct  256   DPIFIFVFHLGVTGAAIAHVISQYLICFILLWRLMAQVNLLPPSIKHLQFSRFLKNGFLL  315

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
               RVIA TFCVTLAASLAAR G T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA 
Sbjct  316   LMRVIAVTFCVTLAASLAARQGPTPMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAK  375

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY KA A A+RVLQ+G V+G  LA ++G+GL +G+ +F+KD NV+ LI IGIPFVA TQ
Sbjct  376   KDYDKATATASRVLQLGLVLGLMLAAILGVGLQYGARLFTKDVNVLHLIGIGIPFVAATQ  435

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PIN+LAFV DGVNFGASDF YSA+SMVMVA ++I   F+   +NGF+GIW+AL I+M LR
Sbjct  436   PINALAFVFDGVNFGASDFAYSAFSMVMVAIVSILVLFVLSYTNGFIGIWVALTIYMSLR  495

Query  226   TIAGLWRLATGTGPWCFLRA  167
             T AG WR+ TGTGPW FLRA
Sbjct  496   TFAGFWRIGTGTGPWEFLRA  515



>ref|XP_008231300.1| PREDICTED: MATE efflux family protein FRD3-like [Prunus mume]
Length=526

 Score =   434 bits (1117),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 259/445 (58%), Positives = 321/445 (72%), Gaps = 17/445 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETME------NGSLTI  1310
             V+ITTSFVAEE++           AK+  + +  E+  K +D L+ +E      NG+   
Sbjct  93    VSITTSFVAEEDT----------VAKMNMKSEKGEQLQK-ADMLDDLEKGAAKPNGTAKE  141

Query  1309  PSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
               S T      SDL ++ +  K+K+ K  I SASTAL+ G ILG+LQ +F+    K LLG
Sbjct  142   NGSRTTVDELPSDLMSTNKKEKIKKQKRHIASASTALIFGTILGLLQAIFIIFSTKVLLG  201

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
             +MGVK  S ML PA +YL +RS+G+PAVLL+LA+QGIFRG KDTKTPLY    G  VNI 
Sbjct  202   VMGVKSDSPMLAPAQKYLKIRSIGAPAVLLTLAMQGIFRGFKDTKTPLYVIVVGYGVNIA  261

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD + I  C  G+ GAA+AHV+SQY++ L+L   L ++++LLPPS K LQ  +FL+NG  
Sbjct  262   LDPLLIFVCGLGIRGAALAHVLSQYLMALVLFIILTKKIDLLPPSIKDLQFGRFLRNGTL  321

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L ARV+A TFCVTLAASLAAR G T MAAFQ CLQ+WLTSSLLADGLA+AGQAILA AFA
Sbjct  322   LLARVVAVTFCVTLAASLAAREGPTPMAAFQTCLQVWLTSSLLADGLAVAGQAILACAFA  381

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
              KDYKKA A A RVLQM F++G GL  VVG+GLYFG+G+FS+D NV+ LI IG+PFVA T
Sbjct  382   EKDYKKAIATATRVLQMSFILGVGLTFVVGIGLYFGAGIFSRDVNVLHLIRIGLPFVAAT  441

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QPINSL+FV DGVNFGASDF Y AYS+V+VA  +I   FL  KS+GF+GIWIAL I+M L
Sbjct  442   QPINSLSFVFDGVNFGASDFAYCAYSLVLVAIASIVSLFLLSKSHGFIGIWIALTIYMAL  501

Query  229   RTIAGLWRLATGTGPWCFLRASTQP  155
             RT AG+WR+ TGTGPW FL+  + P
Sbjct  502   RTFAGVWRMGTGTGPWRFLKGRSPP  526



>ref|XP_009613884.1| PREDICTED: MATE efflux family protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=518

 Score =   434 bits (1116),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 251/436 (58%), Positives = 319/436 (73%), Gaps = 9/436 (2%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++      S+++      E+   +    D+D     E+ SL IP +   
Sbjct  91    VSVTTSFVAEEDT--ITKASQDLQNDKIKEQNEGDAEAMDTDSPSNSESKSL-IPKN---  144

Query  1291  GSSALSDLEASERDS-KVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
             GS   S+  AS  +  K K  K  IPSAS+AL++G +LGI+Q  FL   AKPLL  MG+K
Sbjct  145   GSVCKSEKMASSFEVVKPKPEKRHIPSASSALIIGAVLGIIQAAFLIAGAKPLLKFMGIK  204

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
             PGS M  PA  YL LRSLG+PAVLLSLA+QG+FRG KDTKTPL+AT  GDL NIILD IF
Sbjct  205   PGSAMSKPAEDYLRLRSLGAPAVLLSLAMQGVFRGFKDTKTPLFAT--GDLANIILDPIF  262

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +     GV GAAIAHVISQY++ +IL ++L+ +V+L+PPS K+LQ ++FL NG  L  RV
Sbjct  263   MFVFRLGVRGAAIAHVISQYLISVILFWRLMEKVDLVPPSLKYLQFARFLTNGFLLLVRV  322

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAASLAARLG T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA +D+ 
Sbjct  323   IAVTFCVTLAASLAARLGPTQMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAQEDFS  382

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +  A A++VLQ+G V+G  LA+ +G+GL++G+ VF++D +V+ LI IGIPFVA TQPIN 
Sbjct  383   RCTATASKVLQLGVVLGLVLALTLGVGLHYGARVFTQDVDVLHLIAIGIPFVAATQPINC  442

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DGVNFGASDF YSAYSM+ VA  +I F  +   S G++GIW+AL I+M LR +AG
Sbjct  443   LAFVFDGVNFGASDFAYSAYSMLTVAIFSIVFLLILSSSFGYIGIWVALTIYMSLRALAG  502

Query  214   LWRLATGTGPWCFLRA  167
               R+ TGTGPW FLR+
Sbjct  503   FGRIGTGTGPWKFLRS  518



>ref|XP_009396611.1| PREDICTED: MATE efflux family protein 1-like, partial [Musa acuminata 
subsp. malaccensis]
Length=497

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 255/439 (58%), Positives = 328/439 (75%), Gaps = 24/439 (5%)
 Frame = -2

Query  1471  VNITTSFVAEEN--SELC--DDGSKEVSAKVYSEEKVAEE--PGKDSDQLETMENGSLTI  1310
             V++TTSFVAEE+  S+L   D  S E     +SE+   +E  P  D D+ E       T 
Sbjct  75    VSVTTSFVAEEDATSKLASGDPESGECQGS-FSEDSEMKELMPCTDHDEHE------YTS  127

Query  1309  PSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
             P S +K S+ ++++E           + RIPSAS+AL++G +LG+L+T+FL   AKP+L 
Sbjct  128   PFS-SKKSATMTEVE----------NRKRIPSASSALLVGSVLGVLETLFLNFGAKPILI  176

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
              MGVK  S ML PA  YLTLR+LG+PAVLLSLA+QG+FRG++DT+TPLYAT AGD  NII
Sbjct  177   FMGVKHDSPMLTPACEYLTLRALGAPAVLLSLAMQGVFRGIRDTETPLYATVAGDAANII  236

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD IFI     GVSGAAIAHVISQY++ L+LL+KL+R+V++LPPS K+LQ  +FL++GL 
Sbjct  237   LDPIFIFLFRLGVSGAAIAHVISQYLIALMLLWKLLRQVDVLPPSIKNLQFGRFLRDGLL  296

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L  RVIA TFCVTLAAS+AAR GS  MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA
Sbjct  297   LLVRVIAVTFCVTLAASMAARQGSVPMAAFQICLQIWLATSLLADGLAVAGQAILASAFA  356

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
              KD+  A +AA+RVLQ G V+G  L  ++G+GL F S +F+KD  V++L+ +GIPFVA T
Sbjct  357   RKDHSGATSAASRVLQWGMVLGLLLCFILGIGLQFASKLFTKDAKVLQLVHVGIPFVALT  416

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QP+N+LAFV DG+N+GASDF Y+AYSMV+VA ++I F  +   S+GFVGIWIAL I+M L
Sbjct  417   QPMNALAFVFDGINYGASDFAYAAYSMVLVAIVSIVFLIILSSSHGFVGIWIALTIYMSL  476

Query  229   RTIAGLWRLATGTGPWCFL  173
             R +AG WR+ TGTGPW FL
Sbjct  477   RMLAGFWRIGTGTGPWTFL  495



>ref|XP_009394393.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=518

 Score =   434 bits (1115),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 255/437 (58%), Positives = 316/437 (72%), Gaps = 20/437 (5%)
 Frame = -2

Query  1471  VNITTSFVAEEN----SELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPS  1304
             V++TTSFVAEE+    S   D  S E   + +SE+   +E    +D  E     S ++  
Sbjct  96    VSVTTSFVAEEDAVSKSRSGDPESGEYR-RSFSEDSEMKELITHNDHDEHAHTSSASLDK  154

Query  1303  SETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
             S T               ++    K RIPSAS+AL +G ILG LQT+FL   AKP+L  M
Sbjct  155   STTM--------------TECGHHK-RIPSASSALAIGGILGFLQTLFLVFGAKPILNYM  199

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             G+K  S M+ PA +YLTLRSLG+PAVLLSLA+QG+FRGLKDTKTPLYAT  GD  NIILD
Sbjct  200   GIKHDSPMMTPACQYLTLRSLGAPAVLLSLAMQGVFRGLKDTKTPLYATVVGDATNIILD  259

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     GVSGAAIAHVISQY++ LILL++L+R+V++LPPS K LQ  +FLKNGL L 
Sbjct  260   PIFIFVFQLGVSGAAIAHVISQYLIALILLWRLLRQVDILPPSIKDLQFGRFLKNGLLLL  319

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
             ARVIA TFCVTLAAS+AAR GS  MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA +
Sbjct  320   ARVIAVTFCVTLAASMAARQGSIPMAAFQICLQIWLATSLLADGLAVAGQAILASAFARR  379

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             D+ +A +AA+RVLQ G V+G  L +++G  L F S +F++D  V++LI IGIPFVA TQP
Sbjct  380   DHARATSAASRVLQWGMVLGLVLCIILGTSLQFVSRLFTEDNEVLQLIHIGIPFVALTQP  439

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             INSLAFV DG+N+GASDF YSAYSMV+VA ++IG   +   S+GF+GIWIAL+I+M LR 
Sbjct  440   INSLAFVFDGINYGASDFAYSAYSMVLVALVSIGCLVVLSSSHGFIGIWIALSIYMSLRM  499

Query  223   IAGLWRLATGTGPWCFL  173
              AG WR+ T  GPW FL
Sbjct  500   FAGFWRIGTAKGPWSFL  516



>ref|XP_008363572.1| PREDICTED: MATE efflux family protein 1-like [Malus domestica]
Length=515

 Score =   434 bits (1115),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 267/440 (61%), Positives = 319/440 (73%), Gaps = 22/440 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLET----MENGSLTIPS  1304
             V++TTSFVAEE      D    VS +            KDSD LET     +     IP 
Sbjct  93    VSVTTSFVAEE------DTIGTVSPE-----------AKDSDYLETGSSINDEMKQLIPE  135

Query  1303  SE-TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             S+ T+ +     +  S         K  IPSAS+A+++G ILG++Q +FL   AKPLL  
Sbjct  136   SDATQNAYNSKSVATSFEIVTTDHQKRYIPSASSAMVIGSILGLIQAIFLISGAKPLLNF  195

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGV   S ML PA +YL LRSLG+PAVLLSLA+QGIFRG KDTKTPLYAT AGD+ NIIL
Sbjct  196   MGVGSDSPMLKPAQQYLMLRSLGAPAVLLSLAMQGIFRGXKDTKTPLYATVAGDVTNIIL  255

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI   H GV+GAAIAHVISQY++  ILL++L+ +V LLPPS KHLQ S+FLKNG  L
Sbjct  256   DPIFIFVFHLGVTGAAIAHVISQYLICFILLWRLMAQVNLLPPSIKHLQFSRFLKNGFLL  315

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
               RVIA TFCVTLAASLAAR G T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA 
Sbjct  316   LMRVIAVTFCVTLAASLAARQGXTPMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAK  375

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY KA A A+RVLQ+G V+G  LA ++G+GL +G+ +F+KD NV+ LI IGIPFVA TQ
Sbjct  376   KDYDKAXATASRVLQLGLVLGLMLAAILGVGLQYGARLFTKDVNVLHLIGIGIPFVAATQ  435

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PIN+LAFV DGVNFGASDF YSA+SMVMVA ++I   F+   +NGF+GIW+AL I+M LR
Sbjct  436   PINALAFVFDGVNFGASDFVYSAFSMVMVAIVSILVLFVLSYTNGFIGIWVALTIYMSLR  495

Query  226   TIAGLWRLATGTGPWCFLRA  167
             T AG WR+ TGTGPW FLRA
Sbjct  496   TFAGFWRIGTGTGPWEFLRA  515



>ref|XP_009394394.1| PREDICTED: MATE efflux family protein 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=516

 Score =   433 bits (1114),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 255/437 (58%), Positives = 316/437 (72%), Gaps = 20/437 (5%)
 Frame = -2

Query  1471  VNITTSFVAEEN----SELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPS  1304
             V++TTSFVAEE+    S   D  S E   + +SE+   +E    +D  E     S ++  
Sbjct  94    VSVTTSFVAEEDAVSKSRSGDPESGEYR-RSFSEDSEMKELITHNDHDEHAHTSSASLDK  152

Query  1303  SETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
             S T               ++    K RIPSAS+AL +G ILG LQT+FL   AKP+L  M
Sbjct  153   STTM--------------TECGHHK-RIPSASSALAIGGILGFLQTLFLVFGAKPILNYM  197

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             G+K  S M+ PA +YLTLRSLG+PAVLLSLA+QG+FRGLKDTKTPLYAT  GD  NIILD
Sbjct  198   GIKHDSPMMTPACQYLTLRSLGAPAVLLSLAMQGVFRGLKDTKTPLYATVVGDATNIILD  257

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     GVSGAAIAHVISQY++ LILL++L+R+V++LPPS K LQ  +FLKNGL L 
Sbjct  258   PIFIFVFQLGVSGAAIAHVISQYLIALILLWRLLRQVDILPPSIKDLQFGRFLKNGLLLL  317

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
             ARVIA TFCVTLAAS+AAR GS  MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA +
Sbjct  318   ARVIAVTFCVTLAASMAARQGSIPMAAFQICLQIWLATSLLADGLAVAGQAILASAFARR  377

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             D+ +A +AA+RVLQ G V+G  L +++G  L F S +F++D  V++LI IGIPFVA TQP
Sbjct  378   DHARATSAASRVLQWGMVLGLVLCIILGTSLQFVSRLFTEDNEVLQLIHIGIPFVALTQP  437

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             INSLAFV DG+N+GASDF YSAYSMV+VA ++IG   +   S+GF+GIWIAL+I+M LR 
Sbjct  438   INSLAFVFDGINYGASDFAYSAYSMVLVALVSIGCLVVLSSSHGFIGIWIALSIYMSLRM  497

Query  223   IAGLWRLATGTGPWCFL  173
              AG WR+ T  GPW FL
Sbjct  498   FAGFWRIGTAKGPWSFL  514



>ref|XP_010088236.1| MATE efflux family protein FRD3 [Morus notabilis]
 gb|EXB32788.1| MATE efflux family protein FRD3 [Morus notabilis]
Length=553

 Score =   435 bits (1118),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 258/459 (56%), Positives = 326/459 (71%), Gaps = 21/459 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENS-----------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETME-  1328
             V+ITTSFVAEE++           E  +D   +   K  ++E V E+     D+LE  + 
Sbjct  94    VSITTSFVAEEDTFANMKMKAGQVENLEDEMLDGLEKGAAKEGVVEKGPNGDDKLENAKD  153

Query  1327  --NGSLTIPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLT  1154
               N   + P +  +    +++    E+ +K+ +G+  I SASTAL+ G ILG+LQ +FL 
Sbjct  154   TTNSKDSAPENIAREFPLVTNSSNVEKKAKLHKGQRHIASASTALIFGVILGLLQAIFLM  213

Query  1153  VLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATA  974
               A+ LLG+MGVK  S ML PA +YL  RS G+PAVLL+LA+QGIFRG KDT TPLY   
Sbjct  214   FGARTLLGVMGVKHNSPMLAPAEKYLVTRSFGAPAVLLTLAMQGIFRGFKDTTTPLYVIV  273

Query  973   AGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLS  794
              G  +NI LD + I  C  G+ GAAIAHV+SQY++ L+L   L+R+V+LLPPS K LQ  
Sbjct  274   CGYALNIALDPLLIFVCGLGIRGAAIAHVLSQYLMALVLFLILMRKVDLLPPSLKDLQFG  333

Query  793   KFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQ  614
             +FLKNG +L ARVIA TFCVTLAASLAARLG+T MAAFQ CLQ+W+TSSLLADGLA+A Q
Sbjct  334   RFLKNGFFLLARVIAVTFCVTLAASLAARLGATPMAAFQTCLQVWMTSSLLADGLAVAVQ  393

Query  613   AILATafavkdykkakaaaARVLQ-------MGFVMGHglavvvglgLYFGSGVFSKDKN  455
             A+LA +FA KDYKKA AAA+RV+Q       M FV+G GL +VVG+GLYFG+G+FS+D +
Sbjct  394   AVLACSFAEKDYKKATAAASRVVQKKEYIKLMSFVLGLGLTLVVGVGLYFGAGIFSRDVH  453

Query  454   VIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN  275
             V+ LI IG+PFVA TQPINSL+FV DGVNFGASDF YSAYS+V+VA  +I    +  KS 
Sbjct  454   VLHLIRIGLPFVAATQPINSLSFVFDGVNFGASDFAYSAYSLVLVAIASITSLIMLDKSK  513

Query  274   GFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRASTQ  158
             GFVGIWIAL I+M LRT AG+WR+ TGTGPW FLRA  +
Sbjct  514   GFVGIWIALTIYMGLRTFAGVWRMGTGTGPWRFLRAPLE  552



>emb|CCH27267.1| ferric reductase defective 3 [Arabidopsis thaliana]
Length=527

 Score =   434 bits (1115),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 250/439 (57%), Positives = 327/439 (74%), Gaps = 16/439 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTSFVAEE++  ++ ++ +K  ++ V++E  + ++         ++E G  +  S++
Sbjct  92    VSLTTSFVAEEDTMEKMKEEANK--ASPVHAETILVQD---------SLEKGISSPTSND  140

Query  1297  TKGSS--ALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
             T         D +++  +   K+ K  I +ASTA+++G ILG++Q +FL   +K LLG+M
Sbjct  141   TNQPQQPPAPDTKSNSGNKSNKKEKRTIRTASTAMILGLILGLVQAIFLIFSSKLLLGVM  200

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVKP S ML+PA +YL++R+LG+PA+LLSLA+QGIFRG KDTKTPL+AT   D++NI+LD
Sbjct  201   GVKPNSPMLSPAHKYLSIRALGAPALLLSLAMQGIFRGFKDTKTPLFATVVADVINIVLD  260

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     G+ GAAIAHVISQY + LIL   L ++V L+PP+   LQ  +FLKNGL L 
Sbjct  261   PIFIFVLRLGIIGAAIAHVISQYFMTLILFVFLAKKVNLIPPNFGDLQFGRFLKNGLLLL  320

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
             AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLTSSLL DGLA+AGQAILA +FA K
Sbjct  321   ARTIAVTFCQTLAAAMAARLGTTPMAAFQICLQVWLTSSLLNDGLAVAGQAILACSFAEK  380

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             DY K  A A+RVLQ+GFV+G GL+V VGLGLYFG+G+FSKD  VI L+ IGIP +A TQP
Sbjct  381   DYNKVTAVASRVLQVGFVLGLGLSVFVGLGLYFGAGIFSKDPAVIHLMAIGIPVIAATQP  440

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             INSLAFVLDGVNFGASDF Y+AYSMV VAA++I       K+NGF+GIWIAL I+M LR 
Sbjct  441   INSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAVIYMAKTNGFIGIWIALTIYMALRA  500

Query  223   IAGL-WRLATGTGPWCFLR  170
             I G+  R+ATGTGPW FLR
Sbjct  501   ITGIARRMATGTGPWRFLR  519



>ref|XP_008801942.1| PREDICTED: MATE efflux family protein 1 isoform X2 [Phoenix dactylifera]
Length=508

 Score =   433 bits (1113),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 258/437 (59%), Positives = 323/437 (74%), Gaps = 16/437 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEE-KVAEEPGKDSDQLETMENGSLTIPSSET  1295
             V++TTSFVAEE++          + K+ +EE +  E  G  S   E  E     IP ++ 
Sbjct  85    VSVTTSFVAEEDA----------TCKMANEELECGEHEGPLSVNSEMKE----LIPQNDP  130

Query  1294  KGSSALSDLEASERDSKVK-RGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
             + + + S   + +    +  R +  IPSAS+AL++G ILG+LQ + L   A P+L  MGV
Sbjct  131   ERTGSNSSSCSDKSTCIIPGRERKHIPSASSALVIGGILGLLQALILISGAIPILNFMGV  190

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             KP S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD  NIILD I
Sbjct  191   KPDSPMLTPACQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDATNIILDPI  250

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             FI   H GVSGAAIAHVISQY++ LILL++L+REV++LPPS K LQ S+FLKNG  L AR
Sbjct  251   FIFVFHLGVSGAAIAHVISQYLIALILLWRLLREVDVLPPSIKDLQFSRFLKNGFLLLAR  310

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             VIA TFCVTLAAS+AAR GS  MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA +D+
Sbjct  311   VIAVTFCVTLAASMAARQGSIPMAAFQICLQIWLATSLLADGLAVAGQAILASAFARRDH  370

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
              KA AAA+RVLQ G ++G  L V++G+GL +GS +F+KD +V++LI IGIPFVA TQPIN
Sbjct  371   SKATAAASRVLQWGMILGLVLCVILGIGLQYGSRLFTKDADVLQLIHIGIPFVALTQPIN  430

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGASDF YSAYSMV+VA ++I    +   S+GF+GIWIAL I+M LR  A
Sbjct  431   ALAFVFDGINFGASDFAYSAYSMVLVAIVSILCLVVLSSSHGFIGIWIALTIYMSLRMFA  490

Query  217   GLWRLATGTGPWCFLRA  167
             G WR+    GPW FLR+
Sbjct  491   GFWRIGIARGPWTFLRS  507



>ref|XP_009375048.1| PREDICTED: MATE efflux family protein 1 [Pyrus x bretschneideri]
Length=515

 Score =   433 bits (1114),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 267/440 (61%), Positives = 320/440 (73%), Gaps = 22/440 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLET--MENGSLT--IPS  1304
             V++TTSFVAEE      D    VS +            KDSD LET    NG +   IP 
Sbjct  93    VSVTTSFVAEE------DTIGTVSPE-----------AKDSDYLETGSSTNGEMKQLIPE  135

Query  1303  SE-TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             S+ T+ +     +  S         K  IPSAS+A+++G ILG++Q + L   AKPLL  
Sbjct  136   SDATQNAYNSKSVATSFEIVTTDHQKRYIPSASSAMVIGSILGLIQAIILISGAKPLLSF  195

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGV   S ML PA +YL LRSLG+PAVLLSLA+QGIFRG KDTKTPLYAT AGD+ NIIL
Sbjct  196   MGVGSDSPMLKPAQQYLMLRSLGAPAVLLSLAMQGIFRGFKDTKTPLYATVAGDVTNIIL  255

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI   H GV+GAAIAHVISQY++  +LL++L+ +V LLPPS KHLQ S+FLKNG  L
Sbjct  256   DPIFIFVFHLGVTGAAIAHVISQYLICFLLLWRLMAQVNLLPPSIKHLQFSRFLKNGFLL  315

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
               RVIA TFCVTLAASLAAR G T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA 
Sbjct  316   LMRVIAVTFCVTLAASLAARQGPTPMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAK  375

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY KA A A+RVLQ+G V+G  LA ++G+GL +G+ +F+KD NV+ LI IGIPFVA TQ
Sbjct  376   KDYDKATATASRVLQLGLVLGLMLAAILGMGLQYGARLFTKDVNVLHLIGIGIPFVAATQ  435

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PIN+LAFV DGVNFGASDF YSA+SMVMVA ++I   F+   +NGF+GIW+AL I+M LR
Sbjct  436   PINALAFVFDGVNFGASDFAYSAFSMVMVAIVSILVLFVLSYTNGFIGIWVALTIYMSLR  495

Query  226   TIAGLWRLATGTGPWCFLRA  167
             T AG WR+ TGTGPW FLRA
Sbjct  496   TFAGFWRIGTGTGPWEFLRA  515



>ref|XP_008801941.1| PREDICTED: MATE efflux family protein 1 isoform X1 [Phoenix dactylifera]
Length=522

 Score =   433 bits (1114),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 258/437 (59%), Positives = 323/437 (74%), Gaps = 16/437 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEE-KVAEEPGKDSDQLETMENGSLTIPSSET  1295
             V++TTSFVAEE++          + K+ +EE +  E  G  S   E  E     IP ++ 
Sbjct  99    VSVTTSFVAEEDA----------TCKMANEELECGEHEGPLSVNSEMKE----LIPQNDP  144

Query  1294  KGSSALSDLEASERDSKVK-RGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
             + + + S   + +    +  R +  IPSAS+AL++G ILG+LQ + L   A P+L  MGV
Sbjct  145   ERTGSNSSSCSDKSTCIIPGRERKHIPSASSALVIGGILGLLQALILISGAIPILNFMGV  204

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             KP S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD  NIILD I
Sbjct  205   KPDSPMLTPACQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDATNIILDPI  264

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             FI   H GVSGAAIAHVISQY++ LILL++L+REV++LPPS K LQ S+FLKNG  L AR
Sbjct  265   FIFVFHLGVSGAAIAHVISQYLIALILLWRLLREVDVLPPSIKDLQFSRFLKNGFLLLAR  324

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             VIA TFCVTLAAS+AAR GS  MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA +D+
Sbjct  325   VIAVTFCVTLAASMAARQGSIPMAAFQICLQIWLATSLLADGLAVAGQAILASAFARRDH  384

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
              KA AAA+RVLQ G ++G  L V++G+GL +GS +F+KD +V++LI IGIPFVA TQPIN
Sbjct  385   SKATAAASRVLQWGMILGLVLCVILGIGLQYGSRLFTKDADVLQLIHIGIPFVALTQPIN  444

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGASDF YSAYSMV+VA ++I    +   S+GF+GIWIAL I+M LR  A
Sbjct  445   ALAFVFDGINFGASDFAYSAYSMVLVAIVSILCLVVLSSSHGFIGIWIALTIYMSLRMFA  504

Query  217   GLWRLATGTGPWCFLRA  167
             G WR+    GPW FLR+
Sbjct  505   GFWRIGIARGPWTFLRS  521



>gb|KHN19386.1| MATE efflux family protein FRD3 [Glycine soja]
Length=540

 Score =   433 bits (1113),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 256/445 (58%), Positives = 317/445 (71%), Gaps = 14/445 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKV----------AEEPGKDSDQLETME-N  1325
             V+ITTSFVAEEN+    +  K++S K  S+E+V           +   K++++ E +E N
Sbjct  94    VSITTSFVAEENTIEKINTEKKLSDKAKSKEQVMLDDHSLQDIEKVASKENNETENVEMN  153

Query  1324  GSLTIPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLA  1145
                T     T  +S+ S  ++  +D + KR    + SASTAL+ G ILG+LQ   L   A
Sbjct  154   DCNTSICKSTSDTSSSSSNKSVPKDGRKKR---HVASASTALLFGTILGLLQATTLIFAA  210

Query  1144  KPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGD  965
             KPLL  MG+KP S MLNPA++YL LRSLG+PAVLLSLA+QGIFRG KDT TPLY   +G 
Sbjct  211   KPLLAAMGLKPDSPMLNPAIKYLRLRSLGAPAVLLSLAMQGIFRGFKDTTTPLYVILSGY  270

Query  964   LVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFL  785
              +N+ILD + I  C  G+ GAAI+HV+SQY++ L L+  L R+V+L+PPS K LQ+ +FL
Sbjct  271   ALNVILDPVLIFYCKLGIKGAAISHVLSQYLMALALMVILTRKVDLVPPSIKDLQIFRFL  330

Query  784   KNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAIL  605
             KNG  L ARVIA TFC TLAASLAAR+G   MAAFQ CLQ+WLTSSLLADGLA+A QAIL
Sbjct  331   KNGGLLLARVIAVTFCQTLAASLAARVGPIPMAAFQTCLQVWLTSSLLADGLAVAVQAIL  390

Query  604   ATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIP  425
             A +FA KDY+K   AA R LQM FV+G GL+  VG GLYFG+G+FSK   V+ LI IG+P
Sbjct  391   ACSFAEKDYEKVLVAATRTLQMSFVLGVGLSFAVGFGLYFGAGIFSKSVLVVHLIRIGLP  450

Query  424   FVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALA  245
             FVA TQPINSLAFV DGVN+GASDF YSAYS+V V+  ++   FL  KS GFVGIWIAL 
Sbjct  451   FVAATQPINSLAFVFDGVNYGASDFAYSAYSLVTVSLASVASLFLLSKSKGFVGIWIALT  510

Query  244   IFMLLRTIAGLWRLATGTGPWCFLR  170
             I+M LR  AG+WR+ TGTGPW FLR
Sbjct  511   IYMSLRMFAGVWRMGTGTGPWRFLR  535



>ref|XP_010479604.1| PREDICTED: MATE efflux family protein 1-like isoform X2 [Camelina 
sativa]
Length=510

 Score =   431 bits (1109),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 257/440 (58%), Positives = 320/440 (73%), Gaps = 19/440 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETME----NGSLTIPS  1304
             V+ITTSFVAEE++      S      V   ++  EE G ++ + E  E    N   +I S
Sbjct  85    VSITTSFVAEEDAYSSQQNS------VQDNKECTEEAGINNTKEEAQELIPENNKDSI-S  137

Query  1303  SETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
              E+K SS++ ++  S    ++      IPSAS+AL++G ILG+LQ VFL   AKPLL  M
Sbjct  138   DESKTSSSIFNVSQSPIRKRI------IPSASSALIIGSILGLLQAVFLISAAKPLLSFM  191

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVK  S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD  NIILD
Sbjct  192   GVKHDSPMLRPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDATNIILD  251

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     GV+GAAIAHV+SQY++  ILL+KL+ +V++   S+KHLQL +F+KNGL L 
Sbjct  252   PIFIFVFRLGVTGAAIAHVMSQYLMCGILLWKLMDQVDIFNLSTKHLQLCRFMKNGLLLL  311

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
              RVIA TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA K
Sbjct  312   MRVIAVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFANK  371

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             DYK+A A A+RVLQ+G V+G  LA ++G  L+FG+ VF+KD  V+ LI+IG+PFVAGTQP
Sbjct  372   DYKRAAATASRVLQLGLVLGFLLAAILGAALHFGARVFTKDDKVLHLISIGLPFVAGTQP  431

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN-GFVGIWIALAIFMLLR  227
             IN+LAFV DGVNFGASDF Y+A S+V+VA ++I    LFL S  GF+G+W  L I+M LR
Sbjct  432   INALAFVFDGVNFGASDFGYAAASLVVVAIVSI-LCLLFLSSTLGFIGLWFGLTIYMSLR  490

Query  226   TIAGLWRLATGTGPWCFLRA  167
                G WR+ TGTGPW FLR+
Sbjct  491   AAVGFWRIGTGTGPWSFLRS  510



>ref|XP_010315164.1| PREDICTED: MATE efflux family protein 1-like [Solanum lycopersicum]
Length=524

 Score =   432 bits (1111),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 260/441 (59%), Positives = 320/441 (73%), Gaps = 13/441 (3%)
 Frame = -2

Query  1471  VNITTSFVAEE------NSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTI  1310
             V++TTSFVAEE      N +L DD   E +  V +E    + P K        E+ SL  
Sbjct  91    VSVTTSFVAEEDAITNANEDLQDDRCMEKNEGVDAEAFETDSPSKS-------ESKSLIP  143

Query  1309  PSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
              +  T+      +L  S    + K  K  IPSAS+AL++G +LGI+Q VFL   AKPLL 
Sbjct  144   KNDSTESVCKSENLVTSFEIVQCKPEKRHIPSASSALIIGAVLGIIQAVFLIAGAKPLLK  203

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
              MGVK GS+M  PA  YL LRSLG+PAVLLSLA+QG+FRG KDTKTPL+AT AGDL NII
Sbjct  204   FMGVKTGSSMSKPAQDYLRLRSLGAPAVLLSLAMQGVFRGFKDTKTPLFATVAGDLANII  263

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD IF+   H GV GAAIAHVISQY++ +IL ++L+ +V+++PPS K+LQ S+FL NG  
Sbjct  264   LDPIFMFVFHLGVRGAAIAHVISQYLISVILFWRLLEKVDVVPPSLKYLQFSRFLTNGFL  323

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L  RVIA TFCVTLAASLAARLG T MAAFQVCLQIWL +SLLADGLA+AGQAILA+AFA
Sbjct  324   LLVRVIAVTFCVTLAASLAARLGPTQMAAFQVCLQIWLATSLLADGLAVAGQAILASAFA  383

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
              KD+ +  A A+RVLQ+G V+G  LA+V+G+GL++G+ VF+KD NV+ LI IGIPFVA T
Sbjct  384   QKDFSRCTATASRVLQLGVVLGLVLALVLGIGLHYGARVFTKDVNVLNLIGIGIPFVAAT  443

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QPIN LAFV DGVNFGASDF YSAYSM+ VA  +I F  +   S G++GIW+AL I+M L
Sbjct  444   QPINCLAFVFDGVNFGASDFAYSAYSMLTVALFSIIFLLILSSSYGYIGIWVALTIYMSL  503

Query  229   RTIAGLWRLATGTGPWCFLRA  167
             R +AG  R+ TGTGPW FLR+
Sbjct  504   RALAGFGRIGTGTGPWKFLRS  524



>ref|XP_006407769.1| hypothetical protein EUTSA_v10020489mg [Eutrema salsugineum]
 gb|ESQ49222.1| hypothetical protein EUTSA_v10020489mg [Eutrema salsugineum]
Length=532

 Score =   432 bits (1111),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 255/437 (58%), Positives = 325/437 (74%), Gaps = 9/437 (2%)
 Frame = -2

Query  1471  VNITTSFVAEENSE---LCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSS  1301
             V++TTSFVAEE++    + ++ +K+   +V+++    +      D LE       +  ++
Sbjct  95    VSVTTSFVAEEDTMEKMMKEEEAKKAKLQVHADTLAVQ------DSLEKGIASPTSNNTN  148

Query  1300  ETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
             + + + A     +S  +   K+ K  I SASTA+++G ILG++Q + L   +K LLG+MG
Sbjct  149   QPQQTPAPVTKSSSGSNKANKKEKKTIKSASTAMIIGLILGLVQAIVLIFSSKVLLGVMG  208

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             VKP S +L+PA ++LT+RSLG+PA+LLSL++QGIFRG KDTKTPLYAT   D++NIILD 
Sbjct  209   VKPDSAVLSPAHKFLTIRSLGAPALLLSLSMQGIFRGFKDTKTPLYATLVADIINIILDP  268

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             IFI     GVSGAAIAHVISQY + LIL  +L ++V L+PP+   LQ  KFL+NG  L A
Sbjct  269   IFIFVLRLGVSGAAIAHVISQYFMTLILFIRLAKKVNLMPPNFGELQFGKFLRNGSLLLA  328

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             R IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLT+SLLADGLA+AGQAILA +FA KD
Sbjct  329   RTIAVTFCQTLAAAMAARLGATPMAAFQICLQVWLTTSLLADGLAVAGQAILACSFAEKD  388

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
             + K  AAA+RVLQMGFV+G GL+V VGLGLYFG+GVFSKD  VI LI IGIPFVA TQPI
Sbjct  389   FNKVTAAASRVLQMGFVLGLGLSVFVGLGLYFGAGVFSKDPTVIHLIAIGIPFVAATQPI  448

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTI  221
             NSLAFVLDGVNFGASDF Y+AYSMV VAA++I       K NGF+GIWIAL I+M LR I
Sbjct  449   NSLAFVLDGVNFGASDFAYTAYSMVGVAAVSIAAIIYMAKFNGFLGIWIALTIYMGLRAI  508

Query  220   AGLWRLATGTGPWCFLR  170
              G+ R+ATGTGPW +LR
Sbjct  509   TGIARIATGTGPWRYLR  525



>ref|NP_001236876.1| ferric reductase defective 3b [Glycine max]
 gb|ACE89002.1| ferric reductase defective 3b [Glycine max]
 gb|ACE89003.1| ferric reductase defective 3b [Glycine max]
Length=540

 Score =   432 bits (1111),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 256/445 (58%), Positives = 316/445 (71%), Gaps = 14/445 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKV----------AEEPGKDSDQLETME-N  1325
             V+ITTSFVAEEN+    +  K++S K  S+E+V           +   K++++ E +E N
Sbjct  94    VSITTSFVAEENTIEKINTEKKLSDKAKSKEQVMLDDHSLQDIEKVASKENNETENVEMN  153

Query  1324  GSLTIPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLA  1145
                T     T  +S+ S  ++  +D + KR    + SASTAL+ G ILG+LQ   L   A
Sbjct  154   DCNTSICKSTSDTSSSSSNKSVPKDGRKKR---HVASASTALLFGTILGLLQATTLIFAA  210

Query  1144  KPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGD  965
             KPLL  MG+KP S MLNPA++YL LRSLG+PAVLLSLA+QGIFRG KDT TPLY   +G 
Sbjct  211   KPLLAAMGLKPDSPMLNPAIKYLRLRSLGAPAVLLSLAMQGIFRGFKDTTTPLYVILSGY  270

Query  964   LVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFL  785
              +N+ILD + I  C  G+ GAAI+HV+SQY++ L L+  L R+V+L+PPS K LQ+ +FL
Sbjct  271   ALNVILDPVLIFYCKLGIKGAAISHVLSQYLMALALMVILTRKVDLVPPSIKDLQIFRFL  330

Query  784   KNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAIL  605
             KNG  L ARVIA TFC TLAASLAAR G   MAAFQ CLQ+WLTSSLLADGLA+A QAIL
Sbjct  331   KNGGLLLARVIAVTFCQTLAASLAARFGPIPMAAFQTCLQVWLTSSLLADGLAVAVQAIL  390

Query  604   ATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIP  425
             A +FA KDY+K   AA R LQM FV+G GL+  VG GLYFG+G+FSK   V+ LI IG+P
Sbjct  391   ACSFAEKDYEKVLVAATRTLQMSFVLGVGLSFAVGFGLYFGAGIFSKSVLVVHLIRIGLP  450

Query  424   FVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALA  245
             FVA TQPINSLAFV DGVN+GASDF YSAYS+V V+  ++   FL  KS GFVGIWIAL 
Sbjct  451   FVAATQPINSLAFVFDGVNYGASDFAYSAYSLVTVSLASVASLFLLSKSKGFVGIWIALT  510

Query  244   IFMLLRTIAGLWRLATGTGPWCFLR  170
             I+M LR  AG+WR+ TGTGPW FLR
Sbjct  511   IYMSLRMFAGVWRMGTGTGPWRFLR  535



>ref|XP_006586606.1| PREDICTED: ferric reductase defective 3b isoform X1 [Glycine 
max]
Length=556

 Score =   432 bits (1112),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 256/445 (58%), Positives = 316/445 (71%), Gaps = 14/445 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKV----------AEEPGKDSDQLETME-N  1325
             V+ITTSFVAEEN+    +  K++S K  S+E+V           +   K++++ E +E N
Sbjct  110   VSITTSFVAEENTIEKINTEKKLSDKAKSKEQVMLDDHSLQDIEKVASKENNETENVEMN  169

Query  1324  GSLTIPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLA  1145
                T     T  +S+ S  ++  +D + KR    + SASTAL+ G ILG+LQ   L   A
Sbjct  170   DCNTSICKSTSDTSSSSSNKSVPKDGRKKR---HVASASTALLFGTILGLLQATTLIFAA  226

Query  1144  KPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGD  965
             KPLL  MG+KP S MLNPA++YL LRSLG+PAVLLSLA+QGIFRG KDT TPLY   +G 
Sbjct  227   KPLLAAMGLKPDSPMLNPAIKYLRLRSLGAPAVLLSLAMQGIFRGFKDTTTPLYVILSGY  286

Query  964   LVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFL  785
              +N+ILD + I  C  G+ GAAI+HV+SQY++ L L+  L R+V+L+PPS K LQ+ +FL
Sbjct  287   ALNVILDPVLIFYCKLGIKGAAISHVLSQYLMALALMVILTRKVDLVPPSIKDLQIFRFL  346

Query  784   KNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAIL  605
             KNG  L ARVIA TFC TLAASLAAR G   MAAFQ CLQ+WLTSSLLADGLA+A QAIL
Sbjct  347   KNGGLLLARVIAVTFCQTLAASLAARFGPIPMAAFQTCLQVWLTSSLLADGLAVAVQAIL  406

Query  604   ATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIP  425
             A +FA KDY+K   AA R LQM FV+G GL+  VG GLYFG+G+FSK   V+ LI IG+P
Sbjct  407   ACSFAEKDYEKVLVAATRTLQMSFVLGVGLSFAVGFGLYFGAGIFSKSVLVVHLIRIGLP  466

Query  424   FVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALA  245
             FVA TQPINSLAFV DGVN+GASDF YSAYS+V V+  ++   FL  KS GFVGIWIAL 
Sbjct  467   FVAATQPINSLAFVFDGVNYGASDFAYSAYSLVTVSLASVASLFLLSKSKGFVGIWIALT  526

Query  244   IFMLLRTIAGLWRLATGTGPWCFLR  170
             I+M LR  AG+WR+ TGTGPW FLR
Sbjct  527   IYMSLRMFAGVWRMGTGTGPWRFLR  551



>ref|XP_007203966.1| hypothetical protein PRUPE_ppa023647mg [Prunus persica]
 gb|EMJ05165.1| hypothetical protein PRUPE_ppa023647mg [Prunus persica]
Length=494

 Score =   431 bits (1107),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 253/434 (58%), Positives = 312/434 (72%), Gaps = 21/434 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE      D ++E+ A     E V E     S ++E  E     +P     
Sbjct  81    VSITTSFVAEE------DATEELRANEQVHENV-ENGTPISMEMEMEE----LVPLVGKS  129

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              S+ +  LE   R          IPSAS+AL++G ILG +Q VFL   A P+L  MGV  
Sbjct  130   SSTEMVKLECVRR---------HIPSASSALVVGSILGFIQAVFLIFAANPVLNYMGVDS  180

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD+ NIILD I +
Sbjct  181   NSPMLKPARQYLTLRSLGAPAVLLSLAVQGVFRGFKDTKTPLYATIVGDVANIILDPILM  240

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                H GV GAAIAHV+SQY++ LILL+KL ++V+LL    K L+  +FLKNG  L  RVI
Sbjct  241   FVFHMGVRGAAIAHVVSQYLISLILLWKLNKQVDLLTSGVKDLRFGQFLKNGFLLLVRVI  300

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             AATFCVTLAA+LAAR G T MAAFQVCLQIWL +SLLADGLA+AGQAILA+AFA KD+ K
Sbjct  301   AATFCVTLAAALAARQGPTTMAAFQVCLQIWLAASLLADGLAVAGQAILASAFARKDHSK  360

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+RVLQ+  V+G  L++++ + L FGS +F+KD NV++LI++GIPFVA TQPIN+L
Sbjct  361   AVATASRVLQLALVLGLMLSIILMVVLQFGSRIFTKDINVLQLISLGIPFVAVTQPINAL  420

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVN+GASDF YSAYSMV+VA ++I   FL L S+GFVGIW+AL++FM LR + G 
Sbjct  421   AFVFDGVNYGASDFAYSAYSMVLVALVSILCLFL-LSSHGFVGIWVALSVFMSLRALVGF  479

Query  211   WRLATGTGPWCFLR  170
             WR+ TG GPW FLR
Sbjct  480   WRIGTGMGPWSFLR  493



>ref|XP_010461411.1| PREDICTED: MATE efflux family protein FRD3-like isoform X2 [Camelina 
sativa]
Length=528

 Score =   432 bits (1110),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 253/439 (58%), Positives = 326/439 (74%), Gaps = 17/439 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V+ITTSFVAEE++  ++ ++ +K  +  V++E  + ++         ++E G L+ P+S 
Sbjct  95    VSITTSFVAEEDTMEKMKEEANK--ANLVHAETILVQD---------SLEKG-LSSPTSN  142

Query  1297  TKGSS---ALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             T         SD +++  +   K+GK  I +ASTA+++G ILG+ Q +FL   +K LLG 
Sbjct  143   TPNQPQQPPASDTKSNSENKGNKKGKRTIRTASTAMILGLILGLAQAIFLIFSSKLLLGF  202

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGVK  S ML+PA +YL++R+LG+PA+LLSLA+QG+FRG KDTKTPL+AT   +L+NI+L
Sbjct  203   MGVKSDSPMLSPAHKYLSIRALGAPALLLSLAMQGVFRGFKDTKTPLFATVVANLINIVL  262

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI     G SGAAIAHVISQY + LIL   L +EV L+PP+   LQ  +FLKNGL L
Sbjct  263   DPIFIFVLRLGTSGAAIAHVISQYFMTLILFIFLAKEVNLMPPNFGDLQFGRFLKNGLLL  322

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
              AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLTSSLL DGLA+AGQAILA +FA 
Sbjct  323   LARTIAVTFCQTLAAAMAARLGATPMAAFQICLQVWLTSSLLNDGLAVAGQAILACSFAE  382

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY K  A A+RVLQMGFV+G GL+V VGLGLYFG+G+FSKD  VI L+ IGIPF+A TQ
Sbjct  383   KDYTKVSAVASRVLQMGFVLGFGLSVFVGLGLYFGAGIFSKDPAVIHLMAIGIPFIAATQ  442

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PINSLAFVLDGVNFGASDF Y+AYSMV VAA++I        ++GF+GIWIAL ++M LR
Sbjct  443   PINSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAVIYMAMTHGFIGIWIALTVYMALR  502

Query  226   TIAGLWRLATGTGPWCFLR  170
              I G+ R+ATGTGPW +LR
Sbjct  503   AITGIARIATGTGPWRYLR  521



>ref|NP_001238722.1| aluminum-activated citrate transporter [Glycine max]
 gb|ACC60274.1| aluminum-activated citrate transporter [Glycine max]
Length=555

 Score =   432 bits (1112),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 253/437 (58%), Positives = 318/437 (73%), Gaps = 14/437 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++           A   +EE    E G+ +D  ET E     +P   T 
Sbjct  132   VSVTTSFVAEEDTL--------SGANPQTEEGRCLEAGQPTDT-ETKE----LLPQKVTG  178

Query  1291  GSSALSDLEASERD-SKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
             G+   SD      + +K +R +  IPSAS+A+ +G ILG++Q +FL   AKPLL  MGV 
Sbjct  179   GNVHNSDFVGESFNIAKEERKRRHIPSASSAIFIGGILGLIQAIFLISAAKPLLNFMGVT  238

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
               S ML+PA +YL LRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NI LD +F
Sbjct  239   SDSPMLHPAKQYLKLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIALDPLF  298

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +     GVSGAAIAHVISQY++ +ILL++L+ +V+L+PPS  HLQL +FLKNG  L  RV
Sbjct  299   MFVFRLGVSGAAIAHVISQYLISVILLWRLLEQVDLIPPSINHLQLDRFLKNGFLLLMRV  358

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAASLAAR G T MAAFQVCLQ+WL  SLLADGLA+AGQAILA AFA KD+ 
Sbjct  359   IAVTFCVTLAASLAARQGPTSMAAFQVCLQVWLAVSLLADGLAVAGQAILAGAFANKDFN  418

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +A A A+RVLQMG V+G  LA ++G G +FG+ +F++D NV+ LI IGIPF+A TQP+NS
Sbjct  419   RATATASRVLQMGLVLGLALAFILGTGSHFGAKIFTQDANVLHLIQIGIPFIAATQPLNS  478

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DGVNFGASDF YSA+SMV+VA ++I    + L + GF+GIW+AL I+M LR  AG
Sbjct  479   LAFVFDGVNFGASDFAYSAFSMVVVAILSIISLLILLSAGGFIGIWVALTIYMGLRAFAG  538

Query  214   LWRLATGTGPWCFLRAS  164
               R+ TG+GPW FLR+S
Sbjct  539   FLRIGTGSGPWEFLRSS  555



>gb|KDP22091.1| hypothetical protein JCGZ_25922 [Jatropha curcas]
Length=517

 Score =   431 bits (1108),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 261/441 (59%), Positives = 322/441 (73%), Gaps = 24/441 (5%)
 Frame = -2

Query  1471  VNITTSFVAEE------NSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTI  1310
             V++TTSFVAEE      N E+ D  S E  + V SE K         + +    +G    
Sbjct  94    VSVTTSFVAEEDTIGSVNPEVQDSESLETGSVVNSESK---------ELIPQNVSGE---  141

Query  1309  PSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
                  K  SA+S  + +    K++ G+  IPSAS+AL++G ILG +Q +FL   AKPLL 
Sbjct  142   --GAYKSKSAMSSFDIA----KMESGRRHIPSASSALVIGAILGFIQAIFLISGAKPLLN  195

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
              MGV   S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD+ NII
Sbjct  196   FMGVGSDSPMLRPAQQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVTGDVTNII  255

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD +F+     GVSGAAIAHVISQY++ +ILL++L+ +V+LLPPS KHLQ  KFLKNG  
Sbjct  256   LDPVFMFVFRLGVSGAAIAHVISQYLISVILLWRLMEKVDLLPPSVKHLQFGKFLKNGFL  315

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L  RVIA TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADGLA+AGQAILATAFA
Sbjct  316   LLMRVIAVTFCVTLSASLAARQGSTAMAAFQVCLQVWLATSLLADGLAVAGQAILATAFA  375

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
               DY+KA A A+RVLQ+G ++G  LA+++G+GL FGS +F+ D NV+R+I+IGIPFVAGT
Sbjct  376   KSDYEKATATASRVLQLGLLLGLMLAIILGVGLSFGSRLFTSDVNVLRMISIGIPFVAGT  435

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QPIN+LAFV DGVNFGASDF YSAYSMV+VA ++I        +  F+GIW+AL I+M L
Sbjct  436   QPINALAFVFDGVNFGASDFAYSAYSMVLVAIISILSLLFLSSTYKFIGIWVALTIYMSL  495

Query  229   RTIAGLWRLATGTGPWCFLRA  167
             RT AG WR+ T TGPW FLR+
Sbjct  496   RTSAGFWRIGTRTGPWNFLRS  516



>ref|XP_006493919.1| PREDICTED: MATE efflux family protein 1-like [Citrus sinensis]
Length=510

 Score =   431 bits (1107),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 250/435 (57%), Positives = 319/435 (73%), Gaps = 17/435 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTS VAEE      D  K ++ + + EEK+ E+    S+++E +      I   E K
Sbjct  93    VSVTTSLVAEE------DTIKRLTVEAHEEEKL-EKGFATSEEMEEL------ISEVECK  139

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              +  L+++ A     + +  +  IPSAS+AL++G +LG++QT FL   AKP+L  MGV  
Sbjct  140   -TMTLNNISA---KVEARHERKHIPSASSALVIGSVLGLIQTFFLIAYAKPILNYMGVNS  195

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S M+ PA +YLTLRS+G+PAVLLSLA+QGIFRG KDTKTP YAT  GDL N+ILD IFI
Sbjct  196   DSPMIKPAQQYLTLRSIGAPAVLLSLALQGIFRGFKDTKTPFYATILGDLANVILDPIFI  255

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                +WGVSGAAIAHVISQY++ LILL+KLI EV+LLPPSSK L+  +FLKNG  L  RVI
Sbjct  256   FLFNWGVSGAAIAHVISQYLISLILLWKLIEEVDLLPPSSKDLKFGQFLKNGFLLMVRVI  315

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTLAASLAAR GST MAAFQVCLQIWL +SLLADGLA+A Q ILA+AF  KDY +
Sbjct  316   AVTFCVTLAASLAARQGSTSMAAFQVCLQIWLATSLLADGLAVAAQTILASAFVKKDYDR  375

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A   A+RVLQ+  V+G  L V + +GL F S +F+KD  V++LI +GIPF+A TQPIN+L
Sbjct  376   ATTIASRVLQLSVVLGLVLTVNLLVGLPFSSRLFTKDLKVLQLIGVGIPFIAVTQPINAL  435

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DG+NFGASDF YSAYSMV VA ++I   F+   S+G+VGIW+AL+++M LR IAG 
Sbjct  436   AFVFDGINFGASDFAYSAYSMVSVAVVSILCLFILSSSHGYVGIWVALSMYMSLRAIAGF  495

Query  211   WRLATGTGPWCFLRA  167
              R+ +G+GPW FL+A
Sbjct  496   LRIGSGSGPWSFLKA  510



>ref|XP_010461208.1| PREDICTED: MATE efflux family protein FRD3-like isoform X1 [Camelina 
sativa]
 ref|XP_010461282.1| PREDICTED: MATE efflux family protein FRD3-like isoform X1 [Camelina 
sativa]
 ref|XP_010461348.1| PREDICTED: MATE efflux family protein FRD3-like isoform X1 [Camelina 
sativa]
Length=529

 Score =   431 bits (1109),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 253/440 (58%), Positives = 327/440 (74%), Gaps = 18/440 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V+ITTSFVAEE++  ++ ++ +K  +  V++E  + ++         ++E G L+ P+S 
Sbjct  95    VSITTSFVAEEDTMEKMKEEANK--ANLVHAETILVQD---------SLEKG-LSSPTSN  142

Query  1297  T----KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
             T    +     SD +++  +   K+GK  I +ASTA+++G ILG+ Q +FL   +K LLG
Sbjct  143   TPNQPQQPPVASDTKSNSENKGNKKGKRTIRTASTAMILGLILGLAQAIFLIFSSKLLLG  202

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
              MGVK  S ML+PA +YL++R+LG+PA+LLSLA+QG+FRG KDTKTPL+AT   +L+NI+
Sbjct  203   FMGVKSDSPMLSPAHKYLSIRALGAPALLLSLAMQGVFRGFKDTKTPLFATVVANLINIV  262

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD IFI     G SGAAIAHVISQY + LIL   L +EV L+PP+   LQ  +FLKNGL 
Sbjct  263   LDPIFIFVLRLGTSGAAIAHVISQYFMTLILFIFLAKEVNLMPPNFGDLQFGRFLKNGLL  322

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLTSSLL DGLA+AGQAILA +FA
Sbjct  323   LLARTIAVTFCQTLAAAMAARLGATPMAAFQICLQVWLTSSLLNDGLAVAGQAILACSFA  382

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
              KDY K  A A+RVLQMGFV+G GL+V VGLGLYFG+G+FSKD  VI L+ IGIPF+A T
Sbjct  383   EKDYTKVSAVASRVLQMGFVLGFGLSVFVGLGLYFGAGIFSKDPAVIHLMAIGIPFIAAT  442

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QPINSLAFVLDGVNFGASDF Y+AYSMV VAA++I        ++GF+GIWIAL ++M L
Sbjct  443   QPINSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAVIYMAMTHGFIGIWIALTVYMAL  502

Query  229   RTIAGLWRLATGTGPWCFLR  170
             R I G+ R+ATGTGPW +LR
Sbjct  503   RAITGIARIATGTGPWRYLR  522



>ref|XP_010479603.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Camelina 
sativa]
Length=516

 Score =   431 bits (1107),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 257/440 (58%), Positives = 320/440 (73%), Gaps = 19/440 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETME----NGSLTIPS  1304
             V+ITTSFVAEE++      S      V   ++  EE G ++ + E  E    N   +I S
Sbjct  91    VSITTSFVAEEDAYSSQQNS------VQDNKECTEEAGINNTKEEAQELIPENNKDSI-S  143

Query  1303  SETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
              E+K SS++ ++  S    ++      IPSAS+AL++G ILG+LQ VFL   AKPLL  M
Sbjct  144   DESKTSSSIFNVSQSPIRKRI------IPSASSALIIGSILGLLQAVFLISAAKPLLSFM  197

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVK  S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD  NIILD
Sbjct  198   GVKHDSPMLRPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDATNIILD  257

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     GV+GAAIAHV+SQY++  ILL+KL+ +V++   S+KHLQL +F+KNGL L 
Sbjct  258   PIFIFVFRLGVTGAAIAHVMSQYLMCGILLWKLMDQVDIFNLSTKHLQLCRFMKNGLLLL  317

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
              RVIA TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA K
Sbjct  318   MRVIAVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFANK  377

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             DYK+A A A+RVLQ+G V+G  LA ++G  L+FG+ VF+KD  V+ LI+IG+PFVAGTQP
Sbjct  378   DYKRAAATASRVLQLGLVLGFLLAAILGAALHFGARVFTKDDKVLHLISIGLPFVAGTQP  437

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN-GFVGIWIALAIFMLLR  227
             IN+LAFV DGVNFGASDF Y+A S+V+VA ++I    LFL S  GF+G+W  L I+M LR
Sbjct  438   INALAFVFDGVNFGASDFGYAAASLVVVAIVSI-LCLLFLSSTLGFIGLWFGLTIYMSLR  496

Query  226   TIAGLWRLATGTGPWCFLRA  167
                G WR+ TGTGPW FLR+
Sbjct  497   AAVGFWRIGTGTGPWSFLRS  516



>gb|KFK38257.1| hypothetical protein AALP_AA3G089700 [Arabis alpina]
Length=532

 Score =   431 bits (1108),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 258/450 (57%), Positives = 322/450 (72%), Gaps = 32/450 (7%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++                E    EE  K ++QL    + +L +  S  K
Sbjct  92    VSITTSFVAEEDTM---------------ERMKEEEEAKKANQL-VHASDTLHVQDSMEK  135

Query  1291  GSSAL----------------SDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVF  1160
             G S+L                S+ ++S      K+GK  I SASTA+++G ILG++Q + 
Sbjct  136   GISSLTSNNDNNNTNQPQPQASNTKSSNGKKPNKKGKKTIKSASTAMIIGLILGLVQAIS  195

Query  1159  LTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYA  980
             L   +K L+G+MGVKP S +L+PA RYLT+RSLG+PA++LSL++QGIFRG KDTKTPL+A
Sbjct  196   LIFGSKVLIGVMGVKPDSPVLSPAQRYLTIRSLGAPALVLSLSMQGIFRGFKDTKTPLFA  255

Query  979   TAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQ  800
             T   D++NI+LD IFI     G+SGAAIAHVISQY + LIL  +L  +V+L PP+   LQ
Sbjct  256   TVVADVINIVLDPIFIFVLRLGISGAAIAHVISQYCMTLILFIRLANKVDLKPPNFGELQ  315

Query  799   LSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIA  620
               KFLKNG  + AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLT+SLLADGLA+A
Sbjct  316   FGKFLKNGGLMLARTIAVTFCQTLAAAMAARLGTTQMAAFQICLQVWLTTSLLADGLAVA  375

Query  619   GQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLI  440
              QAILA +F  KDY K  AAA+RVLQMGFV+G GL+V VGLGLYFG+G+F+KD NVI LI
Sbjct  376   AQAILACSFTEKDYNKVSAAASRVLQMGFVLGLGLSVFVGLGLYFGAGIFTKDPNVIHLI  435

Query  439   TIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGI  260
              IGIPFVA TQPINSLAFVLDGVNFGASDF Y+AYSMV VAA++I       K +GF+GI
Sbjct  436   VIGIPFVAATQPINSLAFVLDGVNFGASDFAYTAYSMVGVAAISITAVIYMAKFSGFLGI  495

Query  259   WIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             WIAL I+M LR + G+ R+ATGTGPW FLR
Sbjct  496   WIALTIYMALRAVTGIVRIATGTGPWKFLR  525



>ref|XP_011075217.1| PREDICTED: MATE efflux family protein 1-like [Sesamum indicum]
 ref|XP_011075218.1| PREDICTED: MATE efflux family protein 1-like [Sesamum indicum]
Length=507

 Score =   430 bits (1105),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 252/434 (58%), Positives = 311/434 (72%), Gaps = 28/434 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE+++    GS       Y E ++AE+     ++ E +      +P  E  
Sbjct  101   VSVTTSFVAEEDAK----GSSRAE---YRETEMAEKQSASDNEKEQL------MPKMEMT  147

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
             G  A                K  I SAS+AL++G  LG++Q V L   AKPLL  MGVK 
Sbjct  148   GGMA---------------TKRHISSASSALIIGGALGLIQAVILICTAKPLLSYMGVKS  192

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD+ NIILD IFI
Sbjct  193   DSPMLKPAVRYLTVRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATMVGDVANIILDPIFI  252

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GVSGAAIAHV+SQY++ LIL+++L+ +V LLPP+ + LQLS+FL+NGL L  RVI
Sbjct  253   FLFGLGVSGAAIAHVLSQYLISLILMWRLMEQVNLLPPTIEDLQLSRFLRNGLLLLFRVI  312

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             AATFCVTLAASLAA+LGST MAAFQ+CLQ+WL +SLLADGLA+AGQAILA AFA  DY+K
Sbjct  313   AATFCVTLAASLAAKLGSTSMAAFQICLQVWLATSLLADGLAVAGQAILANAFARNDYEK  372

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
               A A+RVLQ+   +G  L +VV + L F S +F+ D NV+RL+ +GIPFVA TQPINSL
Sbjct  373   VMATASRVLQLSLALGLILCIVVAIILQFSSRLFTDDINVLRLLQLGIPFVAVTQPINSL  432

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DG+N+GASDF YSAYSMV++A  TI   FL   SN FVGIW+AL+IFM LR +AG 
Sbjct  433   AFVFDGLNYGASDFTYSAYSMVLIAVFTIICLFLLYSSNAFVGIWLALSIFMSLRAVAGF  492

Query  211   WRLATGTGPWCFLR  170
              R+ T TGPW FLR
Sbjct  493   LRIGTRTGPWSFLR  506



>ref|XP_006366538.1| PREDICTED: MATE efflux family protein 1-like [Solanum tuberosum]
Length=522

 Score =   430 bits (1106),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 257/439 (59%), Positives = 318/439 (72%), Gaps = 11/439 (3%)
 Frame = -2

Query  1471  VNITTSFVAEE----NSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPS  1304
             V++TTSFVAEE    N ++ DD   E +    +E    + P K        E+ SL   +
Sbjct  91    VSVTTSFVAEEDAISNEDMQDDKCMEKNEGDDAEAFETDSPSKS-------ESKSLLPKN  143

Query  1303  SETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
               T+       +  S    K K  K  IPSAS+AL++G +LGI+Q VFL   AKPLL  M
Sbjct  144   DSTESICKSEKIVTSFEIVKSKPEKRHIPSASSALIIGAVLGIIQAVFLIAGAKPLLKFM  203

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVKPGS M  PA  YL LRSLG+PAVLLSLA+QG+FRG KDTKTPL+AT AGDL NIILD
Sbjct  204   GVKPGSPMSKPAQDYLRLRSLGAPAVLLSLAMQGVFRGFKDTKTPLFATVAGDLANIILD  263

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IF+   H GV GAAIAHVISQY++ +IL  +L+ +V+++PPS K+LQ ++FL NG  L 
Sbjct  264   PIFMFVFHLGVRGAAIAHVISQYLISVILFLRLLEKVDIVPPSLKYLQFARFLTNGFLLL  323

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
              RVIAATFCVTLAASLAARLG T MAAFQVCLQIWL +SLLADGLA+AGQAILA+AFA K
Sbjct  324   VRVIAATFCVTLAASLAARLGPTQMAAFQVCLQIWLATSLLADGLAVAGQAILASAFAQK  383

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             D+ +  A A+RVLQ+G V+G  LA+V+G+GL++G+ VF+KD NV+ LI IGIPFVA TQP
Sbjct  384   DFNRCTATASRVLQLGVVLGLVLALVLGIGLHYGARVFTKDVNVLNLIGIGIPFVAATQP  443

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             IN LAFV DGVNFGASDF YSAYSM+ VA  +I F  +   + G++GIW+AL I+M LR 
Sbjct  444   INCLAFVFDGVNFGASDFAYSAYSMLTVALFSIIFLLILSSNYGYIGIWVALTIYMSLRA  503

Query  223   IAGLWRLATGTGPWCFLRA  167
             +AG  R+ TGTGPW FL++
Sbjct  504   LAGFGRIGTGTGPWKFLQS  522



>ref|XP_004250944.1| PREDICTED: MATE efflux family protein 1 [Solanum lycopersicum]
 ref|XP_010313275.1| PREDICTED: MATE efflux family protein 1 [Solanum lycopersicum]
 ref|XP_010313276.1| PREDICTED: MATE efflux family protein 1 [Solanum lycopersicum]
 ref|XP_010313277.1| PREDICTED: MATE efflux family protein 1 [Solanum lycopersicum]
 ref|XP_010313278.1| PREDICTED: MATE efflux family protein 1 [Solanum lycopersicum]
Length=510

 Score =   429 bits (1104),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 263/439 (60%), Positives = 317/439 (72%), Gaps = 17/439 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEE----KVAEEPGKDSDQLETMENGSLTIPS  1304
             V++TTSFVAEE      D   +VS+     E    +  +  G D++     EN  L IP 
Sbjct  83    VSVTTSFVAEE------DTITKVSSMPRDNEIQDIQSQDVEGLDTESQSNSENKEL-IPQ  135

Query  1303  SET--KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
             + +  K  +  +  E      K K  K  IPSAS+AL++G ILG +Q  FL   AKP+L 
Sbjct  136   NRSVYKSETTATSFEVV----KPKPEKRHIPSASSALIIGAILGFIQAAFLISGAKPILS  191

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
              MGVK GS ML PA  YL LRSLG+PAVLLSLA+QG+FRG KDTKTPL+AT AGDL NII
Sbjct  192   FMGVKHGSPMLKPAQEYLKLRSLGAPAVLLSLAMQGVFRGFKDTKTPLFATVAGDLTNII  251

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD IFI A H GV GAAIAHVISQY++  IL ++L+ +V+LLPPS K++Q S+FL NG  
Sbjct  252   LDPIFIFAFHMGVRGAAIAHVISQYLISAILFWRLMEKVDLLPPSLKYMQFSRFLTNGFL  311

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L  RVIA TFCVTLAASLAARLG T MAAFQVCLQ+WLT SLLADGLA+AGQAILA+AFA
Sbjct  312   LLMRVIAVTFCVTLAASLAARLGPTEMAAFQVCLQVWLTVSLLADGLAVAGQAILASAFA  371

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
               DY +A A A+RVLQ+G V+G  LAV++G+GL+FG+ +F++D NVI LI IG+PFVA T
Sbjct  372   QNDYNRATATASRVLQLGLVLGLVLAVILGVGLHFGARLFTEDVNVIHLIGIGMPFVAAT  431

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QPIN+LAFV DGVNFGASDF YSAYSMV VA  +I F F+   S  FVGIW+AL I+M L
Sbjct  432   QPINALAFVFDGVNFGASDFAYSAYSMVTVALFSILFLFILSSSYKFVGIWVALTIYMSL  491

Query  229   RTIAGLWRLATGTGPWCFL  173
             R +AG WR+ T TGPW FL
Sbjct  492   RALAGFWRIGTRTGPWKFL  510



>ref|XP_009343721.1| PREDICTED: MATE efflux family protein 1-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009343730.1| PREDICTED: MATE efflux family protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=513

 Score =   429 bits (1104),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 268/440 (61%), Positives = 320/440 (73%), Gaps = 24/440 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLET--MENGSLT--IPS  1304
             V++TTSFVAEE      D    VS +            KDSD LET    NG +   IP 
Sbjct  93    VSVTTSFVAEE------DTIGTVSPE-----------AKDSDYLETGSSTNGEMKQLIPE  135

Query  1303  SE-TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             S+ T+ +     +  S         K  IPSAS+A+++G ILG++Q +FL   AKPLL  
Sbjct  136   SDATQNAYNSKSVATSFEIVTTNHQKRYIPSASSAMVIGSILGLIQAIFLISGAKPLLNF  195

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGV   S ML PA +YL LRSLG+PAVLLSLA+QGIFRG KDTKTPLYAT  GD+ NIIL
Sbjct  196   MGVGSDSPMLKPAQQYLMLRSLGAPAVLLSLAMQGIFRGFKDTKTPLYAT--GDVTNIIL  253

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI   H GV+GAAIAHVISQY++  ILL++L+ +V LLPPS KHLQ S+FLKNG  L
Sbjct  254   DPIFIFVFHLGVTGAAIAHVISQYLICFILLWRLMAQVNLLPPSIKHLQFSRFLKNGFLL  313

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
               RVIA TFCVTLAASLAAR G T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA 
Sbjct  314   LMRVIAVTFCVTLAASLAARQGPTPMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAK  373

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY KA A A+RVLQ+G V+G  LA ++G+GL +G+ +F+KD NV+ LI IGIPFVA TQ
Sbjct  374   KDYDKATATASRVLQLGLVLGLMLAAILGVGLQYGARLFTKDVNVLHLIGIGIPFVAATQ  433

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PIN+LAFV DGVNFGASDF YSA+SMVMVA ++I   F+   +NGF+GIW+AL I+M LR
Sbjct  434   PINALAFVFDGVNFGASDFAYSAFSMVMVAIVSILVLFVLSYTNGFIGIWVALTIYMSLR  493

Query  226   TIAGLWRLATGTGPWCFLRA  167
             T AG WR+ TGTGPW FLRA
Sbjct  494   TFAGFWRIGTGTGPWEFLRA  513



>ref|XP_006421437.1| hypothetical protein CICLE_v10004816mg [Citrus clementina]
 gb|ESR34677.1| hypothetical protein CICLE_v10004816mg [Citrus clementina]
Length=498

 Score =   429 bits (1102),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 255/437 (58%), Positives = 319/437 (73%), Gaps = 21/437 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTS VAEE      D  K +  + + EEK+ E+    S++ E +      I   E K
Sbjct  81    VSVTTSLVAEE------DTIKRLRVEAHEEEKL-EKGFATSEETEEL------ISEVECK  127

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
              + AL+++ A     KV+ G  R  IPSAS+AL++G +LG++Q  F+   AKP+L  MGV
Sbjct  128   -TMALNNISA-----KVEAGHERKHIPSASSALVIGSVLGLIQAFFVIAYAKPILNYMGV  181

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
                S M+ PA +YLTLRSLG+PAVLLSLA+QGIFRG KDTKTP YAT  GDL N+ILD I
Sbjct  182   NSDSPMIKPAQQYLTLRSLGAPAVLLSLALQGIFRGFKDTKTPFYATILGDLANLILDPI  241

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             FI   +WGVSGAAIAHVISQY++ LILL+KLI EV+LLPPSSK L+  +FLKNG  L  R
Sbjct  242   FIFLFNWGVSGAAIAHVISQYLISLILLWKLIEEVDLLPPSSKDLKFGQFLKNGFLLMVR  301

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             VIA TFCVTLAASLAAR GST MAAFQVCLQIWL +SLLADGLA+A Q ILA+AF  KDY
Sbjct  302   VIAVTFCVTLAASLAARQGSTSMAAFQVCLQIWLATSLLADGLAVAAQTILASAFVKKDY  361

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
              KA   A+RVLQ+  V+G  L V + +GL F S +F+KD  V++LI +GIPF+A TQPIN
Sbjct  362   DKATTIASRVLQLSVVLGLVLTVNLLVGLPFSSRLFTKDLKVLQLIGVGIPFIAVTQPIN  421

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGASDF YSAYSMV VA ++I   F+   S+G+VGIW+AL+++M LR IA
Sbjct  422   ALAFVFDGINFGASDFAYSAYSMVSVAVVSILCLFILSSSHGYVGIWVALSMYMSLRAIA  481

Query  217   GLWRLATGTGPWCFLRA  167
             G  R+ +G+GPW FL+A
Sbjct  482   GFLRIGSGSGPWSFLKA  498



>gb|KHN39937.1| MATE efflux family protein FRD3 [Glycine soja]
Length=569

 Score =   431 bits (1107),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 251/455 (55%), Positives = 316/455 (69%), Gaps = 21/455 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPG-KDSDQLETMENGSLTIPSSET  1295
             V+ITTSFVAEE++    +  K+++ K  S+E + ++   +D ++  + E       SS  
Sbjct  110   VSITTSFVAEESTIEKINTEKKLTDKTKSKEVMHDDHALQDIEKGASKEKNETPTESSAV  169

Query  1294  KGSSAL--SDLEASERDSKV------------------KRGKLRIPSASTALMMGCILGI  1175
             +G++     ++E  + ++ +                   R K  I SASTAL+ G ILG+
Sbjct  170   RGNTTCVPENVEMDDCNTSICKSASETSSSSNKSVSKAGRKKRHIASASTALLFGTILGL  229

Query  1174  LQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTK  995
             LQ   L   AKPLL  MG+KP S MLNPA++YL LRSLG+PAVLLSLA+QGIFRG KDT 
Sbjct  230   LQATTLIFAAKPLLAAMGLKPDSPMLNPAIKYLRLRSLGAPAVLLSLAMQGIFRGFKDTT  289

Query  994   TPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPS  815
             TPLY   +G  +N+ILD + I  C  G+ GAAI+HV+SQY++ L L+  L R+V+L+PPS
Sbjct  290   TPLYVILSGYALNVILDPVLIFYCKLGIKGAAISHVLSQYLMALALMVILTRKVDLVPPS  349

Query  814   SKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLAD  635
              K LQ+ +FLKNG  L ARVIA TFC TLAASLAAR G   MAAFQ CLQ+WLTSSLLAD
Sbjct  350   IKDLQIFRFLKNGGLLLARVIAVTFCQTLAASLAARFGPIPMAAFQTCLQVWLTSSLLAD  409

Query  634   GLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKN  455
             GLA+A QAILA +FA KDY+K   AA R LQM FV+G GL+  VG+GLYFG+G+FSK   
Sbjct  410   GLAVAVQAILACSFAEKDYEKVLVAATRTLQMSFVLGVGLSFAVGVGLYFGAGIFSKSVL  469

Query  454   VIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN  275
             V+ LI IG+PFVA TQPINSLAFV DGVN+GASDF YSAYS+V V+  ++   FL  KS 
Sbjct  470   VVHLIRIGLPFVAATQPINSLAFVFDGVNYGASDFAYSAYSLVTVSLASVASLFLLSKSK  529

Query  274   GFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             GFVGIWIAL I+M LR  AG+WR+ TGTGPW FLR
Sbjct  530   GFVGIWIALTIYMSLRMFAGVWRMGTGTGPWRFLR  564



>ref|NP_001236057.1| ferric reductase defective 3a [Glycine max]
 ref|XP_006596933.1| PREDICTED: ferric reductase defective 3a isoform X1 [Glycine 
max]
 ref|XP_006596934.1| PREDICTED: ferric reductase defective 3a isoform X2 [Glycine 
max]
 gb|ACE89000.1| ferric reductase defective 3a [Glycine max]
 gb|ACE89001.1| ferric reductase defective 3a [Glycine max]
Length=553

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 251/455 (55%), Positives = 316/455 (69%), Gaps = 21/455 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPG-KDSDQLETMENGSLTIPSSET  1295
             V+ITTSFVAEE++    +  K+++ K  S+E + ++   +D ++  + E       SS  
Sbjct  94    VSITTSFVAEESTIEKINTEKKLTDKTKSKEVMHDDHSLQDIEKGASKEKNETPTESSAV  153

Query  1294  KGSSAL--SDLEASERDSKV------------------KRGKLRIPSASTALMMGCILGI  1175
             +G++     ++E  + ++ +                   R K  I SASTAL+ G ILG+
Sbjct  154   RGNTTCVPENVEMDDCNTSICKSTTETSSSSNKSVSKAGRKKRHIASASTALLFGTILGL  213

Query  1174  LQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTK  995
             LQ   L   AKPLL  MG+KP S MLNPA++YL LRSLG+PAVLLSLA+QGIFRG KDT 
Sbjct  214   LQATTLIFAAKPLLAAMGLKPDSPMLNPAIKYLRLRSLGAPAVLLSLAMQGIFRGFKDTT  273

Query  994   TPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPS  815
             TPLY   +G  +N+ILD + I  C  G+ GAAI+HV+SQY++ L L+  L R+V+L+PPS
Sbjct  274   TPLYVILSGYALNVILDPVLIFYCKLGIKGAAISHVLSQYLMALALMVILTRKVDLVPPS  333

Query  814   SKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLAD  635
              K LQ+ +FLKNG  L ARVIA TFC TLAASLAAR G   MAAFQ CLQ+WLTSSLLAD
Sbjct  334   IKDLQIFRFLKNGGLLLARVIAVTFCQTLAASLAARFGPIPMAAFQTCLQVWLTSSLLAD  393

Query  634   GLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKN  455
             GLA+A QAILA +FA KDY+K   AA R LQM FV+G GL+  VG+GLYFG+G+FSK   
Sbjct  394   GLAVAVQAILACSFAEKDYEKVLVAATRTLQMSFVLGVGLSFAVGVGLYFGAGIFSKSVL  453

Query  454   VIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN  275
             V+ LI IG+PFVA TQPINSLAFV DGVN+GASDF YSAYS+V V+  ++   FL  KS 
Sbjct  454   VVHLIRIGLPFVAATQPINSLAFVFDGVNYGASDFAYSAYSLVTVSLASVASLFLLSKSK  513

Query  274   GFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             GFVGIWIAL I+M LR  AG+WR+ TGTGPW FLR
Sbjct  514   GFVGIWIALTIYMSLRMFAGVWRMGTGTGPWRFLR  548



>gb|KCW51178.1| hypothetical protein EUGRSUZ_J00768 [Eucalyptus grandis]
 gb|KCW51179.1| hypothetical protein EUGRSUZ_J00768 [Eucalyptus grandis]
Length=528

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 257/437 (59%), Positives = 325/437 (74%), Gaps = 19/437 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE      D  + VS++    E +      ++  +E  EN  L IP +E+ 
Sbjct  105   VSVTTSFVAEE------DTIRSVSSEAQESECL------EACSIENAENMEL-IPQNESS  151

Query  1291  GSSA----LSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
                +    +S  + S+ D   +R    IPSAS+AL++G +LG+LQ +FL   AKPLL  M
Sbjct  152   DHLSELIQISSFKVSKFDQMPRRR--HIPSASSALVIGSVLGLLQAIFLISAAKPLLNFM  209

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GV   S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDT TPL AT AGD+ NIILD
Sbjct  210   GVGSDSPMLTPAQQYLTLRSLGAPAVLLSLAMQGVFRGFKDTTTPLIATVAGDVTNIILD  269

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              +FI   H GVSGAAIAHVISQY++ LILL+KL+++++LLPPS KHLQ  +FLKNG  L 
Sbjct  270   PLFIFVFHLGVSGAAIAHVISQYVISLILLWKLMQQIDLLPPSFKHLQFGRFLKNGFLLL  329

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
              RV+A TFCVTLAAS+AARLG T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA K
Sbjct  330   MRVVAVTFCVTLAASMAARLGPTSMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAKK  389

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             DY KA+   +RVLQ+G ++G  LAV++G+G++FG+ +F+ D  V+R+I+IGIPF+A TQP
Sbjct  390   DYNKARETTSRVLQLGLLLGLALAVLLGVGMHFGARLFTTDVGVLRVISIGIPFIAATQP  449

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             IN+LAFV DGVNFGASDF YSAYSMV VA ++I   F+   S+GF+GIWIAL I+M LR 
Sbjct  450   INALAFVFDGVNFGASDFAYSAYSMVAVAVVSILCLFILSSSHGFIGIWIALTIYMSLRA  509

Query  223   IAGLWRLATGTGPWCFL  173
              AG WR+ TGTGPW FL
Sbjct  510   FAGFWRIGTGTGPWNFL  526



>ref|XP_004499881.1| PREDICTED: MATE efflux family protein FRD3-like [Cicer arietinum]
Length=549

 Score =   429 bits (1104),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 255/454 (56%), Positives = 321/454 (71%), Gaps = 17/454 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS----------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETME-N  1325
             V+ITTSFVAEE++          +  +D  K  S ++   + + ++      +L T E N
Sbjct  94    VSITTSFVAEEDTINKINIRAAEKQFNDSIKTKSIEIMPGDHLLQDIEAGESKLNTEEKN  153

Query  1324  GSL---TIPSSETKGSSALSDLEASERD---SKVKRGKLRIPSASTALMMGCILGILQTV  1163
             G+L   T    +T  +++ S +  S R+   SK  R K+ I SASTAL+ G  LG++QT 
Sbjct  154   GTLKNETKNGDDTNSNTSKSSIVTSNRNKSESKPIRKKMHIASASTALLFGTFLGLIQTA  213

Query  1162  FLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLY  983
              L    KPLLG MG+K  S ML PA++YL LR++G+PAVLLSLA+QGIFRG KDT TPLY
Sbjct  214   TLIFATKPLLGAMGLKYDSPMLIPAVKYLRLRAIGAPAVLLSLAMQGIFRGFKDTTTPLY  273

Query  982   ATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHL  803
                +G  +N+ +D + I     G+ GAAI+HV+SQYI+   LL  L+R+V+LLPPS K L
Sbjct  274   VIVSGYALNVAMDPLLIFYFKLGIKGAAISHVLSQYIMAFFLLLILMRKVDLLPPSMKDL  333

Query  802   QLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAI  623
             Q+ +FLKNG  L ARVIA TFCVTL+ASLAARLG   MAAFQ CLQ+W+TSSLLADGLA+
Sbjct  334   QIFRFLKNGGLLLARVIAVTFCVTLSASLAARLGPIPMAAFQTCLQVWMTSSLLADGLAV  393

Query  622   AGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRL  443
             A QAILA +FA KDY K  AAA RVLQM FV+G GL+ VVG GL+FG+GVFSK+ +VI L
Sbjct  394   AIQAILACSFAEKDYNKVTAAATRVLQMSFVLGVGLSFVVGGGLFFGAGVFSKNVDVIHL  453

Query  442   ITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVG  263
             I +GIPFVA TQPINSLAFV DGVN+GASDF YSAYS+VMV+  ++   F   KS GF+G
Sbjct  454   IRLGIPFVAATQPINSLAFVFDGVNYGASDFAYSAYSLVMVSLASVTSLFFLYKSKGFIG  513

Query  262   IWIALAIFMLLRTIAGLWRLATGTGPWCFLRAST  161
             IWIAL I+M LR IAG+WR+ TGTGPW FLR  +
Sbjct  514   IWIALTIYMSLRMIAGIWRMGTGTGPWRFLRGHS  547



>ref|XP_010908478.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Elaeis 
guineensis]
Length=534

 Score =   429 bits (1103),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 251/437 (57%), Positives = 325/437 (74%), Gaps = 15/437 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++  C   + E       E +  E P   +++++ +      IP  +  
Sbjct  110   VSVTTSFVAEEDAA-CKMANDE------PEREAFEGPFSVNNEMKEL------IPQIDPD  156

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
             G++  S   + +    VK    R  +PS S+AL++G +LG+LQ + L + A P+L  MGV
Sbjct  157   GNAYSSSSFSDKSTFPVKLESERKHMPSVSSALVIGGVLGLLQALILVLGAIPILNFMGV  216

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             KP S ML PA +YLTLRSLG+PAVLLSLA+QG++RG KDT+TPLYAT AGD  NIILD I
Sbjct  217   KPDSPMLTPACQYLTLRSLGAPAVLLSLAMQGVYRGFKDTRTPLYATVAGDATNIILDPI  276

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             F+     GVSGAAIAHVISQY++ LILL++L+R+V++LPPS K LQ S+FLKNG  L AR
Sbjct  277   FMFVFQLGVSGAAIAHVISQYLISLILLWRLLRKVDVLPPSFKDLQFSRFLKNGSLLLAR  336

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             VIA TFCVTL+AS+AAR GS  MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA +D+
Sbjct  337   VIAVTFCVTLSASMAARQGSIPMAAFQICLQIWLATSLLADGLAVAGQAILASAFARRDH  396

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
              KA+AAA+RVLQ G ++G  L  ++G+GL F S +F+KD NV++L+ IGIPFVA TQPIN
Sbjct  397   SKARAAASRVLQWGMILGLVLCAILGIGLQFASRLFTKDANVLQLMHIGIPFVALTQPIN  456

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGASDF YSAYSMV+VA ++I    +   S+GFVGIW+ALAI+M LRT+A
Sbjct  457   ALAFVFDGINFGASDFAYSAYSMVLVAIVSILCLVVLSSSHGFVGIWVALAIYMSLRTVA  516

Query  217   GLWRLATGTGPWCFLRA  167
             G WR+ T  GPW FLR+
Sbjct  517   GFWRIGTARGPWTFLRS  533



>ref|XP_007150365.1| hypothetical protein PHAVU_005G147400g [Phaseolus vulgaris]
 gb|ESW22359.1| hypothetical protein PHAVU_005G147400g [Phaseolus vulgaris]
Length=514

 Score =   428 bits (1100),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 250/436 (57%), Positives = 314/436 (72%), Gaps = 14/436 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE      D     S ++   + +   P  D++  E +      + +S+  
Sbjct  93    VSVTTSFVAEE------DTLSGASPQIEEGKCLEAGPPMDTETKELLPQKGGNVHNSDFV  146

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
               S    +   + + K    K  IPSAS AL +G +LG++Q +FL   AKPLL  MGV  
Sbjct  147   CES----INIVQEEHK----KRHIPSASAALFIGGVLGLIQAIFLISAAKPLLNFMGVTS  198

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML+PA +YL LRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NI LD +F+
Sbjct  199   DSPMLHPAQQYLRLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIALDPLFM  258

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                 +GVSGAAIAHVISQY++  ILL++L+ +V+L+PPS KHLQL +FLKNG  L  RVI
Sbjct  259   FVFGYGVSGAAIAHVISQYLISGILLWRLLEQVDLIPPSLKHLQLERFLKNGFLLLMRVI  318

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTLAASLAAR GST MAAFQVCLQ+WL  SLLADGLA+AGQAILA AFA KD+ +
Sbjct  319   AVTFCVTLAASLAARQGSTSMAAFQVCLQVWLAVSLLADGLAVAGQAILAGAFANKDFNR  378

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+RVLQMG V+G  LA ++G GL+FG+ +F+KD  V+RLI IGIPFVA TQP+NSL
Sbjct  379   ASATASRVLQMGLVLGLVLAFILGTGLHFGARIFTKDAEVLRLIQIGIPFVAVTQPLNSL  438

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVNFGASDF YSA+SMV+VA ++I    +   + GF+GIW+AL I+M LR  AG 
Sbjct  439   AFVFDGVNFGASDFAYSAFSMVVVAVLSIICLLILSSTGGFIGIWVALTIYMGLRAFAGF  498

Query  211   WRLATGTGPWCFLRAS  164
              R+ TG+GPW FLR+S
Sbjct  499   LRIGTGSGPWEFLRSS  514



>ref|XP_006299121.1| hypothetical protein CARUB_v10015261mg [Capsella rubella]
 gb|EOA32019.1| hypothetical protein CARUB_v10015261mg [Capsella rubella]
Length=525

 Score =   428 bits (1101),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 258/438 (59%), Positives = 320/438 (73%), Gaps = 21/438 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++                 EK+ EE  K +   +++E G L+ PSS T 
Sbjct  98    VSITTSFVAEEDTM----------------EKMKEEANKANLVQDSLEKG-LSSPSSNTT  140

Query  1291  GS----SALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
                   +  SD + +      K+GK  I +ASTA+++G ILG++Q++ L   +K LLG+M
Sbjct  141   NQPPQETPASDTKPNSETKAKKKGKRTIRTASTAMILGLILGLVQSIILIFSSKLLLGVM  200

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVKP S M+ PA +YL++R+LG+PA+LLSLA+QG+FRG KDTKTPL+AT   +L NI+LD
Sbjct  201   GVKPNSPMIAPAHKYLSIRALGAPALLLSLAMQGVFRGFKDTKTPLFATVVANLTNIVLD  260

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     GVSGAAIAHVISQY + LIL   L +EV L+PP+   LQ  +FLKNGL L 
Sbjct  261   PIFIFVLRLGVSGAAIAHVISQYFMTLILFVLLAKEVNLMPPNFGDLQFGRFLKNGLLLL  320

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
             AR IA TFC TLAAS+AARLG+T MAAFQ+CLQ+WLTSSLL DGLA+A QAILA +FA K
Sbjct  321   ARTIAVTFCQTLAASMAARLGTTPMAAFQICLQVWLTSSLLNDGLAVAAQAILACSFAEK  380

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             DY K  A AARVLQMG  +G GL++ VGLGL+FG+G+FSKD  VIRL+ IGIPF+A TQP
Sbjct  381   DYNKVSAVAARVLQMGLALGLGLSLFVGLGLHFGAGIFSKDAAVIRLMAIGIPFIAATQP  440

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             INSLAFVLDGVNFGASDF Y+AYSMV VAA++I       K+NGF+GIWIAL I+M LR 
Sbjct  441   INSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAIIYMAKTNGFIGIWIALTIYMALRA  500

Query  223   IAGLWRLATGTGPWCFLR  170
             I G+ R+ATGTGPW FLR
Sbjct  501   ITGIARMATGTGPWRFLR  518



>dbj|BAM68467.1| multi drugs and toxic compounds exclusion protein [Eucalyptus 
camaldulensis]
Length=502

 Score =   427 bits (1098),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 257/437 (59%), Positives = 317/437 (73%), Gaps = 16/437 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSE--LCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V+ITTSFVAEE+++  L  +  K+ +   +    V++E  KD +  E +     T  SS 
Sbjct  78    VSITTSFVAEEDTKERLHIEAQKDENGDKWF--PVSKE--KDVEMEELLPQSDSTSKSSF  133

Query  1297  TKGS-SALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
             T  S   ++DL+   R          IPSAS+AL++G ILGILQT+FL   AKP+L  MG
Sbjct  134   TDTSFGKMADLDNKRR---------YIPSASSALVIGSILGILQTLFLIFAAKPILNYMG  184

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             VK  S ML PA +YLTLRSLG+PAVLLSLA+QGIFRG KDTKTPLYAT  GD  NIILD 
Sbjct  185   VKSDSPMLMPAQKYLTLRSLGAPAVLLSLAMQGIFRGFKDTKTPLYATVVGDASNIILDR  244

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             +FI     G+SGAAIAHVISQY++ LILL++L+ +V+LLPPS K L+  +FLKNGL L  
Sbjct  245   LFIFDFRMGISGAAIAHVISQYLISLILLWRLMSQVDLLPPSIKDLKFERFLKNGLLLLV  304

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             RVIA TFCVTLAASLAAR G+T MAAFQVCLQIWL +SLLADGLA+AGQAILA+AFA  D
Sbjct  305   RVIAVTFCVTLAASLAARHGATSMAAFQVCLQIWLATSLLADGLAVAGQAILASAFARAD  364

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
             Y+KA + A+RVLQ+G  MG  L+VV+  GL F S +F++D  V+ LI++GIPFVA TQPI
Sbjct  365   YEKAMSTASRVLQLGLAMGLVLSVVLVTGLQFASRLFTEDAGVLHLISVGIPFVAVTQPI  424

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTI  221
             N+LAFV DG+N+GASDF YSAYSMV+VA ++I        + GF+GIWIAL I+M LRT 
Sbjct  425   NALAFVFDGINYGASDFAYSAYSMVLVAVVSIACLCALSSTYGFIGIWIALTIYMTLRTF  484

Query  220   AGLWRLATGTGPWCFLR  170
             AG  R+  G GPW FL 
Sbjct  485   AGFLRIGAGMGPWGFLN  501



>ref|XP_003599150.1| Ferric reductase defective 3b [Medicago truncatula]
 gb|AES69401.1| MATE efflux family protein [Medicago truncatula]
Length=540

 Score =   428 bits (1101),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 253/447 (57%), Positives = 318/447 (71%), Gaps = 12/447 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAE--EPGKDSDQLETMENGSLTIPSSE  1298
             V+ITTSFVAEE++   D  + + + K ++E   A+  E   D   L+ +E G+    S+ 
Sbjct  94    VSITTSFVAEEDT--MDRINTKAAEKQFNESGKAKSNEVMPDDHLLQDIEAGATKQDSTL  151

Query  1297  TKGSSALSDLEAS--------ERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAK  1142
               G  A S++  S        + +SK  R K  I SASTAL+ G +LG++Q   L   AK
Sbjct  152   KNGDDANSNISKSSIVTNSSNKSESKPIRKKRHIASASTALLFGTVLGLIQAATLIFAAK  211

Query  1141  PLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDL  962
             PLLG MG+K  S ML PA++YL LR+LG+PAVLLSLA+QGIFRG KDT TPLY   +G  
Sbjct  212   PLLGAMGLKYDSPMLVPAVKYLRLRALGAPAVLLSLAMQGIFRGFKDTTTPLYVIVSGYA  271

Query  961   VNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLK  782
             +N+ +D + I     G+ GAAI+HV+SQYI+  +LLF L+++V+LLPPS K LQ+ +FLK
Sbjct  272   LNVAMDPLLIFYFKLGIRGAAISHVLSQYIMATLLLFILMKKVDLLPPSMKDLQIFRFLK  331

Query  781   NGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILA  602
             NG  L ARVIA TFCVTL+ASLAARLG   MAAFQ CLQ+W+TSSLLADGLA+A QAILA
Sbjct  332   NGGLLLARVIAVTFCVTLSASLAARLGPIPMAAFQTCLQVWMTSSLLADGLAVAIQAILA  391

Query  601   TafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPF  422
              +FA KDY K   AA R LQM FV+G GL++VVG GLYFG+GVFSK+  VI LI +G+PF
Sbjct  392   CSFAEKDYNKVTTAATRTLQMSFVLGVGLSLVVGGGLYFGAGVFSKNVAVIHLIRLGLPF  451

Query  421   VAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAI  242
             VA TQPINSLAFV DGVN+GASDF YSAYS+VMV+  ++   F   KS GF+GIWIAL I
Sbjct  452   VAATQPINSLAFVFDGVNYGASDFAYSAYSLVMVSIASVTSLFFLYKSKGFIGIWIALTI  511

Query  241   FMLLRTIAGLWRLATGTGPWCFLRAST  161
             +M LR  AG+WR+ TGTGPW FLR  +
Sbjct  512   YMSLRMFAGVWRMGTGTGPWRFLRGQS  538



>gb|KDO45405.1| hypothetical protein CISIN_1g010889mg [Citrus sinensis]
Length=498

 Score =   426 bits (1096),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 249/435 (57%), Positives = 317/435 (73%), Gaps = 17/435 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTS VAEE      D  K ++ + + EEK+ E+    S+++E +      I   E K
Sbjct  81    VSVTTSLVAEE------DTIKRLTVEAHEEEKL-EKGFATSEEMEEL------ISEVECK  127

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              +  L+++ A     + +  +  IPSAS+AL++G +LG++Q  F+   AKP+L  MGV  
Sbjct  128   -TMTLNNISA---KVEARHERKHIPSASSALVIGSVLGLIQAFFVIAYAKPILNYMGVNS  183

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S M+ PA +YLTLRSLG+PAVLLSLA+QGIFRG KDTKTP YAT  GDL N+ILD IFI
Sbjct  184   DSPMIKPAQQYLTLRSLGAPAVLLSLALQGIFRGFKDTKTPFYATILGDLANVILDPIFI  243

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                +WGVSGAAIAHVISQY++ LILL+KLI EV+LLPPSSK L+  +FLKNG  L  RVI
Sbjct  244   FLFNWGVSGAAIAHVISQYLISLILLWKLIEEVDLLPPSSKDLKFGQFLKNGFLLMVRVI  303

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTLAASLAAR GST MAAFQVCLQIWL +SLLADGLA+A Q ILA+AF  KDY K
Sbjct  304   AVTFCVTLAASLAARQGSTSMAAFQVCLQIWLATSLLADGLAVAAQTILASAFVKKDYDK  363

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A   A+ VLQ+  V+G  L V + +GL F S +F+KD  V++LI +GIPF+A TQPIN+L
Sbjct  364   ATTIASHVLQLSVVLGLVLTVNLLVGLPFSSRLFTKDLKVLQLIGVGIPFIAVTQPINAL  423

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DG+NFGASDF YSAYSMV VA ++I   F+   S+G+VGIW+AL+++M LR IAG 
Sbjct  424   AFVFDGINFGASDFAYSAYSMVSVAVVSILCLFILSSSHGYVGIWVALSMYMSLRAIAGF  483

Query  211   WRLATGTGPWCFLRA  167
              R+ +G+GPW FL+A
Sbjct  484   LRIGSGSGPWSFLKA  498



>ref|XP_010909110.1| PREDICTED: MATE efflux family protein 1-like [Elaeis guineensis]
Length=609

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 245/436 (56%), Positives = 313/436 (72%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +   G +E        E + +    ++D+ E         P ++++
Sbjct  187   VSVTTSFVAEEDA-IISKGFQE-----QRNEDLEKNSPVNADEKEVP-------PCNDSE  233

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  S + ASE     + G  R  IPS S+AL++G +LGILQ +FL + A+PLL +MGV
Sbjct  234   KRCGASHI-ASEHVKLSRSGCSRKYIPSVSSALIVGGVLGILQAIFLILAARPLLSIMGV  292

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K GS ML PALRYLTLRSLGSPAVLLSLA+QG+FRG KDTKTPLYAT  GD+ NIILD I
Sbjct  293   KSGSPMLTPALRYLTLRSLGSPAVLLSLAVQGVFRGFKDTKTPLYATVVGDVTNIILDPI  352

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +   H GVSGAAIAHVISQY++ LI+L +L+R+V ++PPS K L+ S+FL+ G  L  R
Sbjct  353   LMFVFHLGVSGAAIAHVISQYLITLIMLSRLVRQVNVVPPSIKALKFSRFLRCGFMLLGR  412

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTL ASLAA  G  +MAAFQ+CLQ+WL +SLLADGLA+AGQAILATAFA   Y
Sbjct  413   VVAVTFCVTLGASLAAHHGPIIMAAFQICLQVWLATSLLADGLAVAGQAILATAFARGGY  472

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
              K  AA ARVLQ+  V+G  L +++G+GL FGSG+F+KD NVI +I  GIPFVAGTQ +N
Sbjct  473   HKVVAATARVLQLSIVLGMALTLLLGVGLQFGSGIFTKDINVIHIIHKGIPFVAGTQTLN  532

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             SLAFV DG+NFGASD+ YSAYSMV VAA++I        ++GF+GIW AL I+M +RT A
Sbjct  533   SLAFVFDGINFGASDYTYSAYSMVAVAAVSIPCLIYLSSTHGFIGIWTALTIYMSIRTFA  592

Query  217   GLWRLATGTGPWCFLR  170
              +WR+    GPW F+R
Sbjct  593   SVWRMGAARGPWTFIR  608



>ref|XP_009123959.1| PREDICTED: MATE efflux family protein FRD3-like [Brassica rapa]
 ref|XP_009123965.1| PREDICTED: MATE efflux family protein FRD3-like [Brassica rapa]
 emb|CDY22150.1| BnaC01g39510D [Brassica napus]
Length=528

 Score =   427 bits (1097),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 260/437 (59%), Positives = 320/437 (73%), Gaps = 13/437 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELC---DDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSS  1301
             V++TTSFVAEE++      D+ +K ++    S  + + E G  S           T P+S
Sbjct  95    VSVTTSFVAEEDTMEKMKEDEANKAITHANTSAVQDSLEKGVASPASNNTSQPQQT-PAS  153

Query  1300  ETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
             +TK SS     +  +++ K         SASTA+++G ILG++Q + L   +K LLG+MG
Sbjct  154   DTKPSSGNKAKKKGKKNIK---------SASTAMIIGLILGLVQAIALIFSSKVLLGVMG  204

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             VKP S +L+PA +YLT+RSLGSPA+LLSL++QGIFRG KDTKTPLYAT   D++NIILD 
Sbjct  205   VKPNSAVLSPAHKYLTIRSLGSPALLLSLSMQGIFRGFKDTKTPLYATVVADVINIILDP  264

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             IFI   H GVSGAAIAHVISQY + LIL  +L  +V L+PP+   LQ  KFLK+G  L A
Sbjct  265   IFIFVLHLGVSGAAIAHVISQYFMTLILFIRLASKVNLMPPNFGELQFGKFLKSGGLLLA  324

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             R +A TFC TLAA++ ARLG+T MAAFQ+CLQ+WLT+SLLADGLA+AGQAILA +FA KD
Sbjct  325   RTVAVTFCQTLAAAVMARLGTTPMAAFQICLQVWLTTSLLADGLAVAGQAILACSFAEKD  384

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
             Y K  AA +RVLQMGFV+G GL+V VGLGLYFG+GVFSKD  VI LI IGIPFVA TQPI
Sbjct  385   YNKVTAATSRVLQMGFVLGLGLSVFVGLGLYFGAGVFSKDAAVIHLIAIGIPFVAATQPI  444

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTI  221
             NS+AFVLDGVNFGASDF Y+AYSMV VAA+TI       K  GF+GIWIAL I+M LRT+
Sbjct  445   NSIAFVLDGVNFGASDFAYTAYSMVGVAAITIAAIIYMAKFYGFLGIWIALTIYMGLRTV  504

Query  220   AGLWRLATGTGPWCFLR  170
              G+ R+ATGTGPW FLR
Sbjct  505   TGIARIATGTGPWKFLR  521



>ref|XP_009777234.1| PREDICTED: MATE efflux family protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=520

 Score =   426 bits (1096),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 258/443 (58%), Positives = 322/443 (73%), Gaps = 21/443 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENS------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTI  1310
             V++TTS VAEE++      E  D  S+++ ++        E  G D++     EN  L I
Sbjct  91    VSVTTSMVAEEDTITKVSPEPRDTESQDLQSQ--------EAEGLDTEFQSNSENKEL-I  141

Query  1309  PSSET--KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPL  1136
             P S +  K     +  E  +R    K  K  IPSAS+AL++G ILG++Q VFL   AKP+
Sbjct  142   PQSRSMYKFEMIATTFEVLKR----KPEKRHIPSASSALIIGAILGLIQAVFLISGAKPI  197

Query  1135  LGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVN  956
             L  MGVK GS +L PA  YL LRSLG+PAVLLSLA+QG+FRG KDT+TPL+A  AGDL N
Sbjct  198   LNFMGVKSGSPVLKPAQEYLKLRSLGAPAVLLSLAMQGVFRGFKDTQTPLFAAVAGDLTN  257

Query  955   IILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNG  776
             IILD IFI   H G+ GAAIAHVISQY++ +IL ++L+ +V+LLPPS K+LQ ++FL NG
Sbjct  258   IILDPIFIFVFHMGIRGAAIAHVISQYLISVILFWRLMEQVDLLPPSLKYLQFARFLTNG  317

Query  775   LWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATa  596
               L  RVIA TFCVTLAASLAARLG T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+A
Sbjct  318   FLLLMRVIAVTFCVTLAASLAARLGPTEMAAFQVCLQVWLATSLLADGLAVAGQAILASA  377

Query  595   favkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVA  416
             FA KD+ +A A A+RVLQ+G V+G  LA+++G+GL+FG+ +F+ D NVI LI IGIPFVA
Sbjct  378   FAQKDFGRATATASRVLQLGLVLGLVLALILGVGLHFGARLFTNDINVIHLIGIGIPFVA  437

Query  415   GTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFM  236
              TQPIN+LAFV DGVNFGASDF YSAYSMV VA  +I F F+   S  FVGIW+AL ++M
Sbjct  438   TTQPINALAFVFDGVNFGASDFAYSAYSMVAVAIFSIVFLFVLSSSYKFVGIWVALTVYM  497

Query  235   LLRTIAGLWRLATGTGPWCFLRA  167
              LR  AG WR+ TGTGPW FL++
Sbjct  498   SLRAFAGFWRIGTGTGPWKFLKS  520



>ref|XP_010057429.1| PREDICTED: MATE efflux family protein 1-like [Eucalyptus grandis]
Length=502

 Score =   426 bits (1094),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 254/435 (58%), Positives = 312/435 (72%), Gaps = 12/435 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE+++  +    E       ++ +     KD +  E +     T  SS T 
Sbjct  78    VSITTSFVAEEDTK--ERLHIEAQKNENGDKWLPVSKEKDVEMEELLPQSDSTSKSSFTD  135

Query  1291  GS-SALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
              S   ++DL+   R          IPSAS+AL++G ILGILQT+FL   AKP+L  MGVK
Sbjct  136   TSFGKMADLDNKRR---------YIPSASSALVIGSILGILQTLFLIFSAKPILNYMGVK  186

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
               S ML PA +YLTLRSLG+PAVLLSLA+QGIFRG KDTKTPLYAT  GD  NIILD +F
Sbjct  187   SDSPMLMPAQKYLTLRSLGAPAVLLSLAMQGIFRGFKDTKTPLYATVVGDASNIILDPLF  246

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             I     G+SGAAIAHVISQY++ LILL++L+ +V+LLPPS K L+  +FLKNGL L  RV
Sbjct  247   IFVFRMGISGAAIAHVISQYLISLILLWRLMSQVDLLPPSIKDLKFERFLKNGLLLLVRV  306

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAASLAAR G+T MAAFQVCLQIWL +SLLADGLA+AGQAILA+AFA  DY+
Sbjct  307   IAVTFCVTLAASLAARHGATSMAAFQVCLQIWLATSLLADGLAVAGQAILASAFARADYE  366

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             KA + A+RVLQ+G  MG  L+VV+  GL F S +F++D  V+ LI++GIPFVA TQPIN+
Sbjct  367   KAVSTASRVLQLGLAMGLVLSVVLVTGLQFASRLFTEDAGVLHLISVGIPFVAVTQPINA  426

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DG+N+GASDF YSAYSMV+VA ++I        + GF+GIWIAL I+M LRT AG
Sbjct  427   LAFVFDGINYGASDFAYSAYSMVLVAVVSIVCLCALSSTYGFIGIWIALTIYMTLRTFAG  486

Query  214   LWRLATGTGPWCFLR  170
               R+  G GPW FL 
Sbjct  487   FLRIGAGMGPWGFLN  501



>gb|KDP26018.1| hypothetical protein JCGZ_21051 [Jatropha curcas]
Length=495

 Score =   425 bits (1092),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 259/435 (60%), Positives = 314/435 (72%), Gaps = 17/435 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTS VA+E      D +  +S +V+  EK+ +    + +  E +     T   S   
Sbjct  78    VSVTTSLVAKE------DTTGILSTEVHETEKLEDGVAVNKEMEELLPKAESTHKPSSVS  131

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
                  SD E           +  IPSAS+AL++GC+LG+LQ  FL   AKP+L  MGV  
Sbjct  132   SVCTKSDYE-----------RKHIPSASSALVVGCVLGLLQAFFLIFGAKPILNYMGVHS  180

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA +YLTLRSL +PAVLLSLA+QG+FRG+KDTKTPL+AT AGD+ NI+LD IFI
Sbjct  181   DSPMLIPAQQYLTLRSLSAPAVLLSLAMQGVFRGIKDTKTPLFATLAGDIANIVLDPIFI  240

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GVSGAAIAHVISQY++ LILL+KLI  V+LLPPS K LQ S+FLKNG  L  RVI
Sbjct  241   FLFRLGVSGAAIAHVISQYLISLILLWKLIEHVDLLPPSIKDLQFSQFLKNGFMLLLRVI  300

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             AAT CVTLAASLAAR GST MAAFQVCLQIWL +SLLADGLA+AGQAILATAFA KDY K
Sbjct  301   AATCCVTLAASLAARHGSTSMAAFQVCLQIWLATSLLADGLAVAGQAILATAFANKDYDK  360

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             AKA  +RVLQ G V+G  L+V++ +GL F SG+F++D NV+R+I+IGIPFV  TQPIN L
Sbjct  361   AKATTSRVLQFGLVLGLLLSVILSVGLPFASGLFTEDINVLRIISIGIPFVTATQPINVL  420

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVN+GASDF YSAYSM++VA ++I   F    S+GFVGIWIAL IFM LR   G+
Sbjct  421   AFVFDGVNYGASDFAYSAYSMILVAIISILCLFTLSSSHGFVGIWIALTIFMSLRAFTGV  480

Query  211   WRLATGTGPWCFLRA  167
              R+ TGTGPW FLR+
Sbjct  481   LRVGTGTGPWNFLRS  495



>ref|XP_007015048.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY32667.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=516

 Score =   425 bits (1093),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 264/439 (60%), Positives = 325/439 (74%), Gaps = 22/439 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLET---MENGSLT-IPS  1304
             V++TTSFVAEE++            +V SE        ++S+ LET   + N S   IP 
Sbjct  94    VSVTTSFVAEEDT----------IGRVSSE-------AQESECLETGSYVNNESKELIPQ  136

Query  1303  SET-KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
              E+ +G+     L  S    K +  +  IPSAS+AL++G ILG+LQ +FL   AKPLL  
Sbjct  137   KESSEGAYQPKTLGGSFDIVKFEPERRHIPSASSALVIGGILGLLQAIFLISGAKPLLNF  196

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGV   S MLNPA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NIIL
Sbjct  197   MGVSSDSPMLNPAQQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIIL  256

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IF+   H GVSGAAIAHVISQY++ +ILL+KL+ +V+LLPPS KHLQ S+FLKNG  L
Sbjct  257   DPIFMFVFHLGVSGAAIAHVISQYLISVILLWKLMSQVDLLPPSLKHLQFSRFLKNGFLL  316

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
               RV+A TFC+TL+AS+AAR GST MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA 
Sbjct  317   LIRVMAVTFCITLSASMAARQGSTSMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAK  376

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
              D++KA A A+RVLQ+G V+G  LAVV+G GL FG+ +F+KD NV+ LI  GIPFVA TQ
Sbjct  377   GDHEKATATASRVLQLGLVLGLILAVVLGGGLSFGAKLFTKDVNVLHLIGTGIPFVAATQ  436

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PINSLAFV DGVNFGASDF YSA+S+V+VA ++I    +   S GF+G+WIAL I+M LR
Sbjct  437   PINSLAFVFDGVNFGASDFAYSAFSLVLVAIVSIICLSILSSSRGFIGLWIALTIYMSLR  496

Query  226   TIAGLWRLATGTGPWCFLR  170
               AG WR+ TGTGPW FLR
Sbjct  497   AFAGFWRIGTGTGPWKFLR  515



>ref|XP_010486385.1| PREDICTED: MATE efflux family protein FRD3 [Camelina sativa]
Length=528

 Score =   426 bits (1094),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 253/439 (58%), Positives = 325/439 (74%), Gaps = 17/439 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V+ITTSFVAEE++  ++ ++ +K   A +   EK+  +        +++E G L+ P+S 
Sbjct  95    VSITTSFVAEEDTMEKMKEEANK---ANLVHAEKILVQ--------DSLEKG-LSSPTSN  142

Query  1297  TKGSS---ALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             T         SD +++  +   K+GK  I +ASTA+++G ILG+ Q +FL   +K LLG 
Sbjct  143   TTNQPQQPPASDTKSNSENKGNKKGKRTIRTASTAMILGLILGLAQAIFLIFSSKLLLGF  202

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGVK  S ML+PA +YL++R+LG+PA+LLSLA+QG+FRG KDTKTPL+AT   +L+NI+L
Sbjct  203   MGVKSDSPMLSPAHKYLSIRALGAPALLLSLAMQGVFRGFKDTKTPLFATVVANLINIVL  262

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI     G SGAAIAHVISQY + LIL   L +EV L+PP+   LQ  +FLKNG+ L
Sbjct  263   DPIFIFVLRLGTSGAAIAHVISQYFMTLILFIFLAKEVNLMPPNFGDLQFGRFLKNGVLL  322

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
              AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLTSSLL DGLA+AGQAILA +FA 
Sbjct  323   LARTIAVTFCQTLAAAMAARLGATPMAAFQICLQVWLTSSLLNDGLAVAGQAILACSFAE  382

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY K  A A+RVLQMGFV+G GL+V VGLGLYFG+G+FSKD  VI L+ IGIPF+A TQ
Sbjct  383   KDYTKVSAIASRVLQMGFVLGFGLSVFVGLGLYFGAGIFSKDPAVIHLMAIGIPFIAATQ  442

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PINSLAFVLDGVNFGASDF Y+AYSMV VAA++I        ++GF+GIWIAL ++M LR
Sbjct  443   PINSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAIIYMAMTHGFIGIWIALTVYMALR  502

Query  226   TIAGLWRLATGTGPWCFLR  170
              I G+ R+ATGTGPW +LR
Sbjct  503   AITGIARIATGTGPWRYLR  521



>gb|AGU16976.1| aluminum activated citrate transporter [Brassica oleracea]
 emb|CDY01220.1| BnaC05g25120D [Brassica napus]
Length=517

 Score =   425 bits (1092),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 256/436 (59%), Positives = 321/436 (74%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETME--NGSLTIPSSE  1298
             V+ITTSFVAEE++  C   S+E + + Y E     E G ++ + ET E   G+++ P  E
Sbjct  95    VSITTSFVAEEDA--CS--SEENTNQDYKE---CIETGINNTKEETQELIPGNISTPD-E  146

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
             +K S ++     S  DS VK  K  IPSAS+AL++G ILG+LQ VFL   AKPLL  MGV
Sbjct  147   SKNSCSI----FSVSDSPVK--KRNIPSASSALIIGAILGLLQAVFLISSAKPLLSFMGV  200

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD+ NIILD I
Sbjct  201   KHDSPMLGPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDVTNIILDPI  260

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             FI     GV+GAA AHVISQY++  ILL+KL+ +V++   S+KHLQ  +F+KNG  L  R
Sbjct  261   FIFVFRLGVTGAATAHVISQYLMCGILLWKLMGQVDIFKMSTKHLQFCRFMKNGFLLLMR  320

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTL+ASLAAR G T MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA KDY
Sbjct  321   VVAVTFCVTLSASLAAREGPTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFAKKDY  380

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             K+A A A+RVLQ+G V+G  LAV++G GL+FG+ +F+KD  V+ LI+IG+PFVAGTQPIN
Sbjct  381   KRAAATASRVLQLGLVLGFLLAVILGTGLHFGARLFTKDDKVLHLISIGLPFVAGTQPIN  440

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DGVNFGASDF Y+A S+VMVA +++    L   ++GF+G+W  L I+M LR   
Sbjct  441   ALAFVFDGVNFGASDFGYAAASLVMVAIVSVLCLVLLSATHGFIGLWFGLTIYMSLRAAV  500

Query  217   GLWRLATGTGPWCFLR  170
             G WR+ T TGPW FLR
Sbjct  501   GFWRIGTATGPWSFLR  516



>ref|XP_006597260.1| PREDICTED: MATE efflux family protein 1-like isoform X2 [Glycine 
max]
Length=554

 Score =   426 bits (1094),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 250/438 (57%), Positives = 319/438 (73%), Gaps = 16/438 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEE-PGKDSDQLETMENGSLTIPSSET  1295
             V++TTSFVAEE++   ++   E       E +  E  P KD++  E +       P   T
Sbjct  131   VSVTTSFVAEEDTLSGENPHIE-------EGRCLETGPPKDAETKELL-------PHKVT  176

Query  1294  KGSSALSDLEASERD-SKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
              G++  SD      + +K +  +  IPSAS+A+ +G ILG++Q +FL   AKPLL  MGV
Sbjct  177   GGNNHNSDFVGECFNIAKEEHKRRHIPSASSAIFIGGILGLIQAIFLISAAKPLLNFMGV  236

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
                S ML+PA +YL LR+LG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NI LD +
Sbjct  237   TSDSPMLHPAKQYLKLRTLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIALDPL  296

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             F+     GVSGAAIAHVISQY++  ILL++L+ +V+L+PPS KHLQL +FLKNG  L  R
Sbjct  297   FMFVFRLGVSGAAIAHVISQYLISAILLWRLMEQVDLVPPSIKHLQLDRFLKNGFLLLMR  356

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             VIA TFCVTLAASLAAR G T MAAFQVCLQ+WL  SLLADGLA+AGQAILA AFA KD+
Sbjct  357   VIAVTFCVTLAASLAARQGPTSMAAFQVCLQVWLAVSLLADGLAVAGQAILAGAFANKDF  416

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
              +A A A+RVLQMG V+G  LA ++G+GL+FG+ +F++D NV+ LI IGIPFVA TQP+N
Sbjct  417   DRATATASRVLQMGLVLGLALAFILGIGLHFGAKIFTQDANVLHLIQIGIPFVAVTQPLN  476

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             S+AFV DGVNFGASDF YSA+SMV+VA ++I    +   + GF+GIW+AL I+M LR  A
Sbjct  477   SIAFVFDGVNFGASDFAYSAFSMVVVAILSIICLLILSSAGGFIGIWVALTIYMGLRAFA  536

Query  217   GLWRLATGTGPWCFLRAS  164
             G  R+ TG+GPW FLR+S
Sbjct  537   GFLRIGTGSGPWEFLRSS  554



>ref|XP_010461964.1| PREDICTED: MATE efflux family protein 1-like isoform X3 [Camelina 
sativa]
Length=494

 Score =   423 bits (1088),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 251/440 (57%), Positives = 317/440 (72%), Gaps = 19/440 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++      + +        ++  EE G ++ + E  E     IP +   
Sbjct  69    VSITTSFVAEEDAYSSQQNTDQ------DHKECTEEAGMNNTKEEVQE----LIPENN--  116

Query  1291  GSSALSDLEASERDS-KVKRGKLR---IPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
                ++SD   + R+   V +  +R   IPSAS+AL++G ILG+LQ VFL    KPLL  M
Sbjct  117   -KDSISDESKTSRNIFNVSQSPIRRRIIPSASSALIIGSILGLLQAVFLISAEKPLLSFM  175

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVK  + ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD  NIILD
Sbjct  176   GVKHDTLMLRPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDATNIILD  235

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     GV+GAAIAHVISQY++  ILL+KL+ +V++   S+KHLQL +F++NGL L 
Sbjct  236   PIFIFVFRLGVTGAAIAHVISQYLIYGILLWKLMGQVDIFIMSTKHLQLCRFMQNGLLLL  295

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
              RVIA TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA K
Sbjct  296   MRVIAVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFANK  355

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             DYK+A A A+RVLQ+G V+G  LA ++G  L+FG+ VF+KD  V+ LI+IG+PFVAGTQP
Sbjct  356   DYKRAAATASRVLQLGLVLGFLLAAILGAALHFGARVFTKDDKVLHLISIGLPFVAGTQP  415

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKS-NGFVGIWIALAIFMLLR  227
              N+LAFV DGVNFGASDF Y+A S+V+VA ++I    LFL S +GF+G+W  L I+M LR
Sbjct  416   TNALAFVFDGVNFGASDFGYAAASLVVVAIVSI-LCLLFLSSTHGFIGLWFGLTIYMSLR  474

Query  226   TIAGLWRLATGTGPWCFLRA  167
                G WR+ TGTGPW FLR+
Sbjct  475   AAVGFWRIGTGTGPWSFLRS  494



>ref|XP_006593314.1| PREDICTED: aluminum-activated citrate transporter isoform X1 
[Glycine max]
 gb|KHN30137.1| MATE efflux family protein 1 [Glycine soja]
Length=553

 Score =   426 bits (1094),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 252/437 (58%), Positives = 318/437 (73%), Gaps = 16/437 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++           A   +EE    E G+ +D  ET E     +P  +  
Sbjct  132   VSVTTSFVAEEDTL--------SGANPQTEEGRCLEAGQPTDT-ETKE----LLP--QKG  176

Query  1291  GSSALSDLEASERD-SKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
             G+   SD      + +K +R +  IPSAS+A+ +G ILG++Q +FL   AKPLL  MGV 
Sbjct  177   GNVHNSDFVGESFNIAKEERKRRHIPSASSAIFIGGILGLIQAIFLISAAKPLLNFMGVT  236

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
               S ML+PA +YL LRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NI LD +F
Sbjct  237   SDSPMLHPAKQYLKLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIALDPLF  296

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +     GVSGAAIAHVISQY++ +ILL++L+ +V+L+PPS  HLQL +FLKNG  L  RV
Sbjct  297   MFVFRLGVSGAAIAHVISQYLISVILLWRLLEQVDLIPPSINHLQLDRFLKNGFLLLMRV  356

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAASLAAR G T MAAFQVCLQ+WL  SLLADGLA+AGQAILA AFA KD+ 
Sbjct  357   IAVTFCVTLAASLAARQGPTSMAAFQVCLQVWLAVSLLADGLAVAGQAILAGAFANKDFN  416

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +A A A+RVLQMG V+G  LA ++G GL+FG+ +F++D NV+ LI IGIPF+A TQP+NS
Sbjct  417   RATATASRVLQMGLVLGLALAFILGTGLHFGAKIFTQDANVLHLIQIGIPFIAVTQPLNS  476

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DGVNFGASDF YSA+SMV+VA ++I    +   + GF+GIW+AL I+M LR  AG
Sbjct  477   LAFVFDGVNFGASDFAYSAFSMVVVAILSIISLLILSSAGGFIGIWVALTIYMGLRAFAG  536

Query  214   LWRLATGTGPWCFLRAS  164
               R+ TG+GPW FLR+S
Sbjct  537   FLRIGTGSGPWEFLRSS  553



>emb|CDX74014.1| BnaA03g30330D [Brassica napus]
Length=529

 Score =   424 bits (1090),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 260/440 (59%), Positives = 330/440 (75%), Gaps = 18/440 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSS-  1301
             V++TTSFVA+E++  ++ +D +K+   K+     +A +        +++E G +  P+S 
Sbjct  95    VSVTTSFVAQEDTMEKMKEDEAKK--NKLVHANTLAVQ--------DSLEKG-IASPTSN  143

Query  1300  ---ETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
                + + + AL D + S  +   K+ K  I SASTA+++G ILG++Q + L   +K LLG
Sbjct  144   NINQPQQTPAL-DAKPSSGNKANKKEKKNIKSASTAMIIGLILGLVQAIVLIFSSKVLLG  202

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
             +MGVKP S +L+PA +YLT+RSLG+PA+LLSL++QGIFRG KDTKTPLYAT   D++NII
Sbjct  203   VMGVKPNSAVLSPAHKYLTIRSLGAPALLLSLSMQGIFRGFKDTKTPLYATIVADVINII  262

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD IFI   H GVSGAAIAHVISQY + LIL  +L  +V L+PP+   LQ  KFLKNG  
Sbjct  263   LDPIFIFVLHLGVSGAAIAHVISQYFMTLILFIRLASKVNLMPPNFGALQFGKFLKNGGL  322

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLT+SLLADGLA+AGQAILA +FA
Sbjct  323   LLARTIAVTFCQTLAAAMAARLGTTPMAAFQICLQVWLTTSLLADGLAVAGQAILACSFA  382

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
              KDY K  +AA+RVLQMGFV+G GL+V VGLGLYFG+G+F+KD  VI LI IGIPFVA T
Sbjct  383   EKDYNKVSSAASRVLQMGFVLGLGLSVFVGLGLYFGAGIFTKDPAVIHLIAIGIPFVAAT  442

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QPINSLAFVLDGVNFGASDF Y+AYSMV VAA++I       K NGF+GIWIAL I+M L
Sbjct  443   QPINSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAIIHMAKFNGFLGIWIALTIYMGL  502

Query  229   RTIAGLWRLATGTGPWCFLR  170
             R I G+ R+ATGTGPW +LR
Sbjct  503   RAITGIARIATGTGPWRYLR  522



>ref|XP_010461961.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010461963.1| PREDICTED: MATE efflux family protein 1-like isoform X2 [Camelina 
sativa]
Length=515

 Score =   423 bits (1088),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 251/440 (57%), Positives = 317/440 (72%), Gaps = 19/440 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++      + +        ++  EE G ++ + E  E     IP +   
Sbjct  90    VSITTSFVAEEDAYSSQQNTDQ------DHKECTEEAGMNNTKEEVQE----LIPENN--  137

Query  1291  GSSALSDLEASERD-SKVKRGKLR---IPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
                ++SD   + R+   V +  +R   IPSAS+AL++G ILG+LQ VFL    KPLL  M
Sbjct  138   -KDSISDESKTSRNIFNVSQSPIRRRIIPSASSALIIGSILGLLQAVFLISAEKPLLSFM  196

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVK  + ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD  NIILD
Sbjct  197   GVKHDTLMLRPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDATNIILD  256

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     GV+GAAIAHVISQY++  ILL+KL+ +V++   S+KHLQL +F++NGL L 
Sbjct  257   PIFIFVFRLGVTGAAIAHVISQYLIYGILLWKLMGQVDIFIMSTKHLQLCRFMQNGLLLL  316

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
              RVIA TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA K
Sbjct  317   MRVIAVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFANK  376

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             DYK+A A A+RVLQ+G V+G  LA ++G  L+FG+ VF+KD  V+ LI+IG+PFVAGTQP
Sbjct  377   DYKRAAATASRVLQLGLVLGFLLAAILGAALHFGARVFTKDDKVLHLISIGLPFVAGTQP  436

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKS-NGFVGIWIALAIFMLLR  227
              N+LAFV DGVNFGASDF Y+A S+V+VA ++I    LFL S +GF+G+W  L I+M LR
Sbjct  437   TNALAFVFDGVNFGASDFGYAAASLVVVAIVSI-LCLLFLSSTHGFIGLWFGLTIYMSLR  495

Query  226   TIAGLWRLATGTGPWCFLRA  167
                G WR+ TGTGPW FLR+
Sbjct  496   AAVGFWRIGTGTGPWSFLRS  515



>gb|AEM55566.1| multidrug resistance pump [Glycine max]
Length=553

 Score =   424 bits (1091),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 252/437 (58%), Positives = 318/437 (73%), Gaps = 16/437 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++           A   +EE    E G+ +D  ET E     +P  +  
Sbjct  132   VSVTTSFVAEEDTL--------SGANPQTEEGRCLEAGQPTDT-ETKE----LLP--QKG  176

Query  1291  GSSALSDLEASERD-SKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
             G+   SD      + +K +R +  IPSAS+A+ +G ILG++Q +FL   AKPLL  MGV 
Sbjct  177   GNVHNSDFVGESFNIAKEERKRRHIPSASSAIFIGGILGLIQAIFLISAAKPLLNFMGVT  236

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
               S ML+PA +YL LRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NI LD +F
Sbjct  237   SDSPMLHPAKQYLKLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIALDPLF  296

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +     GVSGAAIAHVISQYI+ +ILL++L+ +V+L+PPS  HLQL +FLKNG  L  RV
Sbjct  297   MFVFRLGVSGAAIAHVISQYIISVILLWRLLEQVDLIPPSINHLQLGRFLKNGFLLLMRV  356

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAASLAAR G T MAAFQVCLQ+WL  SLLADGLA+AGQAILA AFA KD+ 
Sbjct  357   IAVTFCVTLAASLAARQGPTSMAAFQVCLQVWLAVSLLADGLAVAGQAILAGAFANKDFN  416

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +A A A+RVLQMG V+G  LA ++G GL+FG+ +F++D NV+ LI IG+PF+A TQP+NS
Sbjct  417   RATATASRVLQMGLVLGLALAFILGTGLHFGAKIFTQDANVLHLIQIGVPFIAVTQPLNS  476

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DGVNFGASDF YSA+SMV+VA ++I    +   + GF+GIW+AL I+M LR  AG
Sbjct  477   LAFVFDGVNFGASDFAYSAFSMVVVAILSIISLLILSSAGGFIGIWVALTIYMGLRAFAG  536

Query  214   LWRLATGTGPWCFLRAS  164
               R+ TG+GPW FLR+S
Sbjct  537   FLRIGTGSGPWEFLRSS  553



>ref|XP_009144907.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Brassica 
rapa]
 ref|XP_009144909.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Brassica 
rapa]
 ref|XP_009144910.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Brassica 
rapa]
 emb|CDY66973.1| BnaA05g35760D [Brassica napus]
Length=517

 Score =   423 bits (1088),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 255/436 (58%), Positives = 321/436 (74%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETME--NGSLTIPSSE  1298
             V+ITTSFVAEE++  C   S+E + + Y E     E G ++ + ET E   G+++ P  E
Sbjct  95    VSITTSFVAEEDA--CS--SEENTNQDYKE---CIETGINNTKEETQELIPGNISTPD-E  146

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
             +K S ++     S  +S VK  K  IPSAS+AL++G ILG+LQ VFL   AKPLL  MGV
Sbjct  147   SKNSCSI----FSVSESPVK--KRNIPSASSALIIGAILGLLQAVFLISSAKPLLSFMGV  200

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD+ NIILD I
Sbjct  201   KHDSPMLGPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDVTNIILDPI  260

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             FI     GV+GAA AHVISQY++  ILL+KL+ +V++   S+KHLQ  +F+KNG  L  R
Sbjct  261   FIFVFRLGVTGAATAHVISQYLMCGILLWKLMGQVDIFKMSTKHLQFCRFMKNGFLLLMR  320

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTL+ASLAAR G T MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA KDY
Sbjct  321   VVAVTFCVTLSASLAAREGPTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFAKKDY  380

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             K+A A A+RVLQ+G V+G  LAV++G GL+FG+ +F+KD  V+ LI+IG+PFVAGTQPIN
Sbjct  381   KRAAATASRVLQLGLVLGFLLAVILGTGLHFGARLFTKDDKVLHLISIGLPFVAGTQPIN  440

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DGVNFGASDF Y+A S+VMVA +++    L   ++GF+G+W  L I+M LR   
Sbjct  441   ALAFVFDGVNFGASDFGYAAASLVMVAIVSVLCLVLLSATHGFIGLWFGLTIYMSLRAAV  500

Query  217   GLWRLATGTGPWCFLR  170
             G WR+ T TGPW FLR
Sbjct  501   GFWRIGTATGPWSFLR  516



>ref|XP_010534745.1| PREDICTED: MATE efflux family protein 1-like [Tarenaya hassleriana]
 ref|XP_010534746.1| PREDICTED: MATE efflux family protein 1-like [Tarenaya hassleriana]
 ref|XP_010534747.1| PREDICTED: MATE efflux family protein 1-like [Tarenaya hassleriana]
Length=517

 Score =   423 bits (1087),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 258/442 (58%), Positives = 322/442 (73%), Gaps = 25/442 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLET-----MENGSLTIP  1307
             V+ITTSFVAEE++     G+                 GKDS+ LET      EN  L IP
Sbjct  93    VSITTSFVAEEDANSSSRGT-----------------GKDSECLETGLKANEENQEL-IP  134

Query  1306  SSE--TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
              ++  T  S ++    +S   +K+   K  IPSAS+AL++G ILG+LQ V L   AKPLL
Sbjct  135   HNDSMTGESRSVHTPSSSFSVTKIPDKKRNIPSASSALIIGSILGLLQAVLLISAAKPLL  194

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
               MGVK  S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GDL N+
Sbjct  195   SFMGVKHDSPMLKPAQQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVIGDLANV  254

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             ILD IFI     GV GAA+AHVISQY++  ILL++L+ +V+LL PS+KHL   +F+KNG 
Sbjct  255   ILDPIFIFVFRLGVRGAAMAHVISQYVIAAILLWRLMGQVDLLNPSTKHLHFGRFIKNGF  314

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L  RVIA TFC+TL+ASLAAR G + MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AF
Sbjct  315   LLLMRVIAVTFCITLSASLAAREGPSPMAAFQVCLQVWLATSLLADGLAVAGQAILASAF  374

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
             A KD+K+A A A+RVLQ+G V+G  LAV +G GL FG+ +F+KD +V+RLI++G+PFVAG
Sbjct  375   AKKDHKRAAATASRVLQLGLVLGLLLAVFLGAGLRFGATLFTKDDDVLRLISVGLPFVAG  434

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFML  233
             TQPIN+LAFV DGVNFGASDF YSA S+VMVA ++I   FL   ++GFVG+W  L I+M 
Sbjct  435   TQPINALAFVFDGVNFGASDFGYSAASLVMVAIVSIVCLFLLSSAHGFVGLWFGLTIYMS  494

Query  232   LRTIAGLWRLATGTGPWCFLRA  167
             LR+  G WR+ TGTGPW FLR+
Sbjct  495   LRSAVGFWRIGTGTGPWSFLRS  516



>ref|XP_008461796.1| PREDICTED: MATE efflux family protein FRD3-like [Cucumis melo]
Length=585

 Score =   425 bits (1093),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 257/493 (52%), Positives = 321/493 (65%), Gaps = 54/493 (11%)
 Frame = -2

Query  1471  VNITTSFVAEENS---------------ELCDDGSKEVSAKVYSEEKV---------AEE  1364
             V+ITTSFVAEE++                L ++G K     +  E  +         + E
Sbjct  93    VSITTSFVAEEDAIGKTAIKPVKCDLEKHLTENGQKRELTSIKKENMLENNRSASVTSNE  152

Query  1363  PGKDSDQ---LETMENGSLTIPSSETKGSSALSD-----------LEASERDSKVKRGK-  1229
             P   + Q   ++ +E  +      E +   +  D           LE  E+D    +G+ 
Sbjct  153   PRNSTPQNGTIQDLEKNASEAKCKELEKKFSNQDGTKESILENATLENVEKDLSTYKGQP  212

Query  1228  ---------------LRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLN  1094
                              I SASTAL+ G +LG+LQ VFL   AK LL +MGVK  S ML 
Sbjct  213   PAVSTPTVKPKKKEKKHIASASTALIFGTVLGLLQAVFLAFGAKYLLNVMGVKQSSPMLA  272

Query  1093  PALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWG  914
             PA++YL LRSLG+PAVLLSLA+QGIFRG KDT+TPLY    G   NIILD I I  CH G
Sbjct  273   PAMKYLVLRSLGAPAVLLSLAMQGIFRGFKDTRTPLYVIVLGYTTNIILDPILIFVCHLG  332

Query  913   VSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCV  734
             V GAAIAHV+SQY+++L+L ++L+++V+LLPPS + LQ  +FLKNG  L ARVIA TFCV
Sbjct  333   VRGAAIAHVLSQYLIVLVLAWRLMQKVDLLPPSLRDLQFGRFLKNGSLLLARVIAVTFCV  392

Query  733   TLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykkakaaaA  554
             TLAAS+AARLG T MAAFQ CLQ+W+TSSLLADGLA+AGQAILA AFA KDY+K  A A 
Sbjct  393   TLAASMAARLGPTPMAAFQTCLQVWMTSSLLADGLAVAGQAILACAFAEKDYEKTTATAT  452

Query  553   RVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDG  374
             RVLQM  VMG GLAV+V   ++FG+G+FS+D NV  LI +G+PFVA TQP+NSLAFV DG
Sbjct  453   RVLQMSLVMGVGLAVIVAAIMFFGAGIFSRDLNVQALIHLGVPFVAATQPMNSLAFVFDG  512

Query  373   VNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATG  194
             VNFGASDF YSAYS+ +V+  TI   FL  KS GF+GIW ALAI+M LRT+ G +R+ +G
Sbjct  513   VNFGASDFAYSAYSLTLVSIATIVSLFLLSKSYGFIGIWTALAIYMALRTLVGFFRMGSG  572

Query  193   TGPWCFLRASTQP  155
             TGPW +LR    P
Sbjct  573   TGPWRYLRGPLLP  585



>ref|XP_011025531.1| PREDICTED: MATE efflux family protein 1 [Populus euphratica]
Length=516

 Score =   423 bits (1087),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 258/439 (59%), Positives = 324/439 (74%), Gaps = 22/439 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLET-----MENGSLTIP  1307
             V++TTSFVAEE++            +V  EE+       DS+ LET      EN  L   
Sbjct  93    VSVTTSFVAEEDA----------IGRVSPEEE-------DSESLETGSTMNSENKELIPQ  135

Query  1306  SSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             +   +G        +S    K++  +  IPSAS+AL++G ILG++Q +FL   AK LL  
Sbjct  136   NYSAEGPYKAKSPVSSFGIDKIENERRCIPSASSALVIGAILGLIQAIFLVSGAKQLLNF  195

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGV   S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NI+L
Sbjct  196   MGVGSDSPMLGPAQQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIML  255

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IF+     GV GAAIAHV+SQY++ +ILL++L+++V+LLPPS KHL+L +FL+NGL L
Sbjct  256   DPIFMFVFGLGVRGAAIAHVLSQYLISVILLWRLMKQVDLLPPSIKHLRLGQFLRNGLLL  315

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
               RV+A TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA 
Sbjct  316   LMRVVAVTFCVTLSASLAARQGSTSMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAR  375

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY+KA A A RVLQ+G ++G  LA V+GLGL FG+ +F+ D +V+ +I+IGIPFVAGTQ
Sbjct  376   KDYEKATATATRVLQLGLLLGLMLAAVLGLGLRFGARLFTSDADVLHMISIGIPFVAGTQ  435

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PIN+LAFV DGVNFGASDF YSAYSMVMVA ++I   FL   S+ F+GIW+AL I+M LR
Sbjct  436   PINALAFVFDGVNFGASDFAYSAYSMVMVAIVSILCLFLLSSSHKFIGIWVALTIYMSLR  495

Query  226   TIAGLWRLATGTGPWCFLR  170
              +AG WR+ TGTGPW FLR
Sbjct  496   ALAGFWRIGTGTGPWNFLR  514



>ref|XP_009135020.1| PREDICTED: MATE efflux family protein FRD3-like [Brassica rapa]
Length=531

 Score =   423 bits (1088),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 261/441 (59%), Positives = 320/441 (73%), Gaps = 18/441 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS-------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLT  1313
             V++TTSFVAEEN+       E     +  V A   + +   E+ G  S     M     T
Sbjct  95    VSVTTSFVAEENTMEKIKEEEEEAKKNNRVHANTLAVQDSLEK-GIASPTSNNMNQPQQT  153

Query  1312  IPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
              P+S+TK SS     +  +++ K         SASTA+++G ILG++Q +FL   +K LL
Sbjct  154   -PASDTKSSSGNKANKKGKKNIK---------SASTAMIIGLILGLVQAIFLIFSSKVLL  203

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
             G+MGVKP S +L+PA +YLT+RSLG+PA+LLSL++QGIFRG KDTKTPLYAT   D++NI
Sbjct  204   GVMGVKPNSAVLSPAHKYLTIRSLGAPALLLSLSMQGIFRGFKDTKTPLYATIVADVINI  263

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             ILD IFI   H G+SGAAIAHVISQY + LIL  +L  +V L+PP+   LQ  KFLKNG 
Sbjct  264   ILDPIFIFVLHLGISGAAIAHVISQYFMTLILFTRLASKVNLMPPNFAALQFGKFLKNGG  323

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLT+SLLADGLA+AGQAILA +F
Sbjct  324   LLLARTIAVTFCQTLAAAMAARLGATPMAAFQICLQVWLTTSLLADGLAVAGQAILACSF  383

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
               KDY K  + A+RVLQMGFV+G GL+V VGLGLYFG+G+F+KD  VI LI IGIPFVA 
Sbjct  384   TEKDYNKVSSCASRVLQMGFVLGLGLSVFVGLGLYFGAGIFTKDPAVIHLIAIGIPFVAA  443

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFML  233
             TQPINSLAFVLDGVNFGASDF Y+AYSMV VAA++I       K NGF+GIWIAL I+M 
Sbjct  444   TQPINSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAIIYMAKFNGFLGIWIALTIYMG  503

Query  232   LRTIAGLWRLATGTGPWCFLR  170
             LR I G+ R+ATGTGPW FLR
Sbjct  504   LRAITGIARIATGTGPWKFLR  524



>ref|XP_008227303.1| PREDICTED: MATE efflux family protein 1 [Prunus mume]
 ref|XP_008227305.1| PREDICTED: MATE efflux family protein 1 [Prunus mume]
 ref|XP_008227306.1| PREDICTED: MATE efflux family protein 1 [Prunus mume]
Length=513

 Score =   422 bits (1085),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 258/435 (59%), Positives = 318/435 (73%), Gaps = 14/435 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++      S E +   Y E         ++ QL         IP   T 
Sbjct  93    VSVTTSFVAEEDT--IGTASPEENQNDYLE--TGSSINGETRQL---------IPERGTD  139

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
               +A   + AS         K  IPSAS+A+++G ILG++Q +FL   AKPLL  MGV  
Sbjct  140   -QNAYKPVGASFEIVTTNHQKRYIPSASSAMVIGSILGLIQAIFLISAAKPLLNFMGVSS  198

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA +YL LRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NIILD IF+
Sbjct  199   DSPMLKPAQQYLILRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIILDPIFM  258

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GV+GAAI+HVISQY++ +ILL++L+ +V+LLPPS KHLQ  +FLKNG  L  RVI
Sbjct  259   FVFRLGVNGAAISHVISQYLICVILLWRLMAQVDLLPPSIKHLQFGRFLKNGFLLLMRVI  318

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTLAASLAAR G T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA KDY K
Sbjct  319   AVTFCVTLAASLAARQGPTPMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAKKDYDK  378

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+RVLQ+G V+G  LAV++G+GL +G+ +F+KD +V+ LI+IGIPFVA TQPIN+L
Sbjct  379   ATATASRVLQLGLVLGLMLAVILGVGLQYGARLFTKDVDVLHLISIGIPFVAATQPINAL  438

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVNFGASDF YSA+SMVMVA ++I   F+   +NGF+GIW+AL I+M LR  AG 
Sbjct  439   AFVFDGVNFGASDFAYSAFSMVMVAIVSIFVLFILSSTNGFIGIWVALTIYMSLRAFAGF  498

Query  211   WRLATGTGPWCFLRA  167
             WR+ TGTGPW FLRA
Sbjct  499   WRIGTGTGPWEFLRA  513



>ref|XP_009135017.1| PREDICTED: MATE efflux family protein FRD3 [Brassica rapa]
 ref|XP_009135018.1| PREDICTED: MATE efflux family protein FRD3 [Brassica rapa]
Length=529

 Score =   423 bits (1087),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 259/440 (59%), Positives = 330/440 (75%), Gaps = 18/440 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSS-  1301
             V++TTSFVA+E++  ++ +D +K+   K+     +A +        +++E G +  P+S 
Sbjct  95    VSVTTSFVAQEDTMEKMKEDEAKK--NKLVHANTLAVQ--------DSLEKG-IASPTSN  143

Query  1300  ---ETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
                + + + AL D + S  +   K+ K  I SASTA+++G ILG++Q + L   +K LLG
Sbjct  144   NINQPQQTPAL-DAKPSSGNKANKKEKKNIKSASTAMIIGLILGLVQAIVLIFSSKVLLG  202

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
             +MGVKP S +L+PA +YLT+RSLG+PA+LLSL++QGIFRG KDTKTPLYAT   D++NII
Sbjct  203   VMGVKPNSAVLSPAHKYLTIRSLGAPALLLSLSMQGIFRGFKDTKTPLYATIVADVINII  262

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD IFI   H GVSGAAIAHV+SQY + LIL  +L  +V L+PP+   LQ  KFLKNG  
Sbjct  263   LDPIFIFVLHLGVSGAAIAHVMSQYFMTLILFIRLASKVNLMPPNFGALQFGKFLKNGGL  322

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLT+SLLADGLA+AGQAILA +FA
Sbjct  323   LLARTIAVTFCQTLAAAMAARLGTTPMAAFQICLQVWLTTSLLADGLAVAGQAILACSFA  382

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
              KDY K  +AA+RVLQMGFV+G GL+V VGLGLYFG+G+F+KD  VI LI IGIPFVA T
Sbjct  383   EKDYNKVSSAASRVLQMGFVLGLGLSVFVGLGLYFGAGIFTKDPAVIHLIAIGIPFVAAT  442

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QPINSLAFVLDGVNFGASDF Y+AYSMV VAA++I       K NGF+GIWIAL I+M L
Sbjct  443   QPINSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAIIHMAKFNGFLGIWIALTIYMGL  502

Query  229   RTIAGLWRLATGTGPWCFLR  170
             R I G+ R+ATGTGPW +LR
Sbjct  503   RAITGIARIATGTGPWRYLR  522



>ref|XP_007133823.1| hypothetical protein PHAVU_011G211900g [Phaseolus vulgaris]
 gb|ESW05817.1| hypothetical protein PHAVU_011G211900g [Phaseolus vulgaris]
Length=540

 Score =   423 bits (1087),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 253/449 (56%), Positives = 321/449 (71%), Gaps = 15/449 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKD--------SDQLETMENGSL  1316
             V+ITTSFVAEE++    +   +    V  E+ + ++  K+        S  L+ +EN + 
Sbjct  93    VSITTSFVAEEDTLEKLNNKSKFKEVVVPEDHMLQDLQKEKPMVEKCESKDLQALENYNA  152

Query  1315  TI---PSSETKGSSALSDLEAS-ERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVL  1148
             T    P    KG+  +     S E+D K KR   RI SASTAL+ G ILG++Q   L   
Sbjct  153   TRDNDPEIGDKGNKKICKCSKSMEKDEKKKR---RIASASTALLFGTILGLIQASVLIFA  209

Query  1147  AKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAG  968
             AKPLL +MGVKP S MLN A +YL LRS+G+PAVLLSLA+QGIFRG KDTKTPLY   +G
Sbjct  210   AKPLLRVMGVKPDSPMLNQAEKYLKLRSIGAPAVLLSLAMQGIFRGFKDTKTPLYVIVSG  269

Query  967   DLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKF  788
               +N+ILD I I     G+ GAAI+HV+SQY++ + LL  L+++V LLPPS K LQ+ +F
Sbjct  270   YTLNVILDPILIFTLKLGLKGAAISHVLSQYMMAITLLLILMKKVHLLPPSIKDLQIFRF  329

Query  787   LKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAI  608
             LKNG  L  RVIA TFCVTLAASLAARLGS  MAAFQ CLQ+WLTSSLLADGLA+A QAI
Sbjct  330   LKNGGLLMIRVIAVTFCVTLAASLAARLGSVPMAAFQTCLQVWLTSSLLADGLAVAVQAI  389

Query  607   LATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGI  428
             LA +FA KD+KKA  AA + LQM FV+G GL++ VGLGLYFG+G+FSK+ +V+  I I I
Sbjct  390   LACSFAEKDHKKATTAATKTLQMSFVLGMGLSLAVGLGLYFGAGIFSKNVHVLHFIKISI  449

Query  427   PFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIAL  248
             PFVA TQPINSLAFV DGVN+GASDF YSAYS+V+V+ +++  EF+  ++  F+GIWIAL
Sbjct  450   PFVAATQPINSLAFVFDGVNYGASDFAYSAYSLVVVSLVSVAIEFVLYRAKHFIGIWIAL  509

Query  247   AIFMLLRTIAGLWRLATGTGPWCFLRAST  161
              I+M LR +AG+WR+ TGTGPW +LR  +
Sbjct  510   TIYMTLRMLAGVWRMGTGTGPWHYLRGCS  538



>gb|KEH19074.1| MATE efflux family protein [Medicago truncatula]
Length=531

 Score =   422 bits (1085),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 247/459 (54%), Positives = 315/459 (69%), Gaps = 25/459 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V+ITTSFVAEE++   +    SK +      + K++      +  L+ +ENG +   + +
Sbjct  78    VSITTSFVAEEDTIERMNIKASKNID-----DAKLSGIETPKNQLLQDIENGKIHKENID  132

Query  1297  TKGSSALSDLE--------ASERDSKVKRGKL----------RIPSASTALMMGCILGIL  1172
              +  +A +D          A + DS +  G             I SASTAL+ G +LG++
Sbjct  133   VEKYAANNDTNVEDDSKTNACKHDSSITNGNKSKDKDGKKKRHIASASTALLFGTMLGLI  192

Query  1171  QTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKT  992
             QT  L   AK LL  MG+K  S ML PA++YL LR+ GSPAVLLSLA+QGIFRG KD  T
Sbjct  193   QTTILIFGAKLLLAAMGIKHDSPMLKPAVKYLRLRAFGSPAVLLSLAMQGIFRGFKDVTT  252

Query  991   PLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSS  812
             PLY   +G  +N+ILD I I     G++GAAI+HV SQY++   LL  L+R+V +LPPS 
Sbjct  253   PLYVILSGYALNVILDPILIFYLKLGLNGAAISHVFSQYLMAFTLLVLLMRKVYILPPSL  312

Query  811   KHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADG  632
             K LQ+ +FLKNG  L ARV+A TFC+T AASLAARLGS  MAAFQ CLQIWLTSSLLADG
Sbjct  313   KDLQIFRFLKNGGLLLARVVAVTFCMTFAASLAARLGSVPMAAFQPCLQIWLTSSLLADG  372

Query  631   LAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNV  452
             LA+A QAILA +F  KDYKK  AAA R LQM FV+G GL+++VG+G YFG+G+FSKD +V
Sbjct  373   LAVAVQAILACSFTEKDYKKTTAAATRALQMSFVLGMGLSILVGIGFYFGAGIFSKDVHV  432

Query  451   IRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNG  272
             + LI IGIPFVA TQPINSLAFV DGVN+G+SDF YSAYS+VMV+ ++I  EF   +S  
Sbjct  433   VHLIKIGIPFVAATQPINSLAFVFDGVNYGSSDFAYSAYSLVMVSVVSIVTEFFLYRSKQ  492

Query  271   FVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRASTQP  155
             F+GIWIAL I+M+LR  AG+WR+ T TGPW +LR S+ P
Sbjct  493   FIGIWIALTIYMILRMFAGIWRMGTATGPWRYLRTSSLP  531



>gb|EYU46259.1| hypothetical protein MIMGU_mgv1a004792mg [Erythranthe guttata]
Length=510

 Score =   421 bits (1083),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 255/435 (59%), Positives = 319/435 (73%), Gaps = 21/435 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ + D G                 P     ++ET+ENG LT+  SE  
Sbjct  93    VSVTTSFVAEEDT-ITDAG-----------------PHDTIKEIETLENG-LTL-DSEKN  132

Query  1291  GSSALSDLEASERD-SKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
                 L++  +   D +K ++ K  IPSAS+AL++G +LGI+Q VFL + AKPLL  MGVK
Sbjct  133   MLIPLNEQTSKSFDIAKDEQRKKNIPSASSALIIGGVLGIIQAVFLILAAKPLLSFMGVK  192

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
               S ML PA  YL LRSLG+PAVLLSLA+QG+FRGLKDTKTPL+AT  GD+ NI+LD IF
Sbjct  193   SDSEMLYPAQEYLKLRSLGAPAVLLSLAMQGVFRGLKDTKTPLFATVFGDVANIVLDPIF  252

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             I      V GAAIAHVISQY++  IL ++L  +V+L+PP+ K+LQ  +FLKNG  L  RV
Sbjct  253   IFVFKMEVRGAAIAHVISQYLISGILFWRLKEQVDLIPPTLKYLQFGRFLKNGFLLLTRV  312

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAAS+AAR+GST MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA  DY 
Sbjct  313   IAVTFCVTLAASMAARMGSTEMAAFQVCLQVWLATSLLADGLAVAGQAILASAFARNDYD  372

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
              A   A+RVLQ+G  +G  LA+ +G GL+FG+ +F+KD  V+RLI +GIPFVA TQPIN+
Sbjct  373   WATLTASRVLQLGLALGLVLALFLGFGLHFGARIFTKDAEVLRLIGVGIPFVAATQPINA  432

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DGVNFGASDF YSA+SMV+VA ++I   F+   SNG+VGIWIAL I+M LR +AG
Sbjct  433   LAFVFDGVNFGASDFAYSAFSMVIVAIISIIALFILSSSNGYVGIWIALTIYMSLRALAG  492

Query  214   LWRLATGTGPWCFLR  170
              WR+ TGTGPW FLR
Sbjct  493   FWRIGTGTGPWKFLR  507



>ref|XP_010651236.1| PREDICTED: MATE efflux family protein 1 [Vitis vinifera]
 ref|XP_010651237.1| PREDICTED: MATE efflux family protein 1 [Vitis vinifera]
 ref|XP_010651238.1| PREDICTED: MATE efflux family protein 1 [Vitis vinifera]
 ref|XP_010651239.1| PREDICTED: MATE efflux family protein 1 [Vitis vinifera]
 ref|XP_010651240.1| PREDICTED: MATE efflux family protein 1 [Vitis vinifera]
 ref|XP_010651241.1| PREDICTED: MATE efflux family protein 1 [Vitis vinifera]
 ref|XP_010651242.1| PREDICTED: MATE efflux family protein 1 [Vitis vinifera]
 emb|CBI16375.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 258/435 (59%), Positives = 314/435 (72%), Gaps = 14/435 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++    D   EVS  V     V  E  K              IP    +
Sbjct  93    VSVTTSFVAEEDTIGILDSEPEVSKSVEMGSAVNGETKK-------------LIPKGSGE  139

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
                 L ++  S  D+     K  IPSAS AL++G ILG++Q +FL   AKP+L  MGV  
Sbjct  140   RPYDL-EMHGSGHDTPKFESKRHIPSASAALVVGGILGLIQAIFLISGAKPILNFMGVHS  198

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA  YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NIILD IF+
Sbjct  199   DSPMLAPAQEYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIILDPIFM  258

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                H GV GAAIAHVISQYI+ +IL +KL+++VELLPPS+K L+  +FLKNGL L  RVI
Sbjct  259   FVFHMGVGGAAIAHVISQYIISVILFWKLMQQVELLPPSTKVLRFGRFLKNGLLLLMRVI  318

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTLAASLAAR G T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA +DY K
Sbjct  319   AVTFCVTLAASLAARQGPTSMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAKQDYSK  378

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A AAA+RVLQ+G V+G  L+ ++G G+   + +F+KD +V+ LI+IGIPFVA TQPINSL
Sbjct  379   ATAAASRVLQLGLVLGLVLSSILGTGMQSAAKLFTKDLSVLHLISIGIPFVAVTQPINSL  438

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVNFGASDF YSAYSMV+VA ++I   F+   S GFVGIW+AL I++ LR  AG 
Sbjct  439   AFVFDGVNFGASDFAYSAYSMVLVAIVSILCLFILSSSFGFVGIWVALTIYVTLRAFAGF  498

Query  211   WRLATGTGPWCFLRA  167
             WR+ TG+GPW FLR+
Sbjct  499   WRIGTGSGPWSFLRS  513



>ref|XP_009596394.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=543

 Score =   422 bits (1085),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 263/460 (57%), Positives = 321/460 (70%), Gaps = 32/460 (7%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTS VAEE++  ++  +     S  + S+E  AE  G D++     EN  L IP S 
Sbjct  91    VSVTTSMVAEEDTITKVSPESRDTESQDLQSQE--AE--GLDTESQSNSENKEL-IPQSR  145

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
             +   S    +  +    K K  K  IPSAS+AL++G ILG +Q  FL   AKP+L  MGV
Sbjct  146   SMYKS--ETIATTFEVLKPKPEKRHIPSASSALIIGAILGFIQAAFLISGAKPILNFMGV  203

Query  1117  K-----------------------PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGL  1007
             K                        GS ML PA  YL LRSLG+PAVLLSLA+QG+FRG 
Sbjct  204   KSGSYSWPVFTASNQDLNLNDSIFKGSPMLKPAQEYLKLRSLGAPAVLLSLAMQGVFRGF  263

Query  1006  KDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVEL  827
             KDTKTPL+AT AGDL NIILD IFI   H GV GAAIAHVISQY++ +IL ++L+ +V+L
Sbjct  264   KDTKTPLFATVAGDLTNIILDPIFIFVFHMGVRGAAIAHVISQYLISVILFWRLMEQVDL  323

Query  826   LPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSS  647
             LPPS K+LQ ++FL NG  L  RVIA TFCVTLAASLAARLG T MAAFQVCLQ+WL +S
Sbjct  324   LPPSLKYLQFARFLTNGFLLLMRVIAVTFCVTLAASLAARLGPTEMAAFQVCLQVWLATS  383

Query  646   LLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFS  467
             LLADGLA+AGQAILA+AFA KD+ +A A A+RVLQ+G V+G  LA+++G+GL+FG+ +F+
Sbjct  384   LLADGLAVAGQAILASAFAQKDFSRATATASRVLQLGLVLGLVLALILGVGLHFGARLFT  443

Query  466   KDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLF  287
              D NVI LI IGIPFVA TQPIN+LAFV DGVNFGASDF YSAYSMV VA  +I F F+ 
Sbjct  444   NDINVIHLIGIGIPFVAATQPINALAFVFDGVNFGASDFAYSAYSMVTVALFSIIFLFIL  503

Query  286   LKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRA  167
               S  FVGIW+AL I+M LR  AG WR+ TGTGPW FLR+
Sbjct  504   SSSYKFVGIWVALTIYMSLRAFAGFWRIGTGTGPWKFLRS  543



>ref|XP_004293176.1| PREDICTED: MATE efflux family protein 1-like [Fragaria vesca 
subsp. vesca]
Length=492

 Score =   420 bits (1080),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 252/435 (58%), Positives = 316/435 (73%), Gaps = 14/435 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE      D    V  ++ S E +  E    SD     E   L +P ++T 
Sbjct  70    VSVTTSFVAEE------DAIGRV--RLESNENIHLE----SDSPTNGETKQL-LPETDTG  116

Query  1291  GSSALSDLEASERDSKVKRGKLR-IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
              ++  S L     D+     K R IPSAS+A+++G ILG +Q +FL   AKPLL  MGV 
Sbjct  117   KNAYNSKLVNVSFDTVTTGQKKRYIPSASSAMVIGGILGFIQAIFLISGAKPLLSFMGVG  176

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
               S ML PA +YL LRSLG+PAVLLSLA+QG+FRG KDTKTPL+AT AGD  NIILD IF
Sbjct  177   SDSPMLKPAQQYLMLRSLGAPAVLLSLAMQGVFRGFKDTKTPLHATVAGDATNIILDPIF  236

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             I    +GV+GAAIAHVISQY++ +IL  +L+ +V+L+PPS+KHLQ  +FLKNG  L  RV
Sbjct  237   IFVFRFGVNGAAIAHVISQYLMCIILFLRLMAQVDLIPPSAKHLQFGRFLKNGFLLLMRV  296

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAASL+AR G   MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA  D+ 
Sbjct  297   IAVTFCVTLAASLSARQGPIAMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAKNDHD  356

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             KA   AARVLQ+G  +G  LA ++G+GL +G+ +F+KD NV+ LI+IGIPFVA TQPIN+
Sbjct  357   KAAVTAARVLQLGLALGLILAFLLGVGLQYGARLFTKDVNVLHLISIGIPFVAATQPINA  416

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DGVNFGASDF Y+A SMV+VA ++I F F+   ++GF+GIW+AL I+M LR+ AG
Sbjct  417   LAFVFDGVNFGASDFAYAALSMVLVAIVSIIFLFILSYTSGFIGIWVALTIYMSLRSFAG  476

Query  214   LWRLATGTGPWCFLR  170
              WR+ TGTGPW FLR
Sbjct  477   FWRIGTGTGPWQFLR  491



>emb|CDY29628.1| BnaA05g15420D [Brassica napus]
Length=516

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 250/434 (58%), Positives = 310/434 (71%), Gaps = 14/434 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++  C      V      + K   E G ++ + ET E     IP     
Sbjct  96    VSITTSFVAEEDA--CSSQENTVQ-----DHKECIETGINNTKEETQE----LIPEINKD  144

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              S   S + +  + S  KR    IPSAS+AL++G ILG+LQ VFL   AKPLL  MGVK 
Sbjct  145   ESKISSSIFSVNKSSVKKR---NIPSASSALIIGAILGLLQAVFLISSAKPLLSFMGVKH  201

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD+ NIILD IFI
Sbjct  202   DSPMLGPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDVTNIILDPIFI  261

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GV+GAA AHVISQY++  ILL+KL+ +V++   S+KHLQ  +F+KNG  L  RV+
Sbjct  262   FVFRLGVTGAATAHVISQYLMCGILLWKLMGQVDIFKMSTKHLQFCRFMKNGFLLLMRVV  321

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTL+ASLAAR G T MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA KDYK+
Sbjct  322   AVTFCVTLSASLAAREGPTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFAKKDYKR  381

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+RVLQ+G V+G  LAV++G GL+FG+ +F+KD  V+ LI+IG+PFVAGTQPIN+L
Sbjct  382   AAATASRVLQLGLVLGFLLAVILGTGLHFGARLFTKDDKVLHLISIGLPFVAGTQPINAL  441

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVNFGASDF Y+A S+VMVA +++    L   ++GF+G+W  L I+M LR   G 
Sbjct  442   AFVFDGVNFGASDFGYAAASLVMVAIVSVLCLVLLSATHGFIGLWFGLTIYMSLRAAVGF  501

Query  211   WRLATGTGPWCFLR  170
             WR+ T TGPW FLR
Sbjct  502   WRIGTATGPWSFLR  515



>ref|XP_007213927.1| hypothetical protein PRUPE_ppa004360mg [Prunus persica]
 gb|EMJ15126.1| hypothetical protein PRUPE_ppa004360mg [Prunus persica]
Length=515

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 257/436 (59%), Positives = 319/436 (73%), Gaps = 14/436 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++      S E +   Y E         ++ QL         IP   T 
Sbjct  93    VSVTTSFVAEEDT--IGTASPEENQNDYLE--TGSSINGETRQL---------IPERGTD  139

Query  1291  GSSALSD-LEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
              ++  S  + AS         K  IPSAS+A+++G ILG++Q +FL   AKPLL  MGV 
Sbjct  140   QNAYNSKPVGASFEIVTTNHQKRYIPSASSAMVIGSILGLIQAIFLISAAKPLLNFMGVS  199

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
               S ML PA +YL LRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NIILD IF
Sbjct  200   SDSPMLKPAQQYLILRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIILDPIF  259

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +     GV+GAAI+HVISQY++ +ILL++L+ +V+LLPPS KHLQ  +FLKNG  L  RV
Sbjct  260   MFVFRLGVNGAAISHVISQYLICVILLWRLMAQVDLLPPSIKHLQFGRFLKNGFLLLMRV  319

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAASLAAR G T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA KD+ 
Sbjct  320   IAVTFCVTLAASLAARQGPTPMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAKKDHD  379

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             KA A A+RVLQ+G V+G  LAV++G+GL +G+ +F+KD +V+ LI+IGIPFVA TQPIN+
Sbjct  380   KATATASRVLQLGLVLGLMLAVILGVGLQYGARLFTKDVDVLHLISIGIPFVAATQPINA  439

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DGVNFGASDF YSA+SMVMVA ++I   F+   +NGF+GIW+AL I+M LR  AG
Sbjct  440   LAFVFDGVNFGASDFAYSAFSMVMVAIVSIFVLFILSSTNGFIGIWVALTIYMSLRAFAG  499

Query  214   LWRLATGTGPWCFLRA  167
              WR+ TGTGPW FLRA
Sbjct  500   FWRIGTGTGPWEFLRA  515



>ref|XP_002891631.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67890.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 254/436 (58%), Positives = 313/436 (72%), Gaps = 12/436 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++  C      V       E     P +++ +L   +N      S E K
Sbjct  90    VSITTSFVAEEDA--CSSQQDTVQDHKECIEAGINNPTEETQELIPEKNKDSL--SDEFK  145

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
               S++  +      SK    K  IPSAS+AL++G  LG+ Q VFL   AKPLL  MGVK 
Sbjct  146   TGSSIFSI------SKPPAKKRNIPSASSALIIGGFLGLFQAVFLISAAKPLLSFMGVKH  199

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPL+AT  GD+ NIILD IFI
Sbjct  200   DSPMLRPAQRYLSLRSLGAPAVLLSLAAQGVFRGFKDTTTPLFATVIGDVTNIILDPIFI  259

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GV+GAA AHVISQY++  ILL+KL+ +V++   S+KHLQL +F+KNG  L  RVI
Sbjct  260   FVFRLGVTGAATAHVISQYLMCGILLWKLMGQVDIFNMSTKHLQLCRFMKNGFLLLMRVI  319

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA KDYK+
Sbjct  320   AVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFAKKDYKR  379

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+RVLQ+G V+G  LAV++G GL+FG+ VF+KD  V+ LI+IG+PFVAGTQPIN+L
Sbjct  380   AAATASRVLQLGLVLGFVLAVILGAGLHFGARVFTKDDKVLHLISIGLPFVAGTQPINAL  439

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKS-NGFVGIWIALAIFMLLRTIAG  215
             AFV DGVNFGASDF Y+A S+VMVA ++I    LFL S +GF+G+W  L I+M LR   G
Sbjct  440   AFVFDGVNFGASDFGYAAASLVMVAIVSI-LCLLFLSSTHGFIGLWFGLTIYMSLRAAVG  498

Query  214   LWRLATGTGPWCFLRA  167
              WR+ TGTGPW FLR+
Sbjct  499   FWRIGTGTGPWSFLRS  514



>emb|CDY07957.1| BnaC03g35660D [Brassica napus]
Length=529

 Score =   421 bits (1083),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 258/436 (59%), Positives = 325/436 (75%), Gaps = 10/436 (2%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTSFVA+E++  ++ +D +K+   K+     +A +     D LE       +   ++
Sbjct  95    VSVTTSFVAQEDTMEKMKEDEAKK--NKLVHANTLAVQ-----DSLEKGIASPTSNNINQ  147

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
              + + AL D + S  +   K+ K  I SASTA+++G ILG++Q + L   +K LLG+MGV
Sbjct  148   PQQTPAL-DAKPSCGNKANKKEKKNIKSASTAMIIGLILGLVQAIVLIFSSKVLLGVMGV  206

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             KP S +L+PA +YLT+RSLG+PA+LLSL++QGIFRG KDTKTPLYAT   D++NIILD I
Sbjct  207   KPNSAVLSPAHKYLTIRSLGAPALLLSLSMQGIFRGFKDTKTPLYATIVADVINIILDPI  266

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             FI   H GVSGAAIAHVISQY + LIL  +L  +V L+PP+   LQ  KFLKNG  L AR
Sbjct  267   FIFVLHLGVSGAAIAHVISQYFMTLILFIRLASKVNLMPPNFGALQFGKFLKNGGLLLAR  326

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
              IA TFC TLAA++AARLG+  MAAFQ+CLQ+WLT+SLLADGLA+AGQAILA +FA KDY
Sbjct  327   TIAVTFCQTLAAAMAARLGTIPMAAFQICLQVWLTTSLLADGLAVAGQAILACSFAEKDY  386

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
              K  +AA+RVLQMGFV+G GL+V VGLGLYFG+G+F+KD  VI LI IGIPFVA TQPIN
Sbjct  387   NKVSSAASRVLQMGFVLGLGLSVFVGLGLYFGAGIFTKDPAVIHLIAIGIPFVAATQPIN  446

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             SLAFVLDGVNFGASDF Y+AYSMV VAA++I       K NGF+GIWIAL I+M LR I 
Sbjct  447   SLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAIIYMAKFNGFLGIWIALTIYMGLRAIT  506

Query  217   GLWRLATGTGPWCFLR  170
             G+ R+ATGTGPW +LR
Sbjct  507   GIARIATGTGPWRYLR  522



>ref|XP_008801950.1| PREDICTED: MATE efflux family protein 1-like [Phoenix dactylifera]
Length=610

 Score =   424 bits (1089),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 246/440 (56%), Positives = 316/440 (72%), Gaps = 23/440 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENS------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTI  1310
             V++TTSFVAEE++      E  D    E +++V ++EK    P  DS++       +++ 
Sbjct  187   VSVTTSFVAEEDAIIGKGIEEQDSKDLEKASRVNTDEK-EFPPCHDSEK----RRCNVSY  241

Query  1309  PSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
              +SE         L  S+R+ K       +PS S+AL++G +LG+LQT+FLT+ A+ +L 
Sbjct  242   IASECM------KLSGSQRNRKY------VPSVSSALIVGGVLGLLQTMFLTLAARQVLS  289

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
             +MGVK GS ML PALRYLTLRSLGSPAVLLSLA+QG+FRG KDTKTPLYAT  GD+ NII
Sbjct  290   IMGVKSGSPMLTPALRYLTLRSLGSPAVLLSLAMQGVFRGFKDTKTPLYATVVGDVTNII  349

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD I I   H GVSGAAIAHVISQY++ LIL  +L+++V ++PPS K L+ S+FL+ G  
Sbjct  350   LDPILIFVFHLGVSGAAIAHVISQYLITLILFVRLVQQVNVVPPSIKALKFSRFLRCGFL  409

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L  RVIA TFCVTL ASLAA  G  +MAAFQ+CLQIWL++SLLADGLA+AGQAILA+AFA
Sbjct  410   LLGRVIAVTFCVTLGASLAAHNGPIIMAAFQICLQIWLSTSLLADGLAVAGQAILASAFA  469

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
               D  KA  A ARV+Q+  V+G  L +++G+GL FGSG+F+KD NVI++I   IPFVAGT
Sbjct  470   RGDLHKAVTATARVIQLSIVLGMALTLLLGVGLQFGSGIFTKDINVIQIIHKCIPFVAGT  529

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             Q +NSLAFV DG+NFGASD+ YSAYSMV VAA++I        ++GF+GIW  L I+M L
Sbjct  530   QMLNSLAFVFDGINFGASDYTYSAYSMVGVAAVSIPCLIYLSSTHGFIGIWTGLTIYMSL  589

Query  229   RTIAGLWRLATGTGPWCFLR  170
             RT A  WR+A   GPW F+R
Sbjct  590   RTFASTWRMAAARGPWTFIR  609



>ref|XP_010461965.1| PREDICTED: MATE efflux family protein 1-like [Camelina sativa]
Length=516

 Score =   421 bits (1081),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 255/440 (58%), Positives = 315/440 (72%), Gaps = 19/440 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++  C      V      + K   E G +++   T E     IP +   
Sbjct  91    VSITTSFVAEEDA--CSSQQNTVQ-----DHKECIETGTNNN---TTEETQELIPENNKD  140

Query  1291  GSS----ALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
              SS    A+S + +  + S  KR    IPSAS+AL++G  LG+ Q VFL   AKPLL  M
Sbjct  141   SSSDESKAVSSIFSVSKPSAKKR---NIPSASSALIIGGFLGLFQAVFLISAAKPLLSFM  197

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVK  S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPL+AT  GD+ NIILD
Sbjct  198   GVKHDSPMLRPAQRYLSLRSLGAPAVLLSLAAQGVFRGFKDTTTPLFATVIGDVTNIILD  257

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     GV+GAA AHVISQY++  ILL+KL+ +V++   S+KHLQ  +F+KNG  L 
Sbjct  258   PIFIFVFRLGVTGAATAHVISQYLMCGILLWKLMGQVDIFNMSTKHLQFCRFMKNGFLLL  317

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
              RVIA TFC TL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA K
Sbjct  318   MRVIAVTFCATLSASLAAREGSTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFAKK  377

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             DYK+A A A+RVLQ+G V+G  LAV++G GL+FG+ VF+KD  V+ LI+IG+PFVAGTQP
Sbjct  378   DYKRAAATASRVLQLGLVLGFLLAVILGAGLHFGARVFTKDDKVLHLISIGLPFVAGTQP  437

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKS-NGFVGIWIALAIFMLLR  227
             IN+LAFV DGVNFGASDF Y+A S+VMVA ++I    LFL S +GF+G+W  L I+M LR
Sbjct  438   INALAFVFDGVNFGASDFGYAAASLVMVAIVSI-LCLLFLSSTHGFIGLWFGLTIYMSLR  496

Query  226   TIAGLWRLATGTGPWCFLRA  167
                G WR+ TGTGPW FLR+
Sbjct  497   AAVGFWRIGTGTGPWSFLRS  516



>ref|XP_010479600.1| PREDICTED: MATE efflux family protein 1 [Camelina sativa]
 ref|XP_010479601.1| PREDICTED: MATE efflux family protein 1 [Camelina sativa]
Length=516

 Score =   420 bits (1080),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 255/436 (58%), Positives = 314/436 (72%), Gaps = 11/436 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++  C      V      + K   E G +++  E  E   L   +S+  
Sbjct  91    VSITTSFVAEEDA--CSSQQNTVQ-----DHKECIESGTNNNTTE--ETQELIPENSKDS  141

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              S     + +    SK    K  IPSAS+AL++G ILG+LQ VFL   AKPLL  MGVK 
Sbjct  142   SSDESKTVSSIFSVSKPPAKKRNIPSASSALIIGSILGLLQAVFLISAAKPLLSFMGVKH  201

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPL+AT  GD+ NIILD IFI
Sbjct  202   DSPMLRPAQRYLSLRSLGAPAVLLSLAAQGVFRGFKDTTTPLFATVIGDVTNIILDPIFI  261

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GV+GAA AHVISQY++  ILL+KL+ +V++   S+KHLQ  +F+KNG  L  RVI
Sbjct  262   FVFRLGVTGAATAHVISQYLMCGILLWKLMSQVDIFNMSTKHLQFCRFMKNGFLLLMRVI  321

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA KDYK+
Sbjct  322   AVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFAKKDYKR  381

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+RVLQ+G V+G  LAV++G GL+FG+ VF+KD  V+ LI+IG+PFVAGTQPIN+L
Sbjct  382   AAATASRVLQLGLVLGFLLAVILGAGLHFGARVFTKDDKVLHLISIGLPFVAGTQPINAL  441

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKS-NGFVGIWIALAIFMLLRTIAG  215
             AFV DGVNFGASDF Y+A S+VMVA ++I    LFL S +GF+G+W  L I+M LR   G
Sbjct  442   AFVFDGVNFGASDFGYAAASLVMVAIVSI-LCLLFLSSTHGFIGLWFGLTIYMSLRAAVG  500

Query  214   LWRLATGTGPWCFLRA  167
              WR+ TGTGPW FLR+
Sbjct  501   FWRIGTGTGPWSFLRS  516



>ref|XP_002313336.1| MATE efflux family protein [Populus trichocarpa]
 gb|EEE87291.1| MATE efflux family protein [Populus trichocarpa]
Length=493

 Score =   419 bits (1078),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 256/439 (58%), Positives = 321/439 (73%), Gaps = 22/439 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLET-----MENGSLTIP  1307
             V++TTSFVAEE++            +V  EE+       DS+ LET      EN  L   
Sbjct  70    VSVTTSFVAEEDA----------IGRVSPEEE-------DSESLETGSTVNSENKELIPQ  112

Query  1306  SSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             +   +G        +S    K++  +  IPSAS+AL++G ILG++Q  FL   AKPLL  
Sbjct  113   NYSAEGPCKAKSPVSSFGIDKIENERRCIPSASSALVIGAILGLIQATFLISGAKPLLNF  172

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGV   S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NIIL
Sbjct  173   MGVGSDSPMLGPAQQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIIL  232

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IF+     GV GAAIAHV+SQY++ +ILL++L+++V+LLPPS KHL+L +FL+NGL L
Sbjct  233   DPIFMFVFGLGVRGAAIAHVLSQYLISVILLWRLMKQVDLLPPSIKHLRLGQFLRNGLLL  292

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
               RV+A TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA 
Sbjct  293   LMRVVAVTFCVTLSASLAARQGSTSMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAK  352

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY+KA A A RVLQ+G ++G  LA V+GLGL FG+ +F+ D +V+ +I+IGIPFVAGTQ
Sbjct  353   KDYEKATATATRVLQLGLLLGLMLAAVLGLGLRFGARLFTSDADVLHMISIGIPFVAGTQ  412

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PIN+LAFV DGVNFGASDF YSAYSM  + ++ I   FL   S+ F+GIW+AL I+M LR
Sbjct  413   PINALAFVFDGVNFGASDFAYSAYSMESLCSLIIPCLFLLSSSHKFIGIWVALTIYMSLR  472

Query  226   TIAGLWRLATGTGPWCFLR  170
              +AG WR+ TGTGPW FLR
Sbjct  473   ALAGFWRIGTGTGPWNFLR  491



>ref|XP_010464452.1| PREDICTED: MATE efflux family protein FRD3-like isoform X1 [Camelina 
sativa]
 ref|XP_010464453.1| PREDICTED: MATE efflux family protein FRD3-like isoform X1 [Camelina 
sativa]
 ref|XP_010464454.1| PREDICTED: MATE efflux family protein FRD3-like isoform X1 [Camelina 
sativa]
Length=529

 Score =   421 bits (1081),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 250/440 (57%), Positives = 325/440 (74%), Gaps = 18/440 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V+ITTSFVAEE++  ++ ++ +K  S  V++E  + ++         ++E G L+ P+S 
Sbjct  95    VSITTSFVAEEDTMEKMKEEANKTNS--VHAETILVQD---------SLEKG-LSSPTSN  142

Query  1297  T----KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
             T    +     SD  ++  +   K+GK  I +ASTA+++G ILG+ Q +FL   +K LLG
Sbjct  143   TTNQPQQPPVASDTRSNSENKGNKKGKRTIRTASTAMILGLILGLAQAIFLIFSSKLLLG  202

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
              MGVK  S ML+PA +YL++R+LG+PA+LLSLA+QG+FRG KDTKTPL+AT   +++NI+
Sbjct  203   FMGVKSDSPMLSPAHKYLSIRALGAPALLLSLAMQGVFRGFKDTKTPLFATVVANIINIV  262

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD IFI     G SGAAIAHVISQY + LIL   L +EV L+PP+   LQ  +FLKNG+ 
Sbjct  263   LDPIFIFVLRLGTSGAAIAHVISQYFMTLILFIFLAKEVNLMPPNFGDLQFGRFLKNGVL  322

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLTSSLL DGLA+AGQAILA +FA
Sbjct  323   LLARTIAVTFCQTLAAAMAARLGATPMAAFQICLQVWLTSSLLNDGLAVAGQAILACSFA  382

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
              KDY K  A A+RVLQMG V+G GL+V VGLGLYFG+G+FSKD  VI L+ +GIPF+A T
Sbjct  383   EKDYTKVSAIASRVLQMGTVLGFGLSVFVGLGLYFGAGIFSKDPAVIHLMAVGIPFIAAT  442

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QPINSLAFVLDGVNFGASDF Y+AYSMV VAA++I        ++GF+GIWIAL ++M L
Sbjct  443   QPINSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAIIYMAMTHGFIGIWIALTVYMAL  502

Query  229   RTIAGLWRLATGTGPWCFLR  170
             R I G+ R+ATGTGPW +LR
Sbjct  503   RAITGIARIATGTGPWRYLR  522



>ref|XP_010464456.1| PREDICTED: MATE efflux family protein FRD3-like isoform X2 [Camelina 
sativa]
Length=528

 Score =   420 bits (1080),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 250/439 (57%), Positives = 324/439 (74%), Gaps = 17/439 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V+ITTSFVAEE++  ++ ++ +K  S  V++E  + ++         ++E G L+ P+S 
Sbjct  95    VSITTSFVAEEDTMEKMKEEANKTNS--VHAETILVQD---------SLEKG-LSSPTSN  142

Query  1297  TKGSS---ALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             T         SD  ++  +   K+GK  I +ASTA+++G ILG+ Q +FL   +K LLG 
Sbjct  143   TTNQPQQPPASDTRSNSENKGNKKGKRTIRTASTAMILGLILGLAQAIFLIFSSKLLLGF  202

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGVK  S ML+PA +YL++R+LG+PA+LLSLA+QG+FRG KDTKTPL+AT   +++NI+L
Sbjct  203   MGVKSDSPMLSPAHKYLSIRALGAPALLLSLAMQGVFRGFKDTKTPLFATVVANIINIVL  262

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI     G SGAAIAHVISQY + LIL   L +EV L+PP+   LQ  +FLKNG+ L
Sbjct  263   DPIFIFVLRLGTSGAAIAHVISQYFMTLILFIFLAKEVNLMPPNFGDLQFGRFLKNGVLL  322

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
              AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLTSSLL DGLA+AGQAILA +FA 
Sbjct  323   LARTIAVTFCQTLAAAMAARLGATPMAAFQICLQVWLTSSLLNDGLAVAGQAILACSFAE  382

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY K  A A+RVLQMG V+G GL+V VGLGLYFG+G+FSKD  VI L+ +GIPF+A TQ
Sbjct  383   KDYTKVSAIASRVLQMGTVLGFGLSVFVGLGLYFGAGIFSKDPAVIHLMAVGIPFIAATQ  442

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PINSLAFVLDGVNFGASDF Y+AYSMV VAA++I        ++GF+GIWIAL ++M LR
Sbjct  443   PINSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAIIYMAMTHGFIGIWIALTVYMALR  502

Query  226   TIAGLWRLATGTGPWCFLR  170
              I G+ R+ATGTGPW +LR
Sbjct  503   AITGIARIATGTGPWRYLR  521



>ref|XP_003547162.1| PREDICTED: MATE efflux family protein 1-like isoformX1 [Glycine 
max]
Length=552

 Score =   421 bits (1082),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 248/438 (57%), Positives = 318/438 (73%), Gaps = 18/438 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEE-PGKDSDQLETMENGSLTIPSSET  1295
             V++TTSFVAEE++   ++   E       E +  E  P KD++  E + +          
Sbjct  131   VSVTTSFVAEEDTLSGENPHIE-------EGRCLETGPPKDAETKELLPH---------K  174

Query  1294  KGSSALSDLEASERD-SKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
              G++  SD      + +K +  +  IPSAS+A+ +G ILG++Q +FL   AKPLL  MGV
Sbjct  175   GGNNHNSDFVGECFNIAKEEHKRRHIPSASSAIFIGGILGLIQAIFLISAAKPLLNFMGV  234

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
                S ML+PA +YL LR+LG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NI LD +
Sbjct  235   TSDSPMLHPAKQYLKLRTLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIALDPL  294

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             F+     GVSGAAIAHVISQY++  ILL++L+ +V+L+PPS KHLQL +FLKNG  L  R
Sbjct  295   FMFVFRLGVSGAAIAHVISQYLISAILLWRLMEQVDLVPPSIKHLQLDRFLKNGFLLLMR  354

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             VIA TFCVTLAASLAAR G T MAAFQVCLQ+WL  SLLADGLA+AGQAILA AFA KD+
Sbjct  355   VIAVTFCVTLAASLAARQGPTSMAAFQVCLQVWLAVSLLADGLAVAGQAILAGAFANKDF  414

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
              +A A A+RVLQMG V+G  LA ++G+GL+FG+ +F++D NV+ LI IGIPFVA TQP+N
Sbjct  415   DRATATASRVLQMGLVLGLALAFILGIGLHFGAKIFTQDANVLHLIQIGIPFVAVTQPLN  474

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             S+AFV DGVNFGASDF YSA+SMV+VA ++I    +   + GF+GIW+AL I+M LR  A
Sbjct  475   SIAFVFDGVNFGASDFAYSAFSMVVVAILSIICLLILSSAGGFIGIWVALTIYMGLRAFA  534

Query  217   GLWRLATGTGPWCFLRAS  164
             G  R+ TG+GPW FLR+S
Sbjct  535   GFLRIGTGSGPWEFLRSS  552



>ref|XP_010500702.1| PREDICTED: MATE efflux family protein 1-like isoform X2 [Camelina 
sativa]
Length=490

 Score =   419 bits (1077),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 251/439 (57%), Positives = 315/439 (72%), Gaps = 21/439 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSS---  1301
             V+ITTSFVAEE++      + +        ++  EE G ++ + E  E     IP +   
Sbjct  69    VSITTSFVAEEDAYSSQQNTDQ------DHKEGTEEAGINNTKEEVQE----LIPENNKD  118

Query  1300  ETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
             ++K SS++ ++  S    ++      IPSAS+AL++G ILG+LQ VFL   AKPLL  MG
Sbjct  119   DSKTSSSIFNVSHSPIRKRI------IPSASSALIIGSILGLLQAVFLISAAKPLLSFMG  172

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             VK  S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD  NIILD 
Sbjct  173   VKHDSPMLRPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDATNIILDP  232

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             IFI     G +GAAIAHVISQY++  ILL+KL+ +V++   S+KHLQL +F+KNGL L  
Sbjct  233   IFIFVFRLGETGAAIAHVISQYLMCGILLWKLMGQVDIFNLSTKHLQLCRFMKNGLLLLM  292

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             RV A TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA KD
Sbjct  293   RVTAVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFANKD  352

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
             YK+A A A+RVLQ+G V+G  LA ++G  L+FG+ VF+KD  V+ LI+IG+PFVAGTQPI
Sbjct  353   YKRAAATASRVLQLGLVLGFLLAAILGAALHFGARVFTKDDKVLHLISIGLPFVAGTQPI  412

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN-GFVGIWIALAIFMLLRT  224
             N+LAFV DGVNFGASDF Y+A S+V+VA  +I    LFL S  GF+G+W  L I+M LR 
Sbjct  413   NALAFVFDGVNFGASDFGYAAASLVVVAIASI-LCLLFLSSTLGFIGLWFGLTIYMSLRA  471

Query  223   IAGLWRLATGTGPWCFLRA  167
                 WR+ TGTGPW FLR+
Sbjct  472   AVRFWRIGTGTGPWSFLRS  490



>ref|NP_564588.2| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE32653.1| MATE efflux family protein [Arabidopsis thaliana]
Length=509

 Score =   419 bits (1078),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 254/443 (57%), Positives = 316/443 (71%), Gaps = 26/443 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENS-----ELCDDGSK--EVSAKVYSEEKVAEEPGKDSDQLETMENGSLT  1313
             V+ITTSFVAEE++     +   D  +  E+     +EE +   P K  D L         
Sbjct  85    VSITTSFVAEEDACSSQQDTVRDHKECIEIGINNPTEETIELIPEKHKDSL---------  135

Query  1312  IPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
               S E K SS++  +      SK    K  IPSAS+AL++G +LG+ Q VFL   AKPLL
Sbjct  136   --SDEFKTSSSIFSI------SKPPAKKRNIPSASSALIIGGVLGLFQAVFLISAAKPLL  187

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
               MGVK  S M+ P+ RYL+LRSLG+PAVLLSLA QG+FRG KDT TPL+AT  GD+ NI
Sbjct  188   SFMGVKHDSPMMRPSQRYLSLRSLGAPAVLLSLAAQGVFRGFKDTTTPLFATVIGDVTNI  247

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             ILD IFI     GV+GAA AHVISQY++  ILL+KL+ +V++   S+KHLQ  +F+KNG 
Sbjct  248   ILDPIFIFVFRLGVTGAATAHVISQYLMCGILLWKLMGQVDIFNMSTKHLQFCRFMKNGF  307

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L  RVIA TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AF
Sbjct  308   LLLMRVIAVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGYAVAGQAILASAF  367

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
             A KDYK+A A A+RVLQ+G V+G  LAV++G GL+FG+ VF+KD  V+ LI+IG+PFVAG
Sbjct  368   AKKDYKRAAATASRVLQLGLVLGFVLAVILGAGLHFGARVFTKDDKVLHLISIGLPFVAG  427

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKS-NGFVGIWIALAIFM  236
             TQPIN+LAFV DGVNFGASDF Y+A S+VMVA ++I    LFL S +GF+G+W  L I+M
Sbjct  428   TQPINALAFVFDGVNFGASDFGYAAASLVMVAIVSI-LCLLFLSSTHGFIGLWFGLTIYM  486

Query  235   LLRTIAGLWRLATGTGPWCFLRA  167
              LR   G WR+ TGTGPW FLR+
Sbjct  487   SLRAAVGFWRIGTGTGPWSFLRS  509



>ref|XP_004166240.1| PREDICTED: MATE efflux family protein FRD3-like [Cucumis sativus]
Length=519

 Score =   419 bits (1078),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 252/439 (57%), Positives = 311/439 (71%), Gaps = 12/439 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++     G   +       EK   E G+  + L +++  ++   +S+  
Sbjct  93    VSITTSFVAEEDAV----GKTAIKPVKCDLEKHLTENGQKRE-LTSIKKENMLENNSQPP  147

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
               S       +      K+ K  I SASTAL+ G +LG+LQ VFL   AK LL +MGVK 
Sbjct  148   AVS-------TPTVKPKKKEKKHIGSASTALIFGTVLGLLQAVFLAFGAKYLLNVMGVKE  200

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA++YL LRSLG+PAVLLSLA+QGIFRG KDT+TPLY    G   NIILD I I
Sbjct  201   SSPMLAPAMKYLVLRSLGAPAVLLSLAMQGIFRGFKDTRTPLYVIVLGYTTNIILDPILI  260

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
               CH GV GAAIAHV+SQY+++L+L ++L+++V+LLPPS + LQ  +FLKNG  L ARVI
Sbjct  261   FVCHLGVRGAAIAHVLSQYLIVLVLAWRLMQKVDLLPPSLRDLQFGRFLKNGSLLLARVI  320

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTLAAS+AARLG T MAAFQ CLQ+W+TSSLLADGLA+AGQAILA AFA KDY+K
Sbjct  321   AVTFCVTLAASMAARLGPTPMAAFQTCLQVWMTSSLLADGLAVAGQAILACAFAEKDYEK  380

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
               A A RVLQM  VMG GLAV+V   + FG+G+FS+D NV  LI +G+PFVA TQP+NSL
Sbjct  381   TTATATRVLQMSLVMGVGLAVIVAAIMLFGAGIFSRDLNVQALIHLGVPFVAATQPMNSL  440

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVNFGASDF YSAYS+ +V+  TI   FL  KS GF+GIW ALAI+M LRT+ G 
Sbjct  441   AFVFDGVNFGASDFAYSAYSLTLVSIATIISLFLLSKSYGFIGIWTALAIYMALRTLVGF  500

Query  211   WRLATGTGPWCFLRASTQP  155
              R+ +GTGPW +LR    P
Sbjct  501   LRMGSGTGPWRYLRGPLLP  519



>gb|AFL69846.1| aluminum-activated citrate transporter isoform A [Medicago sativa]
Length=507

 Score =   419 bits (1077),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 251/443 (57%), Positives = 306/443 (69%), Gaps = 36/443 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSL---TIPSS  1301
             V++TTSFVAEE++    D S +V                        ENG L   T P +
Sbjct  93    VSVTTSFVAEEDA--LSDASSQVE-----------------------ENGCLEAATPPDA  127

Query  1300  ETK-----GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPL  1136
             ETK      +S +      + D   +R   +IPSAS+AL  G ILG++Q   L   AKPL
Sbjct  128   ETKEFLPQKNSVVESFNVVKVDGSKRR---QIPSASSALYFGGILGLVQATLLISAAKPL  184

Query  1135  LGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVN  956
             L  MGV   S ML+PA++YL LRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGDL N
Sbjct  185   LNFMGVTSDSPMLHPAMQYLKLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDLTN  244

Query  955   IILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNG  776
             I LD  FI     GV+GAAIAHVISQY+L  ILL+ L ++V+L+PPS KHLQ  +F KNG
Sbjct  245   IALDPPFIFVFRMGVNGAAIAHVISQYLLSAILLWSLNKQVDLIPPSIKHLQFDRFAKNG  304

Query  775   LWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATa  596
               LF RVIA TFCVTLAASLAA  GST MAAFQVCLQ+WL  SLLADGLA+AGQAILA A
Sbjct  305   FLLFMRVIAVTFCVTLAASLAAHHGSTSMAAFQVCLQVWLAESLLADGLAVAGQAILARA  364

Query  595   favkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVA  416
             FA KDY+KA   A R LQMG V+G  LA ++G GL+FG+ +F+KD +V+ LI +G+PFVA
Sbjct  365   FANKDYEKASTTATRALQMGMVLGLALAFILGTGLHFGAKLFTKDDDVLHLIRVGVPFVA  424

Query  415   GTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFM  236
              TQP+N LAFV DGVNFGASDF YSA+SMV+VA ++I    +   + GF+GIW+AL I+M
Sbjct  425   LTQPLNCLAFVFDGVNFGASDFAYSAFSMVIVAIISIICLLILSSAGGFIGIWVALTIYM  484

Query  235   LLRTIAGLWRLATGTGPWCFLRA  167
              LR  AG  R+ TG+GPW FLR+
Sbjct  485   SLRAFAGFLRIGTGSGPWEFLRS  507



>ref|XP_006307279.1| hypothetical protein CARUB_v10008894mg [Capsella rubella]
 gb|EOA40177.1| hypothetical protein CARUB_v10008894mg [Capsella rubella]
Length=509

 Score =   419 bits (1077),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 253/436 (58%), Positives = 313/436 (72%), Gaps = 12/436 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++  C      V      + K + E G ++   ET E        S + 
Sbjct  85    VSITTSFVAEEDA--CSSQQNTVQ-----DHKESIETGTNNTMEETQELIPENSKDSSSD  137

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              S  +S + +  +    KR    IPSAS+AL++G  LG+ Q VFL   AKPLL  MGVK 
Sbjct  138   ESKTISSIFSVSKPPAKKR---NIPSASSALIIGAFLGLFQAVFLISAAKPLLSFMGVKH  194

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S M+ PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPL+AT  GD+ NIILD IFI
Sbjct  195   DSPMMRPAQRYLSLRSLGAPAVLLSLAAQGVFRGFKDTTTPLFATVIGDVTNIILDPIFI  254

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GV+GAA AHVISQY++  ILL+KL+ +V++   S+KHLQL +F+KNG  L  RVI
Sbjct  255   FVFRLGVTGAATAHVISQYLMCGILLWKLMGQVDVFNMSTKHLQLCRFMKNGFLLLMRVI  314

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA KDYK+
Sbjct  315   AVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFAKKDYKR  374

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+RVLQ+G V+G  LAV++G GL+FG+ VF+KD  V+ LI+IG+PFVAGTQPIN+L
Sbjct  375   AAATASRVLQLGLVLGFVLAVILGAGLHFGARVFTKDDKVLHLISIGLPFVAGTQPINAL  434

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN-GFVGIWIALAIFMLLRTIAG  215
             AFV DGVNFGASDF Y+A S+VMVA ++I    LFL S  GF+G+W  L I+M LR   G
Sbjct  435   AFVFDGVNFGASDFGYAAASLVMVAIVSI-MCLLFLSSTLGFIGLWFGLTIYMSLRAAVG  493

Query  214   LWRLATGTGPWCFLRA  167
              WR+ TGTGPW FLR+
Sbjct  494   FWRIGTGTGPWSFLRS  509



>emb|CDY35980.1| BnaA05g29700D [Brassica napus]
Length=536

 Score =   420 bits (1079),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 257/436 (59%), Positives = 317/436 (73%), Gaps = 3/436 (1%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTSFVAEE++  ++ ++  +   AK      +A +   +     T  N     P   
Sbjct  95    VSVTTSFVAEEDTLEKIKEEEEEANKAKNVHANTLAIQDSLEKGVTSTTSNNK-NQPQQT  153

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                    SD +++  +   K+GK  I SASTA+++G  LG++Q + L   +K L+G+MGV
Sbjct  154   PVDVKLTSDTKSNNGNKANKKGKKTIKSASTAMIIGLTLGLVQAIVLIFSSKVLIGIMGV  213

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             KP S +L+PA +YLT+R+LG+PA+LLSL++QGIFRG KDTKTPLYAT A D +NIILD I
Sbjct  214   KPNSAVLSPAQKYLTIRALGAPALLLSLSMQGIFRGFKDTKTPLYATVASDGLNIILDPI  273

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             FI     GVSGAAIAHVISQY +LLILL +L +EV L+PP    LQ  KF++NG  + AR
Sbjct  274   FIFVLRLGVSGAAIAHVISQYFMLLILLIRLAKEVNLMPPKFGDLQFGKFIRNGGLMLAR  333

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
              IA TFC TLAAS+AARLG+T MAAFQ+CLQ+WLTSS+LADGLA+AGQAILA  FA KDY
Sbjct  334   TIAVTFCQTLAASMAARLGTTPMAAFQICLQVWLTSSMLADGLAVAGQAILACNFAEKDY  393

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
              K  AAA+RV+QM  V+G GL+V VGLGLYFGSGVFSKD  VI LI IGIPFVA TQPIN
Sbjct  394   NKVTAAASRVIQMSLVLGLGLSVFVGLGLYFGSGVFSKDPAVIHLIAIGIPFVAATQPIN  453

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             SL FVLDGVNFGASDF Y+AYSMV VAA++I       K NGFVGIWIAL I+M LR + 
Sbjct  454   SLTFVLDGVNFGASDFAYTAYSMVGVAAVSIAAVIYMAKVNGFVGIWIALTIYMGLRAVT  513

Query  217   GLWRLATGTGPWCFLR  170
             G+ R+ATGTGPW FLR
Sbjct  514   GIGRMATGTGPWKFLR  529



>ref|XP_010500701.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Camelina 
sativa]
Length=511

 Score =   419 bits (1076),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 251/439 (57%), Positives = 315/439 (72%), Gaps = 21/439 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSS---  1301
             V+ITTSFVAEE++      + +        ++  EE G ++ + E  E     IP +   
Sbjct  90    VSITTSFVAEEDAYSSQQNTDQ------DHKEGTEEAGINNTKEEVQE----LIPENNKD  139

Query  1300  ETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
             ++K SS++ ++  S    ++      IPSAS+AL++G ILG+LQ VFL   AKPLL  MG
Sbjct  140   DSKTSSSIFNVSHSPIRKRI------IPSASSALIIGSILGLLQAVFLISAAKPLLSFMG  193

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             VK  S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD  NIILD 
Sbjct  194   VKHDSPMLRPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDATNIILDP  253

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             IFI     G +GAAIAHVISQY++  ILL+KL+ +V++   S+KHLQL +F+KNGL L  
Sbjct  254   IFIFVFRLGETGAAIAHVISQYLMCGILLWKLMGQVDIFNLSTKHLQLCRFMKNGLLLLM  313

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             RV A TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA KD
Sbjct  314   RVTAVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFANKD  373

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
             YK+A A A+RVLQ+G V+G  LA ++G  L+FG+ VF+KD  V+ LI+IG+PFVAGTQPI
Sbjct  374   YKRAAATASRVLQLGLVLGFLLAAILGAALHFGARVFTKDDKVLHLISIGLPFVAGTQPI  433

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN-GFVGIWIALAIFMLLRT  224
             N+LAFV DGVNFGASDF Y+A S+V+VA  +I    LFL S  GF+G+W  L I+M LR 
Sbjct  434   NALAFVFDGVNFGASDFGYAAASLVVVAIASI-LCLLFLSSTLGFIGLWFGLTIYMSLRA  492

Query  223   IAGLWRLATGTGPWCFLRA  167
                 WR+ TGTGPW FLR+
Sbjct  493   AVRFWRIGTGTGPWSFLRS  511



>gb|KCW90221.1| hypothetical protein EUGRSUZ_A02386 [Eucalyptus grandis]
Length=385

 Score =   414 bits (1064),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 238/384 (62%), Positives = 293/384 (76%), Gaps = 7/384 (2%)
 Frame = -2

Query  1312  IPSSETKGSSALSDL---EASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAK  1142
             +P S++   S+ +D    + ++ D+K    +  IPSAS+AL++G ILGILQT+FL   AK
Sbjct  5     LPQSDSTSKSSFTDTSFGKMADLDNK----RRYIPSASSALVIGSILGILQTLFLIFSAK  60

Query  1141  PLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDL  962
             P+L  MGVK  S ML PA +YLTLRSLG+PAVLLSLA+QGIFRG KDTKTPLYAT  GD 
Sbjct  61    PILNYMGVKSDSPMLMPAQKYLTLRSLGAPAVLLSLAMQGIFRGFKDTKTPLYATVVGDA  120

Query  961   VNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLK  782
              NIILD +FI     G+SGAAIAHVISQY++ LILL++L+ +V+LLPPS K L+  +FLK
Sbjct  121   SNIILDPLFIFVFRMGISGAAIAHVISQYLISLILLWRLMSQVDLLPPSIKDLKFERFLK  180

Query  781   NGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILA  602
             NGL L  RVIA TFCVTLAASLAAR G+T MAAFQVCLQIWL +SLLADGLA+AGQAILA
Sbjct  181   NGLLLLVRVIAVTFCVTLAASLAARHGATSMAAFQVCLQIWLATSLLADGLAVAGQAILA  240

Query  601   TafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPF  422
             +AFA  DY+KA + A+RVLQ+G  MG  L+VV+  GL F S +F++D  V+ LI++GIPF
Sbjct  241   SAFARADYEKAVSTASRVLQLGLAMGLVLSVVLVTGLQFASRLFTEDAGVLHLISVGIPF  300

Query  421   VAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAI  242
             VA TQPIN+LAFV DG+N+GASDF YSAYSMV+VA ++I        + GF+GIWIAL I
Sbjct  301   VAVTQPINALAFVFDGINYGASDFAYSAYSMVLVAVVSIVCLCALSSTYGFIGIWIALTI  360

Query  241   FMLLRTIAGLWRLATGTGPWCFLR  170
             +M LRT AG  R+  G GPW FL 
Sbjct  361   YMTLRTFAGFLRIGAGMGPWGFLN  384



>ref|XP_003638284.1| Ferric reductase defective 3a, partial [Medicago truncatula]
Length=578

 Score =   421 bits (1082),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 246/457 (54%), Positives = 314/457 (69%), Gaps = 25/457 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V+ITTSFVAEE++   +    SK +      + K++      +  L+ +ENG +   + +
Sbjct  78    VSITTSFVAEEDTIERMNIKASKNID-----DAKLSGIETPKNQLLQDIENGKIHKENID  132

Query  1297  TKGSSALSDLE--------ASERDSKVKRGKL----------RIPSASTALMMGCILGIL  1172
              +  +A +D          A + DS +  G             I SASTAL+ G +LG++
Sbjct  133   VEKYAANNDTNVEDDSKTNACKHDSSITNGNKSKDKDGKKKRHIASASTALLFGTMLGLI  192

Query  1171  QTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKT  992
             QT  L   AK LL  MG+K  S ML PA++YL LR+ GSPAVLLSLA+QGIFRG KD  T
Sbjct  193   QTTILIFGAKLLLAAMGIKHDSPMLKPAVKYLRLRAFGSPAVLLSLAMQGIFRGFKDVTT  252

Query  991   PLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSS  812
             PLY   +G  +N+ILD I I     G++GAAI+HV SQY++   LL  L+R+V +LPPS 
Sbjct  253   PLYVILSGYALNVILDPILIFYLKLGLNGAAISHVFSQYLMAFTLLVLLMRKVYILPPSL  312

Query  811   KHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADG  632
             K LQ+ +FLKNG  L ARV+A TFC+T AASLAARLGS  MAAFQ CLQIWLTSSLLADG
Sbjct  313   KDLQIFRFLKNGGLLLARVVAVTFCMTFAASLAARLGSVPMAAFQPCLQIWLTSSLLADG  372

Query  631   LAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNV  452
             LA+A QAILA +F  KDYKK  AAA R LQM FV+G GL+++VG+G YFG+G+FSKD +V
Sbjct  373   LAVAVQAILACSFTEKDYKKTTAAATRALQMSFVLGMGLSILVGIGFYFGAGIFSKDVHV  432

Query  451   IRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNG  272
             + LI IGIPFVA TQPINSLAFV DGVN+G+SDF YSAYS+VMV+ ++I  EF   +S  
Sbjct  433   VHLIKIGIPFVAATQPINSLAFVFDGVNYGSSDFAYSAYSLVMVSVVSIVTEFFLYRSKQ  492

Query  271   FVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRAST  161
             F+GIWIAL I+M+LR  AG+WR+ T TGPW +LR S+
Sbjct  493   FIGIWIALTIYMILRMFAGIWRMGTATGPWRYLRTSS  529


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -2

Query  373  VNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIF  239
            +N+ +SDF YSAYS+VMV+ ++I  EF   +S  F+GIWIAL I+
Sbjct  534  LNYRSSDFAYSAYSLVMVSVVSIVTEFFLYRSKQFIGIWIALTIY  578



>emb|CDY07959.1| BnaC03g35640D [Brassica napus]
Length=531

 Score =   419 bits (1078),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 260/441 (59%), Positives = 320/441 (73%), Gaps = 18/441 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS-------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLT  1313
             V++TTSFVAEE++       E     +  V A   + +   E+ G  S     M     T
Sbjct  95    VSVTTSFVAEEDTMEKLKEEEKEAKKNNLVHANTLAVQDSLEK-GIASPTSNNMNQPQQT  153

Query  1312  IPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
              P+S+TK SS     +  +++ K         SASTA+++G ILG++Q +FL   +K LL
Sbjct  154   -PASDTKSSSGNKANKKGKKNIK---------SASTAMIIGLILGLVQAIFLIFSSKVLL  203

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
             G+MGVKP S +L+PA +YLT+RSLG+PA+LLSL++QGIFRG KDTKTPLYAT   D++NI
Sbjct  204   GVMGVKPNSAVLSPAHKYLTIRSLGAPALLLSLSMQGIFRGFKDTKTPLYATIVADVINI  263

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             ILD IFI   H G+SGAAIAHVISQY + LIL  +L  +V L+PP+   LQ  KFLKNG 
Sbjct  264   ILDPIFIFVLHLGISGAAIAHVISQYFMTLILFTRLASKVNLMPPNFAALQFGKFLKNGG  323

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLT+SLLADGLA+AGQAILA +F
Sbjct  324   LLLARTIAVTFCQTLAAAMAARLGATPMAAFQICLQVWLTTSLLADGLAVAGQAILACSF  383

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
             A KD  K  + A+RVLQMGFV+G GL+V VGLGLYFG+G+F+KD  VI LI IGIPFVA 
Sbjct  384   AEKDDNKVSSCASRVLQMGFVLGLGLSVFVGLGLYFGAGIFTKDPAVIHLIAIGIPFVAA  443

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFML  233
             TQPINSLAFVLDGVNFGASDF Y+AYSMV VAA++I       K NGF+GIWIAL I+M 
Sbjct  444   TQPINSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAIIYMAKFNGFLGIWIALTIYMG  503

Query  232   LRTIAGLWRLATGTGPWCFLR  170
             LR I G+ R+ATGTGPW FLR
Sbjct  504   LRAITGIARIATGTGPWKFLR  524



>ref|XP_009147006.1| PREDICTED: MATE efflux family protein FRD3-like isoform X3 [Brassica 
rapa]
Length=536

 Score =   419 bits (1078),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 257/436 (59%), Positives = 317/436 (73%), Gaps = 3/436 (1%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTSFVAEE++  ++ ++  +   AK      +A +   +     T  N     P   
Sbjct  95    VSVTTSFVAEEDTLEKIKEEEEEANKAKNVHANTLAIQDSLEKGVTSTTSNNK-NQPQQT  153

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                    SD +++  +   K+GK  I SASTA+++G  LG++Q + L   +K L+G+MGV
Sbjct  154   PVDVKLTSDTKSNNGNKANKKGKKTIKSASTAMIIGLTLGLVQAIVLIFSSKVLIGIMGV  213

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             KP S +L+PA +YLT+R+LG+PA+LLSL++QGIFRG KDTKTPLYAT A D +NIILD I
Sbjct  214   KPNSAVLSPAQKYLTIRALGAPALLLSLSMQGIFRGFKDTKTPLYATVASDGLNIILDPI  273

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             FI     GVSGAAIAHVISQY +LLILL +L +EV L+PP    LQ  KF++NG  + AR
Sbjct  274   FIFVLRLGVSGAAIAHVISQYFMLLILLIRLAKEVNLMPPKFGDLQFGKFIRNGGLMLAR  333

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
              IA TFC TLAAS+AARLG+T MAAFQ+CLQ+WLTSS+LADGLA+AGQAILA  FA KDY
Sbjct  334   TIAVTFCQTLAASMAARLGTTPMAAFQICLQVWLTSSMLADGLAVAGQAILACNFAEKDY  393

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
              K  AAA+RV+QM  V+G GL+V VGLGLYFGSGVFSKD  VI LI IGIPFVA TQPIN
Sbjct  394   NKVTAAASRVIQMSLVLGLGLSVFVGLGLYFGSGVFSKDPAVIHLIAIGIPFVAATQPIN  453

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             SL FVLDGVNFGASDF Y+AYSMV VAA++I       K NGFVGIWIAL I+M LR + 
Sbjct  454   SLTFVLDGVNFGASDFAYTAYSMVGVAAVSIAAVIYMAKVNGFVGIWIALTIYMGLRAVT  513

Query  217   GLWRLATGTGPWCFLR  170
             G+ R+ATGTGPW FLR
Sbjct  514   GIGRMATGTGPWKFLR  529



>ref|NP_974000.1| MATE efflux family protein [Arabidopsis thaliana]
 sp|Q9SYD6.2|MATE1_ARATH RecName: Full=MATE efflux family protein 1; AltName: Full=Aluminum-activated 
citrate transporter; AltName: Full=FRD-like 
protein; AltName: Full=MATE citrate transporter; AltName: Full=Multidrug 
and toxin extrusion protein; Short=AtMATE; AltName: 
Full=Protein DTX42 [Arabidopsis thaliana]
 gb|AEE32652.1| MATE efflux family protein [Arabidopsis thaliana]
Length=515

 Score =   418 bits (1075),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 254/443 (57%), Positives = 316/443 (71%), Gaps = 26/443 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENS-----ELCDDGSK--EVSAKVYSEEKVAEEPGKDSDQLETMENGSLT  1313
             V+ITTSFVAEE++     +   D  +  E+     +EE +   P K  D L         
Sbjct  91    VSITTSFVAEEDACSSQQDTVRDHKECIEIGINNPTEETIELIPEKHKDSL---------  141

Query  1312  IPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
               S E K SS++  +      SK    K  IPSAS+AL++G +LG+ Q VFL   AKPLL
Sbjct  142   --SDEFKTSSSIFSI------SKPPAKKRNIPSASSALIIGGVLGLFQAVFLISAAKPLL  193

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
               MGVK  S M+ P+ RYL+LRSLG+PAVLLSLA QG+FRG KDT TPL+AT  GD+ NI
Sbjct  194   SFMGVKHDSPMMRPSQRYLSLRSLGAPAVLLSLAAQGVFRGFKDTTTPLFATVIGDVTNI  253

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             ILD IFI     GV+GAA AHVISQY++  ILL+KL+ +V++   S+KHLQ  +F+KNG 
Sbjct  254   ILDPIFIFVFRLGVTGAATAHVISQYLMCGILLWKLMGQVDIFNMSTKHLQFCRFMKNGF  313

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L  RVIA TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AF
Sbjct  314   LLLMRVIAVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGYAVAGQAILASAF  373

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
             A KDYK+A A A+RVLQ+G V+G  LAV++G GL+FG+ VF+KD  V+ LI+IG+PFVAG
Sbjct  374   AKKDYKRAAATASRVLQLGLVLGFVLAVILGAGLHFGARVFTKDDKVLHLISIGLPFVAG  433

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKS-NGFVGIWIALAIFM  236
             TQPIN+LAFV DGVNFGASDF Y+A S+VMVA ++I    LFL S +GF+G+W  L I+M
Sbjct  434   TQPINALAFVFDGVNFGASDFGYAAASLVMVAIVSI-LCLLFLSSTHGFIGLWFGLTIYM  492

Query  235   LLRTIAGLWRLATGTGPWCFLRA  167
              LR   G WR+ TGTGPW FLR+
Sbjct  493   SLRAAVGFWRIGTGTGPWSFLRS  515



>ref|XP_006850216.1| hypothetical protein AMTR_s00022p00252850 [Amborella trichopoda]
 gb|ERN11797.1| hypothetical protein AMTR_s00022p00252850 [Amborella trichopoda]
Length=504

 Score =   418 bits (1074),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 247/434 (57%), Positives = 310/434 (71%), Gaps = 11/434 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAE      DD +  ++      E+  + P K+ +  E +          E +
Sbjct  81    VSITTSFVAE------DDANCTITRDEIDIEETRKSPLKEEEMNEMLPRDD-----PEKQ  129

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              +  L  +     D+ ++  K  IPSA +AL+ G ILG+LQ V L   A+ +L +MGVK 
Sbjct  130   TNKPLGFVNTKTNDTYLECEKRHIPSAYSALVFGSILGLLQAVILIFGARSILSIMGVKH  189

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
             GS ML PA +YL LRSLGSPAVLLSLA QG+FRG KDTKTPL+AT  GD  NIILD IF+
Sbjct  190   GSPMLTPAEQYLKLRSLGSPAVLLSLATQGVFRGFKDTKTPLFATVIGDATNIILDPIFM  249

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GV GAAIAHV+SQY+L+LILL++L  +++++PPS   LQ  +FLKNG  L ARVI
Sbjct  250   FVLKLGVRGAAIAHVVSQYLLMLILLWRLCMKIKVVPPSITDLQYDRFLKNGFLLLARVI  309

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTLAAS+AAR GS  MAAFQVCLQ+WLT+SLLADGLA+AGQAILA+AFAV D++K
Sbjct  310   AVTFCVTLAASMAAREGSVPMAAFQVCLQVWLTTSLLADGLAVAGQAILASAFAVGDHEK  369

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A+  A RVLQ+G  +G  L+VV+GLGL FG  +F++D +V+ L+ +GIPFVA TQPINSL
Sbjct  370   ARITATRVLQLGLALGLILSVVLGLGLRFGGQIFTRDVHVLHLMRVGIPFVAITQPINSL  429

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DG+NFGASDF YSA+SMV+VA  +IG   L   S GF+GIWIAL I+M LR +AG 
Sbjct  430   AFVFDGLNFGASDFAYSAWSMVLVAIASIGCLILLSWSKGFIGIWIALTIYMSLRMLAGF  489

Query  211   WRLATGTGPWCFLR  170
             WR+ T TGPW FLR
Sbjct  490   WRIGTATGPWKFLR  503



>ref|XP_004486970.1| PREDICTED: MATE efflux family protein 1-like [Cicer arietinum]
Length=506

 Score =   418 bits (1074),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 254/442 (57%), Positives = 310/442 (70%), Gaps = 35/442 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSL---TIPSS  1301
             V+ITTSFVAEE++                           S Q+E  ENG L   T P +
Sbjct  93    VSITTSFVAEEDTL-----------------------SGASSQVE--ENGFLEAGTPPDA  127

Query  1300  ETKGSSALSDLEAS----ERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
             ETK      +L A     E+D   +R    IPSAS+AL  G ILG++Q + L   AKPLL
Sbjct  128   ETKEFLPQKELVAESFNIEKDEHKRR---HIPSASSALFFGGILGLIQAMLLIFAAKPLL  184

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
               MGV   S ML+PA +YL LRSLG+PAVLLSLA+QG+FRG KDT TPLYAT AGD+ NI
Sbjct  185   NFMGVTSDSPMLHPAQQYLKLRSLGAPAVLLSLAMQGVFRGFKDTTTPLYATVAGDVTNI  244

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
              LD +FI     GV+GAAIAHVISQY++  ILL+ L+++V+L+PP+ KHLQ  +FLKNG 
Sbjct  245   ALDPLFIFVFRMGVNGAAIAHVISQYLISAILLWSLMKQVDLIPPTIKHLQFDRFLKNGF  304

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L  RV+A TFCVTL+ASLAAR GST MAAFQVCLQ+WL  SLLADGLA+AGQAILA AF
Sbjct  305   LLLMRVVAVTFCVTLSASLAARHGSTSMAAFQVCLQVWLAVSLLADGLAVAGQAILAGAF  364

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
             A KDY KA A A+RVLQMG V+G  LA ++G GL+FG+ +F+KD +V+ LI IGIPFVA 
Sbjct  365   ANKDYDKATATASRVLQMGVVLGMALAFILGTGLHFGAKLFTKDVDVLNLIRIGIPFVAL  424

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFML  233
             TQP+N LAFV DGVNFGASDF YSA+SMV+VA ++I    +   + GFVGIW+AL I+M 
Sbjct  425   TQPLNCLAFVFDGVNFGASDFAYSAFSMVVVAIISIICLLILSSAGGFVGIWVALTIYMS  484

Query  232   LRTIAGLWRLATGTGPWCFLRA  167
             LR  AG  R+ TG+GPW FLR+
Sbjct  485   LRAFAGFLRIGTGSGPWGFLRS  506



>gb|EEC72043.1| hypothetical protein OsI_04949 [Oryza sativa Indica Group]
Length=597

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 244/446 (55%), Positives = 308/446 (69%), Gaps = 22/446 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELC-----DDGSKE----VSAKVYSEEKVAEEPGKDSDQLETMENGS  1319
             V++TTSFVAEE++ L      DDG        SA   ++ +  +  G DS +    E  +
Sbjct  161   VSVTTSFVAEEDAILSKGAAGDDGHDAKGHGASAAAVADLEKQQVVGVDSAETNGAEVST  220

Query  1318  LTIPSSETKGSSALSDLEASERDSKVKRGKLR---IPSASTALMMGCILGILQTVFLTVL  1148
               + +++ K ++A          + V  GK R   +PS ++AL++G  LG+LQ VFL   
Sbjct  221   AAVRTTDDKKAAA----------AGVGVGKCRRRFVPSVTSALIVGAFLGLLQAVFLVAA  270

Query  1147  AKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAG  968
              KPLL +MGVKPGS M+ PALRYL +RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  G
Sbjct  271   GKPLLRIMGVKPGSPMMIPALRYLVMRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVTG  330

Query  967   DLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKF  788
             DL NI LD I I  C +GV GAAIAHVISQY++ LI+L KL+R+V+++P S K L+  +F
Sbjct  331   DLANIALDPILIFTCRFGVVGAAIAHVISQYLITLIMLCKLVRKVDVIPSSLKSLKFRRF  390

Query  787   LKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAI  608
             L  G  L ARV+A TFCVTLAASLAAR G+T MAAFQ+C Q+WL SSLLADGLA+AGQA+
Sbjct  391   LGCGFLLLARVVAVTFCVTLAASLAARHGATAMAAFQICAQVWLASSLLADGLAVAGQAL  450

Query  607   LATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGI  428
             LA+AFA KD+ K     ARVLQ+  V+G GL   +  G++FG+GVF+ D  VI  I  G+
Sbjct  451   LASAFAKKDHYKVAVTTARVLQLAVVLGVGLTAFLAAGMWFGAGVFTSDAAVISTIHRGV  510

Query  427   PFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIAL  248
             PFVAGTQ IN+LAFV DGVNFGASD+ ++AYSMV VAA+TI    L     GFVGIWIAL
Sbjct  511   PFVAGTQTINTLAFVFDGVNFGASDYAFAAYSMVGVAAVTIPCLVLLSSHGGFVGIWIAL  570

Query  247   AIFMLLRTIAGLWRLATGTGPWCFLR  170
             AI+M +R  A  WR+    GPW FLR
Sbjct  571   AIYMSVRAFASTWRMGAARGPWKFLR  596



>ref|NP_001169974.1| hypothetical protein [Zea mays]
 ref|XP_008645637.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN35408.1| unknown [Zea mays]
 tpg|DAA44108.1| TPA: hypothetical protein ZEAMMB73_968567 [Zea mays]
Length=553

 Score =   419 bits (1077),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 243/436 (56%), Positives = 308/436 (71%), Gaps = 8/436 (2%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKV--AEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTSFVAEE++ +    SK V      EE V  A   G D +      +G   +  +E
Sbjct  123   VSVTTSFVAEEDAII----SKAVRGNSSQEEDVEKASHVGFDPETSNLHASGPAGM--AE  176

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                S   ++  A     + +  K  +PS ++AL++G ILG+LQ VFL + A+ +L +MGV
Sbjct  177   CVNSCIPTECAADPSGRQGRCEKRYVPSVTSALIVGSILGLLQAVFLVLSARFVLNIMGV  236

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K GS M  PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  237   KSGSPMQGPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDAANIILDPI  296

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAAIAHV+SQY++ LILL +L++ V ++PPS K L+  +FL  G  L AR
Sbjct  297   LMFVCHMGVTGAAIAHVVSQYMITLILLCRLVQRVHVIPPSIKSLKFGRFLGCGFLLLAR  356

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLAASLAAR G TVMA FQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  357   VVAVTFCVTLAASLAARHGPTVMAGFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDS  416

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+G+F+ D  VI++I  GIPFVAGTQ IN
Sbjct  417   KKVAAATSRVLQLSIVLGMGLTVVLGLAMRFGAGIFTSDVPVIQVIHRGIPFVAGTQTIN  476

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             SLAFV DG+NFGASD+ YSAYSMV VA+++I         NGF+GIWIAL I+M LRTIA
Sbjct  477   SLAFVFDGINFGASDYRYSAYSMVAVASVSIPCLLYLSAHNGFIGIWIALTIYMSLRTIA  536

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  537   STWRMGAARGPWTFLR  552



>ref|XP_009147004.1| PREDICTED: MATE efflux family protein FRD3-like isoform X1 [Brassica 
rapa]
Length=580

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 255/437 (58%), Positives = 316/437 (72%), Gaps = 5/437 (1%)
 Frame = -2

Query  1471  VNITTSFVAEENS---ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSS  1301
             V++TTSFVAEE++      ++     +  V++     ++  +      T  N +   P  
Sbjct  139   VSVTTSFVAEEDTLEKIKEEEEEANKAKNVHANTLAIQDSLEKGVTSTTSNNKNQ--PQQ  196

Query  1300  ETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
                     SD +++  +   K+GK  I SASTA+++G  LG++Q + L   +K L+G+MG
Sbjct  197   TPVDVKLTSDTKSNNGNKANKKGKKTIKSASTAMIIGLTLGLVQAIVLIFSSKVLIGIMG  256

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             VKP S +L+PA +YLT+R+LG+PA+LLSL++QGIFRG KDTKTPLYAT A D +NIILD 
Sbjct  257   VKPNSAVLSPAQKYLTIRALGAPALLLSLSMQGIFRGFKDTKTPLYATVASDGLNIILDP  316

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             IFI     GVSGAAIAHVISQY +LLILL +L +EV L+PP    LQ  KF++NG  + A
Sbjct  317   IFIFVLRLGVSGAAIAHVISQYFMLLILLIRLAKEVNLMPPKFGDLQFGKFIRNGGLMLA  376

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             R IA TFC TLAAS+AARLG+T MAAFQ+CLQ+WLTSS+LADGLA+AGQAILA  FA KD
Sbjct  377   RTIAVTFCQTLAASMAARLGTTPMAAFQICLQVWLTSSMLADGLAVAGQAILACNFAEKD  436

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
             Y K  AAA+RV+QM  V+G GL+V VGLGLYFGSGVFSKD  VI LI IGIPFVA TQPI
Sbjct  437   YNKVTAAASRVIQMSLVLGLGLSVFVGLGLYFGSGVFSKDPAVIHLIAIGIPFVAATQPI  496

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTI  221
             NSL FVLDGVNFGASDF Y+AYSMV VAA++I       K NGFVGIWIAL I+M LR +
Sbjct  497   NSLTFVLDGVNFGASDFAYTAYSMVGVAAVSIAAVIYMAKVNGFVGIWIALTIYMGLRAV  556

Query  220   AGLWRLATGTGPWCFLR  170
              G+ R+ATGTGPW FLR
Sbjct  557   TGIGRMATGTGPWKFLR  573



>ref|XP_003539638.1| PREDICTED: MATE efflux family protein FRD3-like [Glycine max]
Length=530

 Score =   418 bits (1074),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 252/450 (56%), Positives = 310/450 (69%), Gaps = 22/450 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQL--ETMENGSLTIPSSE  1298
             V+ITTSFVAEE++ +    +KE        E + +E  +   +   ET E+ ++   S+ 
Sbjct  74    VSITTSFVAEEDT-IQRLINKETETDNIENETITKENVEAPKKFKGETDESNNVVAKSTF  132

Query  1297  TKGSSALSDLE--------------ASERDSKVKRGKLRIPSASTALMMGCILGILQTVF  1160
             T G     D+E               S   SK K GK RI SASTAL+ G ILG+LQT  
Sbjct  133   TSG-----DVEKLATGNMGINNENVTSSTKSKPKVGKKRIASASTALLFGTILGLLQTAI  187

Query  1159  LTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYA  980
             LT  AKPLL  MG+K  S ML PA +YL LRS+GSPAVLLSLA+QGIFRG KDT TPLY 
Sbjct  188   LTFAAKPLLYAMGLKHDSPMLIPAEKYLRLRSIGSPAVLLSLAMQGIFRGFKDTTTPLYV  247

Query  979   TAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQ  800
               +G   N++LD I I     G+ GAA+AHVISQY++ + LL  L++ V L+PPS K LQ
Sbjct  248   IVSGYAFNVLLDPILIFYLKLGLKGAAMAHVISQYMMAITLLLLLMKRVHLVPPSIKDLQ  307

Query  799   LSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIA  620
             + +FLKNG  L  RV++ TFC+TLAASLAARLGS  MAAFQ  LQIWL SSLLADGLA+A
Sbjct  308   IFRFLKNGGLLLTRVVSVTFCMTLAASLAARLGSIPMAAFQPGLQIWLASSLLADGLAVA  367

Query  619   GQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLI  440
              Q +LA +FA KDY KA AAA R LQM FV+G GL+  V LGLYFG G+FSK+ NV+ LI
Sbjct  368   VQTMLACSFAEKDYNKATAAATRTLQMSFVLGVGLSFAVALGLYFGPGIFSKNANVVHLI  427

Query  439   TIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGI  260
              I +PFVA TQPINSLAFV DGVN+GASDF YSAYS+V+V+ ++I  E L  +S  FVGI
Sbjct  428   KISMPFVAATQPINSLAFVFDGVNYGASDFAYSAYSLVLVSLVSIPIEILLFRSKQFVGI  487

Query  259   WIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             WIAL I+M+LR + G+WR+ TGTGPW +LR
Sbjct  488   WIALTIYMILRMLVGIWRMGTGTGPWYYLR  517



>ref|XP_006651171.1| PREDICTED: MATE efflux family protein 1-like [Oryza brachyantha]
Length=561

 Score =   419 bits (1077),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 311/438 (71%), Gaps = 20/438 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSEL--C--DDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPS  1304
             V++TTSFVAEE++ +  C  ++ S ++      + +    P    D++E + +    IP+
Sbjct  139   VSVTTSFVAEEDAIITKCMEENNSHDLEKASPVDSETNNLPVSGPDKVECVNS---CIPT  195

Query  1303  SETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
               T       DL     D   KR    IPS ++AL++G  LG+LQ VFL   AK +LG+M
Sbjct  196   ECT-------DLS----DQGCKRK--YIPSVTSALVVGSFLGLLQAVFLVFSAKFVLGIM  242

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVK  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD
Sbjct  243   GVKHDSPMLRPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDAANIILD  302

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              I +  CH GV+GAA+AHVISQY++ +ILL +L+R+V+++PPS K L+  +FL  G  L 
Sbjct  303   PILMFVCHMGVTGAAVAHVISQYLITMILLCRLVRQVDVIPPSLKSLKFGRFLGCGFLLL  362

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
             ARV+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  
Sbjct  363   ARVVAVTFCVTLASSLAARHGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKN  422

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             D  K  AA +RVLQ+  V+G  L VV+G+G+  G+G+F+KD +VI +I  GIPFVAGTQ 
Sbjct  423   DKGKVVAATSRVLQLSIVLGMCLTVVLGVGIKLGAGIFTKDIDVIDVIHKGIPFVAGTQT  482

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             INSLAFV DG+NFGASD+ YSAYSMV VAA++I         NGF+GIWIAL I+M LRT
Sbjct  483   INSLAFVFDGINFGASDYTYSAYSMVGVAAISIPCLVYLSAHNGFIGIWIALTIYMSLRT  542

Query  223   IAGLWRLATGTGPWCFLR  170
             IA  WR+    GPW FLR
Sbjct  543   IASTWRMGAARGPWVFLR  560



>ref|XP_008645641.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
Length=550

 Score =   419 bits (1076),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 243/436 (56%), Positives = 307/436 (70%), Gaps = 11/436 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKV--AEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTSFVAEE++ +    SK V      EE V  A   G D +      +G      +E
Sbjct  123   VSVTTSFVAEEDAII----SKAVRGNSSQEEDVEKASHVGFDPETSNLHASGM-----AE  173

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                S   ++  A     + +  K  +PS ++AL++G ILG+LQ VFL + A+ +L +MGV
Sbjct  174   CVNSCIPTECAADPSGRQGRCEKRYVPSVTSALIVGSILGLLQAVFLVLSARFVLNIMGV  233

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K GS M  PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  234   KSGSPMQGPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDAANIILDPI  293

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAAIAHV+SQY++ LILL +L++ V ++PPS K L+  +FL  G  L AR
Sbjct  294   LMFVCHMGVTGAAIAHVVSQYMITLILLCRLVQRVHVIPPSIKSLKFGRFLGCGFLLLAR  353

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLAASLAAR G TVMA FQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  354   VVAVTFCVTLAASLAARHGPTVMAGFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDS  413

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+G+F+ D  VI++I  GIPFVAGTQ IN
Sbjct  414   KKVAAATSRVLQLSIVLGMGLTVVLGLAMRFGAGIFTSDVPVIQVIHRGIPFVAGTQTIN  473

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             SLAFV DG+NFGASD+ YSAYSMV VA+++I         NGF+GIWIAL I+M LRTIA
Sbjct  474   SLAFVFDGINFGASDYRYSAYSMVAVASVSIPCLLYLSAHNGFIGIWIALTIYMSLRTIA  533

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  534   STWRMGAARGPWTFLR  549



>gb|EYU18756.1| hypothetical protein MIMGU_mgv1a007641mg [Erythranthe guttata]
Length=400

 Score =   413 bits (1061),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 244/387 (63%), Positives = 295/387 (76%), Gaps = 3/387 (1%)
 Frame = -2

Query  1312  IPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
             IP S    +S    L + E +S     K  I SAS+AL++G  LG++Q + L   AKPLL
Sbjct  16    IPKSGIHHTSPF--LTSKEMNSG-GVNKRHISSASSALIIGGALGLIQALILICTAKPLL  72

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
               MGV+  S ML PALRYLTLRSLG+PAVLLSLA+QG+FRGLKDTKTPLYAT  GD+ NI
Sbjct  73    SFMGVQSDSPMLKPALRYLTLRSLGAPAVLLSLAMQGVFRGLKDTKTPLYATLVGDVANI  132

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             ILD IFI    +GVSGAAIAHVISQY++ LILL +L++EV LLPP+ K LQLS+FLKNG 
Sbjct  133   ILDPIFIFVFGFGVSGAAIAHVISQYLITLILLVRLMKEVNLLPPTVKELQLSRFLKNGS  192

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L  RVIAATFCVTLAASLA++ GST MAAFQ+CLQ+WL +SLLADGLA+AGQAILA AF
Sbjct  193   LLLFRVIAATFCVTLAASLASKQGSTSMAAFQICLQVWLATSLLADGLAVAGQAILANAF  252

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
             A  DY+K  A A+RVLQ+G ++G  L++VV + L F S +F+KD NV+RL+ +GIPFVA 
Sbjct  253   ARNDYEKVTATASRVLQLGLILGLILSIVVAIILQFSSTLFTKDVNVLRLLQLGIPFVAV  312

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFML  233
             TQPINSLAFV DG+N+GASDF YSAYSMV +A ++I   F+   SNGFVGIW AL+IFM 
Sbjct  313   TQPINSLAFVFDGLNYGASDFAYSAYSMVSIAVLSIVCLFVLSSSNGFVGIWFALSIFMS  372

Query  232   LRTIAGLWRLATGTGPWCFLRASTQPM  152
             LR +AG  R+ T TGPW FLR    P+
Sbjct  373   LRAVAGFLRIGTRTGPWIFLRGGLTPV  399



>ref|XP_009147005.1| PREDICTED: MATE efflux family protein FRD3-like isoform X2 [Brassica 
rapa]
Length=563

 Score =   419 bits (1076),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 257/436 (59%), Positives = 317/436 (73%), Gaps = 3/436 (1%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTSFVAEE++  ++ ++  +   AK      +A +   +     T  N     P   
Sbjct  122   VSVTTSFVAEEDTLEKIKEEEEEANKAKNVHANTLAIQDSLEKGVTSTTSNNK-NQPQQT  180

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                    SD +++  +   K+GK  I SASTA+++G  LG++Q + L   +K L+G+MGV
Sbjct  181   PVDVKLTSDTKSNNGNKANKKGKKTIKSASTAMIIGLTLGLVQAIVLIFSSKVLIGIMGV  240

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             KP S +L+PA +YLT+R+LG+PA+LLSL++QGIFRG KDTKTPLYAT A D +NIILD I
Sbjct  241   KPNSAVLSPAQKYLTIRALGAPALLLSLSMQGIFRGFKDTKTPLYATVASDGLNIILDPI  300

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             FI     GVSGAAIAHVISQY +LLILL +L +EV L+PP    LQ  KF++NG  + AR
Sbjct  301   FIFVLRLGVSGAAIAHVISQYFMLLILLIRLAKEVNLMPPKFGDLQFGKFIRNGGLMLAR  360

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
              IA TFC TLAAS+AARLG+T MAAFQ+CLQ+WLTSS+LADGLA+AGQAILA  FA KDY
Sbjct  361   TIAVTFCQTLAASMAARLGTTPMAAFQICLQVWLTSSMLADGLAVAGQAILACNFAEKDY  420

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
              K  AAA+RV+QM  V+G GL+V VGLGLYFGSGVFSKD  VI LI IGIPFVA TQPIN
Sbjct  421   NKVTAAASRVIQMSLVLGLGLSVFVGLGLYFGSGVFSKDPAVIHLIAIGIPFVAATQPIN  480

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             SL FVLDGVNFGASDF Y+AYSMV VAA++I       K NGFVGIWIAL I+M LR + 
Sbjct  481   SLTFVLDGVNFGASDFAYTAYSMVGVAAVSIAAVIYMAKVNGFVGIWIALTIYMGLRAVT  540

Query  217   GLWRLATGTGPWCFLR  170
             G+ R+ATGTGPW FLR
Sbjct  541   GIGRMATGTGPWKFLR  556



>ref|NP_001049386.2| Os03g0216700 [Oryza sativa Japonica Group]
 gb|ABF94649.1| MATE efflux family protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94651.1| MATE efflux family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95121.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF11300.2| Os03g0216700 [Oryza sativa Japonica Group]
Length=571

 Score =   419 bits (1076),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 241/438 (55%), Positives = 311/438 (71%), Gaps = 20/438 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSEL--C--DDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPS  1304
             V++TTSFVAEE++ +  C  ++ S+++      + +    P    D++E + +    IP+
Sbjct  149   VSVTTSFVAEEDAIISKCIEENSSQDLEKASPVDSETNNLPVSGPDKVECVNS---CIPT  205

Query  1303  SETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
               T  S           D   KR    IPS ++A+++G  LG+LQ VFL   AK +L +M
Sbjct  206   ECTNPS-----------DQGCKRK--YIPSVTSAVIVGSFLGLLQAVFLVFSAKFVLNIM  252

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVK  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD
Sbjct  253   GVKNDSPMLRPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDAANIILD  312

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              I +  CH GV+GAA+AHVISQY++ +ILL +LIR+V+++PPS K L+  +FL  G  L 
Sbjct  313   PILMFVCHMGVTGAAVAHVISQYLITMILLCRLIRQVDVIPPSLKSLKFGRFLGCGFLLL  372

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
             ARV+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  
Sbjct  373   ARVVAVTFCVTLASSLAARHGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKN  432

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             D  K   A +RVLQ+  V+G GL VV+G+G+ FG+G+F+KD +VI +I  GIPFVAGTQ 
Sbjct  433   DKGKVVVATSRVLQLSIVLGMGLTVVLGVGMKFGAGIFTKDIDVIDVIHKGIPFVAGTQT  492

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             INSLAFV DG+NFGASD+ YSAYSMV VAA++I         NGF+GIWIAL I+M LRT
Sbjct  493   INSLAFVFDGINFGASDYTYSAYSMVGVAAISIPCLVYLSAHNGFIGIWIALTIYMSLRT  552

Query  223   IAGLWRLATGTGPWCFLR  170
             IA  WR+    GPW FLR
Sbjct  553   IASTWRMGAARGPWVFLR  570



>emb|CBI24884.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   417 bits (1073),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 253/395 (64%), Positives = 297/395 (75%), Gaps = 16/395 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS--ELCDDGSK-EVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSS  1301
             V+ITTSFVAEE++  +  ++  K E S K   +    +E   +   LE +E GS   P+S
Sbjct  97    VSITTSFVAEEDTVGKKGNEAPKGENSEKASVQNSETKELEDEDVILENLEKGS--NPNS  154

Query  1300  ETKGSSALSDLEA-----------SERDSKVKRGKLRIPSASTALMMGCILGILQTVFLT  1154
             E K      DL+            S    K+K+ +  IPSASTAL++G  LG+ QT+FL 
Sbjct  155   EMKELIPEDDLKTTTYKPPSVSTVSPNRVKLKKERRHIPSASTALVIGSFLGLFQTIFLI  214

Query  1153  VLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATA  974
               AKPLL  MGVK GS+ML PA RYLTLR+LG+PAVLLSLA+QG+FRG KDTKTPLYAT 
Sbjct  215   FAAKPLLSFMGVKSGSSMLTPARRYLTLRALGAPAVLLSLAMQGVFRGFKDTKTPLYATV  274

Query  973   AGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLS  794
              GDL NIILD IFI  C  GVSGAAIAHVISQY++ LILL +L++EV+LLPPS K LQ  
Sbjct  275   VGDLTNIILDPIFIFVCKLGVSGAAIAHVISQYLISLILLLRLMKEVDLLPPSLKDLQFR  334

Query  793   KFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQ  614
             +FLKNG+ L  RVIAATFCVTLAASLAARLGST MAAFQ+CLQ+W+TSSLLADGLA+AGQ
Sbjct  335   RFLKNGVLLLGRVIAATFCVTLAASLAARLGSTPMAAFQICLQVWMTSSLLADGLAVAGQ  394

Query  613   AILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITI  434
             AILA AFA  DY KA  AA RVLQMGF++G GLA++VGLGL FG+ VFSKD NV+ LI+I
Sbjct  395   AILACAFAENDYAKATNAATRVLQMGFILGLGLALLVGLGLQFGAKVFSKDVNVLHLISI  454

Query  433   GIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSM  329
             G+PFVA TQPINSLAFV DGVNFGASDF YSAYSM
Sbjct  455   GVPFVAATQPINSLAFVFDGVNFGASDFAYSAYSM  489



>ref|XP_010500705.1| PREDICTED: MATE efflux family protein 1-like [Camelina sativa]
 ref|XP_010500706.1| PREDICTED: MATE efflux family protein 1-like [Camelina sativa]
Length=516

 Score =   416 bits (1070),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 257/440 (58%), Positives = 316/440 (72%), Gaps = 19/440 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++  C      V      + K   E G +++   T E     IP +   
Sbjct  91    VSITTSFVAEEDA--CSSQQNTVQ-----DHKECIETGTNNN---TTEETQELIPENSKD  140

Query  1291  GSS----ALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
              SS    A+S + +  +    KR    IPSAS+AL++G  LG+ Q VFL   AKPLL  M
Sbjct  141   SSSDESKAVSSIFSVSKPPTKKR---NIPSASSALIIGGFLGLFQAVFLISAAKPLLSFM  197

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVK  S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPL+AT  GD+ NIILD
Sbjct  198   GVKHDSPMLRPAQRYLSLRSLGAPAVLLSLAAQGVFRGFKDTTTPLFATVIGDVTNIILD  257

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              IFI     GV+GAA AHVISQY++  ILL+KL+ +V++L  S+KHLQ  +F+KNG  L 
Sbjct  258   PIFIFVFRLGVTGAATAHVISQYLMCGILLWKLMGQVDILNMSTKHLQFCRFMKNGFLLL  317

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
              RVIA TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA K
Sbjct  318   MRVIAVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGFAVAGQAILASAFAKK  377

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             DYK+A A A+RVLQ+G V+G  LAV++G GL+FG+ VF+KD  V  LI+IG+PFVAGTQP
Sbjct  378   DYKRAAATASRVLQLGLVLGFLLAVILGAGLHFGARVFTKDDKVSHLISIGLPFVAGTQP  437

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKS-NGFVGIWIALAIFMLLR  227
             IN+LAFV DGVNFGASDF Y+A S+VMVA ++I    LFL S +GF+G+W  L I+M LR
Sbjct  438   INALAFVFDGVNFGASDFGYAAASLVMVAIVSI-LCLLFLSSTHGFIGLWFGLTIYMSLR  496

Query  226   TIAGLWRLATGTGPWCFLRA  167
                GLWR+ TGTGPW FLR+
Sbjct  497   AAVGLWRIGTGTGPWSFLRS  516



>emb|CBI29870.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   416 bits (1069),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 251/435 (58%), Positives = 318/435 (73%), Gaps = 19/435 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE     D   +  +  +     +  E  +    +++M N     PS    
Sbjct  92    VSITTSFVAEE-----DTVGRRTNENLEKGLAIDNEMEELIPHIDSMHNS----PSRTVN  142

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              +          ++ + +  +  IPSAS+AL++G +LG++Q +FL   AK +L  MGV  
Sbjct  143   NT----------KNMEFEHERRHIPSASSALVIGGVLGLIQALFLIFSAKSILNFMGVNS  192

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
             GS ML PA++YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD+ NIILD I +
Sbjct  193   GSPMLAPAMQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATILGDVANIILDPILM  252

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GVSGAAIAHVISQY++ +ILL++L+R+V+LLPPS K LQL +FL+NG  L  RVI
Sbjct  253   FVFRLGVSGAAIAHVISQYLISVILLWRLMRKVDLLPPSIKDLQLGRFLRNGSLLLVRVI  312

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTLAASLAARLGST MAAFQVCLQIWL +SLLADGLA+AGQAILA+AFA KDY K
Sbjct  313   AVTFCVTLAASLAARLGSTSMAAFQVCLQIWLATSLLADGLAVAGQAILASAFAKKDYDK  372

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+RVLQ+G V+G  L+V + + L + S VF+KD NV++L+ +GIPFVA TQPIN+L
Sbjct  373   ATATASRVLQLGLVLGLVLSVFLLVVLQYASRVFTKDVNVLQLMNLGIPFVAVTQPINAL  432

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVNFGASDF YSA SMV+VA ++I   F+   S GF+GIWIAL+I+M LRT++G 
Sbjct  433   AFVFDGVNFGASDFAYSACSMVLVAIVSILCLFILSSSLGFIGIWIALSIYMSLRTMSGF  492

Query  211   WRLATGTGPWCFLRA  167
             WR+ TG+GPW FLRA
Sbjct  493   WRIWTGSGPWSFLRA  507



>ref|XP_010908479.1| PREDICTED: MATE efflux family protein 1-like isoform X2 [Elaeis 
guineensis]
Length=464

 Score =   414 bits (1065),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 231/360 (64%), Positives = 291/360 (81%), Gaps = 0/360 (0%)
 Frame = -2

Query  1246  KVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLR  1067
             K++  +  +PS S+AL++G +LG+LQ + L + A P+L  MGVKP S ML PA +YLTLR
Sbjct  104   KLESERKHMPSVSSALVIGGVLGLLQALILVLGAIPILNFMGVKPDSPMLTPACQYLTLR  163

Query  1066  SLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHV  887
             SLG+PAVLLSLA+QG++RG KDT+TPLYAT AGD  NIILD IF+     GVSGAAIAHV
Sbjct  164   SLGAPAVLLSLAMQGVYRGFKDTRTPLYATVAGDATNIILDPIFMFVFQLGVSGAAIAHV  223

Query  886   ISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAAR  707
             ISQY++ LILL++L+R+V++LPPS K LQ S+FLKNG  L ARVIA TFCVTL+AS+AAR
Sbjct  224   ISQYLISLILLWRLLRKVDVLPPSFKDLQFSRFLKNGSLLLARVIAVTFCVTLSASMAAR  283

Query  706   LGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVM  527
              GS  MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA +D+ KA+AAA+RVLQ G ++
Sbjct  284   QGSIPMAAFQICLQIWLATSLLADGLAVAGQAILASAFARRDHSKARAAASRVLQWGMIL  343

Query  526   GHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFF  347
             G  L  ++G+GL F S +F+KD NV++L+ IGIPFVA TQPIN+LAFV DG+NFGASDF 
Sbjct  344   GLVLCAILGIGLQFASRLFTKDANVLQLMHIGIPFVALTQPINALAFVFDGINFGASDFA  403

Query  346   YSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRA  167
             YSAYSMV+VA ++I    +   S+GFVGIW+ALAI+M LRT+AG WR+ T  GPW FLR+
Sbjct  404   YSAYSMVLVAIVSILCLVVLSSSHGFVGIWVALAIYMSLRTVAGFWRIGTARGPWTFLRS  463



>gb|AFW19998.1| aluminum-activated citrate transporter [Brassica napus]
Length=519

 Score =   416 bits (1069),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 253/441 (57%), Positives = 313/441 (71%), Gaps = 24/441 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPS----  1304
             V+ITTSFVAEE++  C      V      + K   E G ++ + ET E     IP     
Sbjct  95    VSITTSFVAEEDA--CSSQENTVQ-----DHKECIETGINNTKEETQE----LIPEINKD  143

Query  1303  ---SETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
                 E+K SS++     S   S VK  K  IPSAS+AL++G ILG+LQ  FL   A+PLL
Sbjct  144   SLPDESKISSSI----FSVNKSSVK--KRNIPSASSALIIGAILGLLQAAFLISTARPLL  197

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
               MGVK  S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD  NI
Sbjct  198   SFMGVKHDSPMLGPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDATNI  257

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             ILD IFI     GV+GAA AHV+SQY++  ILL+KL+ +V++   S+KHLQ S+F+KNG 
Sbjct  258   ILDPIFIFVFRLGVTGAATAHVLSQYLMCGILLWKLMGQVDIFNLSTKHLQFSRFMKNGF  317

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L  RVIA TFCVTL+ASLAAR GS  MAAFQVCLQ+WL +SLLADG A+AGQAILA+AF
Sbjct  318   LLLMRVIAVTFCVTLSASLAAREGSISMAAFQVCLQVWLATSLLADGFAVAGQAILASAF  377

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
             A KDYK+A A A+RVLQ+G V+G  LA+++G GL+FG+ +F+KD  V+ LI+IG+PFVAG
Sbjct  378   AKKDYKRAAATASRVLQLGLVLGFLLAIILGAGLHFGARLFTKDDKVLHLISIGLPFVAG  437

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFML  233
             TQPIN+LAFV DGVNFGASDF Y+A S+VMVA ++I    L   ++GF+G+W  L I+M 
Sbjct  438   TQPINALAFVFDGVNFGASDFGYAAASLVMVAIVSILCLVLLSSTHGFIGLWFGLTIYMS  497

Query  232   LRTIAGLWRLATGTGPWCFLR  170
             LR   G WR+ T TGPW FLR
Sbjct  498   LRAAVGFWRIGTATGPWSFLR  518



>ref|XP_004985179.1| PREDICTED: MATE efflux family protein 1-like [Setaria italica]
Length=564

 Score =   417 bits (1071),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 240/438 (55%), Positives = 306/438 (70%), Gaps = 20/438 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELC----DDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPS  1304
             V++TTSFVAEE++ +     ++ S ++    + + +    P    D  E +      IP+
Sbjct  142   VSVTTSFVAEEDAIISKAVEENSSHDLEKASHVDSETNNSPVSGPDIAECVNT---CIPT  198

Query  1303  SETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
               T         E S   SK K     IPS ++AL++G ILG+LQ +FL   AK +L +M
Sbjct  199   ECT---------ELSNHGSKKKY----IPSVTSALIVGSILGLLQAIFLVFSAKFVLSIM  245

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVK GS M  PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD
Sbjct  246   GVKSGSPMQGPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILD  305

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              I +  CH GV+GAA+AHV SQY++ LILL +L+++V+++PPS K L+  +FL  G  L 
Sbjct  306   PILMFVCHMGVTGAAVAHVASQYLITLILLCRLVQQVDVIPPSIKSLKFGRFLGCGFLLL  365

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
             ARV+A TFCVTLAASLAAR G T+MA FQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  
Sbjct  366   ARVVAVTFCVTLAASLAARQGPTIMAGFQICCQLWLATSLLADGLAVAGQAVLASAFAKN  425

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             D KK  AA +RVLQ+  V+G  L VV+GL + FG+G+F+KD  VI +I  GIPFVAGTQ 
Sbjct  426   DNKKVVAATSRVLQLSIVLGMCLTVVLGLAMKFGAGIFTKDLPVIEVIHKGIPFVAGTQT  485

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             INSLAFV DG+NFGASD+ YSAYSMV VA+++I         NGF+GIWIAL I+M LRT
Sbjct  486   INSLAFVFDGINFGASDYTYSAYSMVAVASVSIPCLVYLSAHNGFIGIWIALTIYMSLRT  545

Query  223   IAGLWRLATGTGPWCFLR  170
             IA  WR+    GPW FLR
Sbjct  546   IASTWRMGAARGPWTFLR  563



>ref|XP_010278990.1| PREDICTED: MATE efflux family protein 1-like [Nelumbo nucifera]
 ref|XP_010278991.1| PREDICTED: MATE efflux family protein 1-like [Nelumbo nucifera]
 ref|XP_010278992.1| PREDICTED: MATE efflux family protein 1-like [Nelumbo nucifera]
 ref|XP_010278993.1| PREDICTED: MATE efflux family protein 1-like [Nelumbo nucifera]
 ref|XP_010278995.1| PREDICTED: MATE efflux family protein 1-like [Nelumbo nucifera]
 ref|XP_010278996.1| PREDICTED: MATE efflux family protein 1-like [Nelumbo nucifera]
Length=501

 Score =   414 bits (1065),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 256/442 (58%), Positives = 322/442 (73%), Gaps = 25/442 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENS------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTI  1310
             V++TTSFVAEE++      E  ++ + EV   ++SE K    P   SDQ           
Sbjct  78    VSVTTSFVAEEDTVGRVNIEELENENVEVDLSIHSEMK-ELIPRSGSDQ-----------  125

Query  1309  PSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
                      ++  ++ +   SK + GK  IPSAS+AL++G +LG+LQ +FL   +KP+L 
Sbjct  126   -----NVCKSVCKIDDNSNMSKFEHGKRHIPSASSALVIGGVLGLLQAIFLIFGSKPILN  180

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
              MGV   S ML PA +YLTLRS+G+PAVLLSLA+QG+FRG KDTKTPLYAT AGD++NII
Sbjct  181   FMGVNSDSPMLTPARQYLTLRSIGAPAVLLSLAVQGVFRGFKDTKTPLYATVAGDVMNII  240

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD I I   H GVSGAAIAHVISQY++ +ILL++L+ +V++LPP+ K LQ S+FLKNG  
Sbjct  241   LDPILIFVFHLGVSGAAIAHVISQYLISIILLWRLMEQVDILPPNIKDLQFSRFLKNGFL  300

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L ARVIA TFCVTLAAS+AAR GST MAAFQVCLQIWL +SL+ADGLA+AGQAILA+AFA
Sbjct  301   LLARVIAVTFCVTLAASMAARHGSTSMAAFQVCLQIWLATSLVADGLAVAGQAILASAFA  360

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
               DY KA   A+RVLQ+G V+G  L+V++G GL+F S  F+KD NV+ LI IGIPFVA T
Sbjct  361   KHDYDKAIDTASRVLQLGLVLGLVLSVILGSGLHFASRFFTKDVNVLHLINIGIPFVAAT  420

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN-GFVGIWIALAIFML  233
             QPINSLAFV DGVNFGASDF Y+AYSM++VA ++I    +FL S  GF+GIW+AL I+M 
Sbjct  421   QPINSLAFVFDGVNFGASDFAYTAYSMILVAIVSI-LCLIFLSSGYGFIGIWVALTIYMS  479

Query  232   LRTIAGLWRLATGTGPWCFLRA  167
             LR  AG  R+ T TGPW FLR+
Sbjct  480   LRAFAGFGRIGTATGPWRFLRS  501



>ref|XP_004149599.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein FRD3-like 
[Cucumis sativus]
Length=515

 Score =   415 bits (1066),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 246/439 (56%), Positives = 304/439 (69%), Gaps = 16/439 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++     G   +       EK   E G+  + L +++  ++   +S+  
Sbjct  93    VSITTSFVAEEDAV----GKTAIKPVKCDLEKHLTENGQKRE-LTSIKKENMLENNSQPP  147

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
               S       +      K+ K  I SASTAL+ G +LG+LQ VFL   AK LL +MGVK 
Sbjct  148   AVS-------TPTVKPKKKEKKHIGSASTALIFGTVLGLLQAVFLAFGAKYLLNVMGVKE  200

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA++YL LRSLG+PAVLLSLA+QGIFRG KDT+TPLY    G   NIILD I I
Sbjct  201   SSPMLAPAMKYLVLRSLGAPAVLLSLAMQGIFRGFKDTRTPLYVIVLGYTTNIILDPILI  260

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
               CH GV GAAIAHV+SQY+++L+L ++L+++V+LLPPS + LQ  +FLKNG  L ARVI
Sbjct  261   FVCHLGVRGAAIAHVLSQYLIVLVLAWRLMQKVDLLPPSLRDLQFGRFLKNGSLLLARVI  320

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTLAAS+AARLG T MAAFQ CLQ+W+TSSLLADGLA+AGQAILA        KK
Sbjct  321   AVTFCVTLAASMAARLGPTPMAAFQTCLQVWMTSSLLADGLAVAGQAILAC----ALXKK  376

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
                 A RVLQM  VMG GLAV+V   + FG+G+FS+D NV  LI +G+PFVA TQP+NSL
Sbjct  377   KTPPATRVLQMSLVMGVGLAVIVAAIMLFGAGIFSRDLNVQALIHLGVPFVAATQPMNSL  436

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVNFGASDF YSAYS+ +V+  TI   FL  KS GF+GIW ALAI+M LRT+ G 
Sbjct  437   AFVFDGVNFGASDFAYSAYSLTLVSIATIISLFLLSKSYGFIGIWTALAIYMALRTLVGF  496

Query  211   WRLATGTGPWCFLRASTQP  155
              R+ +GTGPW +LR    P
Sbjct  497   LRMGSGTGPWRYLRGPLLP  515



>gb|KDO45406.1| hypothetical protein CISIN_1g010889mg [Citrus sinensis]
Length=370

 Score =   409 bits (1052),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 228/360 (63%), Positives = 280/360 (78%), Gaps = 0/360 (0%)
 Frame = -2

Query  1246  KVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLR  1067
             + +  +  IPSAS+AL++G +LG++Q  F+   AKP+L  MGV   S M+ PA +YLTLR
Sbjct  11    EARHERKHIPSASSALVIGSVLGLIQAFFVIAYAKPILNYMGVNSDSPMIKPAQQYLTLR  70

Query  1066  SLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHV  887
             SLG+PAVLLSLA+QGIFRG KDTKTP YAT  GDL N+ILD IFI   +WGVSGAAIAHV
Sbjct  71    SLGAPAVLLSLALQGIFRGFKDTKTPFYATILGDLANVILDPIFIFLFNWGVSGAAIAHV  130

Query  886   ISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAAR  707
             ISQY++ LILL+KLI EV+LLPPSSK L+  +FLKNG  L  RVIA TFCVTLAASLAAR
Sbjct  131   ISQYLISLILLWKLIEEVDLLPPSSKDLKFGQFLKNGFLLMVRVIAVTFCVTLAASLAAR  190

Query  706   LGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVM  527
              GST MAAFQVCLQIWL +SLLADGLA+A Q ILA+AF  KDY KA   A+ VLQ+  V+
Sbjct  191   QGSTSMAAFQVCLQIWLATSLLADGLAVAAQTILASAFVKKDYDKATTIASHVLQLSVVL  250

Query  526   GHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFF  347
             G  L V + +GL F S +F+KD  V++LI +GIPF+A TQPIN+LAFV DG+NFGASDF 
Sbjct  251   GLVLTVNLLVGLPFSSRLFTKDLKVLQLIGVGIPFIAVTQPINALAFVFDGINFGASDFA  310

Query  346   YSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRA  167
             YSAYSMV VA ++I   F+   S+G+VGIW+AL+++M LR IAG  R+ +G+GPW FL+A
Sbjct  311   YSAYSMVSVAVVSILCLFILSSSHGYVGIWVALSMYMSLRAIAGFLRIGSGSGPWSFLKA  370



>ref|XP_002465638.1| hypothetical protein SORBIDRAFT_01g042740 [Sorghum bicolor]
 gb|EER92636.1| hypothetical protein SORBIDRAFT_01g042740 [Sorghum bicolor]
Length=565

 Score =   416 bits (1070),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 237/436 (54%), Positives = 310/436 (71%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E+  +D ++   +++ +  +P+S   
Sbjct  143   VSVTTSFVAEEDAII--------------SKAIEEKSSQDLEKASHVDSETNNLPASGPD  188

Query  1291  GSSALSDLEASERDSKVKRG--KLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
              +  ++    +E      +G  K  IPS ++AL++G ILG+LQ VFL   AK +L +MGV
Sbjct  189   LAECVNSCIPTECTDLPNQGCKKRYIPSVTSALIVGSILGLLQAVFLVFSAKFVLNIMGV  248

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K GS M  PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  249   KSGSPMQKPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDAANIILDPI  308

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAAIAHV+SQY++ LILL +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  309   LMFVCHMGVTGAAIAHVVSQYLITLILLCRLVQQVDVIPPSIKSLKFGRFLGCGFLLLAR  368

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLAASLAAR G T+MA FQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  369   VVAVTFCVTLAASLAARHGPTIMAGFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDK  428

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+G+F+ D  VI +I  GIPFVAGTQ IN
Sbjct  429   KKVVAATSRVLQLSIVLGMGLTVVLGLAMRFGAGIFTSDLPVIEVIHKGIPFVAGTQTIN  488

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             SLAFV DG+NFGASD+ YSAYSMV VA+++I         NGF+GIWIAL I+M LRTIA
Sbjct  489   SLAFVFDGINFGASDYTYSAYSMVAVASVSIPCLVYLSVHNGFIGIWIALTIYMSLRTIA  548

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  549   STWRMGAARGPWKFLR  564



>ref|XP_006662259.1| PREDICTED: MATE efflux family protein 1-like [Oryza brachyantha]
Length=526

 Score =   415 bits (1067),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 252/438 (58%), Positives = 324/438 (74%), Gaps = 14/438 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ + D+  K       +E     EP     ++E +          ET+
Sbjct  100   VSVTTSFVAEEDA-MSDNIDK-------NEMNGENEPIVSDSEMEEL------FSHEETR  145

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              +S+ S  E        +  +  IPS ST+L++G +LG+LQ + L + AKPLLG MGVKP
Sbjct  146   TASSKSSFETDSSGVNTEHKRKNIPSVSTSLLLGGVLGLLQALLLIICAKPLLGYMGVKP  205

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
             GS ML PAL+YL +RSLG+PAVLLSLA+QG+FRGLKDTKTPLYAT AGD  NI+LD IF+
Sbjct  206   GSAMLMPALKYLVIRSLGAPAVLLSLAMQGVFRGLKDTKTPLYATVAGDATNIVLDPIFM  265

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                H+GVSGAAIAHVISQY++  ILL++L   V LLPPSSKHLQ S+FL+NG  L ARVI
Sbjct  266   FIFHYGVSGAAIAHVISQYLIACILLWRLRLHVNLLPPSSKHLQFSRFLRNGFLLLARVI  325

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             AAT CVTL+AS+AARLGS  MAAFQ+CLQIWL SSLLADGLA AGQAILA+AFA KD+ K
Sbjct  326   AATCCVTLSASMAARLGSVPMAAFQICLQIWLASSLLADGLAFAGQAILASAFARKDHSK  385

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+R+LQ+G V+G  L++++G+GL  GS +F+ D++V+R I +GIPFVA TQPIN+L
Sbjct  386   AAATASRILQLGLVLGLLLSILLGIGLRIGSRLFTDDQDVLRHIYLGIPFVALTQPINTL  445

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DG+N+GASDF Y+AYSM++VA ++I F       +GF+GIWIAL ++M LR +AG 
Sbjct  446   AFVFDGINYGASDFGYAAYSMILVAIVSIVFIITLASYSGFIGIWIALTVYMSLRMLAGF  505

Query  211   WRLATGTGPWCFLRASTQ  158
              R+ T  GPW FLR+ST+
Sbjct  506   LRIGTARGPWAFLRSSTR  523



>emb|CDY03629.1| BnaC03g68880D [Brassica napus]
Length=520

 Score =   414 bits (1065),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 253/441 (57%), Positives = 312/441 (71%), Gaps = 24/441 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPS----  1304
             V+ITTSFVAEE++  C      V      + K   E G ++ + ET E     IP     
Sbjct  96    VSITTSFVAEEDA--CSSQENTVQ-----DHKECIETGINNTKEETQE----LIPEINKD  144

Query  1303  ---SETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
                 E+K SS++     S   S VK  K  IPSAS+AL++G ILG+LQ  FL   A+PLL
Sbjct  145   SLPDESKISSSI----FSVNKSSVK--KRNIPSASSALIIGAILGLLQAAFLISTARPLL  198

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
               MGVK  S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD  NI
Sbjct  199   SFMGVKHDSPMLGPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDATNI  258

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             ILD IFI     GV+GAA AHV+SQY++  ILL+KL+ +V++   S+KHLQ S+F+KNG 
Sbjct  259   ILDPIFIFVFRLGVTGAATAHVLSQYLMCGILLWKLMGQVDIFNLSTKHLQFSRFMKNGF  318

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L  RVIA TFCVTL+ASLAAR GS  MAAFQVCLQ+WL +SLLADG A+AGQAILA+AF
Sbjct  319   LLLMRVIAVTFCVTLSASLAAREGSISMAAFQVCLQVWLATSLLADGFAVAGQAILASAF  378

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
             A KDYK+A A A+RVLQ+G V+G  LA+++G GL+FG+ +F+KD  V+ LI IG+PFVAG
Sbjct  379   AKKDYKRAAATASRVLQLGLVLGFLLAIILGAGLHFGARLFTKDDKVLHLIGIGLPFVAG  438

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFML  233
             TQPIN+LAFV DGVNFGASDF Y+A S+VMVA ++I    L   ++GF+G+W  L I+M 
Sbjct  439   TQPINALAFVFDGVNFGASDFGYAAASLVMVAIVSILCLVLLSSTHGFIGLWFGLTIYMS  498

Query  232   LRTIAGLWRLATGTGPWCFLR  170
             LR   G WR+ T TGPW FLR
Sbjct  499   LRAAVGFWRIGTATGPWSFLR  519



>gb|ACJ85750.1| unknown [Medicago truncatula]
Length=507

 Score =   414 bits (1063),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 247/443 (56%), Positives = 305/443 (69%), Gaps = 36/443 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSL---TIPSS  1301
             V++TTSFVAEE++    D S +V                        ENG L   T P +
Sbjct  93    VSVTTSFVAEEDA--LSDASSQVE-----------------------ENGCLEAATPPDA  127

Query  1300  ETK-----GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPL  1136
             ETK      +S +      + D   +R   +IPSAS+AL  G +LG++Q   L   AKPL
Sbjct  128   ETKEFLPQKNSVVESFNVVKDDQHKRR---QIPSASSALYFGGVLGLVQATILISAAKPL  184

Query  1135  LGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVN  956
             L  MGV   S ML+ A +YL LRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGDL N
Sbjct  185   LNFMGVTSDSPMLHHAQQYLKLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDLTN  244

Query  955   IILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNG  776
             I LD +FI     GV+GAAIAHVISQY+L  I L+ L ++V+L+PPS KH+Q  +F KNG
Sbjct  245   IALDPLFIFVFRMGVNGAAIAHVISQYLLSAIHLWSLNKQVDLIPPSIKHMQFDRFAKNG  304

Query  775   LWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATa  596
               LF RVIA TFCVTL+ASLAA  GST MAAFQVCLQ+WL  SLLADGLA+AGQAILA A
Sbjct  305   FLLFMRVIAVTFCVTLSASLAAHHGSTSMAAFQVCLQVWLAVSLLADGLAVAGQAILAGA  364

Query  595   favkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVA  416
             FA KDY+KA   A RVLQMG V+G  LA ++G GL+FG+ +F+KD +V+ LI +G+PFVA
Sbjct  365   FANKDYEKASTTATRVLQMGMVLGLALAFILGTGLHFGAKLFTKDIDVLHLIRVGVPFVA  424

Query  415   GTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFM  236
              TQP+N LAFV DGVNFGASDF YSA+SMV+VA ++I    +   + GF+GIW+AL I+M
Sbjct  425   LTQPLNCLAFVFDGVNFGASDFAYSAFSMVIVAIISIICLLILSSAGGFIGIWVALTIYM  484

Query  235   LLRTIAGLWRLATGTGPWCFLRA  167
              LR  AG  R+ TG+GPW FLR+
Sbjct  485   SLRAFAGFLRIGTGSGPWEFLRS  507



>gb|KHN37617.1| MATE efflux family protein FRD3 [Glycine soja]
Length=522

 Score =   414 bits (1065),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 251/446 (56%), Positives = 307/446 (69%), Gaps = 22/446 (5%)
 Frame = -2

Query  1471  VNITTSFVAEE------NSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTI  1310
             V+ITTSFVAEE      N++  ++G+        S+ K  E    +   L+ ME G+ TI
Sbjct  92    VSITTSFVAEEDTIQKLNTKAAENGN--------SKAKFGETIVPEDHMLQDMEKGANTI  143

Query  1309  PSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLG  1130
                 +  SS  S  +  ++          I SASTAL+ G ILG++Q   L    KPLLG
Sbjct  144   CKFSSVTSSKKSKDKVGKKKR-------LIASASTALLFGTILGLIQAAVLIFATKPLLG  196

Query  1129  LMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNII  950
             +MGVK  S ML PA  YL LRS G+PAVLLSLA+QGIFRG KDT TPLY   +G  +N+I
Sbjct  197   VMGVKRDSPMLKPAESYLRLRSFGAPAVLLSLAMQGIFRGFKDTTTPLYVIVSGYALNVI  256

Query  949   LDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLW  770
             LD IFI     G+ GAAIAHV+SQY++   LL  L+++V LLPP  K LQ+ +FLKNG  
Sbjct  257   LDPIFIFTLKLGIKGAAIAHVLSQYMMAFTLLLILMKKVHLLPPRIKDLQIFRFLKNGGL  316

Query  769   LFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafa  590
             L  +VIA TFCVTLA SLAARLGS  MAAFQ CLQ+W+TSSLLADGLA+A QAILA +F 
Sbjct  317   LMLKVIAVTFCVTLATSLAARLGSIPMAAFQTCLQVWMTSSLLADGLAVAVQAILACSFT  376

Query  589   vkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
              KDYKKA AAA R LQM FV+G GL++ V LGLYFG+GVFSKD +V+ LI IGIPFVA T
Sbjct  377   EKDYKKATAAATRTLQMSFVLGVGLSLAVALGLYFGAGVFSKDAHVVHLIKIGIPFVAAT  436

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAA-MTIGFEFLFLKSNGFVGIWIALAIFML  233
             QPINSLAFV DGVN+GASDF YSAYS+    A  ++  EF+  ++  FVGIWIAL I+M 
Sbjct  437   QPINSLAFVFDGVNYGASDFAYSAYSLASSHAFFSVATEFILYRTKHFVGIWIALTIYMT  496

Query  232   LRTIAGLWRLATGTGPWCFLRASTQP  155
             LR +AG+WR+ TGTGPW +LR  + P
Sbjct  497   LRMLAGIWRMGTGTGPWLYLRGRSLP  522



>ref|XP_003597421.1| Multidrug export protein mepA [Medicago truncatula]
 gb|AES67672.1| aluminum-activated citrate transporter [Medicago truncatula]
Length=507

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 248/443 (56%), Positives = 306/443 (69%), Gaps = 36/443 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSL---TIPSS  1301
             V++TTSFVAEE++    D S +V                        ENG L   T P +
Sbjct  93    VSVTTSFVAEEDA--LSDASSQVE-----------------------ENGCLEAATPPDA  127

Query  1300  ETK-----GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPL  1136
             ETK      +S +      + D   +R   +IPSAS+AL  G +LG++Q   L   AKPL
Sbjct  128   ETKEFLPQKNSVVESFNVVKDDQHKRR---QIPSASSALYFGGVLGLVQATILISAAKPL  184

Query  1135  LGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVN  956
             L  MGV   S ML+ A +YL LRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGDL N
Sbjct  185   LNFMGVTSDSPMLHHAQQYLKLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDLTN  244

Query  955   IILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNG  776
             I LD +FI     GV+GAAIAHVISQY+L  ILL+ L ++V+L+PPS KH+Q  +F KNG
Sbjct  245   IALDPLFIFVFRMGVNGAAIAHVISQYLLSAILLWSLNKQVDLIPPSIKHMQFDRFAKNG  304

Query  775   LWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATa  596
               LF RVIA TFCVTL+ASLAA  GST MAAFQVCLQ+WL  SLLADGLA+AGQAILA A
Sbjct  305   FLLFMRVIAVTFCVTLSASLAAHHGSTSMAAFQVCLQVWLAVSLLADGLAVAGQAILAGA  364

Query  595   favkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVA  416
             FA KDY+KA   A RVLQMG V+G  LA ++G GL+FG+ +F+KD +V+ LI +G+PFVA
Sbjct  365   FANKDYEKASTTATRVLQMGMVLGLALAFILGTGLHFGAKLFTKDIDVLHLIRVGVPFVA  424

Query  415   GTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFM  236
              TQP+N LAFV DGVNFGASDF YSA+SMV+VA ++I    +   + GF+GIW+AL I+M
Sbjct  425   LTQPLNCLAFVFDGVNFGASDFAYSAFSMVIVAIISIICLLILSSAGGFIGIWVALTIYM  484

Query  235   LLRTIAGLWRLATGTGPWCFLRA  167
              LR  AG  R+ TG+GPW FLR+
Sbjct  485   SLRAFAGFLRIGTGSGPWEFLRS  507



>ref|XP_008363703.1| PREDICTED: MATE efflux family protein 1, partial [Malus domestica]
Length=439

 Score =   410 bits (1055),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 256/426 (60%), Positives = 307/426 (72%), Gaps = 22/426 (5%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLET----MENGSLTIPS  1304
             V++TTSFVAEE      D    VS +            KDSD LET     +     IP 
Sbjct  28    VSVTTSFVAEE------DTIGTVSPE-----------AKDSDYLETGSSINDEMKQLIPE  70

Query  1303  SE-TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             S+ T+ +     +  S         K  IPSAS+A+++G ILG++Q +FL   AKPLL  
Sbjct  71    SDATQNAYNSKSVATSFEIVTTDHQKRYIPSASSAMVIGSILGLIQAIFLISGAKPLLNF  130

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGV   S ML PA +YL LRSLG+PAVLLSLA+QGIFRG KDTKTPLYAT AGD+ NIIL
Sbjct  131   MGVGSDSPMLKPAQQYLMLRSLGAPAVLLSLAMQGIFRGXKDTKTPLYATVAGDVTNIIL  190

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI   H GV+GAAIAHVISQY++  ILL++L+ +V LLPPS KHLQ S+FLKNG  L
Sbjct  191   DPIFIFVFHLGVTGAAIAHVISQYLICFILLWRLMAQVNLLPPSIKHLQFSRFLKNGFLL  250

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
               RVIA TFCVTLAASLAAR G T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA 
Sbjct  251   LMRVIAVTFCVTLAASLAARQGXTPMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAK  310

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY KA A A+RVLQ+G V+G  LA ++G+GL +G+ +F+KD NV+ LI IGIPFVA TQ
Sbjct  311   KDYDKAXATASRVLQLGLVLGLMLAAILGVGLQYGARLFTKDXNVLHLIGIGIPFVAATQ  370

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PIN+LAFV DGVNFGASDF YSA+SMVMVA ++I   F+   +NGF+GIW+AL I+M LR
Sbjct  371   PINALAFVFDGVNFGASDFVYSAFSMVMVAIVSILVLFVLSYTNGFIGIWVALTIYMSLR  430

Query  226   TIAGLW  209
             T AG W
Sbjct  431   TFAGFW  436



>dbj|BAD87624.1| MATE efflux family protein-like [Oryza sativa Japonica Group]
Length=559

 Score =   414 bits (1065),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 244/452 (54%), Positives = 306/452 (68%), Gaps = 29/452 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCD---------------DGSKEVSAKVYSEEKVAEEPGKDSDQLE  1337
             V++TTSFVAEE++ L                  G    +A V   EK  +  G DS +  
Sbjct  118   VSVTTSFVAEEDAILSKGAAGADDDNDDGHDAKGHGASAAAVADPEK-QQVVGVDSAETN  176

Query  1336  TMENGSLTIPSSETKGSSALSDLEASERDSKVKRGKLR---IPSASTALMMGCILGILQT  1166
               E  +  + +++ K ++A          + V  GK R   +PS ++AL++G  LG+LQ 
Sbjct  177   GAEVSTAAVRTTDDKKAAA----------AGVGVGKCRRRFVPSVTSALIVGAFLGLLQA  226

Query  1165  VFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPL  986
             VFL    KPLL +MGVKPGS M+ PALRYL +RSLG+PAVLLSLA+QG+FRG KDTKTPL
Sbjct  227   VFLVAAGKPLLRIMGVKPGSPMMIPALRYLVVRSLGAPAVLLSLAMQGVFRGFKDTKTPL  286

Query  985   YATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKH  806
             YAT  GDL NI LD I I  C +GV GAAIAHVISQY++ LI+L KL+R+V+++P S K 
Sbjct  287   YATVTGDLANIALDPILIFTCRFGVVGAAIAHVISQYLITLIMLCKLVRKVDVIPSSLKS  346

Query  805   LQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLA  626
             L+  +FL  G  L ARV+A TFCVTLAASLAAR G+T MAAFQ+C Q+WL SSLLADGLA
Sbjct  347   LKFRRFLGCGFLLLARVVAVTFCVTLAASLAARHGATAMAAFQICAQVWLASSLLADGLA  406

Query  625   IAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIR  446
             +AGQA+LA+AFA KD+ K     ARVLQ+  V+G GL   +  G++FG+GVF+ D  VI 
Sbjct  407   VAGQALLASAFAKKDHYKVAVTTARVLQLAVVLGVGLTAFLAAGMWFGAGVFTSDAAVIS  466

Query  445   LITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFV  266
              I  G+PFVAGTQ IN+LAFV DGVNFGASD+ ++AYSMV VAA+TI    L     GFV
Sbjct  467   TIHRGVPFVAGTQTINTLAFVFDGVNFGASDYAFAAYSMVGVAAVTIPCLVLLSSHGGFV  526

Query  265   GIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             GIWIALAI+M +R  A  WR+    GPW FLR
Sbjct  527   GIWIALAIYMSVRAFASTWRMGAARGPWKFLR  558



>dbj|BAL41687.1| citrate efflux MATE transporter [Oryza sativa Japonica Group]
Length=599

 Score =   416 bits (1068),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 244/452 (54%), Positives = 306/452 (68%), Gaps = 29/452 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCD---------------DGSKEVSAKVYSEEKVAEEPGKDSDQLE  1337
             V++TTSFVAEE++ L                  G    +A V   EK  +  G DS +  
Sbjct  158   VSVTTSFVAEEDAILSKGAAGADDDNDDGHDAKGHGASAAAVADPEK-QQVVGVDSAETN  216

Query  1336  TMENGSLTIPSSETKGSSALSDLEASERDSKVKRGKLR---IPSASTALMMGCILGILQT  1166
               E  +  + +++ K ++A          + V  GK R   +PS ++AL++G  LG+LQ 
Sbjct  217   GAEVSTAAVRTTDDKKAAA----------AGVGVGKCRRRFVPSVTSALIVGAFLGLLQA  266

Query  1165  VFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPL  986
             VFL    KPLL +MGVKPGS M+ PALRYL +RSLG+PAVLLSLA+QG+FRG KDTKTPL
Sbjct  267   VFLVAAGKPLLRIMGVKPGSPMMIPALRYLVVRSLGAPAVLLSLAMQGVFRGFKDTKTPL  326

Query  985   YATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKH  806
             YAT  GDL NI LD I I  C +GV GAAIAHVISQY++ LI+L KL+R+V+++P S K 
Sbjct  327   YATVTGDLANIALDPILIFTCRFGVVGAAIAHVISQYLITLIMLCKLVRKVDVIPSSLKS  386

Query  805   LQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLA  626
             L+  +FL  G  L ARV+A TFCVTLAASLAAR G+T MAAFQ+C Q+WL SSLLADGLA
Sbjct  387   LKFRRFLGCGFLLLARVVAVTFCVTLAASLAARHGATAMAAFQICAQVWLASSLLADGLA  446

Query  625   IAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIR  446
             +AGQA+LA+AFA KD+ K     ARVLQ+  V+G GL   +  G++FG+GVF+ D  VI 
Sbjct  447   VAGQALLASAFAKKDHYKVAVTTARVLQLAVVLGVGLTAFLAAGMWFGAGVFTSDAAVIS  506

Query  445   LITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFV  266
              I  G+PFVAGTQ IN+LAFV DGVNFGASD+ ++AYSMV VAA+TI    L     GFV
Sbjct  507   TIHRGVPFVAGTQTINTLAFVFDGVNFGASDYAFAAYSMVGVAAVTIPCLVLLSSHGGFV  566

Query  265   GIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             GIWIALAI+M +R  A  WR+    GPW FLR
Sbjct  567   GIWIALAIYMSVRAFASTWRMGAARGPWKFLR  598



>ref|XP_007145626.1| hypothetical protein PHAVU_007G254800g [Phaseolus vulgaris]
 gb|ESW17620.1| hypothetical protein PHAVU_007G254800g [Phaseolus vulgaris]
Length=532

 Score =   413 bits (1062),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 229/453 (51%), Positives = 316/453 (70%), Gaps = 16/453 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS-ELCDDGSKEV---------SAKVYSEEKVAEEPGKDSDQLE-----  1337
             V++TTS VAEE++ E      KE+         S KV    + AE+ G    + E     
Sbjct  78    VSVTTSLVAEEDAAEQNHQSEKEILLEESVVNRSVKVDIHHQ-AEKAGNHQSEKEILLEE  136

Query  1336  TMENGSLTIPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFL  1157
             ++ N S+ +   +    +  +  +  ++ + + RGK  IPSAS+ +++G +LG+LQT+FL
Sbjct  137   SVVNESVKVDVQDQAEKAGNTFSKNVDKKATLDRGKAYIPSASSGIVIGGVLGVLQTLFL  196

Query  1156  TVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYAT  977
                AKP+L  MGV   S M  PA +YLTLRS G+PAV++S+AIQG+FRG+KDTKTPLYAT
Sbjct  197   IFAAKPMLNYMGVDSNSPMFKPAQQYLTLRSFGAPAVIISMAIQGVFRGIKDTKTPLYAT  256

Query  976   AAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQL  797
               GD  NI+LD + +     GV+GAAIAH+ SQY++ ++LL  L+++V LLPP+ K  Q 
Sbjct  257   VMGDATNILLDPLLMFVVRLGVNGAAIAHIFSQYLIAIMLLRSLMKQVVLLPPTMKDFQF  316

Query  796   SKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAG  617
             +K LKNG  L  +V A TFCVTL+ASLAAR GST MAAFQ+CLQIW+ +SLLADGLA+AG
Sbjct  317   AKILKNGFLLLVKVAAVTFCVTLSASLAARKGSTTMAAFQICLQIWMATSLLADGLAVAG  376

Query  616   QAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLIT  437
             QAI+A+ FA +DYKK   +A+RVLQ+G ++G  L+V++   L FGS +F+ D NV++LI+
Sbjct  377   QAIIASEFAKRDYKKVIESASRVLQLGLILGLVLSVLLLSLLPFGSKLFTNDSNVLQLIS  436

Query  436   IGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIW  257
             IGIP+VA TQPIN+LAFV DG+N+GASDF YSAYSM++VA ++I   ++   S GF GIW
Sbjct  437   IGIPYVAATQPINALAFVFDGINYGASDFTYSAYSMILVALVSICSLYVLSSSFGFTGIW  496

Query  256   IALAIFMLLRTIAGLWRLATGTGPWCFLRASTQ  158
             IAL+I+M LR  AG WR+ T +GPW FL  ++ 
Sbjct  497   IALSIYMSLRIFAGFWRIGTASGPWSFLTENSN  529



>gb|ABS89149.1| MATE [Sorghum bicolor]
Length=600

 Score =   416 bits (1068),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 311/445 (70%), Gaps = 17/445 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVS---------AKVYSEEKVAEEPGKDSDQLETMENGS  1319
             V++TTSFVAEE++ L   G+K +          A     EK     G D ++ +   +  
Sbjct  161   VSVTTSFVAEEDAVLSKGGAKVIDNGEEEEELEAGQVGPEKHTAAAGADPEKQQQPAD--  218

Query  1318  LTIPSSETKGSSALSDLEASERDSKVKRGKLR-IPSASTALMMGCILGILQTVFLTVLAK  1142
                  +   G    +    + R S  K G  R +PS ++AL++G +LG+ QTVFL    K
Sbjct  219   ---EEAAKNGGEGCAPAVVAGRSSGKKSGNRRFVPSVTSALIVGALLGLFQTVFLVAAGK  275

Query  1141  PLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDL  962
             PLL LMGVKPGS M+ PALRYLTLR+LG+PAVLLSLA+QG+FRG KD KTPLYA  AGD 
Sbjct  276   PLLRLMGVKPGSPMVMPALRYLTLRALGAPAVLLSLAMQGVFRGFKDAKTPLYAIVAGDA  335

Query  961   VNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLK  782
              NI+LD I I  C  GV GAAIAHV+SQY++ LI+L KL+R+V+++PPS K L+  +FL 
Sbjct  336   ANIVLDPILIFGCRLGVIGAAIAHVLSQYLITLIMLSKLVRKVDVVPPSLKCLKFRRFLG  395

Query  781   NGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILA  602
              G  L ARV+A TFCVTLAASLAAR G T MAAFQ+C Q+WL +SLLADGLA+AGQA++A
Sbjct  396   CGFLLLARVVAVTFCVTLAASLAARHGPTAMAAFQICTQVWLATSLLADGLAVAGQAMIA  455

Query  601   TafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPF  422
             +AFA +D  K  A AARVLQ+G V+G  L  ++GLGL FG+GVF+ D  VI+ I  G+PF
Sbjct  456   SAFAKEDRYKVAATAARVLQLGVVLGAALTALLGLGLQFGAGVFTSDAAVIKTIRKGVPF  515

Query  421   VAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN-GFVGIWIALA  245
             VAGTQ +N+LAFV DG+NFGASD+ +SAYSM+ VAA++I    +FL S+ GFVGIW+AL 
Sbjct  516   VAGTQTLNTLAFVFDGINFGASDYAFSAYSMIGVAAVSIP-SLIFLSSHGGFVGIWVALT  574

Query  244   IFMLLRTIAGLWRLATGTGPWCFLR  170
             I+M +R +A  WR+A   GPW FLR
Sbjct  575   IYMGVRALASTWRMAAAQGPWKFLR  599



>ref|XP_009777232.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777233.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=543

 Score =   413 bits (1062),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 258/466 (55%), Positives = 322/466 (69%), Gaps = 44/466 (9%)
 Frame = -2

Query  1471  VNITTSFVAEENS------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTI  1310
             V++TTS VAEE++      E  D  S+++ ++        E  G D++     EN  L I
Sbjct  91    VSVTTSMVAEEDTITKVSPEPRDTESQDLQSQ--------EAEGLDTEFQSNSENKEL-I  141

Query  1309  PSSET--KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPL  1136
             P S +  K     +  E  +R    K  K  IPSAS+AL++G ILG++Q VFL   AKP+
Sbjct  142   PQSRSMYKFEMIATTFEVLKR----KPEKRHIPSASSALIIGAILGLIQAVFLISGAKPI  197

Query  1135  LGLMGVK-----------------------PGSTMLNPALRYLTLRSLGSPAVLLSLAIQ  1025
             L  MGVK                        GS +L PA  YL LRSLG+PAVLLSLA+Q
Sbjct  198   LNFMGVKSGSYSWPVFTASNQDTNLNDSIFKGSPVLKPAQEYLKLRSLGAPAVLLSLAMQ  257

Query  1024  GIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfkl  845
             G+FRG KDT+TPL+A  AGDL NIILD IFI   H G+ GAAIAHVISQY++ +IL ++L
Sbjct  258   GVFRGFKDTQTPLFAAVAGDLTNIILDPIFIFVFHMGIRGAAIAHVISQYLISVILFWRL  317

Query  844   IREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQ  665
             + +V+LLPPS K+LQ ++FL NG  L  RVIA TFCVTLAASLAARLG T MAAFQVCLQ
Sbjct  318   MEQVDLLPPSLKYLQFARFLTNGFLLLMRVIAVTFCVTLAASLAARLGPTEMAAFQVCLQ  377

Query  664   IWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYF  485
             +WL +SLLADGLA+AGQAILA+AFA KD+ +A A A+RVLQ+G V+G  LA+++G+GL+F
Sbjct  378   VWLATSLLADGLAVAGQAILASAFAQKDFGRATATASRVLQLGLVLGLVLALILGVGLHF  437

Query  484   GSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTI  305
             G+ +F+ D NVI LI IGIPFVA TQPIN+LAFV DGVNFGASDF YSAYSMV VA  +I
Sbjct  438   GARLFTNDINVIHLIGIGIPFVATTQPINALAFVFDGVNFGASDFAYSAYSMVAVAIFSI  497

Query  304   GFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLRA  167
              F F+   S  FVGIW+AL ++M LR  AG WR+ TGTGPW FL++
Sbjct  498   VFLFVLSSSYKFVGIWVALTVYMSLRAFAGFWRIGTGTGPWKFLKS  543



>ref|XP_002322704.2| hypothetical protein POPTR_0016s05400g [Populus trichocarpa]
 gb|EEF04465.2| hypothetical protein POPTR_0016s05400g [Populus trichocarpa]
Length=511

 Score =   412 bits (1059),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 249/435 (57%), Positives = 311/435 (71%), Gaps = 17/435 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++           AK+     V +E          ME     +P +E+ 
Sbjct  94    VSITTSFVAEEDATGGLTTEDHEDAKLQGGFAVNKE----------MEE---LLPQAEST  140

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
               S+      ++R+ +    +  IPSAS+AL++GC+LGI+QT+FLT  AKP+L  MGV  
Sbjct  141   YKSSSVSSNYTKREYE----RRHIPSASSALLVGCVLGIIQTLFLTFSAKPILSYMGVNS  196

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA RYL LRSLG+PAVLLSLA+QG+FRG+KDTKTPLYAT  GD  NI+LD IFI
Sbjct  197   DSPMLIPAERYLILRSLGAPAVLLSLAMQGVFRGIKDTKTPLYATVIGDAANIVLDPIFI  256

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                   VSGAAIAHVISQY++ +ILL+KLI+ V+LL PS + LQ+ +FLK G  L  RVI
Sbjct  257   FVFRMDVSGAAIAHVISQYLISIILLWKLIKHVDLLSPSMEDLQIGRFLKTGCLLLVRVI  316

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             AAT CVTLAASLA R GST MAAFQV LQIWL +SLLADGLA+AGQAILA+AFA KDY K
Sbjct  317   AATACVTLAASLATRHGSTSMAAFQVSLQIWLATSLLADGLAVAGQAILASAFAKKDYDK  376

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+RVLQ   V+G  L++++ +GL F S +F+KD +V+ LI++GIPFVA TQPIN L
Sbjct  377   ATATASRVLQYALVLGVVLSIILSVGLQFASRLFTKDASVLHLISVGIPFVAATQPINVL  436

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVN+G SDF YSAYSMV+VA ++I   F    S+G+VGIW+ALA FM LR +AG 
Sbjct  437   AFVFDGVNYGVSDFAYSAYSMVLVAIISILCLFTLSSSHGYVGIWVALATFMSLRALAGF  496

Query  211   WRLATGTGPWCFLRA  167
              R+ TG GPW FL++
Sbjct  497   LRIGTGMGPWRFLKS  511



>gb|KHN19450.1| MATE efflux family protein FRD3 [Glycine soja]
Length=554

 Score =   413 bits (1062),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 252/454 (56%), Positives = 311/454 (69%), Gaps = 26/454 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQL--ETMENGSLTIPSSE  1298
             V+ITTSFVAEE++ +    +KE        E + +E  +   +   ET E+ ++   S+ 
Sbjct  94    VSITTSFVAEEDT-IQRLINKETETDNIENETITKENVEAPKKFKGETDESNNVVAKSTF  152

Query  1297  TKGSSALSDLE--------------ASERDSKVKRGKLRIPSASTALMMGCILGILQTVF  1160
             T G     D+E               S   SK K GK RI SASTAL+ G ILG+LQT  
Sbjct  153   TSG-----DVEKLATGNMGINNENVTSSTKSKPKVGKKRIASASTALLFGTILGLLQTAI  207

Query  1159  LTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYA  980
             LT  AKPLL  MG+K  S ML PA +YL LRS+GSPAVLLSLA+QGIFRG KDT TPLY 
Sbjct  208   LTFAAKPLLYAMGLKHDSPMLIPAEKYLRLRSIGSPAVLLSLAMQGIFRGFKDTTTPLYV  267

Query  979   TAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQ  800
               +G   N++LD I I     G+ GAA+AHVISQY++ + LL  L++ V L+PPS K LQ
Sbjct  268   IVSGYAFNVLLDPILIFYLKLGLKGAAMAHVISQYMMAITLLLLLMKRVHLVPPSIKDLQ  327

Query  799   LSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIA  620
             + +FLKNG  L  RV++ TFC+TLAASLAARLGS  MAAFQ  LQIWL SSLLADGLA+A
Sbjct  328   IFRFLKNGGLLLTRVVSVTFCMTLAASLAARLGSIPMAAFQPGLQIWLASSLLADGLAVA  387

Query  619   GQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLI  440
              Q +LA +FA KDY KA AAA R LQM FV+G GL+  V LGLYFG+G+FSK+ NV+ LI
Sbjct  388   VQTMLACSFAEKDYNKATAAATRTLQMSFVLGVGLSFAVALGLYFGAGIFSKNANVVHLI  447

Query  439   TIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSM----VMVAAMTIGFEFLFLKSNG  272
              I +PFVA TQPINSLAFV DGVN+GASDF YSAYS+    V+V+ ++I  E L  +S  
Sbjct  448   KISMPFVAATQPINSLAFVFDGVNYGASDFAYSAYSLASLHVLVSLVSIPIEILLFRSKQ  507

Query  271   FVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             FVGIWIAL I+M+LR + G+WR+ TGTGPW +LR
Sbjct  508   FVGIWIALTIYMILRMLVGIWRMGTGTGPWYYLR  541



>ref|XP_008345011.1| PREDICTED: MATE efflux family protein 1-like [Malus domestica]
Length=526

 Score =   412 bits (1059),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 261/443 (59%), Positives = 314/443 (71%), Gaps = 26/443 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLET----MENGSLTIPS  1304
             V++TTSFVAEE      D    VS +            KDSD LET     +     IP 
Sbjct  93    VSVTTSFVAEE------DTIGTVSPE-----------AKDSDYLETGSSINDEMKQLIPE  135

Query  1303  SE-TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
             S+ T+ +     +  S         K  IPSAS+A+++G ILG++Q +FL   AKPLL  
Sbjct  136   SDATQNAYNSKSVATSFEIVTTDHQKRYIPSASSAMVIGSILGLIQAIFLISGAKPLLNF  195

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGV   S ML PA +YL LRSLG+PAVLLSLA+QGIFRG KDTKTPLYAT AGD+ NIIL
Sbjct  196   MGVGSDSPMLKPAQQYLMLRSLGAPAVLLSLAMQGIFRGXKDTKTPLYATVAGDVTNIIL  255

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI   H GV+GAAIAHVISQY++  ILL++L+ +V LLPPS KHLQ S+FLKNG  L
Sbjct  256   DPIFIFVFHLGVTGAAIAHVISQYLICFILLWRLMAQVNLLPPSIKHLQFSRFLKNGFLL  315

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
               RVIA TFCVTLAASLAAR G T MAAFQVCLQ+WL +SLLADGLA+AGQAILA+AFA 
Sbjct  316   LMRVIAVTFCVTLAASLAARQGXTPMAAFQVCLQVWLATSLLADGLAVAGQAILASAFAK  375

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY KA A A+RVLQ+G V+G  LA ++G+GL +G+ +F+KD NV+ LI IGIPFVA TQ
Sbjct  376   KDYDKAAATASRVLQLGLVLGLMLAAILGVGLQYGARLFTKDXNVLHLIGIGIPFVAATQ  435

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PIN+LAFV DGVNFGASDF YSA+SMVMVA ++I   F+   +NGF+GIW+AL I+M LR
Sbjct  436   PINALAFVFDGVNFGASDFVYSAFSMVMVAIVSILVLFVLSYTNGFIGIWVALTIYMSLR  495

Query  226   TIAGLWRLATGTGPWCFLRASTQ  158
             T AG WR         F RA+T+
Sbjct  496   TFAGFWRYNLTV----FARANTK  514



>gb|ACI46131.1| aluminum activated citrate transporter [Secale cereale]
Length=554

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 234/436 (54%), Positives = 306/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S   
Sbjct  132   VSVTTSFVAEEDAII--------------SKYLEENNSKDLEKAAHVHSDACNVPASGGD  177

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS S+AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  178   TPVCANSCIPTECADPSNQGCKRRYIPSVSSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  237

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  238   KRDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  297

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  298   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  357

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  358   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDT  417

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIPFVAGTQ IN
Sbjct  418   KKVIAATSRVLQLSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHRGIPFVAGTQTIN  477

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRTIA
Sbjct  478   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTIA  537

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  538   STWRMGAARGPWAFLR  553



>gb|ACI46129.1| aluminum activated citrate transporter [Secale cereale]
 dbj|BAJ61741.1| putative citrate efflux MATE transporter [Secale cereale]
Length=554

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 234/436 (54%), Positives = 306/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S   
Sbjct  132   VSVTTSFVAEEDAII--------------SKYLEENNSKDLEKAAHVHSDACNVPASGGD  177

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS S+AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  178   TPVCANSCIPTECADPSNQGCKRRYIPSVSSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  237

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  238   KRDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  297

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  298   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  357

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  358   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDT  417

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIPFVAGTQ IN
Sbjct  418   KKVIAATSRVLQLSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHRGIPFVAGTQTIN  477

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRTIA
Sbjct  478   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTIA  537

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  538   STWRMGAARGPWAFLR  553



>ref|XP_009107201.1| PREDICTED: MATE efflux family protein 1 isoform X2 [Brassica 
rapa]
Length=515

 Score =   411 bits (1056),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 253/434 (58%), Positives = 310/434 (71%), Gaps = 14/434 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++  C      V      + K   E G ++ + ET E     IP    K
Sbjct  95    VSITTSFVAEEDA--CSSQENTVQ-----DHKECIETGINNTKEETQE----LIPEIN-K  142

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
               S +S    S   S VK  K  IPSAS+AL++G ILG+LQ  FL   A+PLL  MGVK 
Sbjct  143   DESKISSSIFSVSKSPVK--KRNIPSASSALIIGAILGLLQAAFLISTARPLLSFMGVKH  200

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD  NIILD IFI
Sbjct  201   DSPMLGPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDATNIILDPIFI  260

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GV+GAA AHV+SQY++  ILL+KL+ +V++   S+KHLQ S+F+KNG  L  RVI
Sbjct  261   FVFRLGVTGAATAHVLSQYLMCGILLWKLMGQVDIFNLSTKHLQFSRFMKNGFLLLMRVI  320

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTL+ASLAAR GS  MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA KDYK+
Sbjct  321   AVTFCVTLSASLAAREGSISMAAFQVCLQVWLATSLLADGFAVAGQAILASAFAKKDYKR  380

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+RVLQ+G V+G  LAV++G GL+FG+ +F+KD  V+ LI+IG+PFVAGTQPIN+L
Sbjct  381   AAATASRVLQLGLVLGFLLAVILGAGLHFGARLFTKDDKVLHLISIGLPFVAGTQPINAL  440

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVNFGASDF Y+A S+VMVA ++I    L   ++GF+G+W  L I+M LR   G 
Sbjct  441   AFVFDGVNFGASDFGYAAASLVMVAIVSILCLVLLSSTHGFIGLWFGLTIYMSLRAAVGF  500

Query  211   WRLATGTGPWCFLR  170
             WR+ T TGPW FLR
Sbjct  501   WRIGTATGPWSFLR  514



>gb|ADK70243.1| aluminum activated citrate transporter 1-5 [Secale cereale]
Length=554

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 234/436 (54%), Positives = 306/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S   
Sbjct  132   VSVTTSFVAEEDAII--------------SKYLEENNSKDLEKAAHVHSDACNVPASGGD  177

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS S+AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  178   TPVCANSCIPTECADPSNQGCKRRYIPSVSSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  237

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  238   KRDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  297

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  298   LMFVCHMGVAGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  357

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  358   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDT  417

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIPFVAGTQ IN
Sbjct  418   KKVIAATSRVLQLSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHRGIPFVAGTQTIN  477

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRTIA
Sbjct  478   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTIA  537

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  538   STWRMGAARGPWAFLR  553



>gb|ACI46130.1| aluminum activated citrate transporter [Secale cereale]
Length=556

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 234/436 (54%), Positives = 306/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S   
Sbjct  134   VSVTTSFVAEEDAII--------------SKYLEENNSKDLEKAAHVHSDACNVPASGGD  179

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS S+AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  180   TPVCANSCIPTECADPSNQGCKRRYIPSVSSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  239

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  240   KRDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  299

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  300   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  359

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  360   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDT  419

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIPFVAGTQ IN
Sbjct  420   KKVIAATSRVLQLSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHRGIPFVAGTQTIN  479

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRTIA
Sbjct  480   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTIA  539

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  540   STWRMGAARGPWAFLR  555



>gb|AFZ61904.1| MATE1D [Triticum aestivum]
Length=553

 Score =   412 bits (1058),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 232/436 (53%), Positives = 307/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S   
Sbjct  131   VSVTTSFVAEEDAII--------------SKYLEENNSKDLEKAAHVHSDACNVPASGGD  176

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS ++AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  177   TPVCANSCIPTECADLSNQGCKRRYIPSVTSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  236

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  237   KHDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  296

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  297   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  356

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  357   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDT  416

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIPFVAGTQ IN
Sbjct  417   KKVIAATSRVLQLSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHKGIPFVAGTQTIN  476

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRT+A
Sbjct  477   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTVA  536

Query  217   GLWRLATGTGPWCFLR  170
               WR+   +GPW FLR
Sbjct  537   STWRMGAASGPWAFLR  552



>ref|XP_003558487.1| PREDICTED: MATE efflux family protein 1-like [Brachypodium distachyon]
Length=559

 Score =   412 bits (1058),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 235/434 (54%), Positives = 313/434 (72%), Gaps = 16/434 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +    SK      Y EE  +++  K       +++ +  +P S  +
Sbjct  139   VSVTTSFVAEEDAII----SK------YLEENSSQDLEK-----APVDSEASNVPVSGAE  183

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
               ++    E ++  ++  + K  IPS ++AL++G  LG++Q VFL   AK +LG+MGVK 
Sbjct  184   CVNSCIPTECTDLSNQGCKRKY-IPSVTSALIVGSFLGLVQAVFLIFSAKVVLGIMGVKH  242

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA+RYL +RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I +
Sbjct  243   DSPMLEPAVRYLKIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDAANIILDPILM  302

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
               CH GV+GAA+AHV+SQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L ARV+
Sbjct  303   FVCHMGVTGAAVAHVVSQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLARVV  362

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTLA+SLAAR G+T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D  K
Sbjct  363   AVTFCVTLASSLAARDGATIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDNNK  422

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
               AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIPFVAGTQ IN+L
Sbjct  423   VVAATSRVLQLSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHRGIPFVAGTQTINAL  482

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DG+NFGASD+ YSAYSMV VAA++I         NGF+GIW+AL I+M LRTIA  
Sbjct  483   AFVFDGINFGASDYTYSAYSMVGVAAISIPCLVYLSAHNGFIGIWVALTIYMSLRTIAST  542

Query  211   WRLATGTGPWCFLR  170
             WR+    GPW FLR
Sbjct  543   WRMGAARGPWVFLR  556



>gb|AIS76465.1| Al-activated citrate transporter [Vigna umbellata]
Length=565

 Score =   412 bits (1058),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 255/468 (54%), Positives = 326/468 (70%), Gaps = 34/468 (7%)
 Frame = -2

Query  1471  VNITTSFVAEENS--EL-CDDGSK-EVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPS  1304
             V+ITTSFVAEE++  +L   +G+K ++   +  E+++ ++  KD+ +     +    I  
Sbjct  93    VSITTSFVAEEDTLEKLNVQNGNKLKLKEVIMPEDQMLQDLEKDTLKENIKTSAKPVIGK  152

Query  1303  SETK-------GSSALSDLEASERDSKVKRGK-----------------------LRIPS  1214
              E K       GS A+ +  A+  ++ ++ G                         RI S
Sbjct  153   RELKDLEVKSFGSQAVENNNATTDNNDIETGDEGNKSICKSSWITKSKEKVVKKKRRIAS  212

Query  1213  ASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSL  1034
             ASTAL+ G ILG++QT  L   AKPLL +MGVKP S MLNPA RYL LRS+G+PAVLLSL
Sbjct  213   ASTALLFGTILGLIQTAVLIFAAKPLLRVMGVKPDSPMLNPAERYLKLRSIGAPAVLLSL  272

Query  1033  AIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllill  854
             A QGIFRG KDTKTPLY    G   N+ILD I I     G++GAAI+HV+SQY++ + LL
Sbjct  273   ATQGIFRGFKDTKTPLYVIVLGYTFNVILDPILIFTLRLGINGAAISHVLSQYMMAITLL  332

Query  853   fklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQV  674
               L+++V LLPPS K LQ+ +FLKNG  L  RVIA TFCVTLAASLAARLGS  MAAFQ 
Sbjct  333   LILMKKVHLLPPSIKDLQIFRFLKNGGLLMLRVIAVTFCVTLAASLAARLGSIPMAAFQT  392

Query  673   CLQIWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglg  494
             CLQ+WLTSSLLADGLA+A QAILA +FA KDYKK  AAA R LQM FV+G GL++ VGLG
Sbjct  393   CLQVWLTSSLLADGLAVAVQAILACSFAEKDYKKTTAAAVRTLQMSFVLGTGLSLAVGLG  452

Query  493   LYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAA  314
             LYFG+G+FSK+ +V+ LI +GIPFVA TQPINSLAFV DGVN+GASDF YSA S+V+V+ 
Sbjct  453   LYFGAGIFSKNVHVVHLIKLGIPFVAATQPINSLAFVFDGVNYGASDFAYSACSLVVVSI  512

Query  313   MTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             +++  EF+  ++  F+GIWIAL I+M LR +AG+WR+ TGTGPW +LR
Sbjct  513   VSVAIEFILYRTKHFIGIWIALTIYMTLRMMAGVWRMGTGTGPWRYLR  560



>gb|KEH19073.1| MATE efflux family protein [Medicago truncatula]
Length=539

 Score =   410 bits (1055),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 246/453 (54%), Positives = 312/453 (69%), Gaps = 26/453 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVA-EEPGKDSDQLETMENGSL-------  1316
             V+ITTSFVAEE      D  K ++ K    +K    E   +SD ++ +E G+        
Sbjct  93    VSITTSFVAEE------DTIKRMNIKAAENDKSKLTEVTPESDVVQDIEKGTPKESNKAQ  146

Query  1315  ---TIPSSETKGSSALSDLEASERDSKVKRGKL--------RIPSASTALMMGCILGILQ  1169
                 +  +ET G+   +D + +  DS+  + K          I SASTAL+ G ILG+LQ
Sbjct  147   KESVVGHNETNGTLGNND-KTNGVDSRSSKIKEIVVKKKKRHIASASTALLFGSILGLLQ  205

Query  1168  TVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTP  989
                L   AKPLL +MGVK GS ML PA++YLT RS G+PAVLLSLA+QGIFRG KDT TP
Sbjct  206   ASVLIFGAKPLLYVMGVKHGSPMLKPAVKYLTYRSFGAPAVLLSLAMQGIFRGFKDTTTP  265

Query  988   LYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSK  809
             LY   AG  +N++L+ + I     G+ GAAIAHVISQY++   L F L+++V LLPP  K
Sbjct  266   LYVIVAGYSLNVLLEPLLIFKLKMGIKGAAIAHVISQYMMAFTLFFILMKKVYLLPPRIK  325

Query  808   HLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGL  629
              LQ+ +FL+NG  L  +VIA TFCVTLAASLAARLGS  MAAFQ CLQ+WL SSL ADGL
Sbjct  326   DLQIFRFLRNGGLLMTKVIAVTFCVTLAASLAARLGSIPMAAFQPCLQVWLASSLFADGL  385

Query  628   AIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVI  449
             AIA QAILA +FA KD  K  AAA R LQ GF++G GL+++VG GLYFG+G+FSK+  VI
Sbjct  386   AIAVQAILAGSFAEKDCNKTTAAATRTLQFGFILGAGLSLIVGFGLYFGAGIFSKNLQVI  445

Query  448   RLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGF  269
               I IG P VA TQPIN+LAFV DGVN+GASDF Y++YS+V V+ +++G EFL  +SN F
Sbjct  446   HFIRIGAPIVAATQPINTLAFVFDGVNYGASDFAYASYSLVTVSLVSVGVEFLLYRSNQF  505

Query  268   VGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             +GIWIAL+I+M LR +AG+WR+ TGTGPW +LR
Sbjct  506   IGIWIALSIYMTLRMLAGVWRMGTGTGPWSYLR  538



>gb|AHA98249.1| MATE1 [Triticum aestivum]
Length=553

 Score =   411 bits (1056),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 232/436 (53%), Positives = 306/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEEN+ +               + + E   KD ++   + + +  +P+S   
Sbjct  131   VSVTTSFVAEENAII--------------SKYIEENNSKDLEKAAHVHSDACNVPASGGD  176

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS ++AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  177   TPVCANSCIPTECADPSNQGCKRRYIPSVTSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  236

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  237   KHDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  296

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  297   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  356

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D+
Sbjct  357   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDH  416

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIP VAGTQ IN
Sbjct  417   KKVIAATSRVLQVSIVLGMGLTVVLGLFMKFGAGVFTKDATVIDVIHKGIPVVAGTQTIN  476

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRT+A
Sbjct  477   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTVA  536

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  537   STWRMGAARGPWVFLR  552



>gb|ADK70244.1| aluminum activated citrate transporter 1 [Secale cereale]
 gb|ACD88867.2| aluminum activated citrate transporter [Secale cereale]
Length=554

 Score =   410 bits (1055),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 233/436 (53%), Positives = 305/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S   
Sbjct  132   VSVTTSFVAEEDAII--------------SKYLEENNSKDLEKAAHVHSDACNVPASGGD  177

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS S+AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  178   TPVCANSCIPTECADPSNQGCKRRYIPSVSSALIVGSFLGLVQAVFLIFPAKVVLGIMGV  237

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+R LG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  238   KRDSPMLEPAVRYLTIRPLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  297

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  298   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  357

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  358   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDT  417

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIPFVAGTQ IN
Sbjct  418   KKVIAATSRVLQLSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHRGIPFVAGTQTIN  477

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRTIA
Sbjct  478   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTIA  537

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  538   STWRMGAARGPWAFLR  553



>gb|AFZ61901.1| MATE1A [Triticum aestivum]
Length=553

 Score =   410 bits (1055),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 232/436 (53%), Positives = 307/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S  +
Sbjct  131   VSVTTSFVAEEDAII--------------SKYLEENNSKDLEKAAHVHSDACNVPASGGE  176

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS ++AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  177   TPVCANSCIPTECADLSNQGCKRRYIPSVTSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  236

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  237   KHDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  296

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  297   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  356

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  357   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDT  416

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIPFVAGTQ IN
Sbjct  417   KKVIAATSRVLQLSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHKGIPFVAGTQTIN  476

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRT+A
Sbjct  477   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTVA  536

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  537   STWRMGAARGPWAFLR  552



>emb|CDY65471.1| BnaA08g29560D [Brassica napus]
Length=520

 Score =   409 bits (1052),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 248/439 (56%), Positives = 313/439 (71%), Gaps = 19/439 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETME-----NGSLTIP  1307
             V+ITTSFVAEE++      S+E + +   + K   E G ++ + ET E     N   ++P
Sbjct  95    VSITTSFVAEEDAY----SSQENTVQ---DHKECIETGINNTKEETQELIPEINKVCSLP  147

Query  1306  SSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
                   SS  S  ++  +       K  IPSAS+AL++G ILG+LQ  FL   A+PLL  
Sbjct  148   DESKISSSIFSVSKSPVK-------KRNIPSASSALIIGAILGLLQAAFLISTARPLLSF  200

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGVK  S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD  NIIL
Sbjct  201   MGVKHDSPMLGPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDATNIIL  260

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D IFI     GV+GAA AHV+SQY++  ILL+KL+ +V++   S+KHLQ S+F+KNG  L
Sbjct  261   DPIFIFVFRLGVTGAATAHVLSQYLMCGILLWKLMGQVDIFNLSTKHLQFSRFMKNGFLL  320

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
               RVIA TFCVTL+ASLAAR GS  MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA 
Sbjct  321   LMRVIAVTFCVTLSASLAAREGSISMAAFQVCLQVWLATSLLADGFAVAGQAILASAFAK  380

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDYK+A A A+RVLQ+G V+G  LA+++G GL+FG+ +F+KD  V+ LI+IG+PFVAGTQ
Sbjct  381   KDYKRAAATASRVLQLGLVLGFLLAIILGAGLHFGARLFTKDDKVLHLISIGLPFVAGTQ  440

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PIN+LAFV DGVNFGASDF Y+A S+VMVA ++I    L   ++GF+G+W  L I+M LR
Sbjct  441   PINALAFVFDGVNFGASDFGYAAASLVMVAIVSILCLVLLSSTHGFIGLWFGLTIYMSLR  500

Query  226   TIAGLWRLATGTGPWCFLR  170
                G WR+ T TGPW FLR
Sbjct  501   AAVGFWRIGTATGPWSFLR  519



>gb|AGD81027.1| MATE1 protein [Triticum aestivum]
Length=553

 Score =   410 bits (1054),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 231/436 (53%), Positives = 306/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S   
Sbjct  131   VSVTTSFVAEEDAII--------------SKYIEENNSKDLEKAAHVHSDACNVPASGGD  176

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS ++AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  177   TPVCANSCIPTECADPSNQGCKRRYIPSVTSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  236

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  237   KHDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  296

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  297   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  356

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  357   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDT  416

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVL++  V+G GL VV+GL + FG+GVF+KD  VI +I  GIPFVAGTQ IN
Sbjct  417   KKVIAATSRVLRLSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHKGIPFVAGTQTIN  476

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRT+A
Sbjct  477   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHRGFIGIWVALTIYMSLRTVA  536

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  537   STWRMGAARGPWAFLR  552



>dbj|BAF75822.1| aluminum activated citrate transporter [Hordeum vulgare]
Length=555

 Score =   410 bits (1054),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 230/436 (53%), Positives = 308/436 (71%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   +D ++   + + +  +P+S   
Sbjct  133   VSVTTSFVAEEDAII--------------SKYLEENSSQDLEKASHVHSDACNVPASGPD  178

Query  1291  GSSALSDLEASERDSKVKRG--KLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  K  IPS ++AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  179   TPVCANSCIPTECTDLSNQGCKKRYIPSVTSALIVGSFLGLVQAVFLIFSAKFVLGIMGV  238

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  239   KHDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  298

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  299   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  358

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D+
Sbjct  359   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDH  418

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF++D +VI +I  GIPFVAGTQ IN
Sbjct  419   KKVIAATSRVLQLSIVLGMGLTVVLGLFMKFGAGVFTRDADVINVIHKGIPFVAGTQTIN  478

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRT+A
Sbjct  479   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTVA  538

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  539   STWRMGAARGPWVFLR  554



>dbj|BAF75823.1| aluminum activated citrate transporter [Hordeum vulgare subsp. 
vulgare]
Length=555

 Score =   410 bits (1054),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 230/436 (53%), Positives = 308/436 (71%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   +D ++   + + +  +P+S   
Sbjct  133   VSVTTSFVAEEDAII--------------SKYLEENSSQDLEKASHVHSDACNLPASGPD  178

Query  1291  GSSALSDLEASERDSKVKRG--KLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  K  IPS ++AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  179   TPVCANSCIPTECTDLSNQGCKKRYIPSVTSALIVGSFLGLVQAVFLIFSAKFVLGIMGV  238

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  239   KHDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  298

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  299   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  358

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D+
Sbjct  359   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDH  418

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF++D +VI +I  GIPFVAGTQ IN
Sbjct  419   KKVIAATSRVLQLSIVLGMGLTVVLGLFMKFGAGVFTRDADVINVIHKGIPFVAGTQTIN  478

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRT+A
Sbjct  479   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTVA  538

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  539   STWRMGAARGPWVFLR  554



>ref|XP_003597420.1| Multidrug export protein mepA [Medicago truncatula]
Length=509

 Score =   408 bits (1049),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 248/445 (56%), Positives = 306/445 (69%), Gaps = 38/445 (9%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSL---TIPSS  1301
             V++TTSFVAEE++    D S +V                        ENG L   T P +
Sbjct  93    VSVTTSFVAEEDA--LSDASSQVE-----------------------ENGCLEAATPPDA  127

Query  1300  ETK-----GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPL  1136
             ETK      +S +      + D   +R   +IPSAS+AL  G +LG++Q   L   AKPL
Sbjct  128   ETKEFLPQKNSVVESFNVVKDDQHKRR---QIPSASSALYFGGVLGLVQATILISAAKPL  184

Query  1135  LGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVN  956
             L  MGV   S ML+ A +YL LRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGDL N
Sbjct  185   LNFMGVTSDSPMLHHAQQYLKLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDLTN  244

Query  955   IILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKN-  779
             I LD +FI     GV+GAAIAHVISQY+L  ILL+ L ++V+L+PPS KH+Q  +F KN 
Sbjct  245   IALDPLFIFVFRMGVNGAAIAHVISQYLLSAILLWSLNKQVDLIPPSIKHMQFDRFAKNG  304

Query  778   -GLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILA  602
              G  LF RVIA TFCVTL+ASLAA  GST MAAFQVCLQ+WL  SLLADGLA+AGQAILA
Sbjct  305   KGFLLFMRVIAVTFCVTLSASLAAHHGSTSMAAFQVCLQVWLAVSLLADGLAVAGQAILA  364

Query  601   TafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPF  422
              AFA KDY+KA   A RVLQMG V+G  LA ++G GL+FG+ +F+KD +V+ LI +G+PF
Sbjct  365   GAFANKDYEKASTTATRVLQMGMVLGLALAFILGTGLHFGAKLFTKDIDVLHLIRVGVPF  424

Query  421   VAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAI  242
             VA TQP+N LAFV DGVNFGASDF YSA+SMV+VA ++I    +   + GF+GIW+AL I
Sbjct  425   VALTQPLNCLAFVFDGVNFGASDFAYSAFSMVIVAIISIICLLILSSAGGFIGIWVALTI  484

Query  241   FMLLRTIAGLWRLATGTGPWCFLRA  167
             +M LR  AG  R+ TG+GPW FLR+
Sbjct  485   YMSLRAFAGFLRIGTGSGPWEFLRS  509



>gb|ADK70245.1| aluminum activated citrate transporter 1-4 [Secale cereale]
Length=554

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 233/436 (53%), Positives = 306/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S   
Sbjct  132   VSVTTSFVAEEDAII--------------SKYLEENNSKDLEKAAHVHSDACNVPASGGD  177

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS S+AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  178   TPVCANSCIPTECADPSNQGCKRRYIPSVSSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  237

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  +IILD I
Sbjct  238   KRDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATDIILDPI  297

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  298   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  357

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  358   VVAVTFCVTLASSLAARDGPTIMAAFQICSQLWLATSLLADGLAVAGQAVLASAFAKNDT  417

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIPFVAGTQ IN
Sbjct  418   KKVIAATSRVLQLSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHRGIPFVAGTQTIN  477

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRTIA
Sbjct  478   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTIA  537

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  538   STWRMGAARGPWAFLR  553



>ref|XP_010906077.1| PREDICTED: MATE efflux family protein 1 isoform X3 [Elaeis guineensis]
Length=503

 Score =   408 bits (1048),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 250/436 (57%), Positives = 307/436 (70%), Gaps = 33/436 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEE-KVAEEPGKDSDQLETMENGSLTIPSSET  1295
             V++TTSFVAEE++          + K+ SEE +  E+ G  S   E  E      P    
Sbjct  99    VSVTTSFVAEEDA----------TCKMASEEFECGEQEGTFSIDSEMKELIPRNDPERTV  148

Query  1294  KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
               SS  SD   S    K+ R +  IPSAS+AL +G ILG+LQ + L   A P+L  MGVK
Sbjct  149   HNSSPCSD--KSICTIKLGRERKHIPSASSALAIGGILGLLQALILIFGAIPILNFMGVK  206

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
             P S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT              
Sbjct  207   PDSPMLTPACQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYAT--------------  252

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
                   GVSGAAIAHVISQY++ LILL++L+REV++LPPS K LQ S+FLKN   L ARV
Sbjct  253   ------GVSGAAIAHVISQYLIALILLWRLLREVDVLPPSIKDLQFSRFLKNSFLLLARV  306

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAAS+AAR GS  MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA +D+ 
Sbjct  307   IAVTFCVTLAASMAARQGSIPMAAFQICLQIWLATSLLADGLAVAGQAILASAFARRDHA  366

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +A AAA+RVLQ G ++G  L V++G+GL F S +F+KD NV++LI IGIPFVA TQPIN+
Sbjct  367   RATAAASRVLQWGVILGLVLCVILGIGLQFASRLFTKDANVLQLIHIGIPFVALTQPINA  426

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DG+NFGASDF YSAYSMV+VA ++I    +   S+GF+GIW+AL I+M LR  AG
Sbjct  427   LAFVFDGINFGASDFSYSAYSMVLVAIVSILCLVVLSSSHGFIGIWVALTIYMSLRMFAG  486

Query  214   LWRLATGTGPWCFLRA  167
              WR+ T  GPW FLR+
Sbjct  487   FWRIGTARGPWAFLRS  502



>ref|XP_009107199.1| PREDICTED: MATE efflux family protein 1 isoform X1 [Brassica 
rapa]
 ref|XP_009107200.1| PREDICTED: MATE efflux family protein 1 isoform X1 [Brassica 
rapa]
Length=519

 Score =   408 bits (1049),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 248/435 (57%), Positives = 307/435 (71%), Gaps = 12/435 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPS-SET  1295
             V+ITTSFVAEE++  C      V      + K   E G ++ + ET E     IP  ++ 
Sbjct  95    VSITTSFVAEEDA--CSSQENTVQ-----DHKECIETGINNTKEETQE----LIPEINKD  143

Query  1294  KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
                       +    SK    K  IPSAS+AL++G ILG+LQ  FL   A+PLL  MGVK
Sbjct  144   SLPDESKISSSIFSVSKSPVKKRNIPSASSALIIGAILGLLQAAFLISTARPLLSFMGVK  203

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
               S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD  NIILD IF
Sbjct  204   HDSPMLGPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDATNIILDPIF  263

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             I     GV+GAA AHV+SQY++  ILL+KL+ +V++   S+KHLQ S+F+KNG  L  RV
Sbjct  264   IFVFRLGVTGAATAHVLSQYLMCGILLWKLMGQVDIFNLSTKHLQFSRFMKNGFLLLMRV  323

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTL+ASLAAR GS  MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA KDYK
Sbjct  324   IAVTFCVTLSASLAAREGSISMAAFQVCLQVWLATSLLADGFAVAGQAILASAFAKKDYK  383

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +A A A+RVLQ+G V+G  LAV++G GL+FG+ +F+KD  V+ LI+IG+PFVAGTQPIN+
Sbjct  384   RAAATASRVLQLGLVLGFLLAVILGAGLHFGARLFTKDDKVLHLISIGLPFVAGTQPINA  443

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DGVNFGASDF Y+A S+VMVA ++I    L   ++GF+G+W  L I+M LR   G
Sbjct  444   LAFVFDGVNFGASDFGYAAASLVMVAIVSILCLVLLSSTHGFIGLWFGLTIYMSLRAAVG  503

Query  214   LWRLATGTGPWCFLR  170
              WR+ T TGPW FLR
Sbjct  504   FWRIGTATGPWSFLR  518



>gb|AFZ61900.1| MATE1B [Triticum aestivum]
 gb|AFZ61902.1| MATE1B [Triticum aestivum]
 gb|AFZ61903.1| MATE1B [Triticum aestivum]
 gb|AFZ61905.1| MATE1B [Triticum aestivum]
 gb|AFZ61906.1| MATE1B [Triticum aestivum]
Length=553

 Score =   409 bits (1052),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 231/436 (53%), Positives = 306/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S   
Sbjct  131   VSVTTSFVAEEDAII--------------SKYIEENNSKDLEKAAHVHSDACNVPASGGD  176

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS ++AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  177   TPVCANSCIPTECADPSNQGCKRRYIPSVTSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  236

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  237   KHDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  296

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  297   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  356

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A T CVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D+
Sbjct  357   VVAVTSCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDH  416

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIPFVAGTQ IN
Sbjct  417   KKVIAATSRVLQLSIVLGMGLTVVLGLFMKFGAGVFTKDATVIDVIHKGIPFVAGTQTIN  476

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRT+A
Sbjct  477   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTVA  536

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  537   STWRMGAARGPWAFLR  552



>gb|AHA98253.1| MATE1 [Triticum aestivum]
Length=553

 Score =   409 bits (1051),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 231/436 (53%), Positives = 306/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S   
Sbjct  131   VSVTTSFVAEEDAII--------------SKYLEENNSKDLEKAAHVHSDACNVPASGGD  176

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS ++AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  177   TPVCANSCIPTECADLSNQGCKRRYIPSVTSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  236

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  237   KHDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  296

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  297   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  356

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  357   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDT  416

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RV Q+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIPFVAGTQ IN
Sbjct  417   KKVIAATSRVRQVSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHKGIPFVAGTQTIN  476

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRT+A
Sbjct  477   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTVA  536

Query  217   GLWRLATGTGPWCFLR  170
               WR+   +GPW FLR
Sbjct  537   STWRMGAASGPWVFLR  552



>dbj|BAJ61742.1| putative citrate efflux MATE transporter [Secale cereale]
Length=497

 Score =   407 bits (1046),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 248/435 (57%), Positives = 324/435 (74%), Gaps = 16/435 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++   D    E+S    +E  V+E      D+L T E       ++ T 
Sbjct  79    VSVTTSFVAEEDATSSDRNKVEISGD--NEHNVSE-----MDELITHEE------NNATS  125

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
             G S+  + ++SE +++ +R K  IPS STAL++G +LG+++T+ L   AKP+L  MGVK 
Sbjct  126   GKSSF-ETDSSEINTEHRRKK--IPSVSTALLLGGVLGLVETLLLVFCAKPILDFMGVKA  182

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              + ML PAL+YL LRSLG+PAVLLSLA+QG+FRGLKDT+TPLYAT AGD +NI+LD IF+
Sbjct  183   DTGMLKPALQYLVLRSLGAPAVLLSLAMQGVFRGLKDTRTPLYATVAGDAINIVLDPIFM  242

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                 +GVSGAA+AHVISQY +  ILL +L  +VELLPP+ KHL + +FLKNG  L ARVI
Sbjct  243   FVFQYGVSGAAVAHVISQYFIAAILLCRLSLQVELLPPNLKHLPIGRFLKNGSLLLARVI  302

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             AAT CVTL+AS+AARLGST MAAFQ+CLQIWL SSLLADGLA AGQAILA+AFA KD+ K
Sbjct  303   AATCCVTLSASMAARLGSTQMAAFQICLQIWLASSLLADGLAFAGQAILASAFARKDHSK  362

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             AKA A+RVLQ+G ++G  L +++G+GL+ GS +F++D+ V+  I +  PFVA TQPIN+L
Sbjct  363   AKATASRVLQLGLILGLLLGLLLGVGLHTGSRLFTEDQGVLHHIYVATPFVALTQPINAL  422

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVN+GASDF Y+AYS+++VA ++I          GF+GIWIAL+I+M LR  AGL
Sbjct  423   AFVFDGVNYGASDFAYAAYSLILVAIVSIACIVTLANYCGFIGIWIALSIYMSLRMFAGL  482

Query  211   WRLATGTGPWCFLRA  167
             WR+ T  GPW FLR+
Sbjct  483   WRIGTARGPWAFLRS  497



>ref|XP_003638283.1| Ferric reductase defective 3a [Medicago truncatula]
Length=520

 Score =   408 bits (1048),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 248/465 (53%), Positives = 313/465 (67%), Gaps = 37/465 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVA-EEPGKDSDQLETMENGSL-------  1316
             V+ITTSFVAEE      D  K ++ K    +K    E   +SD ++ +E G+        
Sbjct  61    VSITTSFVAEE------DTIKRMNIKAAENDKSKLTEVTPESDVVQDIEKGTPKESNKAQ  114

Query  1315  ---TIPSSETKGSSALSD---------------LEASERDSKVKRGKL-----RIPSAST  1205
                 +  +ET G+   +D               L +  R SK+K   +      I SAST
Sbjct  115   KESVVGHNETNGTLGNNDKTNGVVMNNEQEPHLLSSDSRSSKIKEIVVKKKKRHIASAST  174

Query  1204  ALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQ  1025
             AL+ G ILG+LQ   L   AKPLL +MGVK GS ML PA++YLT RS G+PAVLLSLA+Q
Sbjct  175   ALLFGSILGLLQASVLIFGAKPLLYVMGVKHGSPMLKPAVKYLTYRSFGAPAVLLSLAMQ  234

Query  1024  GIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfkl  845
             GIFRG KDT TPLY   AG  +N++L+ + I     G+ GAAIAHVISQY++   L F L
Sbjct  235   GIFRGFKDTTTPLYVIVAGYSLNVLLEPLLIFKLKMGIKGAAIAHVISQYMMAFTLFFIL  294

Query  844   IREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQ  665
             +++V LLPP  K LQ+ +FL+NG  L  +VIA TFCVTLAASLAARLGS  MAAFQ CLQ
Sbjct  295   MKKVYLLPPRIKDLQIFRFLRNGGLLMTKVIAVTFCVTLAASLAARLGSIPMAAFQPCLQ  354

Query  664   IWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYF  485
             +WL SSL ADGLAIA QAILA +FA KD  K  AAA R LQ GF++G GL+++VG GLYF
Sbjct  355   VWLASSLFADGLAIAVQAILAGSFAEKDCNKTTAAATRTLQFGFILGAGLSLIVGFGLYF  414

Query  484   GSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTI  305
             G+G+FSK+  VI  I IG P VA TQPIN+LAFV DGVN+GASDF Y++YS+V V+ +++
Sbjct  415   GAGIFSKNLQVIHFIRIGAPIVAATQPINTLAFVFDGVNYGASDFAYASYSLVTVSLVSV  474

Query  304   GFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             G EFL  +SN F+GIWIAL+I+M LR +AG+WR+ TGTGPW +LR
Sbjct  475   GVEFLLYRSNQFIGIWIALSIYMTLRMLAGVWRMGTGTGPWSYLR  519



>ref|XP_002444946.1| hypothetical protein SORBIDRAFT_07g001800 [Sorghum bicolor]
 gb|EES14441.1| hypothetical protein SORBIDRAFT_07g001800 [Sorghum bicolor]
Length=525

 Score =   408 bits (1048),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 247/441 (56%), Positives = 312/441 (71%), Gaps = 28/441 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSET-  1295
             V++TTSFVAEE+                     A    +D+D++      S+++   E  
Sbjct  105   VSVTTSFVAEED---------------------AMSNCRDNDKINQENECSVSVSEMEEL  143

Query  1294  ---KGSSALSDLEASERDS---KVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
                +G+SA + + + E DS    V++ +  IPS STAL++G +LG+L+TV L   AKP+L
Sbjct  144   ISPEGASATTSISSFETDSCEVSVEQKRKNIPSVSTALLLGGVLGLLETVLLVFSAKPIL  203

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
             G MGV P S M+ PAL+YL LRSLG+PAVLLSLA QG+FRG KDTKTPLYAT AGD +NI
Sbjct  204   GYMGVTPDSAMMKPALQYLVLRSLGAPAVLLSLATQGVFRGFKDTKTPLYATVAGDAINI  263

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             +LD IFI    +GVSGAAIAHVISQY +  ILL++L   V+LLPPS KHLQ  +FLKNG 
Sbjct  264   VLDPIFIFVFQYGVSGAAIAHVISQYFIASILLWRLRLHVDLLPPSFKHLQFGRFLKNGF  323

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L ARVIAATFCVTL+AS+AAR GST MAAFQ+CLQ WL  SLLADGLA AGQAILA+AF
Sbjct  324   LLLARVIAATFCVTLSASMAARQGSTPMAAFQICLQTWLACSLLADGLAFAGQAILASAF  383

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
             A KDY KA A A+R+LQ+  V+G  L++++G+GL  GS +F+ D+ V+  I IGIPFV  
Sbjct  384   ARKDYPKATATASRILQLALVLGLILSILLGIGLRIGSRLFTSDQGVLHHIYIGIPFVCL  443

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFML  233
             TQPIN+LAFV DG+N+GASDF Y+AYSMV+VA ++I         +GF+GIWIAL I+M 
Sbjct  444   TQPINALAFVFDGINYGASDFGYAAYSMVLVAIVSIICILTLESYSGFIGIWIALVIYMS  503

Query  232   LRTIAGLWRLATGTGPWCFLR  170
             LR  AG WR+ T  GPW +LR
Sbjct  504   LRMFAGFWRIGTAQGPWAYLR  524



>gb|AET02174.2| MATE efflux family protein [Medicago truncatula]
Length=607

 Score =   410 bits (1055),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 246/453 (54%), Positives = 312/453 (69%), Gaps = 26/453 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVA-EEPGKDSDQLETMENGSL-------  1316
             V+ITTSFVAEE      D  K ++ K    +K    E   +SD ++ +E G+        
Sbjct  161   VSITTSFVAEE------DTIKRMNIKAAENDKSKLTEVTPESDVVQDIEKGTPKESNKAQ  214

Query  1315  ---TIPSSETKGSSALSDLEASERDSKVKRGKL--------RIPSASTALMMGCILGILQ  1169
                 +  +ET G+   +D + +  DS+  + K          I SASTAL+ G ILG+LQ
Sbjct  215   KESVVGHNETNGTLGNND-KTNGVDSRSSKIKEIVVKKKKRHIASASTALLFGSILGLLQ  273

Query  1168  TVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTP  989
                L   AKPLL +MGVK GS ML PA++YLT RS G+PAVLLSLA+QGIFRG KDT TP
Sbjct  274   ASVLIFGAKPLLYVMGVKHGSPMLKPAVKYLTYRSFGAPAVLLSLAMQGIFRGFKDTTTP  333

Query  988   LYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSK  809
             LY   AG  +N++L+ + I     G+ GAAIAHVISQY++   L F L+++V LLPP  K
Sbjct  334   LYVIVAGYSLNVLLEPLLIFKLKMGIKGAAIAHVISQYMMAFTLFFILMKKVYLLPPRIK  393

Query  808   HLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGL  629
              LQ+ +FL+NG  L  +VIA TFCVTLAASLAARLGS  MAAFQ CLQ+WL SSL ADGL
Sbjct  394   DLQIFRFLRNGGLLMTKVIAVTFCVTLAASLAARLGSIPMAAFQPCLQVWLASSLFADGL  453

Query  628   AIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVI  449
             AIA QAILA +FA KD  K  AAA R LQ GF++G GL+++VG GLYFG+G+FSK+  VI
Sbjct  454   AIAVQAILAGSFAEKDCNKTTAAATRTLQFGFILGAGLSLIVGFGLYFGAGIFSKNLQVI  513

Query  448   RLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGF  269
               I IG P VA TQPIN+LAFV DGVN+GASDF Y++YS+V V+ +++G EFL  +SN F
Sbjct  514   HFIRIGAPIVAATQPINTLAFVFDGVNYGASDFAYASYSLVTVSLVSVGVEFLLYRSNQF  573

Query  268   VGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             +GIWIAL+I+M LR +AG+WR+ TGTGPW +LR
Sbjct  574   IGIWIALSIYMTLRMLAGVWRMGTGTGPWSYLR  606



>gb|KEH19072.1| MATE efflux family protein [Medicago truncatula]
Length=552

 Score =   408 bits (1049),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 248/465 (53%), Positives = 313/465 (67%), Gaps = 37/465 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVA-EEPGKDSDQLETMENGSL-------  1316
             V+ITTSFVAEE      D  K ++ K    +K    E   +SD ++ +E G+        
Sbjct  93    VSITTSFVAEE------DTIKRMNIKAAENDKSKLTEVTPESDVVQDIEKGTPKESNKAQ  146

Query  1315  ---TIPSSETKGSSALSD---------------LEASERDSKVKRGKL-----RIPSAST  1205
                 +  +ET G+   +D               L +  R SK+K   +      I SAST
Sbjct  147   KESVVGHNETNGTLGNNDKTNGVVMNNEQEPHLLSSDSRSSKIKEIVVKKKKRHIASAST  206

Query  1204  ALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQ  1025
             AL+ G ILG+LQ   L   AKPLL +MGVK GS ML PA++YLT RS G+PAVLLSLA+Q
Sbjct  207   ALLFGSILGLLQASVLIFGAKPLLYVMGVKHGSPMLKPAVKYLTYRSFGAPAVLLSLAMQ  266

Query  1024  GIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfkl  845
             GIFRG KDT TPLY   AG  +N++L+ + I     G+ GAAIAHVISQY++   L F L
Sbjct  267   GIFRGFKDTTTPLYVIVAGYSLNVLLEPLLIFKLKMGIKGAAIAHVISQYMMAFTLFFIL  326

Query  844   IREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQ  665
             +++V LLPP  K LQ+ +FL+NG  L  +VIA TFCVTLAASLAARLGS  MAAFQ CLQ
Sbjct  327   MKKVYLLPPRIKDLQIFRFLRNGGLLMTKVIAVTFCVTLAASLAARLGSIPMAAFQPCLQ  386

Query  664   IWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYF  485
             +WL SSL ADGLAIA QAILA +FA KD  K  AAA R LQ GF++G GL+++VG GLYF
Sbjct  387   VWLASSLFADGLAIAVQAILAGSFAEKDCNKTTAAATRTLQFGFILGAGLSLIVGFGLYF  446

Query  484   GSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTI  305
             G+G+FSK+  VI  I IG P VA TQPIN+LAFV DGVN+GASDF Y++YS+V V+ +++
Sbjct  447   GAGIFSKNLQVIHFIRIGAPIVAATQPINTLAFVFDGVNYGASDFAYASYSLVTVSLVSV  506

Query  304   GFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             G EFL  +SN F+GIWIAL+I+M LR +AG+WR+ TGTGPW +LR
Sbjct  507   GVEFLLYRSNQFIGIWIALSIYMTLRMLAGVWRMGTGTGPWSYLR  551



>ref|XP_006446116.1| hypothetical protein CICLE_v10014936mg [Citrus clementina]
 ref|XP_006470609.1| PREDICTED: MATE efflux family protein 1-like [Citrus sinensis]
 gb|ESR59356.1| hypothetical protein CICLE_v10014936mg [Citrus clementina]
 gb|KDO61259.1| hypothetical protein CISIN_1g010159mg [Citrus sinensis]
Length=516

 Score =   407 bits (1045),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 248/437 (57%), Positives = 317/437 (73%), Gaps = 15/437 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE      D  K V+ +  +EE  + E G  +   E  E     IP S++ 
Sbjct  91    VSVTTSFVAEE------DAIKSVARE--AEESDSIEEGSANGNSEDRE----LIPRSDST  138

Query  1291  GSSALSDLEASERD---SKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
              +   S    S  +    K +  +  IPSAS+A+++G ILG++Q + L   A PLL  MG
Sbjct  139   EADCESKPLTSSCNVVKPKYEHQRRYIPSASSAMVIGSILGLIQAIVLIAGAVPLLNFMG  198

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             +   S ML+PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGDL NIILD 
Sbjct  199   IGSESPMLSPAQKYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDLTNIILDP  258

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             IFI     GVSGAAIAHVISQY++ +ILL+KLI++V+L+PPS K L+  +FL+NG  L  
Sbjct  259   IFIFVFRLGVSGAAIAHVISQYLIAIILLWKLIQQVDLIPPSMKRLKFGRFLQNGFLLLI  318

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             RV+A TFCVTL+ASLAAR G T MAAFQVCLQ+WL +SLLADGLA+AGQAILA++FA KD
Sbjct  319   RVMAVTFCVTLSASLAARQGPTSMAAFQVCLQVWLATSLLADGLAVAGQAILASSFAKKD  378

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
             Y++A ++AARVLQ+G V+G  L  ++G+ L +G+ +F++D +V+RLI IGIPFVA TQPI
Sbjct  379   YERATSSAARVLQLGLVLGLVLGAILGVALQYGAKLFTRDADVVRLIGIGIPFVASTQPI  438

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTI  221
             NSLAFV DG+NFGASD+ Y+A SMV VA ++I        +NGFVG+WI L I+M LR  
Sbjct  439   NSLAFVFDGINFGASDYAYAACSMVFVAFVSILCLLGLSATNGFVGLWIGLTIYMSLRAF  498

Query  220   AGLWRLATGTGPWCFLR  170
             AG WR+ TGTGPW FLR
Sbjct  499   AGFWRIGTGTGPWAFLR  515



>gb|KGN58591.1| hypothetical protein Csa_3G696860 [Cucumis sativus]
Length=597

 Score =   409 bits (1052),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 257/505 (51%), Positives = 318/505 (63%), Gaps = 66/505 (13%)
 Frame = -2

Query  1471  VNITTSFVAEENS---------------ELCDDGSKEVSAKVYSEEKV---------AEE  1364
             V+ITTSFVAEE++                L ++G K     +  E  +         + E
Sbjct  93    VSITTSFVAEEDAVGKTAIKPVKCDLEKHLTENGQKRELTSIKKENMLENNSSASLTSNE  152

Query  1363  PGKDSDQ---LETMENGSLTIPSSETKGSSALSD-----------LEASERDSKVKRGK-  1229
             P   + Q   ++ +E  +      E +  S+  D           LE  E+D     G+ 
Sbjct  153   PRNSTPQNGTIQDLEKNASEAKCKELEKKSSNQDGTKESILENPTLENVEKDLSTCTGQP  212

Query  1228  ---------------LRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLN  1094
                              I SASTAL+ G +LG+LQ VFL   AK LL +MGVK  S ML 
Sbjct  213   PAVSTPTVKPKKKEKKHIGSASTALIFGTVLGLLQAVFLAFGAKYLLNVMGVKESSPMLA  272

Query  1093  PALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWG  914
             PA++YL LRSLG+PAVLLSLA+QGIFRG KDT+TPLY    G   NIILD I I  CH G
Sbjct  273   PAMKYLVLRSLGAPAVLLSLAMQGIFRGFKDTRTPLYVIVLGYTTNIILDPILIFVCHLG  332

Query  913   VSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCV  734
             V GAAIAHV+SQY+++L+L ++L+++V+LLPPS + LQ  +FLKNG  L ARVIA TFCV
Sbjct  333   VRGAAIAHVLSQYLIVLVLAWRLMQKVDLLPPSLRDLQFGRFLKNGSLLLARVIAVTFCV  392

Query  733   TLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykkakaaaA  554
             TLAAS+AARLG T MAAFQ CLQ+W+TSSLLADGLA+AGQAILA AFA KDY+K  A A 
Sbjct  393   TLAASMAARLGPTPMAAFQTCLQVWMTSSLLADGLAVAGQAILACAFAEKDYEKTTATAT  452

Query  553   RVL------------QMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGT  410
             R L            QM  VMG GLAV+V   + FG+G+FS+D NV  LI +G+PFVA T
Sbjct  453   RGLQGKNLDSWGLEMQMSLVMGVGLAVIVAAIMLFGAGIFSRDLNVQALIHLGVPFVAAT  512

Query  409   QPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLL  230
             QP+NSLAFV DGVNFGASDF YSAYS+ +V+  TI   FL  KS GF+GIW ALAI+M L
Sbjct  513   QPMNSLAFVFDGVNFGASDFAYSAYSLTLVSIATIISLFLLSKSYGFIGIWTALAIYMAL  572

Query  229   RTIAGLWRLATGTGPWCFLRASTQP  155
             RT+ G  R+ +GTGPW +LR    P
Sbjct  573   RTLVGFLRMGSGTGPWRYLRGPLLP  597



>gb|AHA98248.1| MATE1 [Triticum aestivum]
Length=554

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 230/436 (53%), Positives = 306/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S  +
Sbjct  132   VSVTTSFVAEEDAII--------------SKYLEENNSKDLEKAAHVHSDACNVPASGGE  177

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS ++AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  178   TPVCANSCIPTECADLSNQGCKRRYIPSVTSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  237

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  238   KHDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  297

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  298   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  357

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  358   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDT  417

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             +K  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIP VAGTQ IN
Sbjct  418   EKVIAATSRVLQVSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHKGIPVVAGTQTIN  477

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRT+A
Sbjct  478   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTVA  537

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  538   STWRMGAARGPWVFLR  553



>ref|XP_006645235.1| PREDICTED: MATE efflux family protein 1-like [Oryza brachyantha]
Length=576

 Score =   408 bits (1049),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 241/452 (53%), Positives = 311/452 (69%), Gaps = 31/452 (7%)
 Frame = -2

Query  1471  VNITTSFVAEENSELC---------DDG--------SKEVSAKVYSEEKVAEEPGKDSDQ  1343
             V++TTSFVAEE++ L          DDG        S  V+A +  ++    +P K SD 
Sbjct  137   VSVTTSFVAEEDAILSKGFAGEEDDDDGKVAKAHCDSAAVAADLEKQQVADADPAKASD-  195

Query  1342  LETMENGSLTIPSSETKGSSALSDLEASERDSKVKRGKLR-IPSASTALMMGCILGILQT  1166
                   G  + P+  T       D +A+   +   +GK R +PS ++AL++G +LG+LQ 
Sbjct  196   ------GEDSTPARSTD------DKKAAAAAATGGKGKRRFVPSVTSALIVGALLGLLQA  243

Query  1165  VFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPL  986
             VFL    KPLL +MG+KPGS ML PALRYL +RSLG+PAVLLSLA+QG+FRG KDTKTPL
Sbjct  244   VFLVAAGKPLLRIMGIKPGSPMLIPALRYLVVRSLGAPAVLLSLAMQGVFRGFKDTKTPL  303

Query  985   YATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKH  806
             YAT AGDL NI LD I I +C  GV GAAIAHVISQY++ LI+L KL+R+V+++P S K 
Sbjct  304   YATVAGDLANIALDPILIFSCRLGVVGAAIAHVISQYLITLIMLCKLVRKVDVIPSSLKS  363

Query  805   LQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLA  626
             L+  +F+  G  L ARV+A TFCVT+AASLAAR G+T MAAFQ+C Q+WL +SLLADGLA
Sbjct  364   LKFRRFIGCGFLLLARVVAVTFCVTMAASLAARHGTTAMAAFQICAQVWLATSLLADGLA  423

Query  625   IAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIR  446
             +AGQA++A+AFA +D+ K     ARVLQ+  V+G GL  VV  G++FG+GVF+ D  V+ 
Sbjct  424   VAGQAMIASAFARRDHYKVAVTTARVLQLAVVLGAGLTAVVAAGMWFGAGVFTSDAAVLA  483

Query  445   LITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFV  266
              I  G+PFVAGTQ IN+LAFV DG+NFGASD+ ++AYSMV VAA+TI    L     GFV
Sbjct  484   TIRKGVPFVAGTQTINTLAFVFDGINFGASDYAFAAYSMVGVAAVTIPCLILLSSHGGFV  543

Query  265   GIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             GIW+AL I+M +R  A  WR+    GPW FLR
Sbjct  544   GIWVALTIYMSVRAFASTWRMGAARGPWTFLR  575



>gb|AHA98250.1| MATE1 [Triticum aestivum]
Length=553

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 230/436 (53%), Positives = 306/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S   
Sbjct  131   VSVTTSFVAEEDAII--------------SKYLEENNSKDLEKAAHVHSDACNVPASGGD  176

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS ++AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  177   TPVCANSCIPTECADLSNQGCKRRYIPSVTSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  236

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  237   KHDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  296

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  297   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  356

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T++AAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  357   VVAVTFCVTLASSLAARDGPTIIAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDT  416

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF++D  VI +I  GIPFVAGTQ IN
Sbjct  417   KKVIAATSRVLQVSIVLGMGLTVVLGLFMKFGAGVFTEDAAVIDVIHKGIPFVAGTQTIN  476

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRT+A
Sbjct  477   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTVA  536

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  537   STWRMGAARGPWVFLR  552



>gb|ACN35041.1| unknown [Zea mays]
 tpg|DAA44105.1| TPA: hypothetical protein ZEAMMB73_968567 [Zea mays]
 tpg|DAA44106.1| TPA: hypothetical protein ZEAMMB73_968567 [Zea mays]
 tpg|DAA44107.1| TPA: hypothetical protein ZEAMMB73_968567 [Zea mays]
Length=380

 Score =   401 bits (1031),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 224/378 (59%), Positives = 281/378 (74%), Gaps = 0/378 (0%)
 Frame = -2

Query  1303  SETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLM  1124
             +E   S   ++  A     + +  K  +PS ++AL++G ILG+LQ VFL + A+ +L +M
Sbjct  2     AECVNSCIPTECAADPSGRQGRCEKRYVPSVTSALIVGSILGLLQAVFLVLSARFVLNIM  61

Query  1123  GVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILD  944
             GVK GS M  PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD
Sbjct  62    GVKSGSPMQGPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDAANIILD  121

Query  943   AIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLF  764
              I +  CH GV+GAAIAHV+SQY++ LILL +L++ V ++PPS K L+  +FL  G  L 
Sbjct  122   PILMFVCHMGVTGAAIAHVVSQYMITLILLCRLVQRVHVIPPSIKSLKFGRFLGCGFLLL  181

Query  763   ARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavk  584
             ARV+A TFCVTLAASLAAR G TVMA FQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  
Sbjct  182   ARVVAVTFCVTLAASLAARHGPTVMAGFQICCQLWLATSLLADGLAVAGQAVLASAFAKN  241

Query  583   dykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQP  404
             D KK  AA +RVLQ+  V+G GL VV+GL + FG+G+F+ D  VI++I  GIPFVAGTQ 
Sbjct  242   DSKKVAAATSRVLQLSIVLGMGLTVVLGLAMRFGAGIFTSDVPVIQVIHRGIPFVAGTQT  301

Query  403   INSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRT  224
             INSLAFV DG+NFGASD+ YSAYSMV VA+++I         NGF+GIWIAL I+M LRT
Sbjct  302   INSLAFVFDGINFGASDYRYSAYSMVAVASVSIPCLLYLSAHNGFIGIWIALTIYMSLRT  361

Query  223   IAGLWRLATGTGPWCFLR  170
             IA  WR+    GPW FLR
Sbjct  362   IASTWRMGAARGPWTFLR  379



>gb|KHN33350.1| MATE efflux family protein 1 [Glycine soja]
Length=530

 Score =   406 bits (1043),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 240/423 (57%), Positives = 307/423 (73%), Gaps = 16/423 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEE-PGKDSDQLETMENGSLTIPSSET  1295
             V++TTSFVAEE++   ++   E       E +  E  P KD++  E + +    + +S+ 
Sbjct  93    VSVTTSFVAEEDTLSGENPHIE-------EGRCLETGPPKDAETKELLPHKGGNVHNSDF  145

Query  1294  KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
              G S           +K +R +  IPSAS+A+ +G ILG++Q +FL   AKPLL  MGV 
Sbjct  146   VGESF--------NIAKEERKRRHIPSASSAIFIGGILGLIQAIFLISAAKPLLNFMGVT  197

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
               S ML+PA +YL LRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD+ NI LD +F
Sbjct  198   SDSPMLHPAKQYLKLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDVTNIALDPLF  257

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +     GVSGAAIAHVISQY++ +ILL++L+ +V+L+PPS  HLQL +FLKNG  L  RV
Sbjct  258   MFVFRLGVSGAAIAHVISQYLISVILLWRLLEQVDLIPPSINHLQLDRFLKNGFLLLMRV  317

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAASLAAR G T MAAFQVCLQ+WL  SLLADGLA+AGQAILA AFA KD+ 
Sbjct  318   IAVTFCVTLAASLAARQGPTSMAAFQVCLQVWLAVSLLADGLAVAGQAILAGAFANKDFD  377

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +A A A+RVLQMG V+G  LA ++G+GL+FG+ +F++D NV+ LI IGIPFVA TQP+NS
Sbjct  378   RATATASRVLQMGLVLGMALAFILGIGLHFGAKIFTQDANVLHLIQIGIPFVAVTQPLNS  437

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             +AFV DGVNFGASDF YSA+SMV+VA ++I    +   + GF+GIW+AL I+M LR  AG
Sbjct  438   IAFVFDGVNFGASDFAYSAFSMVVVAILSIICLLILSSAGGFIGIWVALTIYMGLRAFAG  497

Query  214   LWR  206
               R
Sbjct  498   FLR  500



>ref|XP_010278987.1| PREDICTED: MATE efflux family protein 1-like [Nelumbo nucifera]
 ref|XP_010278988.1| PREDICTED: MATE efflux family protein 1-like [Nelumbo nucifera]
Length=563

 Score =   407 bits (1046),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 253/476 (53%), Positives = 322/476 (68%), Gaps = 42/476 (9%)
 Frame = -2

Query  1471  VNITTSFVAEENS----ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIP-  1307
             VNITTSFVAEE++     + +D SK++   +    +++  P + +   E  E G  T   
Sbjct  87    VNITTSFVAEEDAIKTVAIDEDESKDLEKGLSKCCQLSITPSESTSNTEEQEEGFETSTE  146

Query  1306  -------------SSETKGSSALSDLEASERDSKVK-----------------------R  1235
                          +SE K  +   DL  +     V+                        
Sbjct  147   DSHLSNEDTGGAVNSEEKSENLDKDLPINSHTKDVQFDSDTSGYNPPSITGGSSTMLKCA  206

Query  1234  GKLR-IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLG  1058
             GK + I SASTAL++G +LG+ QT+FL + AKPLL  MGV   S ML PA +YLTLRSLG
Sbjct  207   GKRKNIASASTALIVGGVLGLFQTIFLILTAKPLLKFMGVHSDSPMLKPARQYLTLRSLG  266

Query  1057  SPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQ  878
             +PAVLLSLA+QG+FRG+KDTKTPLYAT AGD+ NIILD +FI   H GVSGAAIAHVISQ
Sbjct  267   APAVLLSLAMQGVFRGIKDTKTPLYATVAGDVANIILDPLFIFVLHMGVSGAAIAHVISQ  326

Query  877   YilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGS  698
             Y++ +ILL++L+++V+LLPPS+K LQ  +FLK+G  L  RVI+ TFCVTLAASLAAR GS
Sbjct  327   YLISVILLWRLLQKVDLLPPSAKDLQFWRFLKSGGLLLVRVISVTFCVTLAASLAARHGS  386

Query  697   TVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHg  518
             T MAAFQVCLQIWL +SLLADGLA+ GQAILA++ A KDY KA A  ARVLQ+  V+G  
Sbjct  387   TPMAAFQVCLQIWLATSLLADGLAVGGQAILASSIARKDYNKATATTARVLQLSLVLGLV  446

Query  517   lavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSA  338
             L   +G+G+ F + +F+KD +V+ LI IG PFVA TQPIN LAFV DG+NFG SDF YSA
Sbjct  447   LLSGIGIGMPFAARLFTKDISVLHLIIIGTPFVAATQPINVLAFVFDGINFGVSDFAYSA  506

Query  337   YSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             YSMV+VA ++I   F    S+GF+GIW+ L I++ LR +AG+ R+ TGTGPW FLR
Sbjct  507   YSMVVVAILSILCLFFLSSSHGFIGIWVGLTIYITLRALAGVLRIGTGTGPWHFLR  562



>ref|XP_007028822.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY09324.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=511

 Score =   405 bits (1041),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 244/434 (56%), Positives = 312/434 (72%), Gaps = 18/434 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVA E      D +   SA+   +E +   P  D +  E M       P  E+ 
Sbjct  93    VSITTSFVARE------DATSRSSAEAEQDEILERGPVVDHEMEELM-------PLVESL  139

Query  1291  GS-SALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
              S  A S+ + +E     K  +  IPSAS+AL++G +LGI+QT FL   AKPLL  MGV 
Sbjct  140   SSFVACSNTKIAES----KNERRHIPSASSALVIGSMLGIIQTFFLIFAAKPLLSYMGVN  195

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
               S ML PA +YLT+RS G+PA+LLSLA+QG+FRGLKDT+TPLYA   GD  N+++D IF
Sbjct  196   SESPMLKPAQQYLTIRSTGAPALLLSLAVQGVFRGLKDTRTPLYAIIVGDSANVLMDPIF  255

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             I     GV GAAIAHV+SQY+++LIL ++L+ +V+LLPPS K LQ  +FLKNG  L  +V
Sbjct  256   IFTFGLGVKGAAIAHVLSQYLIVLILFWRLVDKVDLLPPSFKELQFGQFLKNGFLLLVKV  315

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA T CVT+AASL+AR G T MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA KDY+
Sbjct  316   IAVTLCVTVAASLSARQGPTTMAAFQICLQIWLAASLLADGLAVAGQAILASAFAKKDYE  375

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             K  A A+RVLQ+G ++G  L+ ++ +GL F S +F+KD  V++LI++GIPF+A TQPIN+
Sbjct  376   KIIATASRVLQIGILLGLLLSFILVVGLQFASRLFTKDIAVLKLISLGIPFIAATQPINA  435

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DGVN+GASDF YSAYSMV+VA M+I   F+   S+G+VGIW+AL IFM LR IAG
Sbjct  436   LAFVFDGVNYGASDFAYSAYSMVLVAVMSIFCLFILSSSHGYVGIWVALTIFMSLRVIAG  495

Query  214   LWRLATGTGPWCFL  173
             L R+ TG GPW FL
Sbjct  496   LLRIGTGMGPWSFL  509



>gb|AHA98252.1| MATE1 [Triticum aestivum]
Length=553

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 230/436 (53%), Positives = 305/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S   
Sbjct  131   VSVTTSFVAEEDAII--------------SKYIEENNSKDLEKAAHVHSDACNVPASGGD  176

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS ++AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  177   TPVCANSCIPTECADPSNQGCKRRYIPSVTSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  236

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  237   KHDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPI  296

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+AHVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  297   LMFVCHMGVTGAAVAHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  356

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A T CVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D+
Sbjct  357   VVAVTSCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDH  416

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             KK  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIP VAGTQ IN
Sbjct  417   KKVIAATSRVLQVSIVLGMGLTVVLGLFMKFGAGVFTKDATVIDVIHKGIPVVAGTQTIN  476

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRT+A
Sbjct  477   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTVA  536

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  537   STWRMGAARGPWVFLR  552



>gb|AHA98251.1| MATE1 [Triticum aestivum]
Length=554

 Score =   406 bits (1043),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 229/436 (53%), Positives = 305/436 (70%), Gaps = 16/436 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++ +               + + E   KD ++   + + +  +P+S  +
Sbjct  132   VSVTTSFVAEEDAII--------------SKYLEENNSKDLEKAAHVHSDACNVPASGGE  177

Query  1291  GSSALSDLEASERDSKVKRGKLR--IPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                  +    +E      +G  R  IPS ++AL++G  LG++Q VFL   AK +LG+MGV
Sbjct  178   TPVCANSCIPTECADLSNQGCKRRYIPSVTSALIVGSFLGLVQAVFLIFSAKVVLGIMGV  237

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K  S ML PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  238   KHDSPMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDQI  297

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
              +  CH GV+GAA+ HVISQY++ +IL+ +L+++V+++PPS K L+  +FL  G  L AR
Sbjct  298   LMFVCHMGVTGAAVVHVISQYLITMILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLAR  357

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             V+A TFCVTLA+SLAAR G T+MAAFQ+C Q+WL +SLLADGLA+AGQA+LA+AFA  D 
Sbjct  358   VVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLAVAGQAVLASAFAKNDT  417

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             +K  AA +RVLQ+  V+G GL VV+GL + FG+GVF+KD  VI +I  GIP VAGTQ IN
Sbjct  418   EKVIAATSRVLQVSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHKGIPVVAGTQTIN  477

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGA D+ YSAYSMV VA+++I          GF+GIW+AL I+M LRT+A
Sbjct  478   ALAFVFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHKGFIGIWVALTIYMSLRTVA  537

Query  217   GLWRLATGTGPWCFLR  170
               WR+    GPW FLR
Sbjct  538   STWRMGAARGPWVFLR  553



>ref|XP_003627698.1| Aluminum activated citrate transporter [Medicago truncatula]
Length=620

 Score =   408 bits (1048),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 248/465 (53%), Positives = 313/465 (67%), Gaps = 37/465 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVA-EEPGKDSDQLETMENGSL-------  1316
             V+ITTSFVAEE      D  K ++ K    +K    E   +SD ++ +E G+        
Sbjct  161   VSITTSFVAEE------DTIKRMNIKAAENDKSKLTEVTPESDVVQDIEKGTPKESNKAQ  214

Query  1315  ---TIPSSETKGSSALSD---------------LEASERDSKVKRGKL-----RIPSAST  1205
                 +  +ET G+   +D               L +  R SK+K   +      I SAST
Sbjct  215   KESVVGHNETNGTLGNNDKTNGVVMNNEQEPHLLSSDSRSSKIKEIVVKKKKRHIASAST  274

Query  1204  ALMMGCILGILQTVFLTVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQ  1025
             AL+ G ILG+LQ   L   AKPLL +MGVK GS ML PA++YLT RS G+PAVLLSLA+Q
Sbjct  275   ALLFGSILGLLQASVLIFGAKPLLYVMGVKHGSPMLKPAVKYLTYRSFGAPAVLLSLAMQ  334

Query  1024  GIFRGLKDTKTPLYATAAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfkl  845
             GIFRG KDT TPLY   AG  +N++L+ + I     G+ GAAIAHVISQY++   L F L
Sbjct  335   GIFRGFKDTTTPLYVIVAGYSLNVLLEPLLIFKLKMGIKGAAIAHVISQYMMAFTLFFIL  394

Query  844   IREVELLPPSSKHLQLSKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQ  665
             +++V LLPP  K LQ+ +FL+NG  L  +VIA TFCVTLAASLAARLGS  MAAFQ CLQ
Sbjct  395   MKKVYLLPPRIKDLQIFRFLRNGGLLMTKVIAVTFCVTLAASLAARLGSIPMAAFQPCLQ  454

Query  664   IWLTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYF  485
             +WL SSL ADGLAIA QAILA +FA KD  K  AAA R LQ GF++G GL+++VG GLYF
Sbjct  455   VWLASSLFADGLAIAVQAILAGSFAEKDCNKTTAAATRTLQFGFILGAGLSLIVGFGLYF  514

Query  484   GSGVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTI  305
             G+G+FSK+  VI  I IG P VA TQPIN+LAFV DGVN+GASDF Y++YS+V V+ +++
Sbjct  515   GAGIFSKNLQVIHFIRIGAPIVAATQPINTLAFVFDGVNYGASDFAYASYSLVTVSLVSV  574

Query  304   GFEFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             G EFL  +SN F+GIWIAL+I+M LR +AG+WR+ TGTGPW +LR
Sbjct  575   GVEFLLYRSNQFIGIWIALSIYMTLRMLAGVWRMGTGTGPWSYLR  619



>ref|XP_004510956.1| PREDICTED: MATE efflux family protein FRD3-like isoform X2 [Cicer 
arietinum]
Length=527

 Score =   404 bits (1039),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 236/437 (54%), Positives = 300/437 (69%), Gaps = 8/437 (2%)
 Frame = -2

Query  1471  VNITTSFVAEENS-ELCDDGSKEVSAKVYSEEKVAE--EPGKDSDQLETMENGSLTIPSS  1301
             V++TTSFVAEE + E  +  + E  +   +  K     E   +    + +E G+L   + 
Sbjct  94    VSVTTSFVAEEETIERMNIKAAENDSNNNNNNKSKLNSEVTPEDHVHQDIEKGALKENTK  153

Query  1300  ETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
             E     A  + +    D   ++ K  I SASTAL+ G ILG LQ   L   AKPLL +MG
Sbjct  154   E-----APKEYDVGNNDKTNRKKKRHIASASTALLFGSILGFLQASILIFAAKPLLRVMG  208

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             VK GS M   A++YL  RS G+PAVL+SLA+QGIFRG KDT TPLY   AG  +N+IL  
Sbjct  209   VKNGSPMQEHAIKYLIYRSFGAPAVLISLAMQGIFRGFKDTATPLYVILAGYSLNVILGP  268

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             IFI     G+ GAAIAHV+SQY +   L F L++ V LLPP  K LQ+ +FL+NG  L  
Sbjct  269   IFIFKLKMGIRGAAIAHVLSQYTMAFTLFFILMKRVYLLPPRIKDLQIFRFLRNGGLLMT  328

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             +VIA TFCVTLAASLAARLG   MAAFQ  LQ+WL SSLLADGLAIA QAILA +FA KD
Sbjct  329   KVIAVTFCVTLAASLAARLGPIQMAAFQTLLQVWLASSLLADGLAIAVQAILAGSFAEKD  388

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
             Y K  A AAR LQMGFV+G  L++ VG GLYFG+G+FS++ +VI+ I IG+PFVA TQPI
Sbjct  389   YNKTTAVAARTLQMGFVLGVVLSLAVGFGLYFGAGIFSQNAHVIQFIRIGVPFVAVTQPI  448

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTI  221
             N+LAFV DGVN+GASDF Y++YS+V V+ +++  EF F ++  FVGIWIAL+I+M LR +
Sbjct  449   NTLAFVFDGVNYGASDFAYASYSLVTVSLVSVAVEFFFYRTKHFVGIWIALSIYMTLRML  508

Query  220   AGLWRLATGTGPWCFLR  170
             AG+WR+ TGTGPW ++R
Sbjct  509   AGVWRMGTGTGPWSYIR  525



>ref|XP_010906085.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010906086.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Elaeis 
guineensis]
Length=610

 Score =   407 bits (1046),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 241/437 (55%), Positives = 309/437 (71%), Gaps = 17/437 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIP---SS  1301
             V++TTSFVAEE++ +               + + E+  +D ++   +      +P    S
Sbjct  187   VSVTTSFVAEEDAII--------------GQGIEEQHSRDLEKASPVTTNEKELPPCNDS  232

Query  1300  ETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMG  1121
             E +G +         + S+ +  +  IPS S+AL++G +LG+LQ +FL +  + +L +MG
Sbjct  233   EKRGCTVSYISSECTKLSRPQCNRKYIPSVSSALIVGGVLGLLQAMFLILAVRQVLSIMG  292

Query  1120  VKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDA  941
             VK GS ML PALRYLTLRSLGSPAVLLSLA+QG+FRG KDTKTPLYAT  GD+ NIILD 
Sbjct  293   VKSGSPMLTPALRYLTLRSLGSPAVLLSLAMQGVFRGFKDTKTPLYATLVGDVTNIILDP  352

Query  940   IFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFA  761
             I I   H GVSGAAIAHVISQY++ LIL  +L+++V +LPPS K L+ S+FL+ G  L  
Sbjct  353   ILIFVFHLGVSGAAIAHVISQYLITLILFVRLVQQVNILPPSIKALKFSRFLRCGFLLLG  412

Query  760   RVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkd  581
             RVIA TFCVTL ASLAAR G  +MAAFQ+CLQIWL++SLLADGLA+AGQAILA+AFA  D
Sbjct  413   RVIAVTFCVTLGASLAARNGPIIMAAFQICLQIWLSTSLLADGLAVAGQAILASAFARGD  472

Query  580   ykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPI  401
               KA AA ARVLQ+  V+G  L +++GLGL FGSG+F+KD NVI++I  GIPFVAGTQ +
Sbjct  473   LHKAVAATARVLQLSIVLGMALTLLLGLGLQFGSGIFTKDINVIQIIHKGIPFVAGTQML  532

Query  400   NSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTI  221
             NSLAFV DG+NFGASD+ YSAYSMV VAA++I        ++GF+GIW  L I+M LRT 
Sbjct  533   NSLAFVFDGINFGASDYTYSAYSMVAVAAVSIPCLVYLSSTHGFIGIWTGLTIYMSLRTF  592

Query  220   AGLWRLATGTGPWCFLR  170
             A  WR+    GPW F+R
Sbjct  593   ASTWRMGAARGPWTFIR  609



>dbj|BAO45881.1| MATE family transporter [Acacia mangium]
Length=505

 Score =   403 bits (1036),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 237/441 (54%), Positives = 303/441 (69%), Gaps = 15/441 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTS VAEE S    +         + EEK     G   D     E   L +      
Sbjct  78    VSVTTSLVAEEESAEKTEN--------HDEEKELLTRGSSVD-----EEMRLNVEVQAEA  124

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              S++ S      + +K    ++ IPSAS+A+++G ILGILQ +FL   AKPLL  MG+  
Sbjct  125   ESTSSSSSANVGKAAKYNHCRIYIPSASSAMVVGSILGILQALFLIFSAKPLLHYMGIDS  184

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S +L PA++YLTLRS G+PAV+LS+A+QGIFRG+KD KTPLYA   GD+ NIILD IFI
Sbjct  185   DSPVLKPAIQYLTLRSFGAPAVILSMAMQGIFRGIKDAKTPLYAAIIGDVTNIILDPIFI  244

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  G+ GAAIAH+ SQY++ LILL+ L+++V+LLPPS+K  Q  K LKNG  +  RV 
Sbjct  245   FILKLGIRGAAIAHITSQYMISLILLWSLMKQVDLLPPSTKDFQFEKILKNGFLILLRVS  304

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             AATFCVTLAASLAAR GS  MAAFQVCLQIW+ SSL+ADGLA+AGQAILA+AFA KDYKK
Sbjct  305   AATFCVTLAASLAARQGSITMAAFQVCLQIWMASSLIADGLAVAGQAILASAFASKDYKK  364

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
                AA+RVLQ+G ++G  L+ ++   L   S +F+ D +V++LI +GIP+VA TQPIN+L
Sbjct  365   VMTAASRVLQLGLILGLVLSFLLFCLLPLASKLFTDDIHVLQLIRVGIPYVAVTQPINTL  424

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DG+N+GASDF Y AYSM+MVA ++I   F      GF GIWIAL+I+M LR  AG 
Sbjct  425   AFVFDGINYGASDFTYCAYSMIMVAILSILCLFTLSSIQGFAGIWIALSIYMSLRAFAGF  484

Query  211   WRLATGTGPWCFLR--ASTQP  155
             WRL + TGPW FLR  ++T P
Sbjct  485   WRLGSETGPWIFLRDNSATPP  505



>ref|XP_008645634.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=577

 Score =   405 bits (1042),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 243/463 (52%), Positives = 308/463 (67%), Gaps = 38/463 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKV--AEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTSFVAEE++ +    SK V      EE V  A   G D +      +G      +E
Sbjct  123   VSVTTSFVAEEDAII----SKAVRGNSSQEEDVEKASHVGFDPETSNLHASGM-----AE  173

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                S   ++  A     + +  K  +PS ++AL++G ILG+LQ VFL + A+ +L +MGV
Sbjct  174   CVNSCIPTECAADPSGRQGRCEKRYVPSVTSALIVGSILGLLQAVFLVLSARFVLNIMGV  233

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K GS M  PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  234   KSGSPMQGPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDAANIILDPI  293

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFL---------  785
              +  CH GV+GAAIAHV+SQY++ LILL +L++ V ++PPS K L+  +FL         
Sbjct  294   LMFVCHMGVTGAAIAHVVSQYMITLILLCRLVQRVHVIPPSIKSLKFGRFLGCGEIPLES  353

Query  784   ------------------KNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIW  659
                                +G  L ARV+A TFCVTLAASLAAR G TVMA FQ+C Q+W
Sbjct  354   RARIIISTLRKEIELFVSASGFLLLARVVAVTFCVTLAASLAARHGPTVMAGFQICCQLW  413

Query  658   LTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGS  479
             L +SLLADGLA+AGQA+LA+AFA  D KK  AA +RVLQ+  V+G GL VV+GL + FG+
Sbjct  414   LATSLLADGLAVAGQAVLASAFAKNDSKKVAAATSRVLQLSIVLGMGLTVVLGLAMRFGA  473

Query  478   GVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGF  299
             G+F+ D  VI++I  GIPFVAGTQ INSLAFV DG+NFGASD+ YSAYSMV VA+++I  
Sbjct  474   GIFTSDVPVIQVIHRGIPFVAGTQTINSLAFVFDGINFGASDYRYSAYSMVAVASVSIPC  533

Query  298   EFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
                    NGF+GIWIAL I+M LRTIA  WR+    GPW FLR
Sbjct  534   LLYLSAHNGFIGIWIALTIYMSLRTIASTWRMGAARGPWTFLR  576



>ref|XP_008645624.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 ref|XP_008645628.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=580

 Score =   405 bits (1042),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 243/463 (52%), Positives = 309/463 (67%), Gaps = 35/463 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKV--AEEPGKDSDQLETMENGSLTIPSSE  1298
             V++TTSFVAEE++ +    SK V      EE V  A   G D +      +G   +  +E
Sbjct  123   VSVTTSFVAEEDAII----SKAVRGNSSQEEDVEKASHVGFDPETSNLHASGPAGM--AE  176

Query  1297  TKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
                S   ++  A     + +  K  +PS ++AL++G ILG+LQ VFL + A+ +L +MGV
Sbjct  177   CVNSCIPTECAADPSGRQGRCEKRYVPSVTSALIVGSILGLLQAVFLVLSARFVLNIMGV  236

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
             K GS M  PA+RYLT+RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GD  NIILD I
Sbjct  237   KSGSPMQGPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDAANIILDPI  296

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFL---------  785
              +  CH GV+GAAIAHV+SQY++ LILL +L++ V ++PPS K L+  +FL         
Sbjct  297   LMFVCHMGVTGAAIAHVVSQYMITLILLCRLVQRVHVIPPSIKSLKFGRFLGCGEIPLES  356

Query  784   ------------------KNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIW  659
                                +G  L ARV+A TFCVTLAASLAAR G TVMA FQ+C Q+W
Sbjct  357   RARIIISTLRKEIELFVSASGFLLLARVVAVTFCVTLAASLAARHGPTVMAGFQICCQLW  416

Query  658   LTSSLLADGLAIAGQAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGS  479
             L +SLLADGLA+AGQA+LA+AFA  D KK  AA +RVLQ+  V+G GL VV+GL + FG+
Sbjct  417   LATSLLADGLAVAGQAVLASAFAKNDSKKVAAATSRVLQLSIVLGMGLTVVLGLAMRFGA  476

Query  478   GVFSKDKNVIRLITIGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGF  299
             G+F+ D  VI++I  GIPFVAGTQ INSLAFV DG+NFGASD+ YSAYSMV VA+++I  
Sbjct  477   GIFTSDVPVIQVIHRGIPFVAGTQTINSLAFVFDGINFGASDYRYSAYSMVAVASVSIPC  536

Query  298   EFLFLKSNGFVGIWIALAIFMLLRTIAGLWRLATGTGPWCFLR  170
                    NGF+GIWIAL I+M LRTIA  WR+    GPW FLR
Sbjct  537   LLYLSAHNGFIGIWIALTIYMSLRTIASTWRMGAARGPWTFLR  579



>ref|XP_010257242.1| PREDICTED: MATE efflux family protein 1-like [Nelumbo nucifera]
Length=497

 Score =   402 bits (1034),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 254/439 (58%), Positives = 323/439 (74%), Gaps = 17/439 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSE---LCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTI--P  1307
             V +TTS VAEE++      +   +++  ++ +  + +    + + ++E  EN   T+  P
Sbjct  70    VCVTTSSVAEEDAVEEVTVEKEGQDLEKRLANNYQSSTIDTETTVRVEEQENSDRTVDNP  129

Query  1306  SSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGL  1127
              S T G+S++S  E   ++         IPSASTAL++G +LG+LQT+     AKPLL  
Sbjct  130   PSTTSGNSSMSKCENKRKN---------IPSASTALVVGGVLGLLQTMLPIFAAKPLLKF  180

Query  1126  MGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIIL  947
             MGV   S ML PA +YLTLRSLG+P +LLSLA+QG+FRG KDTKTPLYAT AGD+ NIIL
Sbjct  181   MGVHSDSPMLRPARQYLTLRSLGAPVILLSLAMQGVFRGFKDTKTPLYATVAGDVSNIIL  240

Query  946   DAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWL  767
             D +F+   H GVSGAAIAHVISQY++ +ILL++L+++VELLPPS K LQ S+FLKNG  L
Sbjct  241   DPVFMFVFHMGVSGAAIAHVISQYLISVILLWRLMQKVELLPPSIKDLQFSRFLKNGGLL  300

Query  766   FARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafav  587
              ARVIA TFC TLAASL+AR GST MAAFQVC +IWL +SLL+DGLA+   +ILA+AFA 
Sbjct  301   LARVIAVTFCQTLAASLSARHGSTPMAAFQVCYEIWLATSLLSDGLAV---SILASAFAR  357

Query  586   kdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQ  407
             KDY+KA AA +RVLQ+G V+G  LAV +G+GL F + +F+KD NV+ LI IG PFVA TQ
Sbjct  358   KDYRKAIAATSRVLQLGLVLGLVLAVGLGIGLPFAARLFTKDNNVLHLIIIGTPFVAATQ  417

Query  406   PINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLR  227
             PIN+LAFVLDGVNFG SDF Y AYSMVMVA M+I   F+   SNGFVGIW+AL I+M LR
Sbjct  418   PINTLAFVLDGVNFGLSDFAYCAYSMVMVAMMSIPCLFVLSSSNGFVGIWVALTIYMTLR  477

Query  226   TIAGLWRLATGTGPWCFLR  170
              +AG+WR+ TGTGPW FLR
Sbjct  478   ALAGVWRVGTGTGPWHFLR  496



>ref|XP_006306101.1| hypothetical protein CARUB_v10011528mg [Capsella rubella]
 gb|EOA38999.1| hypothetical protein CARUB_v10011528mg [Capsella rubella]
Length=515

 Score =   402 bits (1032),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 252/437 (58%), Positives = 311/437 (71%), Gaps = 14/437 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V+ITTSFVAEE++      + +       + K   E G ++ + ET E     IP +   
Sbjct  91    VSITTSFVAEEDAYSSQQDTVQ-------DHKECTEAGINNTKEETQE----LIPENNED  139

Query  1291  GSSALSDLEASERDSKVKRGKLRI-PSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
               S  S   +S         + RI PSAS+AL++G ILG+LQ VFL   AKPLL  MGVK
Sbjct  140   SISDESKTSSSIFSVSKSPIRKRIIPSASSALIIGSILGLLQAVFLISAAKPLLSFMGVK  199

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
               S ML PA RYL+LRSLG+PAVLLSLA QG+FRG KDT TPLYAT  GD  NIILD IF
Sbjct  200   HDSPMLRPAQRYLSLRSLGAPAVLLSLATQGVFRGFKDTTTPLYATVIGDATNIILDPIF  259

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             I     GV+GAAIAHVISQY++  ILL++L+ +V++   S+KHLQL +F+KNGL L  RV
Sbjct  260   IFVFRLGVTGAAIAHVISQYLMCGILLWQLMGQVDIFNLSTKHLQLCRFMKNGLLLLMRV  319

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTL+ASLAAR GS  MAAFQVCLQ+WL +SLLADG A+AGQAILA+AFA KDYK
Sbjct  320   IAVTFCVTLSASLAAREGSISMAAFQVCLQVWLATSLLADGFAVAGQAILASAFANKDYK  379

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +A A A+RVLQ+G V+G  LA ++G  L+FG+ VF+KD  V+ LI+IG+PFVAGTQPIN+
Sbjct  380   RAAATASRVLQLGLVLGVLLAAILGAALHFGARVFTKDDKVLHLISIGLPFVAGTQPINA  439

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSN-GFVGIWIALAIFMLLRTIA  218
             LAFV DGVNFGASDF Y+A S+V+VA ++I    LFL S  GF+G+W  L I+M  R   
Sbjct  440   LAFVFDGVNFGASDFGYAAASLVVVAIVSI-MCLLFLSSTLGFIGLWFGLTIYMSFRAAV  498

Query  217   GLWRLATGTGPWCFLRA  167
             G WR+ TGTGPW FLR+
Sbjct  499   GFWRIGTGTGPWSFLRS  515



>gb|EEC66697.1| hypothetical protein OsI_33017 [Oryza sativa Indica Group]
Length=521

 Score =   402 bits (1033),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 247/435 (57%), Positives = 317/435 (73%), Gaps = 14/435 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++   D    E++ +  +E  V+     DS+  E + +        E  
Sbjct  89    VSVTTSFVAEEDATSSDREKYEINGE--NEFNVS-----DSEMEELVSH-------EEAS  134

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              + + S  E    D K++  +  IPS STAL++G +LG+LQ + L + AKPLLG MGVK 
Sbjct  135   AAPSKSSFETDSSDVKIEHKRKNIPSVSTALLLGGVLGLLQALLLVICAKPLLGYMGVKQ  194

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
             GS ML PAL+YL +RSLG+PAVLLSLA+QG+FRGLKDTKTPLYAT AGD  NI+LD IF+
Sbjct  195   GSAMLMPALKYLVVRSLGAPAVLLSLAMQGVFRGLKDTKTPLYATVAGDATNIVLDPIFM  254

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                 +GVSGAAIAHVISQY +  ILL++L   V+LLPPS KH+Q S+FLKNG  L ARVI
Sbjct  255   FVFQYGVSGAAIAHVISQYFIASILLWRLRLHVDLLPPSFKHMQFSRFLKNGFLLLARVI  314

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             AAT CVTL+AS+AARLGS  MAAFQ+CLQIWL SSLLADGLA AGQAILA+AFA +D+ K
Sbjct  315   AATCCVTLSASMAARLGSVPMAAFQICLQIWLASSLLADGLAFAGQAILASAFARQDHSK  374

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+R+LQ+G V+G  L++ +G+GL  GS +F+ D++V+  I +GIPFV+ TQPIN+L
Sbjct  375   AAATASRILQLGLVLGLLLSIFLGIGLRLGSRLFTDDQDVLHHIYLGIPFVSLTQPINAL  434

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DG+N+GASDF Y+AYSM++VA ++I F       NGFVGIWIAL ++M LR +AG 
Sbjct  435   AFVFDGINYGASDFGYAAYSMILVAIVSIIFIVTLASYNGFVGIWIALTVYMSLRMLAGF  494

Query  211   WRLATGTGPWCFLRA  167
              R+ T  GPW F  A
Sbjct  495   LRIGTARGPWTFYAA  509



>ref|NP_001064314.1| Os10g0206800 [Oryza sativa Japonica Group]
 gb|AAL82672.2|AC092387_20 putative membrane protein [Oryza sativa Japonica Group]
 gb|ABB47036.2| MATE efflux family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26228.1| Os10g0206800 [Oryza sativa Japonica Group]
 dbj|BAG95152.1| unnamed protein product [Oryza sativa Japonica Group]
Length=537

 Score =   402 bits (1033),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 247/435 (57%), Positives = 317/435 (73%), Gaps = 14/435 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE++   D    E++ +  +E  V+     DS+  E + +        E  
Sbjct  105   VSVTTSFVAEEDATSSDREKYEINGE--NEFNVS-----DSEMEELVSH-------EEAS  150

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              + + S  E    D K++  +  IPS STAL++G +LG+LQ + L + AKPLLG MGVK 
Sbjct  151   AAPSKSSFETDSSDVKIEHKRKNIPSVSTALLLGGVLGLLQALLLVICAKPLLGYMGVKQ  210

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
             GS ML PAL+YL +RSLG+PAVLLSLA+QG+FRGLKDTKTPLYAT AGD  NI+LD IF+
Sbjct  211   GSAMLMPALKYLVVRSLGAPAVLLSLAMQGVFRGLKDTKTPLYATVAGDATNIVLDPIFM  270

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                 +GVSGAAIAHVISQY +  ILL++L   V+LLPPS KH+Q S+FLKNG  L ARVI
Sbjct  271   FVFQYGVSGAAIAHVISQYFIASILLWRLRLHVDLLPPSFKHMQFSRFLKNGFLLLARVI  330

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             AAT CVTL+AS+AARLGS  MAAFQ+CLQIWL SSLLADGLA AGQAILA+AFA +D+ K
Sbjct  331   AATCCVTLSASMAARLGSVPMAAFQICLQIWLASSLLADGLAFAGQAILASAFARQDHSK  390

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A A A+R+LQ+G V+G  L++ +G+GL  GS +F+ D++V+  I +GIPFV+ TQPIN+L
Sbjct  391   AAATASRILQLGLVLGLLLSIFLGIGLRLGSRLFTDDQDVLHHIYLGIPFVSLTQPINAL  450

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DG+N+GASDF Y+AYSM++VA ++I F       NGFVGIWIAL ++M LR +AG 
Sbjct  451   AFVFDGINYGASDFGYAAYSMILVAIVSIIFIVTLASYNGFVGIWIALTVYMSLRMLAGF  510

Query  211   WRLATGTGPWCFLRA  167
              R+ T  GPW F  A
Sbjct  511   LRIGTARGPWTFYAA  525



>emb|CDX74015.1| BnaA03g30320D [Brassica napus]
Length=512

 Score =   401 bits (1030),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 251/429 (59%), Positives = 309/429 (72%), Gaps = 18/429 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS-------ELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLT  1313
             V++TTSFVAEEN+       E     +  V A   + +   E+ G  S     M     T
Sbjct  95    VSVTTSFVAEENTMEKIKEEEEEAKKNNRVHANTLAVQDSLEK-GIASPTSNNMNQPQQT  153

Query  1312  IPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
              P+S+TK SS     +  +++ K         SASTA+++G ILG++Q +FL   +K LL
Sbjct  154   -PASDTKSSSGNKANKKGKKNIK---------SASTAMIIGLILGLVQAIFLIFSSKVLL  203

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
             G+MGVKP S +L+PA +YLT+RSLG+PA+LLSL++QGIFRG KDTKTPLYAT   D++NI
Sbjct  204   GVMGVKPNSAVLSPAHKYLTIRSLGAPALLLSLSMQGIFRGFKDTKTPLYATIVADVINI  263

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             ILD IFI   H G+SGAAIAHVISQY + LIL  +L  +V L+PP+   LQ  KFLKNG 
Sbjct  264   ILDPIFIFVLHLGISGAAIAHVISQYFMTLILFTRLASKVNLMPPNFAALQFGKFLKNGG  323

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L AR IA TFC TLAA++AARLG+T MAAFQ+CLQ+WLT+SLLADGLA+AGQAILA +F
Sbjct  324   LLLARTIAVTFCQTLAAAMAARLGATPMAAFQICLQVWLTTSLLADGLAVAGQAILACSF  383

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
               KDY K  + A+RVLQMGFV+G GL+V VGLGLYFG+G+F+KD  VI LI IGIPFVA 
Sbjct  384   TEKDYNKVSSCASRVLQMGFVLGLGLSVFVGLGLYFGAGIFTKDPAVIHLIAIGIPFVAA  443

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFML  233
             TQPINSLAFVLDGVNFGASDF Y+AYSMV VAA++I       K NGF+GIWIAL I+M 
Sbjct  444   TQPINSLAFVLDGVNFGASDFAYTAYSMVGVAAISIAAIIYMAKFNGFLGIWIALTIYMG  503

Query  232   LRTIAGLWR  206
             LR I G+ R
Sbjct  504   LRAITGIAR  512



>ref|XP_007132021.1| hypothetical protein PHAVU_011G060000g [Phaseolus vulgaris]
 gb|ESW04015.1| hypothetical protein PHAVU_011G060000g [Phaseolus vulgaris]
Length=516

 Score =   400 bits (1029),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 252/437 (58%), Positives = 312/437 (71%), Gaps = 15/437 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIP-SSET  1295
             V++TTSFVAEE      D       +V   E +   P  D++  E        IP   +T
Sbjct  93    VSVTTSFVAEE------DTLSGACPQVEKNEWLEASPIIDAEMKEL-------IPLEKDT  139

Query  1294  KGSSALSDLEASERD-SKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGV  1118
              G+   SDL   + +  K +  K  I SAS+AL++G I+GI+Q +FL   AKPLL  MGV
Sbjct  140   GGNVQKSDLIGIDFNIVKFEHKKRHISSASSALLIGGIVGIIQAMFLISAAKPLLNFMGV  199

Query  1117  KPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAI  938
                S MLN A  YLTLRSLG+PAVLLSL +QGIFRG KDTKTPLYAT  GD+ N+ LD +
Sbjct  200   TSDSLMLNHAHNYLTLRSLGAPAVLLSLTMQGIFRGFKDTKTPLYATLVGDVTNVALDPL  259

Query  937   FILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFAR  758
             FI    +GVSGAA+AHVISQY++ L+LL+ L+ +V+L+PPS KHLQ  +FLKNG  LF R
Sbjct  260   FIFVFRFGVSGAAVAHVISQYLISLMLLWSLMEKVDLIPPSIKHLQFHRFLKNGFLLFVR  319

Query  757   VIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdy  578
             VIA TFCVTLAA+LAAR G T MAAFQVCLQIWL  SLLADGLA+AGQAILA AFA KDY
Sbjct  320   VIAVTFCVTLAAALAARKGPTSMAAFQVCLQIWLAVSLLADGLAVAGQAILAGAFANKDY  379

Query  577   kkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPIN  398
             +KA+A A+RVLQ+G V+G  LA ++G GL+FG+ +F+KD NVI LI IGIPFVA TQP+N
Sbjct  380   EKAEATASRVLQLGLVLGLALAFILGTGLHFGAKLFTKDVNVIHLIRIGIPFVAATQPLN  439

Query  397   SLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIA  218
             +LAFV DG+NFGASDF YSA S+V+VA ++I    +     GF GIWIAL+I+M LR I 
Sbjct  440   ALAFVFDGINFGASDFAYSAISLVVVAIVSIICLLVLSSVGGFTGIWIALSIYMGLRAIV  499

Query  217   GLWRLATGTGPWCFLRA  167
             GL R+ TG+GPW  +R+
Sbjct  500   GLLRIGTGSGPWKLIRS  516



>ref|XP_007133824.1| hypothetical protein PHAVU_011G211900g [Phaseolus vulgaris]
 gb|ESW05818.1| hypothetical protein PHAVU_011G211900g [Phaseolus vulgaris]
Length=532

 Score =   400 bits (1028),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 244/433 (56%), Positives = 309/433 (71%), Gaps = 15/433 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKD--------SDQLETMENGSL  1316
             V+ITTSFVAEE++    +   +    V  E+ + ++  K+        S  L+ +EN + 
Sbjct  93    VSITTSFVAEEDTLEKLNNKSKFKEVVVPEDHMLQDLQKEKPMVEKCESKDLQALENYNA  152

Query  1315  TI---PSSETKGSSALSDLEAS-ERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVL  1148
             T    P    KG+  +     S E+D K KR   RI SASTAL+ G ILG++Q   L   
Sbjct  153   TRDNDPEIGDKGNKKICKCSKSMEKDEKKKR---RIASASTALLFGTILGLIQASVLIFA  209

Query  1147  AKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAG  968
             AKPLL +MGVKP S MLN A +YL LRS+G+PAVLLSLA+QGIFRG KDTKTPLY   +G
Sbjct  210   AKPLLRVMGVKPDSPMLNQAEKYLKLRSIGAPAVLLSLAMQGIFRGFKDTKTPLYVIVSG  269

Query  967   DLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKF  788
               +N+ILD I I     G+ GAAI+HV+SQY++ + LL  L+++V LLPPS K LQ+ +F
Sbjct  270   YTLNVILDPILIFTLKLGLKGAAISHVLSQYMMAITLLLILMKKVHLLPPSIKDLQIFRF  329

Query  787   LKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAI  608
             LKNG  L  RVIA TFCVTLAASLAARLGS  MAAFQ CLQ+WLTSSLLADGLA+A QAI
Sbjct  330   LKNGGLLMIRVIAVTFCVTLAASLAARLGSVPMAAFQTCLQVWLTSSLLADGLAVAVQAI  389

Query  607   LATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGI  428
             LA +FA KD+KKA  AA + LQM FV+G GL++ VGLGLYFG+G+FSK+ +V+  I I I
Sbjct  390   LACSFAEKDHKKATTAATKTLQMSFVLGMGLSLAVGLGLYFGAGIFSKNVHVLHFIKISI  449

Query  427   PFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIAL  248
             PFVA TQPINSLAFV DGVN+GASDF YSAYS+V+V+ +++  EF+  ++  F+GIWIAL
Sbjct  450   PFVAATQPINSLAFVFDGVNYGASDFAYSAYSLVVVSLVSVAIEFVLYRAKHFIGIWIAL  509

Query  247   AIFMLLRTIAGLW  209
              I+M LR +AG+W
Sbjct  510   TIYMTLRMLAGVW  522



>ref|XP_004516070.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004516071.1| PREDICTED: MATE efflux family protein 1-like isoform X2 [Cicer 
arietinum]
Length=506

 Score =   399 bits (1025),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 227/434 (52%), Positives = 309/434 (71%), Gaps = 12/434 (3%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTS VAEE++   D    + S K   E  +      +  +LE  EN    I  ++ +
Sbjct  78    VSVTTSLVAEEDA--ADKLQIQPSVK---EMLIKSSSVNEEIKLEVEEN----IDQADHE  128

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
              S++ +++E   R  K    K  IPSAS+A+++G +LG+LQ +F+   AKP+L  MG+  
Sbjct  129   CSTSSTNIE---RVVKFGHEKSYIPSASSAIIIGGVLGVLQALFIIFTAKPVLNYMGIHS  185

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S ML PA +YL LRS GSPAV+LS+AIQGIFRG+KDT+TPLYAT  GD+ NIILD + +
Sbjct  186   NSPMLKPAQQYLILRSFGSPAVILSMAIQGIFRGIKDTRTPLYATIMGDVTNIILDPLLM  245

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                 +GVSGAAIAH+ISQY++ L+LL+ L+ +V LLPPS +  Q  K LKNG  L  +V 
Sbjct  246   FTFRFGVSGAAIAHIISQYLISLMLLWSLMNQVVLLPPSIQDFQFGKILKNGFLLLVKVT  305

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             A TFCVTL+ASLAAR G+T MAAFQ+CLQIW+ +SLLADGLA+AGQAI+A+A A  DY  
Sbjct  306   AVTFCVTLSASLAARQGTTTMAAFQICLQIWMATSLLADGLAVAGQAIIASASARSDYNM  365

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
               A+A+RVLQ+G ++G  L+ ++   L F S +F+ D +V++LI+IGIP+VA TQPIN+L
Sbjct  366   VIASASRVLQLGLILGLLLSFLLFSLLPFVSRLFTNDTDVLQLISIGIPYVAATQPINAL  425

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DG+N+G SDF YSAYSM+MVA+++I   ++   S GF GIWIAL+I+M LR +AG 
Sbjct  426   AFVFDGINYGVSDFIYSAYSMIMVASVSIFCLYMLSSSLGFTGIWIALSIYMTLRILAGF  485

Query  211   WRLATGTGPWCFLR  170
             WR+ T +GPW FL+
Sbjct  486   WRIGTRSGPWSFLK  499



>ref|XP_004510957.1| PREDICTED: MATE efflux family protein FRD3-like isoform X3 [Cicer 
arietinum]
Length=479

 Score =   397 bits (1021),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 236/449 (53%), Positives = 302/449 (67%), Gaps = 18/449 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENS-ELCDDGSKEVSAKVYSEEKVAE--EPGKDSDQLETMENGSLTIPSS  1301
             V++TTSFVAEE + E  +  + E  +   +  K     E   +    + +E G+L     
Sbjct  32    VSVTTSFVAEEETIERMNIKAAENDSNNNNNNKSKLNSEVTPEDHVHQDIEKGAL---KE  88

Query  1300  ETKGSSALSDLEASERDSKVKRGKL------------RIPSASTALMMGCILGILQTVFL  1157
              TK +    D+  +++ ++V                  I SASTAL+ G ILG LQ   L
Sbjct  89    NTKEAPKEYDVGNNDKTNRVDANNKSKDIVVKKKKKRHIASASTALLFGSILGFLQASIL  148

Query  1156  TVLAKPLLGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYAT  977
                AKPLL +MGVK GS M   A++YL  RS G+PAVL+SLA+QGIFRG KDT TPLY  
Sbjct  149   IFAAKPLLRVMGVKNGSPMQEHAIKYLIYRSFGAPAVLISLAMQGIFRGFKDTATPLYVI  208

Query  976   AAGDLVNIILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQL  797
              AG  +N+IL  IFI     G+ GAAIAHV+SQY +   L F L++ V LLPP  K LQ+
Sbjct  209   LAGYSLNVILGPIFIFKLKMGIRGAAIAHVLSQYTMAFTLFFILMKRVYLLPPRIKDLQI  268

Query  796   SKFLKNGLWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAG  617
              +FL+NG  L  +VIA TFCVTLAASLAARLG   MAAFQ  LQ+WL SSLLADGLAIA 
Sbjct  269   FRFLRNGGLLMTKVIAVTFCVTLAASLAARLGPIQMAAFQTLLQVWLASSLLADGLAIAV  328

Query  616   QAILATafavkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLIT  437
             QAILA +FA KDY K  A AAR LQMGFV+G  L++ VG GLYFG+G+FS++ +VI+ I 
Sbjct  329   QAILAGSFAEKDYNKTTAVAARTLQMGFVLGVVLSLAVGFGLYFGAGIFSQNAHVIQFIR  388

Query  436   IGIPFVAGTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIW  257
             IG+PFVA TQPIN+LAFV DGVN+GASDF Y++YS+V V+ +++  EF F ++  FVGIW
Sbjct  389   IGVPFVAVTQPINTLAFVFDGVNYGASDFAYASYSLVTVSLVSVAVEFFFYRTKHFVGIW  448

Query  256   IALAIFMLLRTIAGLWRLATGTGPWCFLR  170
             IAL+I+M LR +AG+WR+ TGTGPW ++R
Sbjct  449   IALSIYMTLRMLAGVWRMGTGTGPWSYIR  477



>emb|CDP18659.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   398 bits (1023),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 245/442 (55%), Positives = 313/442 (71%), Gaps = 35/442 (8%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE      D +K +S               DS ++E +ENG     +++ +
Sbjct  93    VSVTTSFVAEE------DATKSLSI--------------DSQEIEIVENGF----AADGE  128

Query  1291  GSSALSDLEASERDSKVKRGKL--------RIPSASTALMMGCILGILQTVFLTVLAKPL  1136
                 L  +E S +     +GK+           SAS+AL++GCILGI+Q +FL   AKPL
Sbjct  129   KEELLPKVELSSKSFSSSQGKVVDGRRNSRHNSSASSALLIGCILGIIQAIFLIFAAKPL  188

Query  1135  LGLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVN  956
             L  MGV+  S MLNPA +YL +RSLG+PAVLLSLA+QG+FRG KDTKTPLYAT  GDL N
Sbjct  189   LNYMGVESNSPMLNPAQKYLIVRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATMIGDLTN  248

Query  955   IILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNG  776
             IILD IFI     GV+GAA+AHVISQY + LIL+++L+ EV+LL PS K LQL +FLKNG
Sbjct  249   IILDPIFIFLFGLGVTGAAVAHVISQYFISLILMWRLMSEVDLLAPSIKDLQLGRFLKNG  308

Query  775   LWLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATa  596
               L  RVIAATFCVTLAASLAAR+GST MAAFQVCLQ+WL +SLLADGLA++GQAILA+A
Sbjct  309   FLLLLRVIAATFCVTLAASLAARVGSTSMAAFQVCLQVWLATSLLADGLAVSGQAILASA  368

Query  595   favkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVA  416
             FA  DY++A   A+RVLQ+G V+G  L+++V + L + S +F+ D NV+ L+++GIPFV 
Sbjct  369   FAKNDYERATTTASRVLQLGLVLGLVLSLIVIVILKYASTIFTADINVLHLLSLGIPFVV  428

Query  415   GTQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFM  236
              TQPINS+AFV DG+N+GASDF YSAYSM  V+ + +          GFVGIW+AL+IFM
Sbjct  429   VTQPINSVAFVFDGINYGASDFSYSAYSMATVSIILLLLL---SSRFGFVGIWLALSIFM  485

Query  235   LLRTIAGLWRLATGTGPWCFLR  170
              LR +AG WR+ T TGPW +LR
Sbjct  486   SLRALAGFWRIGTRTGPWRYLR  507



>ref|XP_010234680.1| PREDICTED: MATE efflux family protein 1-like isoform X1 [Brachypodium 
distachyon]
Length=502

 Score =   398 bits (1022),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 245/435 (56%), Positives = 315/435 (72%), Gaps = 17/435 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTSFVAEE+    D   ++V     SE  V++    + D+L + E+      +S T 
Sbjct  85    VSVTTSFVAEEDVTSSD--RQKVETNKESEHNVSDS---EMDELISSED------TSATS  133

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
               S+LS L   E + K       IPS ST+L++  +LG+LQT+ L   +KP+L  MG+KP
Sbjct  134   RKSSLSSLVNIEHNRK------SIPSVSTSLLLAGVLGLLQTLLLVFYSKPILDFMGLKP  187

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S MLNPAL+YL LRSLG+PA LLSLA+QG+FRGLKDTKTPLYAT AGD  NI+LD IF+
Sbjct  188   DSGMLNPALQYLVLRSLGAPATLLSLAMQGVFRGLKDTKTPLYATVAGDATNIVLDPIFM  247

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                 +GVSGAAIAHVISQY +  ILL++L   V+LL PS KHLQ+ +FLKNG  L ARVI
Sbjct  248   FVFKYGVSGAAIAHVISQYFIAAILLWRLRLHVDLLQPSLKHLQIGRFLKNGFLLLARVI  307

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             AAT C+TL+AS+AARLGST MAAFQ+CLQIWL SSLL+DGLA A QAILA AFA KDY K
Sbjct  308   AATCCITLSASMAARLGSTPMAAFQICLQIWLASSLLSDGLAFAAQAILAGAFARKDYSK  367

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
             A   A+RVLQ+GF++G  L+V++G+GL  GS +F++DK+V+  I +  PFVA TQPIN+L
Sbjct  368   ATVTASRVLQLGFILGLLLSVLLGVGLRLGSRLFTEDKDVLHHIYVATPFVALTQPINAL  427

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGV++GASDF Y+AYSM++VA  ++         +GF+GIWIAL+I+M LR  AG 
Sbjct  428   AFVSDGVSYGASDFAYAAYSMILVAIASVICIVTLTSYSGFLGIWIALSIYMSLRMFAGF  487

Query  211   WRLATGTGPWCFLRA  167
             WR+ +  GPW FLR+
Sbjct  488   WRIGSARGPWAFLRS  502



>gb|KHN13754.1| MATE efflux family protein 1 [Glycine soja]
Length=501

 Score =   398 bits (1022),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 225/437 (51%), Positives = 316/437 (72%), Gaps = 18/437 (4%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEEKVAEEPGKDSDQLETMENGSLTIPSSETK  1292
             V++TTS VAEE++   D+ +++      SE ++  +   +  +L+  ++       +E  
Sbjct  79    VSVTTSLVAEEDA--VDEQNQQ------SEREMLMKVSNEDVKLDVHDH-------AEKA  123

Query  1291  GSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVKP  1112
             G+S+ +++    R +K+   K  IPSAS+ +++G +LG+LQ +FL   AKP+L  MGV  
Sbjct  124   GNSSSANVG---RVAKLDHDKSYIPSASSGIVIGGLLGVLQALFLIFTAKPMLSYMGVDS  180

Query  1111  GSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIFI  932
              S M  PA +YLTLRS G+PAV++S+AIQG+FRG+KDTKTPLYAT  GD+ NIILD + +
Sbjct  181   NSPMFKPAQQYLTLRSFGAPAVIISMAIQGVFRGIKDTKTPLYATVMGDVTNIILDPLLM  240

Query  931   LACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARVI  752
                  GV+GAAI+H+ISQY++ ++LL+ L+++V LLPPS +  +  K LKNG  L  +V 
Sbjct  241   FVLRLGVNGAAISHIISQYLIAIMLLWSLMKQVVLLPPSIQDFRFGKILKNGFLLLIKVA  300

Query  751   AATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdykk  572
             +ATFCVTL+ SLAAR GST MAAFQ+CLQIW+ +SLLADGLA+A QAI+A+AFA  DYKK
Sbjct  301   SATFCVTLSTSLAARKGSTTMAAFQICLQIWMATSLLADGLAVAAQAIIASAFARDDYKK  360

Query  571   akaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINSL  392
               A+A+RVLQ+G ++G  L+V++   L F S +F+ D NV++LI+IGIP+VA TQPIN+L
Sbjct  361   VIASASRVLQLGLILGLVLSVLLLSLLPFASRLFTNDINVLQLISIGIPYVAATQPINAL  420

Query  391   AFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAGL  212
             AFV DGVN+GASDF YSAYSM+MVA ++I   ++   S GF GIWIAL I+M LR  AG 
Sbjct  421   AFVFDGVNYGASDFTYSAYSMIMVALVSILSLYMLSSSLGFTGIWIALLIYMTLRIFAGF  480

Query  211   WRLATGTGPWCFLRAST  161
             WR+ TG+GPW FL+ ++
Sbjct  481   WRIGTGSGPWSFLKENS  497



>gb|AAD30646.1|AC006085_19 Hypothetical protein [Arabidopsis thaliana]
Length=501

 Score =   397 bits (1020),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 245/430 (57%), Positives = 305/430 (71%), Gaps = 26/430 (6%)
 Frame = -2

Query  1471  VNITTSFVAEENS-----ELCDDGSK--EVSAKVYSEEKVAEEPGKDSDQLETMENGSLT  1313
             V+ITTSFVAEE++     +   D  +  E+     +EE +   P K  D L         
Sbjct  90    VSITTSFVAEEDACSSQQDTVRDHKECIEIGINNPTEETIELIPEKHKDSL---------  140

Query  1312  IPSSETKGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLL  1133
               S E K SS++  +      SK    K  IPSAS+AL++G +LG+ Q VFL   AKPLL
Sbjct  141   --SDEFKTSSSIFSI------SKPPAKKRNIPSASSALIIGGVLGLFQAVFLISAAKPLL  192

Query  1132  GLMGVKPGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNI  953
               MGVK  S M+ P+ RYL+LRSLG+PAVLLSLA QG+FRG KDT TPL+AT  GD+ NI
Sbjct  193   SFMGVKHDSPMMRPSQRYLSLRSLGAPAVLLSLAAQGVFRGFKDTTTPLFATVIGDVTNI  252

Query  952   ILDAIFILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGL  773
             ILD IFI     GV+GAA AHVISQY++  ILL+KL+ +V++   S+KHLQ  +F+KNG 
Sbjct  253   ILDPIFIFVFRLGVTGAATAHVISQYLMCGILLWKLMGQVDIFNMSTKHLQFCRFMKNGF  312

Query  772   WLFARVIAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATaf  593
              L  RVIA TFCVTL+ASLAAR GST MAAFQVCLQ+WL +SLLADG A+AGQAILA+AF
Sbjct  313   LLLMRVIAVTFCVTLSASLAAREGSTSMAAFQVCLQVWLATSLLADGYAVAGQAILASAF  372

Query  592   avkdykkakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAG  413
             A KDYK+A A A+RVLQ+G V+G  LAV++G GL+FG+ VF+KD  V+ LI+IG+PFVAG
Sbjct  373   AKKDYKRAAATASRVLQLGLVLGFVLAVILGAGLHFGARVFTKDDKVLHLISIGLPFVAG  432

Query  412   TQPINSLAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKS-NGFVGIWIALAIFM  236
             TQPIN+LAFV DGVNFGASDF Y+A S+VMVA ++I    LFL S +GF+G+W  L I+M
Sbjct  433   TQPINALAFVFDGVNFGASDFGYAAASLVMVAIVSI-LCLLFLSSTHGFIGLWFGLTIYM  491

Query  235   LLRTIAGLWR  206
              LR   G WR
Sbjct  492   SLRAAVGFWR  501



>ref|XP_010906078.1| PREDICTED: MATE efflux family protein 1 isoform X4 [Elaeis guineensis]
Length=484

 Score =   396 bits (1018),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 241/436 (55%), Positives = 290/436 (67%), Gaps = 52/436 (12%)
 Frame = -2

Query  1471  VNITTSFVAEENSELCDDGSKEVSAKVYSEE-KVAEEPGKDSDQLETMENGSLTIPSSET  1295
             V++TTSFVAEE++          + K+ SEE +  E+ G  S   E  E      P    
Sbjct  99    VSVTTSFVAEEDA----------TCKMASEEFECGEQEGTFSIDSEMKELIPRNDPERTV  148

Query  1294  KGSSALSDLEASERDSKVKRGKLRIPSASTALMMGCILGILQTVFLTVLAKPLLGLMGVK  1115
               SS  SD   S    K+ R +  IPSAS+AL +G ILG+LQ + L   A P+L  MGVK
Sbjct  149   HNSSPCSD--KSICTIKLGRERKHIPSASSALAIGGILGLLQALILIFGAIPILNFMGVK  206

Query  1114  PGSTMLNPALRYLTLRSLGSPAVLLSLAIQGIFRGLKDTKTPLYATAAGDLVNIILDAIF  935
             P S ML PA +YLTLRSLG+PAVLLSLA+QG+FRG KDTKTPLYAT AGD  NIILD IF
Sbjct  207   PDSPMLTPACQYLTLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVAGDATNIILDPIF  266

Query  934   ILACHWGVSGAAIAHVISQYilllillfklIREVELLPPSSKHLQLSKFLKNGLWLFARV  755
             +   H GVSGAAIAHVISQY++ LILL++L+REV++LPPS K LQ S+FLKN   L ARV
Sbjct  267   MFVFHLGVSGAAIAHVISQYLIALILLWRLLREVDVLPPSIKDLQFSRFLKNSFLLLARV  326

Query  754   IAATFCVTLAASLAARLGSTVMAAFQVCLQIWLTSSLLADGLAIAGQAILATafavkdyk  575
             IA TFCVTLAAS+AAR GS  MAAFQ+CLQIWL +SLLADGLA+AGQAILA+AFA +D+ 
Sbjct  327   IAVTFCVTLAASMAARQGSIPMAAFQICLQIWLATSLLADGLAVAGQAILASAFARRDHA  386

Query  574   kakaaaARVLQMGFVMGHglavvvglgLYFGSGVFSKDKNVIRLITIGIPFVAGTQPINS  395
             +A AAA+RVLQ                                       FVA TQPIN+
Sbjct  387   RATAAASRVLQ---------------------------------------FVALTQPINA  407

Query  394   LAFVLDGVNFGASDFFYSAYSMVMVAAMTIGFEFLFLKSNGFVGIWIALAIFMLLRTIAG  215
             LAFV DG+NFGASDF YSAYSMV+VA ++I    +   S+GF+GIW+AL I+M LR  AG
Sbjct  408   LAFVFDGINFGASDFSYSAYSMVLVAIVSILCLVVLSSSHGFIGIWVALTIYMSLRMFAG  467

Query  214   LWRLATGTGPWCFLRA  167
              WR+ T  GPW FLR+
Sbjct  468   FWRIGTARGPWAFLRS  483



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4006524533058