BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17082_g1_i1 len=955 path=[2679:0-954]

Length=955
                                                                      Score     E

emb|CDP06945.1|  unnamed protein product                                462   2e-157   
ref|XP_010031500.1|  PREDICTED: fatty acyl-CoA reductase 3              455   8e-155   
ref|XP_006349115.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    448   5e-152   
ref|XP_009781717.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    448   5e-152   
ref|XP_009631058.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    447   1e-151   
ref|XP_004251043.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    447   2e-151   
ref|XP_006347238.1|  PREDICTED: fatty acyl-CoA reductase 3-like         446   2e-151   
ref|XP_011088872.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    441   5e-150   
ref|XP_009611540.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    442   7e-150   
ref|XP_004241314.1|  PREDICTED: fatty acyl-CoA reductase 3              441   3e-149   
ref|XP_011088871.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    441   3e-149   
ref|XP_008228911.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    440   4e-149   
ref|XP_011090359.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    439   2e-148   
ref|XP_007015863.1|  Jojoba acyl CoA reductase-related male steri...    436   2e-147   
ref|XP_009789793.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    436   3e-147   
ref|XP_007205116.1|  hypothetical protein PRUPE_ppa004817mg             434   1e-146   
ref|XP_006487974.1|  PREDICTED: fatty acyl-CoA reductase 3-like         429   1e-144   
emb|CAN81280.1|  hypothetical protein VITISV_041831                     427   3e-144   Vitis vinifera
ref|XP_010651912.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    427   3e-144   
gb|KDO58051.1|  hypothetical protein CISIN_1g037479mg                   427   4e-144   
gb|ADK66305.1|  gland-specific fatty acyl-CoA reductase 1               427   4e-144   
ref|XP_010045241.1|  PREDICTED: fatty acyl-CoA reductase 3-like         427   5e-144   
ref|XP_009364297.1|  PREDICTED: fatty acyl-CoA reductase 3-like         427   5e-144   
ref|XP_002263184.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    426   2e-143   Vitis vinifera
ref|XP_009338685.1|  PREDICTED: fatty acyl-CoA reductase 3-like         425   5e-143   
ref|XP_011090360.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    424   6e-143   
ref|XP_002263127.1|  PREDICTED: fatty acyl-CoA reductase 3              424   8e-143   Vitis vinifera
ref|XP_002313668.2|  hypothetical protein POPTR_0009s14720g             424   1e-142   Populus trichocarpa [western balsam poplar]
ref|XP_002305561.2|  hypothetical protein POPTR_0004s19580g             424   2e-142   Populus trichocarpa [western balsam poplar]
gb|KDP42371.1|  hypothetical protein JCGZ_01947                         423   2e-142   
ref|XP_009376588.1|  PREDICTED: fatty acyl-CoA reductase 3-like         421   2e-141   
ref|XP_011046268.1|  PREDICTED: fatty acyl-CoA reductase 3-like         419   2e-140   
ref|XP_010089855.1|  Fatty acyl-CoA reductase 3                         418   2e-140   
ref|XP_007015865.1|  Jojoba acyl CoA reductase-related male steri...    419   3e-140   
ref|XP_004139568.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acyl-C...    414   8e-139   
gb|AID60102.1|  alcohol-forming fatty acyl-CoA reductase                414   2e-138   
ref|XP_009119230.1|  PREDICTED: fatty acyl-CoA reductase 3              412   3e-138   
emb|CDX69007.1|  BnaC01g04460D                                          411   1e-137   
ref|XP_004161427.1|  PREDICTED: fatty acyl-CoA reductase 3-like         414   1e-137   
ref|XP_002529056.1|  Male sterility protein, putative                   411   2e-137   Ricinus communis
ref|XP_010535678.1|  PREDICTED: fatty acyl-CoA reductase 3-like         410   2e-137   
gb|AFK38315.1|  unknown                                                 410   2e-137   
ref|XP_006412311.1|  hypothetical protein EUTSA_v10025005mg             410   2e-137   
ref|XP_002867157.1|  predicted protein                                  410   3e-137   
ref|XP_011088867.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    408   5e-137   
gb|AEV53412.1|  fatty acyl-CoA reductase 3                              409   5e-137   
ref|NP_567936.5|  fatty acyl-CoA reductase CER4                         409   9e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150088.1|  hypothetical protein PHAVU_005G125500g             408   2e-136   
ref|XP_011088866.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    407   4e-136   
ref|XP_002313667.2|  acyl CoA reductase family protein                  405   2e-135   Populus trichocarpa [western balsam poplar]
gb|KFK30008.1|  hypothetical protein AALP_AA7G205800                    405   2e-135   
ref|XP_009108773.1|  PREDICTED: fatty acyl-CoA reductase 3-like         405   2e-135   
gb|KDP42364.1|  hypothetical protein JCGZ_01940                         405   3e-135   
ref|XP_006290474.1|  hypothetical protein CARUB_v100190921mg            400   3e-135   
emb|CDY28321.1|  BnaC03g66380D                                          405   4e-135   
ref|XP_011044880.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    404   5e-135   
ref|XP_002305562.1|  hypothetical protein POPTR_0004s19600g             402   3e-134   Populus trichocarpa [western balsam poplar]
ref|XP_002523777.1|  Male sterility protein, putative                   401   1e-133   Ricinus communis
gb|KHN21439.1|  Fatty acyl-CoA reductase 3                              401   1e-133   
ref|XP_008462145.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    400   3e-133   
ref|XP_008462137.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    400   4e-133   
ref|XP_004291620.1|  PREDICTED: fatty acyl-CoA reductase 3-like         399   4e-133   
gb|KEH29873.1|  gland-specific fatty acyl-CoA reductase                 399   8e-133   
gb|AFK47309.1|  unknown                                                 399   8e-133   
ref|XP_004506152.1|  PREDICTED: fatty acyl-CoA reductase 3-like         399   1e-132   
ref|XP_011044902.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    398   2e-132   
ref|XP_006279378.1|  hypothetical protein CARUB_v10007996mg             395   2e-132   
ref|XP_004515386.1|  PREDICTED: fatty acyl-CoA reductase 3-like         398   2e-132   
ref|XP_006283617.1|  hypothetical protein CARUB_v10004673mg             397   3e-132   
ref|XP_004506277.1|  PREDICTED: fatty acyl-CoA reductase 3-like         397   4e-132   
ref|XP_003539817.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    397   5e-132   
gb|AES67032.2|  gland-specific fatty acyl-CoA reductase                 397   5e-132   
ref|XP_010447195.1|  PREDICTED: fatty acyl-CoA reductase 3-like         396   7e-132   
ref|XP_010432512.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    397   9e-132   
ref|XP_007132412.1|  hypothetical protein PHAVU_011G092500g             396   1e-131   
gb|KDP34806.1|  hypothetical protein JCGZ_10586                         392   2e-131   
ref|XP_010514781.1|  PREDICTED: fatty acyl-CoA reductase 3-like         395   2e-131   
ref|XP_010425870.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    394   3e-131   
ref|XP_003540237.1|  PREDICTED: fatty acyl-CoA reductase 3-like         395   3e-131   
ref|XP_003543435.1|  PREDICTED: fatty acyl-CoA reductase 3-like         394   4e-131   
ref|XP_010503101.1|  PREDICTED: fatty acyl-CoA reductase 3-like         394   7e-131   
gb|KHN38645.1|  Fatty acyl-CoA reductase 3                              394   1e-130   
ref|XP_003543433.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    393   1e-130   
ref|XP_010425869.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    393   2e-130   
ref|XP_008458592.1|  PREDICTED: fatty acyl-CoA reductase 3-like         393   2e-130   
ref|XP_010520426.1|  PREDICTED: fatty acyl-CoA reductase 3-like         392   4e-130   
ref|XP_004487512.1|  PREDICTED: fatty acyl-CoA reductase 3-like         392   5e-130   
ref|XP_006591085.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    392   5e-130   
ref|XP_010271727.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    391   7e-130   
ref|XP_004145801.1|  PREDICTED: fatty acyl-CoA reductase 3-like         391   8e-130   
ref|XP_004166245.1|  PREDICTED: fatty acyl-CoA reductase 3-like         390   1e-129   
ref|XP_007150087.1|  hypothetical protein PHAVU_005G125400g             392   2e-129   
ref|XP_004487511.1|  PREDICTED: fatty acyl-CoA reductase 3-like         390   3e-129   
ref|XP_010244271.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    389   4e-129   
ref|XP_010271728.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    389   7e-129   
gb|AFK33782.1|  unknown                                                 388   2e-128   
ref|XP_006419126.1|  hypothetical protein EUTSA_v10002497mg             388   2e-128   
ref|XP_002875671.1|  oxidoreductase, acting on the CH-CH group of...    387   2e-128   
ref|XP_010686043.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    387   3e-128   
ref|XP_010514784.1|  PREDICTED: probable fatty acyl-CoA reductase...    385   3e-128   
ref|NP_001030809.1|  fatty acyl-CoA reductase 4                         385   3e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003596783.1|  Fatty acyl-CoA reductase                           387   3e-128   
ref|XP_003539173.1|  PREDICTED: fatty acyl-CoA reductase 3-like         387   5e-128   
ref|XP_006591086.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    384   8e-128   
ref|XP_003540238.1|  PREDICTED: fatty acyl-CoA reductase 3-like         385   2e-127   
ref|XP_010514783.1|  PREDICTED: probable fatty acyl-CoA reductase...    385   2e-127   
ref|XP_010503104.1|  PREDICTED: probable fatty acyl-CoA reductase...    383   2e-127   
ref|XP_003538130.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    384   3e-127   
gb|KHN38647.1|  Fatty acyl-CoA reductase 3                              384   3e-127   
ref|XP_010425873.1|  PREDICTED: probable fatty acyl-CoA reductase...    382   4e-127   
ref|NP_190040.3|  fatty acyl-CoA reductase 4                            384   4e-127   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33883.1|  hypothetical protein AALP_AA5G072700                    384   4e-127   
ref|XP_006387900.1|  hypothetical protein POPTR_0490s00210g             375   1e-126   
ref|XP_010503102.1|  PREDICTED: probable fatty acyl-CoA reductase...    382   2e-126   
ref|XP_010503103.1|  PREDICTED: probable fatty acyl-CoA reductase...    382   2e-126   
emb|CAB80096.1|  male sterility 2-like protein                          382   3e-126   Arabidopsis thaliana [mouse-ear cress]
gb|KDP34802.1|  hypothetical protein JCGZ_10582                         378   4e-126   
gb|KGN46944.1|  hypothetical protein Csa_6G151810                       382   4e-126   
ref|XP_010425872.1|  PREDICTED: probable fatty acyl-CoA reductase...    382   4e-126   
ref|XP_010535677.1|  PREDICTED: fatty acyl-CoA reductase 1-like         380   9e-126   
ref|XP_008458693.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acyl-C...    382   9e-126   
sp|Q9XGY7.1|FAR_SIMCH  RecName: Full=Alcohol-forming fatty acyl-C...    379   3e-125   Simmondsia chinensis [goatnut]
ref|XP_006419124.1|  hypothetical protein EUTSA_v10002499mg             379   6e-125   
ref|XP_004171145.1|  PREDICTED: fatty acyl-CoA reductase 3-like         375   8e-125   
emb|CDY48435.1|  BnaA08g11440D                                          378   8e-125   
gb|KFK39898.1|  hypothetical protein AALP_AA3G303100                    377   2e-124   
emb|CAB88537.1|  acyl CoA reductase-like protein                        374   2e-124   Arabidopsis thaliana [mouse-ear cress]
emb|CDY09144.1|  BnaA02g05700D                                          377   3e-124   
ref|XP_009126546.1|  PREDICTED: fatty acyl-CoA reductase 1-like         377   3e-124   
ref|XP_006400757.1|  hypothetical protein EUTSA_v10013355mg             377   4e-124   
emb|CAA20592.1|  male sterility 2-like protein                          375   8e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004145802.1|  PREDICTED: fatty acyl-CoA reductase 3-like         376   8e-124   
ref|XP_008458595.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    372   1e-123   
ref|XP_006279365.1|  hypothetical protein CARUB_v10007993mg             375   2e-123   
ref|XP_010943712.1|  PREDICTED: probable fatty acyl-CoA reductase 4     374   3e-123   
emb|CDY26934.1|  BnaC09g36490D                                          374   3e-123   
ref|XP_010493337.1|  PREDICTED: fatty acyl-CoA reductase 1              374   3e-123   
ref|XP_008458594.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    372   6e-123   
ref|XP_010687363.1|  PREDICTED: fatty acyl-CoA reductase 3-like         374   6e-123   
ref|XP_006287458.1|  hypothetical protein CARUB_v10000664mg             375   8e-123   
emb|CDY65611.1|  BnaCnng47950D                                          373   8e-123   
gb|KDO44391.1|  hypothetical protein CISIN_1g0083151mg                  370   9e-123   
ref|NP_190041.2|  fatty acyl-CoA reductase 5                            373   1e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454514.1|  PREDICTED: fatty acyl-CoA reductase 1-like         372   2e-122   
emb|CDY35688.1|  BnaC02g09540D                                          372   3e-122   
ref|XP_008801227.1|  PREDICTED: probable fatty acyl-CoA reductase 4     372   3e-122   
ref|XP_009150272.1|  PREDICTED: probable fatty acyl-CoA reductase 4     372   3e-122   
ref|XP_006419123.1|  hypothetical protein EUTSA_v10002495mg             370   5e-122   
ref|XP_002875673.1|  oxidoreductase, acting on the CH-CH group of...    371   6e-122   
ref|XP_009131879.1|  PREDICTED: putative fatty acyl-CoA reductase...    371   8e-122   
ref|XP_010255716.1|  PREDICTED: fatty acyl-CoA reductase 3-like         371   8e-122   
ref|XP_009131878.1|  PREDICTED: putative fatty acyl-CoA reductase...    371   9e-122   
ref|XP_011005176.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    368   1e-121   
ref|XP_011005175.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    368   2e-121   
gb|KFK39899.1|  hypothetical protein AALP_AA3G303200                    370   2e-121   
emb|CDY21232.1|  BnaC03g53920D                                          370   2e-121   
gb|EYU36959.1|  hypothetical protein MIMGU_mgv1a0177801mg               369   2e-121   
ref|XP_006290972.1|  hypothetical protein CARUB_v10017087mg             370   2e-121   
emb|CDY30935.1|  BnaA06g19780D                                          370   2e-121   
ref|XP_006487981.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    371   2e-121   
ref|XP_011005174.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    369   2e-121   
emb|CDX92346.1|  BnaA10g13850D                                          369   3e-121   
ref|XP_006371440.1|  hypothetical protein POPTR_0019s10390g             369   3e-121   
ref|XP_009120651.1|  PREDICTED: fatty acyl-CoA reductase 1              369   3e-121   
ref|XP_006478011.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    372   3e-121   
ref|XP_006419122.1|  hypothetical protein EUTSA_v10002495mg             369   3e-121   
gb|KDO39573.1|  hypothetical protein CISIN_1g0083242mg                  363   6e-121   
ref|XP_011005173.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    368   8e-121   
gb|KFK23136.1|  hypothetical protein AALP_AAs65178U000500               367   2e-120   
ref|XP_010421031.1|  PREDICTED: putative fatty acyl-CoA reductase 7     367   2e-120   
ref|XP_009405296.1|  PREDICTED: probable fatty acyl-CoA reductase 4     367   3e-120   
ref|XP_006349112.1|  PREDICTED: probable fatty acyl-CoA reductase...    362   3e-120   
gb|KDO39572.1|  hypothetical protein CISIN_1g0083242mg                  363   3e-120   
ref|NP_197642.1|  fatty acyl-CoA reductase 1                            366   4e-120   Arabidopsis thaliana [mouse-ear cress]
gb|KDO39571.1|  hypothetical protein CISIN_1g0083242mg                  363   5e-120   
ref|XP_010493325.1|  PREDICTED: putative fatty acyl-CoA reductase 7     366   6e-120   
ref|XP_002872004.1|  hypothetical protein ARALYDRAFT_910242             365   1e-119   
ref|XP_009150309.1|  PREDICTED: probable fatty acyl-CoA reductase 5     365   1e-119   
gb|KFK33885.1|  hypothetical protein AALP_AA5G072900                    365   1e-119   
ref|XP_003596781.1|  DNA-directed RNA polymerase                        368   1e-119   
emb|CDX99193.1|  BnaA06g18840D                                          365   1e-119   
gb|EYU36962.1|  hypothetical protein MIMGU_mgv1a0098192mg               357   2e-119   
ref|XP_010687495.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    364   3e-119   
ref|XP_007020562.1|  Fatty acid reductase 4                             365   5e-119   
gb|AIE57506.1|  CER4                                                    363   6e-119   
ref|XP_007020558.1|  Fatty acid reductase 4                             363   6e-119   
ref|XP_006279387.1|  hypothetical protein CARUB_v10008006mg             363   6e-119   
ref|XP_002875672.1|  oxidoreductase, acting on the CH-CH group of...    363   9e-119   
emb|CAB88538.1|  acyl CoA reductase-like protein                        360   2e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007020559.1|  Fatty acid reductase 4                             362   3e-118   
ref|XP_009610475.1|  PREDICTED: fatty acyl-CoA reductase 3-like         361   6e-118   
ref|NP_190042.2|  fatty acyl-CoA reductase 8                            361   6e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008382348.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    354   7e-118   
ref|XP_007206366.1|  hypothetical protein PRUPE_ppa017843mg             360   8e-118   
gb|ABK28586.1|  unknown                                                 360   8e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503105.1|  PREDICTED: probable fatty acyl-CoA reductase 5     360   9e-118   
ref|XP_006400746.1|  hypothetical protein EUTSA_v10015841mg             360   2e-117   
ref|XP_010676595.1|  PREDICTED: fatty acyl-CoA reductase 3-like         356   6e-117   
gb|KDP42365.1|  hypothetical protein JCGZ_01941                         353   9e-117   
ref|XP_011005177.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    350   9e-117   
ref|XP_010514782.1|  PREDICTED: probable fatty acyl-CoA reductase 5     358   1e-116   
ref|XP_010313342.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    353   2e-116   
ref|XP_007208215.1|  hypothetical protein PRUPE_ppa018909mg             357   2e-116   
ref|XP_008228895.1|  PREDICTED: fatty acyl-CoA reductase 3-like         357   2e-116   
ref|XP_008228881.1|  PREDICTED: fatty acyl-CoA reductase 3-like         357   2e-116   
ref|XP_006349114.1|  PREDICTED: fatty acyl-CoA reductase 1-like         356   5e-116   
ref|XP_009364296.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    355   7e-116   
ref|XP_009610473.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    355   7e-116   
ref|XP_009373003.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    355   1e-115   
ref|XP_004241312.1|  PREDICTED: probable fatty acyl-CoA reductase...    355   1e-115   
ref|XP_004291621.1|  PREDICTED: fatty acyl-CoA reductase 1-like         355   2e-115   
ref|XP_011090362.1|  PREDICTED: fatty acyl-CoA reductase 3-like         354   3e-115   
ref|XP_010313341.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    353   4e-115   
emb|CDY08707.1|  BnaC03g54750D                                          353   9e-115   
ref|XP_009120662.1|  PREDICTED: putative fatty acyl-CoA reductase 7     352   1e-114   
ref|XP_010454504.1|  PREDICTED: putative fatty acyl-CoA reductase 7     352   2e-114   
ref|XP_010520424.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    352   3e-114   
ref|XP_010520425.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    351   4e-114   
ref|XP_006349135.1|  PREDICTED: probable fatty acyl-CoA reductase...    345   8e-114   
ref|XP_008353939.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    350   9e-114   
gb|KHN38648.1|  Fatty acyl-CoA reductase 3                              349   2e-113   
ref|XP_003538131.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    349   2e-113   
ref|XP_006349136.1|  PREDICTED: fatty acyl-CoA reductase 3-like         349   4e-113   
ref|XP_009610474.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    348   4e-113   
ref|XP_008229411.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    356   1e-112   
ref|XP_006349384.1|  PREDICTED: fatty acyl-CoA reductase 3-like         346   3e-112   
ref|XP_009785725.1|  PREDICTED: fatty acyl-CoA reductase 3-like         346   4e-112   
ref|XP_010314793.1|  PREDICTED: fatty acyl-CoA reductase 3-like         346   4e-112   
ref|XP_010520423.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    346   5e-112   
ref|XP_010520422.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    346   5e-112   
ref|XP_008228906.1|  PREDICTED: fatty acyl-CoA reductase 3-like         345   5e-112   
ref|XP_004251041.1|  PREDICTED: probable fatty acyl-CoA reductase 4     345   6e-112   
ref|XP_007205112.1|  hypothetical protein PRUPE_ppa004772mg             345   7e-112   
ref|XP_009419621.1|  PREDICTED: fatty acyl-CoA reductase 3-like         345   1e-111   
emb|CDX98566.1|  BnaC05g38090D                                          344   1e-111   
ref|XP_004291622.1|  PREDICTED: fatty acyl-CoA reductase 3-like         344   2e-111   
ref|XP_003606214.1|  Fatty acyl-CoA reductase                           337   3e-111   
ref|XP_006441009.1|  hypothetical protein CICLE_v100206971mg            336   3e-111   
gb|KCW58995.1|  hypothetical protein EUGRSUZ_H01619                     343   6e-111   
emb|CDX92353.1|  BnaA10g13920D                                          343   6e-111   
ref|XP_006347258.1|  PREDICTED: fatty acyl-CoA reductase 3-like         342   1e-110   
ref|XP_010070015.1|  PREDICTED: probable fatty acyl-CoA reductase 4     342   2e-110   
ref|XP_010041357.1|  PREDICTED: probable fatty acyl-CoA reductase 4     338   4e-110   
gb|KCW58994.1|  hypothetical protein EUGRSUZ_H01618                     341   4e-110   
ref|XP_009364295.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    339   2e-109   
ref|XP_009419426.1|  PREDICTED: probable fatty acyl-CoA reductase 4     339   2e-109   
gb|KCW58570.1|  hypothetical protein EUGRSUZ_H01227                     336   2e-109   
ref|XP_006851509.1|  hypothetical protein AMTR_s00040p00158690          338   3e-109   
gb|KCW44418.1|  hypothetical protein EUGRSUZ_L02093                     337   4e-109   
gb|AES88411.2|  gland-specific fatty acyl-CoA reductase                 338   7e-109   
ref|XP_009620478.1|  PREDICTED: fatty acyl-CoA reductase 3-like         335   7e-109   
gb|AES98766.2|  gland-specific fatty acyl-CoA reductase                 337   9e-109   
ref|XP_006400747.1|  hypothetical protein EUTSA_v10013371mg             337   1e-108   
gb|EYU36082.1|  hypothetical protein MIMGU_mgv1a004946mg                337   1e-108   
ref|XP_006478064.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    333   4e-108   
dbj|BAH01371.1|  unnamed protein product                                335   5e-108   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83314.1|  hypothetical protein OsI_28691                          335   6e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_003573673.1|  PREDICTED: fatty acyl-CoA reductase 1-like         335   7e-108   
gb|AFW65448.1|  hypothetical protein ZEAMMB73_799465                    329   8e-108   
dbj|BAD31814.1|  putative fatty acyl coA reductase                      335   1e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007132410.1|  hypothetical protein PHAVU_011G092400g             331   2e-107   
ref|XP_007132409.1|  hypothetical protein PHAVU_011G092400g             330   3e-107   
ref|XP_006347255.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    333   4e-107   
ref|XP_007132904.1|  hypothetical protein PHAVU_011G134800g             333   5e-107   
gb|AIZ97195.1|  fatty acyl-coenzyme A reductase 4                       332   2e-106   
emb|CAD30696.1|  fatty acyl coA reductase                               332   2e-106   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003606163.1|  Fatty acyl-CoA reductase                           329   3e-106   
ref|XP_007132411.1|  hypothetical protein PHAVU_011G092400g             330   3e-106   
ref|XP_011089202.1|  PREDICTED: fatty acyl-CoA reductase 3-like         330   5e-106   
ref|XP_002449116.1|  hypothetical protein SORBIDRAFT_05g005340          331   6e-106   Sorghum bicolor [broomcorn]
gb|KHN38171.1|  Putative fatty acyl-CoA reductase 5                     328   8e-106   
ref|XP_006347257.1|  PREDICTED: fatty acyl-CoA reductase 3-like         327   9e-106   
gb|EMT11633.1|  Fatty acyl-CoA reductase 1                              330   1e-105   
ref|XP_007132408.1|  hypothetical protein PHAVU_011G092300g             329   1e-105   
ref|XP_003615808.1|  Fatty acyl-CoA reductase                           329   1e-105   
ref|NP_001151388.1|  male sterility protein 2                           328   6e-105   Zea mays [maize]
gb|AFW65447.1|  male sterility protein 2                                328   6e-105   
emb|CBI75514.1|  male sterility protein, putative, expressed            327   7e-105   
ref|XP_002449115.1|  hypothetical protein SORBIDRAFT_05g005330          327   1e-104   Sorghum bicolor [broomcorn]
ref|XP_006586435.1|  PREDICTED: probable fatty acyl-CoA reductase...    324   3e-104   
ref|XP_004973114.1|  PREDICTED: fatty acyl-CoA reductase 1-like         325   5e-104   
gb|EPS58786.1|  hypothetical protein M569_16027                         323   6e-104   
ref|XP_004490308.1|  PREDICTED: fatty acyl-CoA reductase 8-like         323   7e-104   
ref|XP_010444980.1|  PREDICTED: fatty acyl-CoA reductase 3-like         323   8e-104   
ref|XP_002875662.1|  predicted protein                                  323   1e-103   
ref|XP_006664917.1|  PREDICTED: fatty acyl-CoA reductase 1-like         323   2e-103   
ref|XP_003606165.1|  Fatty acyl-CoA reductase                           318   3e-103   
ref|XP_006659273.1|  PREDICTED: fatty acyl-CoA reductase 1-like         323   3e-103   
gb|EMT30212.1|  Fatty acyl-CoA reductase 1                              323   4e-103   
ref|XP_007133459.1|  hypothetical protein PHAVU_011G1804001g            319   5e-103   
ref|XP_011089201.1|  PREDICTED: fatty acyl-CoA reductase 3-like         321   2e-102   
dbj|BAK04658.1|  predicted protein                                      321   2e-102   
emb|CAD30692.1|  fatty acyl coA reductase                               320   5e-102   
ref|XP_006659274.1|  PREDICTED: fatty acyl-CoA reductase 1-like         320   6e-102   
ref|XP_004490345.1|  PREDICTED: fatty acyl-CoA reductase 8-like         321   6e-102   
gb|AES88362.2|  gland-specific fatty acyl-CoA reductase                 319   9e-102   
ref|XP_006291287.1|  hypothetical protein CARUB_v10017423mg             315   1e-101   
ref|XP_002443047.1|  hypothetical protein SORBIDRAFT_08g006870          318   1e-101   
gb|EMT11621.1|  Fatty acyl-CoA reductase 1                              318   3e-101   
ref|XP_004308636.1|  PREDICTED: fatty acyl-CoA reductase 3-like         318   3e-101   
ref|XP_004956203.1|  PREDICTED: fatty acyl-CoA reductase 1-like         317   1e-100   
ref|XP_003606187.1|  Fatty acyl-CoA reductase                           309   2e-100   
ref|NP_001183038.1|  hypothetical protein                               316   2e-100   
gb|EMT08796.1|  Fatty acyl-CoA reductase 1                              315   2e-100   
gb|KDP34807.1|  hypothetical protein JCGZ_10587                         314   3e-100   
gb|EYU36076.1|  hypothetical protein MIMGU_mgv1a004914mg                316   3e-100   
ref|XP_010111080.1|  Fatty acyl-CoA reductase 1                         324   3e-100   
ref|XP_004295749.1|  PREDICTED: probable fatty acyl-CoA reductase...    315   3e-100   
gb|AIZ97193.1|  fatty acyl-coenzyme A reductase                         315   4e-100   
ref|XP_011089200.1|  PREDICTED: probable fatty acyl-CoA reductase 4     308   4e-100   
dbj|BAK05531.1|  predicted protein                                      312   5e-100   
ref|XP_003606153.1|  Fatty acyl-CoA reductase                           310   1e-99    
ref|XP_010686050.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    310   2e-99    
gb|EMS57501.1|  putative fatty acyl-CoA reductase 5                     313   3e-99    
ref|XP_010686051.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    309   4e-99    
gb|EMS62412.1|  putative fatty acyl-CoA reductase 5                     311   5e-99    
emb|CBI75517.1|  male sterility protein, putative, expressed            312   6e-99    
ref|XP_004490307.1|  PREDICTED: fatty acyl-CoA reductase 8-like         311   6e-99    
ref|XP_010271730.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    310   1e-98    
gb|EMT00454.1|  Fatty acyl-CoA reductase 1                              312   1e-98    
ref|XP_008228919.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    309   2e-98    
ref|XP_010686048.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    310   2e-98    
ref|XP_010271729.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    308   5e-98    
ref|XP_009631061.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    307   9e-98    
ref|XP_002459832.1|  hypothetical protein SORBIDRAFT_02g011920          309   2e-97    
ref|XP_004974193.1|  PREDICTED: fatty acyl-CoA reductase 1-like         308   2e-97    
ref|XP_004974195.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    308   3e-97    
ref|XP_006851510.1|  hypothetical protein AMTR_s00040p00161230          304   5e-97    
gb|EMS54669.1|  Fatty acyl-CoA reductase 1                              308   5e-97    
ref|XP_008347700.1|  PREDICTED: fatty acyl-CoA reductase 3-like         298   5e-97    
ref|XP_004974194.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    308   6e-97    
ref|XP_002445692.1|  hypothetical protein SORBIDRAFT_07g024290          306   2e-96    
gb|KCW58991.1|  hypothetical protein EUGRSUZ_H01615                     301   3e-96    
gb|ACG42983.1|  male sterility protein 2                                302   6e-95    
gb|AJA71622.1|  Male sterility factor protein                           302   1e-94    
gb|EMT24985.1|  Fatty acyl-CoA reductase 1                              301   2e-94    
ref|XP_010109930.1|  Fatty acyl-CoA reductase 1                         302   2e-94    
gb|ACF85730.1|  unknown                                                 300   3e-94    
gb|KGN46942.1|  hypothetical protein Csa_6G151790                       298   4e-94    
ref|XP_009789795.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    297   9e-94    
dbj|BAC84377.1|  putative fatty acyl coA reductase                      298   4e-93    
ref|XP_002445686.1|  hypothetical protein SORBIDRAFT_07g024240          297   5e-93    
gb|EEC82054.1|  hypothetical protein OsI_26036                          296   6e-93    
ref|XP_006660992.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    297   6e-93    
dbj|BAD46254.1|  putative fatty acyl coA reductase                      296   1e-92    
ref|XP_006653297.1|  PREDICTED: fatty acyl-CoA reductase 1-like         295   2e-92    
ref|XP_004957115.1|  PREDICTED: fatty acyl-CoA reductase 1-like         295   2e-92    
ref|NP_001063962.1|  Os09g0567500                                       295   2e-92    
gb|AJA71626.1|  male sterility protein                                  303   9e-92    
ref|XP_004974196.1|  PREDICTED: fatty acyl-CoA reductase 3-like         293   1e-91    
gb|AIZ97194.1|  fatty acyl-coenzyme A reductase 3                       292   2e-91    
ref|XP_003578640.1|  PREDICTED: fatty acyl-CoA reductase 1-like         292   3e-91    
emb|CAD30694.1|  fatty acyl coA reductase                               292   5e-91    
gb|EMT24902.1|  Putative fatty acyl-CoA reductase 5                     292   6e-91    
gb|AIU99981.1|  alcohol-forming fatty acyl-coenzyme A reductase         292   8e-91    
ref|XP_010430959.1|  PREDICTED: probable fatty acyl-CoA reductase 5     289   2e-90    
ref|XP_004957632.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    289   2e-90    
gb|EMS53770.1|  Fatty acyl-CoA reductase 3                              289   6e-90    
gb|ABR18362.1|  unknown                                                 289   9e-90    
ref|XP_004957631.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    288   2e-89    
emb|CAH66597.1|  OSIGBa0092G14.8                                        287   2e-89    
ref|NP_001052541.1|  Os04g0354600                                       287   3e-89    
gb|KCW58563.1|  hypothetical protein EUGRSUZ_H01219                     283   3e-89    
ref|XP_002445685.1|  hypothetical protein SORBIDRAFT_07g024230          287   5e-89    
gb|EMS66724.1|  Fatty acyl-CoA reductase 1                              285   5e-89    
emb|CAE02214.2|  OSJNBb0002N06.4                                        286   7e-89    
dbj|BAK06275.1|  predicted protein                                      287   8e-89    
emb|CAH66590.1|  OSIGBa0092G14.1                                        286   9e-89    
ref|XP_011044886.1|  PREDICTED: fatty acyl-CoA reductase 3-like         280   2e-88    
ref|XP_003574925.1|  PREDICTED: fatty acyl-CoA reductase 3-like         285   2e-88    
gb|KDP34801.1|  hypothetical protein JCGZ_10581                         280   2e-88    
gb|EEE67188.1|  hypothetical protein OsJ_24284                          282   9e-88    
ref|XP_002462532.1|  hypothetical protein SORBIDRAFT_02g027540          282   2e-87    
ref|XP_006653296.1|  PREDICTED: fatty acyl-CoA reductase 3-like         282   3e-87    
ref|NP_001062488.1|  Os08g0557800                                       281   9e-87    
gb|EAZ07989.1|  hypothetical protein OsI_30251                          281   1e-86    
ref|XP_003578677.1|  PREDICTED: probable fatty acyl-CoA reductase 4     280   4e-86    
gb|EMS49520.1|  Fatty acyl-CoA reductase 1                              279   1e-85    
gb|EYU20678.1|  hypothetical protein MIMGU_mgv1a003493mg                279   3e-85    
ref|XP_004987158.1|  PREDICTED: fatty acyl-CoA reductase 2-like         277   1e-84    
ref|XP_009391351.1|  PREDICTED: fatty acyl-CoA reductase 2              275   3e-84    
ref|XP_002523778.1|  oxidoreductase, putative                           271   4e-84    
ref|XP_006424277.1|  hypothetical protein CICLE_v10028434mg             272   4e-84    
ref|XP_008367661.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acyl-C...    264   8e-84    
ref|XP_003578641.1|  PREDICTED: putative fatty acyl-CoA reductase 7     273   1e-83    
ref|XP_006842773.1|  hypothetical protein AMTR_s00133p00107670          275   1e-83    
gb|AES97100.2|  fatty acyl-CoA reductase                                272   1e-83    
ref|XP_003614142.1|  Fatty acyl-CoA reductase                           272   2e-83    
tpg|DAA48675.1|  TPA: hypothetical protein ZEAMMB73_021815              272   3e-83    
emb|CDX67654.1|  BnaA07g16940D                                          273   3e-83    
ref|XP_008664571.1|  PREDICTED: fatty acyl-CoA reductase 1-like         272   4e-83    
ref|XP_009104016.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    271   5e-83    
ref|XP_002974648.1|  hypothetical protein SELMODRAFT_101717             271   7e-83    
ref|XP_009104015.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    271   1e-82    
ref|XP_002323348.2|  Male sterility protein 2                           273   1e-82    
ref|XP_004234754.1|  PREDICTED: fatty acyl-CoA reductase 2              272   2e-82    
gb|AFB77197.1|  male sterility protein 2                                270   2e-82    
ref|XP_006360607.1|  PREDICTED: fatty acyl-CoA reductase 2-like         271   2e-82    
ref|XP_010909720.1|  PREDICTED: fatty acyl-CoA reductase 2-like         267   3e-82    
dbj|BAM71700.1|  hypothetical protein                                   273   4e-82    
gb|ACA28679.1|  male sterility-related protein                          270   4e-82    
ref|XP_009116368.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    270   4e-82    
ref|XP_010068863.1|  PREDICTED: fatty acyl-CoA reductase 2-like         268   5e-82    
ref|XP_010504577.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    269   6e-82    
ref|XP_008352400.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    264   7e-82    
gb|AHJ37516.1|  fatty acyl-CoA reductase 2-like protein                 270   7e-82    
ref|XP_006651074.1|  PREDICTED: fatty acyl-CoA reductase 2-like         271   8e-82    
ref|XP_010427505.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    268   9e-82    
ref|XP_002963359.1|  hypothetical protein SELMODRAFT_80322              268   9e-82    
ref|XP_003562031.1|  PREDICTED: fatty acyl-CoA reductase 2-like         270   1e-81    
gb|EMS67879.1|  putative fatty acyl-CoA reductase 4                     269   1e-81    
emb|CDY56772.1|  BnaAnng14390D                                          269   1e-81    
ref|XP_010673235.1|  PREDICTED: fatty acyl-CoA reductase 2              270   1e-81    
gb|AAR88762.1|  acyl CoA reductase                                      264   1e-81    
gb|EMT31062.1|  Fatty acyl-CoA reductase 2                              270   2e-81    
ref|XP_002276588.1|  PREDICTED: fatty acyl-CoA reductase 2              269   2e-81    
ref|XP_010520001.1|  PREDICTED: fatty acyl-CoA reductase 2-like         270   2e-81    
ref|XP_002468445.1|  hypothetical protein SORBIDRAFT_01g046030          269   2e-81    
ref|XP_011039510.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    268   3e-81    
ref|XP_010557956.1|  PREDICTED: fatty acyl-CoA reductase 2-like         269   4e-81    
gb|EMS49198.1|  Fatty acyl-CoA reductase 2                              268   4e-81    
ref|XP_007145718.1|  hypothetical protein PHAVU_007G262300g             269   4e-81    
ref|XP_007048736.1|  Jojoba acyl CoA reductase-related male steri...    266   5e-81    
ref|XP_006429861.1|  hypothetical protein CICLE_v10011477mg             266   5e-81    
ref|XP_010412804.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    267   5e-81    
ref|XP_009590583.1|  PREDICTED: fatty acyl-CoA reductase 2              268   5e-81    
emb|CBI29968.3|  unnamed protein product                                269   6e-81    
ref|XP_009104027.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    267   6e-81    
ref|XP_009104026.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    267   7e-81    
ref|XP_011039509.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    267   2e-80    
ref|XP_010067301.1|  PREDICTED: fatty acyl-CoA reductase 2-like         266   3e-80    
gb|AAZ06658.1|  male sterility protein 2-2                              267   3e-80    
emb|CAA68190.1|  male sterility protein 2                               267   3e-80    
gb|KCW65407.1|  hypothetical protein EUGRSUZ_G02831                     266   3e-80    
gb|KCW65406.1|  hypothetical protein EUGRSUZ_G02831                     266   4e-80    
ref|XP_010039188.1|  PREDICTED: fatty acyl-CoA reductase 2-like         262   4e-80    
gb|KCW45312.1|  hypothetical protein EUGRSUZ_L01017                     263   5e-80    
ref|XP_006349134.1|  PREDICTED: fatty acyl-CoA reductase 1-like         261   5e-80    
gb|KCW49551.1|  hypothetical protein EUGRSUZ_K03070                     262   5e-80    
ref|XP_008660506.1|  PREDICTED: fatty acyl-CoA reductase 2-like         265   7e-80    
ref|XP_010040308.1|  PREDICTED: fatty acyl-CoA reductase 2-like         263   1e-79    
ref|XP_009121004.1|  PREDICTED: fatty acyl-CoA reductase 2              265   1e-79    
ref|XP_010040307.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acyl-C...    263   1e-79    
gb|AHA15849.1|  male sterility protein 2                                265   1e-79    
ref|XP_009769707.1|  PREDICTED: fatty acyl-CoA reductase 2              265   2e-79    
ref|XP_010068864.1|  PREDICTED: fatty acyl-CoA reductase 2-like         261   2e-79    
emb|CDP06949.1|  unnamed protein product                                258   2e-79    
ref|XP_006659688.1|  PREDICTED: fatty acyl-CoA reductase 1-like         261   2e-79    
gb|AAQ81302.2|  male sterility protein 2-1 mutant                       265   2e-79    
ref|XP_010498380.1|  PREDICTED: fatty acyl-CoA reductase 2 isofor...    262   3e-79    
gb|EEC74588.1|  hypothetical protein OsI_10168                          264   3e-79    
ref|XP_010427503.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    262   3e-79    
ref|XP_010271754.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    256   3e-79    
gb|KCW65408.1|  hypothetical protein EUGRSUZ_G02832                     261   3e-79    
ref|NP_187805.1|  fatty acyl-CoA reductase 2                            264   5e-79    
ref|XP_007029099.1|  Jojoba acyl CoA reductase-related male steri...    263   6e-79    
emb|CDY08472.1|  BnaA05g27080D                                          263   6e-79    
emb|CAA52019.1|  male sterility 2 (MS2) protein                         263   6e-79    
ref|XP_006407385.1|  hypothetical protein EUTSA_v10020305mg             263   6e-79    
ref|XP_010544518.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    261   7e-79    
ref|XP_006492869.1|  PREDICTED: fatty acyl-CoA reductase 2-like         261   8e-79    
ref|XP_007029101.1|  Jojoba acyl CoA reductase-related male steri...    263   9e-79    
ref|NP_001049083.1|  Os03g0167600                                       263   1e-78    
dbj|BAK05128.1|  predicted protein                                      263   1e-78    
ref|XP_006299443.1|  hypothetical protein CARUB_v10015607mg             263   1e-78    
ref|XP_001771307.1|  predicted protein                                  259   1e-78    
emb|CDY01079.1|  BnaC05g41210D                                          262   1e-78    
ref|XP_010559061.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    260   1e-78    
ref|XP_007048737.1|  Jojoba acyl CoA reductase-related male steri...    261   2e-78    
ref|XP_002445691.1|  hypothetical protein SORBIDRAFT_07g024280          259   2e-78    
ref|XP_006481697.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    262   2e-78    
ref|XP_010498364.1|  PREDICTED: fatty acyl-CoA reductase 2 isofor...    262   2e-78    
ref|XP_010101094.1|  Fatty acyl-CoA reductase 2                         261   2e-78    
ref|XP_006429946.1|  hypothetical protein CICLE_v10011332mg             261   3e-78    
ref|XP_009146656.1|  PREDICTED: fatty acyl-CoA reductase 2-like         262   3e-78    
ref|XP_010068865.1|  PREDICTED: fatty acyl-CoA reductase 2-like         258   4e-78    
ref|XP_002882759.1|  hypothetical protein ARALYDRAFT_478549             261   4e-78    
gb|KDP46041.1|  hypothetical protein JCGZ_13487                         254   4e-78    
ref|XP_006481696.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    262   6e-78    
ref|XP_008458694.1|  PREDICTED: fatty acyl-CoA reductase 3-like         253   7e-78    
gb|KCW90352.1|  hypothetical protein EUGRSUZ_A02497                     259   8e-78    
ref|XP_010464945.1|  PREDICTED: fatty acyl-CoA reductase 2-like         260   8e-78    
ref|XP_010024331.1|  PREDICTED: fatty acyl-CoA reductase 2              259   1e-77    
ref|XP_008442197.1|  PREDICTED: fatty acyl-CoA reductase 2 isofor...    256   2e-77    
emb|CDX72117.1|  BnaC08g27570D                                          256   8e-77    
ref|XP_008776229.1|  PREDICTED: uncharacterized protein LOC103696395    265   9e-77    
ref|XP_008442196.1|  PREDICTED: fatty acyl-CoA reductase 2 isofor...    256   1e-76    
ref|XP_004144700.1|  PREDICTED: fatty acyl-CoA reductase 2-like         256   2e-76    
ref|XP_003535102.1|  PREDICTED: fatty acyl-CoA reductase 2-like         255   2e-76    
ref|XP_010559064.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    254   2e-76    
ref|XP_006429858.1|  hypothetical protein CICLE_v10011476mg             254   3e-76    
ref|XP_002967375.1|  hypothetical protein SELMODRAFT_270623             256   3e-76    
ref|XP_002960337.1|  hypothetical protein SELMODRAFT_270198             255   3e-76    
ref|XP_009139082.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    254   5e-76    
ref|XP_006341245.1|  PREDICTED: fatty acyl-CoA reductase 2-like         252   5e-76    
ref|XP_006345721.1|  PREDICTED: fatty acyl-CoA reductase 2-like         253   5e-76    
ref|XP_001758118.1|  predicted protein                                  253   6e-76    
gb|AFW89578.1|  hypothetical protein ZEAMMB73_884169                    254   6e-76    
ref|XP_010325916.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    254   7e-76    
gb|KHN43996.1|  Fatty acyl-CoA reductase 2                              255   9e-76    



>emb|CDP06945.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   462 bits (1188),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 216/301 (72%), Positives = 263/301 (87%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELG+ +QFL+N  ILVTGA GFLAKIF EKILRVQPNVKKLYLLLRAAD+++ALQRFN+
Sbjct  1    MELGNIVQFLENRAILVTGATGFLAKIFTEKILRVQPNVKKLYLLLRAADSKSALQRFNS  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EII K++F++LKEKCG   N++I++K+TVVAGD++ +NLGVKD +L+  M  EVD VVNL
Sbjct  61   EIIAKDLFRVLKEKCGTDLNTLIAQKITVVAGDITSDNLGVKDLNLVEEMWREVDVVVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDV+LG+NTMG KHVLNFAK+C KL++LLHVSTAYVSG KEGL+ E+PY M
Sbjct  121  AATTNFDERYDVSLGINTMGAKHVLNFAKRCAKLKVLLHVSTAYVSGEKEGLMLETPYNM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG SGLD++ EK+ +EE L++L  DN S++SITSAMKDLGIQRAR +GWPNTYVFT
Sbjct  181  GETLNGTSGLDVEVEKKFLEEKLKELRADNNSEQSITSAMKDLGIQRARKFGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG  K + P+VI+RPTIIT T+KEPFPGWVEG+RTIDSL +GY KG++TCFLG
Sbjct  241  KAMGEMLLGHLKGNTPLVIVRPTIITSTFKEPFPGWVEGVRTIDSLAVGYAKGRITCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_010031500.1| PREDICTED: fatty acyl-CoA reductase 3 [Eucalyptus grandis]
 gb|KCW50818.1| hypothetical protein EUGRSUZ_J00479 [Eucalyptus grandis]
Length=490

 Score =   455 bits (1170),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 211/301 (70%), Positives = 261/301 (87%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+GS +QFL+N TILVTGA GFLAKIFLEKI+RVQPNVKKL+LLLRA+D +AA  RF+ 
Sbjct  1    MEMGSVIQFLENKTILVTGATGFLAKIFLEKIVRVQPNVKKLFLLLRASDAKAATHRFHD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGKE+F++LKEKCG   N+ ISEK+T+V GD+ Y +LGVKDS L  +ML ++D +VNL
Sbjct  61   EIIGKELFRVLKEKCGSDFNAFISEKITLVPGDIIYADLGVKDSSLRQQMLDQIDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+N +G KHV+NFAK+C K+++L+HVSTAYV G K GL+ E PY+M
Sbjct  121  AATTKFDERYDVALGINALGAKHVINFAKECGKVQVLVHVSTAYVCGEKGGLLQEKPYQM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDID EK+V+EE L +L  D A++E+ITSAMKDLG++RA  YGWPNTYVFT
Sbjct  181  GETLNGVAGLDIDAEKKVVEEKLNELRADGATEEAITSAMKDLGLERATRYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K++GEM++G+ KEDLP+V++RPTI+T TYKEPFPGWVEG+RTIDSL +GYGKGKLTCFLG
Sbjct  241  KSMGEMLVGQLKEDLPLVVLRPTIVTSTYKEPFPGWVEGVRTIDSLAVGYGKGKLTCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_006349115.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Solanum 
tuberosum]
Length=492

 Score =   448 bits (1152),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 258/301 (86%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L FL+N TILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRAAD ++A+QRFN 
Sbjct  1    MELTSVLNFLENRTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAADDKSAMQRFNN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GK++F++L+EKCG    + +S++ T+V GD++ ENLGV D++LL +M  EVD VVNL
Sbjct  61   EVVGKDLFKVLREKCGPNFTTFVSQRTTIVPGDITCENLGVNDTNLLEQMWKEVDIVVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT G +HVLNFAKKC KL++LLHVSTAYV G KEGL+ E PY M
Sbjct  121  AATTNFDERYDVALGLNTFGARHVLNFAKKCNKLKVLLHVSTAYVCGEKEGLMLEKPYYM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG  GLDI+ EK+VM+E L+ L  +NAS++SIT+ MK+LG++RAR YGWPNTYVFT
Sbjct  181  GETLNGTLGLDIEAEKKVMDEKLKQLNAENASEKSITTTMKELGLERARKYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG+ KE++P+VI RPTIIT T+KEPFPGWVEGIRTIDSL +GYGKG++TCFLG
Sbjct  241  KAMGEMLLGKLKEEVPLVINRPTIITSTFKEPFPGWVEGIRTIDSLAVGYGKGRITCFLG  300

Query  5    D  3
            +
Sbjct  301  N  301



>ref|XP_009781717.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Nicotiana 
sylvestris]
Length=492

 Score =   448 bits (1152),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 259/301 (86%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S ++FL+N TILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRAAD +AA+QRFN 
Sbjct  1    MELPSIVKFLENRTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAADDKAAIQRFNN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++ K++F++LKEKCG   ++ IS++ T+V GD++ ENLGVKDS+LL  M  EVD VVNL
Sbjct  61   EVVAKDLFKVLKEKCGANFSTFISQRTTIVPGDITCENLGVKDSNLLDEMWREVDIVVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT G +HVLNFAKKC KL++LLHVSTAYV G K GL+ E+PY M
Sbjct  121  AATTNFDERYDVALGINTFGARHVLNFAKKCNKLKVLLHVSTAYVCGEKPGLMLETPYSM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG SGLDI+ EK++MEE L+ L  ++AS+++IT  +K+LG++RAR YGWPNTYVFT
Sbjct  181  GETLNGTSGLDIEAEKKLMEETLKQLKAEDASEKTITITLKELGLERARKYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K +GEM+LG+ KED+P+VI+RPTIIT T+KEPFPGWVEGIRTIDSL +GYGKG++TCFLG
Sbjct  241  KTMGEMLLGKLKEDVPLVIVRPTIITSTFKEPFPGWVEGIRTIDSLAVGYGKGRITCFLG  300

Query  5    D  3
            +
Sbjct  301  N  301



>ref|XP_009631058.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=491

 Score =   447 bits (1149),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 213/301 (71%), Positives = 256/301 (85%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L+FL+N TILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRA D +AALQRFNT
Sbjct  1    MELTSVLKFLENRTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAKDNKAALQRFNT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E + K++F++L+EK G   N+ ISEK T++ GD++ ENLGVKD +L+ +M  EVD +VN+
Sbjct  61   EAVAKDLFKLLREKYGANLNTFISEKATIIPGDITCENLGVKDPNLVQQMWREVDVIVNI  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVAL +NT G   V++FAKKC KL++LLHVSTA+VSG K GLI E+PY M
Sbjct  121  AATTNFDERYDVALDLNTFGAIFVVDFAKKCSKLKVLLHVSTAFVSGEKAGLILETPYNM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG SGLDID+EK+VMEE L+ L  + +S+ SITSAMK+LGI+RAR YGWPNTYVFT
Sbjct  181  GETLNGTSGLDIDKEKKVMEETLKQLKAEGSSENSITSAMKELGIERARKYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG  KED+P+VI+RPTIIT T++EPFPGWVEGIRTIDSL +GYGKGKLTCFLG
Sbjct  241  KAMGEMLLGNLKEDIPLVILRPTIITSTFQEPFPGWVEGIRTIDSLAVGYGKGKLTCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_004251043.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Solanum 
lycopersicum]
Length=492

 Score =   447 bits (1149),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 258/301 (86%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+ S L FL+N TILVTGA GFLAKIF+EKILRVQP VKKLYLLLRAAD ++A+QRFNT
Sbjct  1    MEMTSVLNFLENRTILVTGATGFLAKIFVEKILRVQPYVKKLYLLLRAADDKSAMQRFNT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GK++F++L+EKCG    + +S++ T+V GD++ ENLGV D++LL +M  EVD VVNL
Sbjct  61   EVVGKDLFKVLREKCGPNFTTFVSQRTTIVPGDITCENLGVNDTNLLEQMWKEVDIVVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT G  HVLNFAKKC KL++LLHVSTAYV G KEGL+ E PY M
Sbjct  121  AATTNFDERYDVALGLNTFGASHVLNFAKKCNKLKVLLHVSTAYVCGEKEGLMLEKPYYM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG  GLDI+ EK+VM+E L+ L  +NAS++SIT+AMK+LG++RAR YGWPNTYVFT
Sbjct  181  GETLNGTLGLDIEAEKKVMDEKLKQLKAENASEKSITTAMKELGLERARKYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG+ KE++P+VI RPTIIT T+KEPFPGWVEGIRTIDSL +GYGKG++TCFLG
Sbjct  241  KAMGEMLLGKLKEEVPLVINRPTIITSTFKEPFPGWVEGIRTIDSLAVGYGKGRITCFLG  300

Query  5    D  3
            +
Sbjct  301  N  301



>ref|XP_006347238.1| PREDICTED: fatty acyl-CoA reductase 3-like [Solanum tuberosum]
Length=491

 Score =   446 bits (1147),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 213/301 (71%), Positives = 253/301 (84%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L+FL+N +ILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRA D  AALQRFN 
Sbjct  1    MELTSVLKFLENRSILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAQDNNAALQRFNN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E + K++F++L+EK G   N++ISE+  ++ GD+++ENLGVKDS+LL  M  EVD VVNL
Sbjct  61   EAVAKDLFKLLREKHGANLNTLISERTRIIPGDITFENLGVKDSNLLEEMWREVDVVVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDV+LG+NT G  +VLNFAKKC KL++LLHVSTAYVSG K GLI E+PY +
Sbjct  121  AATTNFDERYDVSLGLNTFGAINVLNFAKKCSKLKVLLHVSTAYVSGEKRGLILETPYNL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG SGLDI  EK+VMEE L+ L  + +SQESITSAMK+LG+QRAR YGWPN YVFT
Sbjct  181  GETLNGTSGLDIYTEKKVMEETLKQLRLEGSSQESITSAMKELGLQRARKYGWPNPYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KAL EM+LG+ KED+P+VI RPTI+T T ++PFPGWVEGIRTIDSL +GYGKGKLTCFLG
Sbjct  241  KALAEMILGDLKEDVPLVIFRPTIVTSTLQDPFPGWVEGIRTIDSLAVGYGKGKLTCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_011088872.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X2 [Sesamum indicum]
Length=441

 Score =   441 bits (1134),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 205/300 (68%), Positives = 258/300 (86%), Gaps = 3/300 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            +LGS L+FL+N++ILVTGA GFLAKIF+EKILRVQP+VKKLYLLLRAAD  +A+ RFNTE
Sbjct  3    QLGSILEFLENSSILVTGATGFLAKIFIEKILRVQPDVKKLYLLLRAADDNSAMLRFNTE  62

Query  713  IIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            +I K++F++LKEK G   + ++SEKV  VAGD++ ENLGVKD  LL  M  +VD V++LA
Sbjct  63   VIAKDLFRVLKEKHGGNLSCLLSEKVRAVAGDITSENLGVKDPDLLQEMWKQVDVVLHLA  122

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            ATTKFDERYDVAL +NT+G +HVLNF+KKC KL++ +HVSTAYVSG KEGLI E+PYK+G
Sbjct  123  ATTKFDERYDVALAINTLGARHVLNFSKKCDKLKVFVHVSTAYVSGEKEGLILETPYKLG  182

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E LNG S LDID EK++++E L+ L+  N S++SI SAMKDLGIQRAR YGWPNTYVF+K
Sbjct  183  ETLNGTSELDIDAEKKLVDETLKQLSAKNYSEDSIKSAMKDLGIQRARKYGWPNTYVFSK  242

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM+LG  K+++P+VIIRPTI+T T+K+PFPGWVEG+RTIDSL +GYGKGK+TCFLG+
Sbjct  243  AMGEMLLGHLKQNIPLVIIRPTIVTSTFKDPFPGWVEGVRTIDSLAVGYGKGKITCFLGN  302



>ref|XP_009611540.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Nicotiana 
tomentosiformis]
Length=492

 Score =   442 bits (1138),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 207/301 (69%), Positives = 257/301 (85%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S ++FL+N TILVTGA GFLAKIF+EKILR+QPNVKKLYLLLRAAD +AA+QRFNT
Sbjct  1    MELPSIVKFLENRTILVTGATGFLAKIFVEKILRIQPNVKKLYLLLRAADDKAAIQRFNT  60

Query  716  EIIGKEIFQILKEKCGN---SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++ K++F++LKEKCG    + + ++ TVV GD++ ENLGVKDS+LL  M  EVD VVNL
Sbjct  61   EVVAKDLFKVLKEKCGANFCTFVCQRTTVVPGDITCENLGVKDSNLLDEMWREVDIVVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT G +HVL+FAKKC KL++LLHVSTAYV G K GL+ E+PY M
Sbjct  121  AATTNFDERYDVALGINTFGARHVLSFAKKCNKLKVLLHVSTAYVCGEKPGLMLETPYYM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG SGLDI+ EK+++EE L+ L  ++AS ++IT A+K+LG++RAR YGWPNTYVFT
Sbjct  181  GETLNGTSGLDIEAEKKLIEETLKQLKAEDASDKAITIALKELGLERARKYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K +GEM+LG  KED+P+VI+RPTIIT T+KEPFPGWVEGIRTIDSL +GYGKG++TCFLG
Sbjct  241  KTMGEMLLGNLKEDVPLVIVRPTIITSTFKEPFPGWVEGIRTIDSLAVGYGKGRITCFLG  300

Query  5    D  3
            +
Sbjct  301  N  301



>ref|XP_004241314.1| PREDICTED: fatty acyl-CoA reductase 3 [Solanum lycopersicum]
Length=491

 Score =   441 bits (1133),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 213/301 (71%), Positives = 250/301 (83%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L+FL+N  ILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRA D  AALQRFN 
Sbjct  1    MELTSVLKFLENRAILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAQDNNAALQRFNN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E + K++F++L+EK G   N+ ISE+ T++ GD++ ENLGVKD++LL  M  EVD VVNL
Sbjct  61   EAVAKDLFKLLREKHGANLNTFISERTTIIPGDITIENLGVKDTNLLEEMWREVDVVVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT G  +VLNFAKKC KL++LLHVSTAYVSG K GLI E+PY +
Sbjct  121  AATTNFDERYDVALGLNTFGAINVLNFAKKCSKLKVLLHVSTAYVSGEKRGLILETPYNL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG SGLDI  EK+VMEE L+ L  + +SQESITSAMK+LG+QRAR YGWPN YVFT
Sbjct  181  GETLNGTSGLDIYTEKKVMEETLKQLRVEGSSQESITSAMKELGLQRARKYGWPNPYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KAL EM+LG+ KED+ +VI RPTI+T T ++PFPGWVEGIRTIDSL +GYGKGKLTCFLG
Sbjct  241  KALAEMILGDMKEDVLLVIFRPTIVTSTLRDPFPGWVEGIRTIDSLAVGYGKGKLTCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_011088871.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Sesamum indicum]
Length=493

 Score =   441 bits (1134),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 205/300 (68%), Positives = 258/300 (86%), Gaps = 3/300 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            +LGS L+FL+N++ILVTGA GFLAKIF+EKILRVQP+VKKLYLLLRAAD  +A+ RFNTE
Sbjct  3    QLGSILEFLENSSILVTGATGFLAKIFIEKILRVQPDVKKLYLLLRAADDNSAMLRFNTE  62

Query  713  IIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            +I K++F++LKEK G   + ++SEKV  VAGD++ ENLGVKD  LL  M  +VD V++LA
Sbjct  63   VIAKDLFRVLKEKHGGNLSCLLSEKVRAVAGDITSENLGVKDPDLLQEMWKQVDVVLHLA  122

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            ATTKFDERYDVAL +NT+G +HVLNF+KKC KL++ +HVSTAYVSG KEGLI E+PYK+G
Sbjct  123  ATTKFDERYDVALAINTLGARHVLNFSKKCDKLKVFVHVSTAYVSGEKEGLILETPYKLG  182

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E LNG S LDID EK++++E L+ L+  N S++SI SAMKDLGIQRAR YGWPNTYVF+K
Sbjct  183  ETLNGTSELDIDAEKKLVDETLKQLSAKNYSEDSIKSAMKDLGIQRARKYGWPNTYVFSK  242

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM+LG  K+++P+VIIRPTI+T T+K+PFPGWVEG+RTIDSL +GYGKGK+TCFLG+
Sbjct  243  AMGEMLLGHLKQNIPLVIIRPTIVTSTFKDPFPGWVEGVRTIDSLAVGYGKGKITCFLGN  302



>ref|XP_008228911.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Prunus 
mume]
Length=490

 Score =   440 bits (1132),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 208/301 (69%), Positives = 258/301 (86%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S LQF+ N  ILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRA DT++A QR + 
Sbjct  1    MELESILQFIQNKNILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAVDTKSATQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++L+EK G   NS++SEK+TVV GD+S+E+LG+KDS+L   MLS++D +VNL
Sbjct  61   EIIGKDLFRVLREKWGAGMNSIVSEKLTVVPGDISHEDLGLKDSNLREEMLSQIDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G KHVLNFAK+C KL++L+HVSTAYV G K+GL+ E+PY M
Sbjct  121  AATTNFDERYDVALGINTLGAKHVLNFAKQCFKLKVLVHVSTAYVCGEKDGLLLENPYHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG SGLDID E R ++E LR+L  +  ++++ITSA+KD G++RA +YGWPNTYVFT
Sbjct  181  GETLNGTSGLDIDNEIRQVQEKLRELRAEGLTEQAITSALKDFGLKRANIYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G+ KE+LP+VI+RPTIIT TYKEPFPGWVEGIRTIDSL +GYGKGKLT FL 
Sbjct  241  KAIGEMLIGDLKENLPLVILRPTIITSTYKEPFPGWVEGIRTIDSLAVGYGKGKLTFFLC  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_011090359.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Sesamum indicum]
Length=491

 Score =   439 bits (1128),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 205/300 (68%), Positives = 255/300 (85%), Gaps = 3/300 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            +LGS LQFL+N +ILVTGA GFLAKIF+EKILRVQPNV+KLYLLLRA D + A+ RFNTE
Sbjct  3    QLGSILQFLENRSILVTGATGFLAKIFIEKILRVQPNVRKLYLLLRAPDAKTAMLRFNTE  62

Query  713  IIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            ++ K++F+++KEK G   +S+ISEKV VVAGD++ ENLGVKD+ LL  M  EVD VVNLA
Sbjct  63   VMAKDLFRVVKEKYGGGLSSLISEKVKVVAGDITCENLGVKDTVLLEEMWKEVDVVVNLA  122

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            A T FDERYDV+L +NT+G KHVLNF+K+C KL++ +HVSTAYVSG KEGLI E+PYKMG
Sbjct  123  ANTNFDERYDVSLAINTLGAKHVLNFSKRCDKLKVHVHVSTAYVSGEKEGLILETPYKMG  182

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E LNG SGL ID EK+++++ L+ L  +N S+E I SAMKDLGIQRAR +GWPNTYVF+K
Sbjct  183  ETLNGTSGLAIDAEKKLVDDTLKQLKAENCSEEFIKSAMKDLGIQRARKFGWPNTYVFSK  242

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM+LG  KE++P+VI+RPTI+T TYKEPFPGW EG+RTIDSL +GYGKG++TCFLG+
Sbjct  243  AMGEMLLGHLKENIPLVIVRPTIVTSTYKEPFPGWAEGVRTIDSLAVGYGKGRITCFLGN  302



>ref|XP_007015863.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
 gb|EOY33482.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
Length=491

 Score =   436 bits (1121),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 211/301 (70%), Positives = 253/301 (84%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGSALQFLD+ +ILVTGA GFLAKIF+EKILRVQPNVKK YLLLRAAD ++A+ R + 
Sbjct  1    MELGSALQFLDSKSILVTGATGFLAKIFVEKILRVQPNVKKFYLLLRAADHKSAIHRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKEK G   +S ISEK+T++ GD+S+E+LGV+DS+L+  M  EVD VVNL
Sbjct  61   EIIGKDLFKVLKEKYGKNFSSFISEKITLIPGDISHEDLGVEDSNLVQEMCREVDVVVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G K VLNFAKKC KL++L+HVSTAYVSG + GLI E+ Y M
Sbjct  121  AATTNFDERYDVALGLNTLGAKFVLNFAKKCVKLKVLVHVSTAYVSGERSGLILENSYNM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG SGLDI+ EK+V+EE L +L    AS++ IT AMKDLGI+RARMYGWPN YVFT
Sbjct  181  GETLNGVSGLDINIEKKVVEEKLDELRSQGASEKEITRAMKDLGIERARMYGWPNAYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  K ++P VIIRPTIIT TYKEPFPGW EG+RTIDSL +GY KGKLT FLG
Sbjct  241  KAMGEMLVGYMKGNMPTVIIRPTIITSTYKEPFPGWAEGVRTIDSLAVGYAKGKLTFFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_009789793.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Nicotiana sylvestris]
Length=490

 Score =   436 bits (1120),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 254/301 (84%), Gaps = 4/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S ++FL+N TILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRA D +AALQRFNT
Sbjct  1    MELTS-VKFLENRTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAKDNKAALQRFNT  59

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E + K++F++L+EK G   N+ ISEK T++AGD++ E LGVKD +L+  M  EVD +VN+
Sbjct  60   EAVAKDLFKLLREKYGANLNTFISEKATIIAGDITCEKLGVKDPNLVEEMWREVDVIVNI  119

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVAL +NT G   VL+FAKKC KL++LLHVSTA+VSG K GLI E+PY +
Sbjct  120  AATTNFDERYDVALDLNTFGAIFVLDFAKKCSKLKVLLHVSTAFVSGEKAGLILETPYNL  179

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG SGLDID E +VMEE L+ L  + +S++SITSAMK+LG++RAR YGWPNTYVFT
Sbjct  180  GETLNGTSGLDIDTENKVMEETLKQLKAEGSSEQSITSAMKELGLERARKYGWPNTYVFT  239

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG  KED+P+VI+RPTIIT T++EPFPGWVEGIRTIDSL +GYGKG+LTCFLG
Sbjct  240  KAMGEMLLGNLKEDIPLVILRPTIITSTFQEPFPGWVEGIRTIDSLAVGYGKGRLTCFLG  299

Query  5    D  3
            D
Sbjct  300  D  300



>ref|XP_007205116.1| hypothetical protein PRUPE_ppa004817mg [Prunus persica]
 gb|EMJ06315.1| hypothetical protein PRUPE_ppa004817mg [Prunus persica]
Length=490

 Score =   434 bits (1116),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 205/301 (68%), Positives = 255/301 (85%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S LQF+ N  ILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRAAD ++A QR + 
Sbjct  1    MELESILQFIQNKNILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAADKKSATQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++L+EK G   NS++SEK+TVV GD+S E+LG+KDS+L   MLS++D +VNL
Sbjct  61   EIIGKDLFRVLREKWGAGMNSIVSEKLTVVPGDISLEDLGLKDSNLREEMLSQIDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVAL +NT+G KHVLNFAK+C KL++L+HVSTAYV G K+GL+ E+PY M
Sbjct  121  AATTNFDERYDVALDINTLGAKHVLNFAKQCVKLKVLVHVSTAYVCGEKDGLLLENPYHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG SGLDID E R ++E LR+L  +  ++++ITS +KD G++RA +YGWPNTYVFT
Sbjct  181  GETLNGTSGLDIDSEIRQVQEKLRELRAEGLTEQTITSDLKDFGLKRANIYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G+ KE+LP+VI+RPTIIT TYKEPFPGWVEG+RTIDSL +GYGKGKLT FL 
Sbjct  241  KAMGEMLIGDLKENLPLVIVRPTIITSTYKEPFPGWVEGVRTIDSLAVGYGKGKLTFFLC  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_006487974.1| PREDICTED: fatty acyl-CoA reductase 3-like [Citrus sinensis]
Length=492

 Score =   429 bits (1104),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 204/301 (68%), Positives = 254/301 (84%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS L+FL+N TILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRAAD ++A  RF+ 
Sbjct  1    MELGSVLEFLENKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAADAKSATVRFHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKEK G   N++ISEK+T+V GD++ E+LGVKDS+L   M +++D V+NL
Sbjct  61   EIIGKDLFRVLKEKNGTHLNALISEKITLVPGDITREDLGVKDSNLREEMWNKLDVVINL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVAL +NT G KHVLNF+KKC KL +L+HVSTA+V G + G++ ES +KM
Sbjct  121  AATTNFDERYDVALDLNTFGAKHVLNFSKKCAKLNVLVHVSTAFVWGEESGMLYESSFKM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+ LNG SGLDID E++V+E+ L +L  + AS+E+IT AMKDLGI+RA++YGWPNTYVFT
Sbjct  181  GDTLNGASGLDIDVERQVVEQELNELQAEGASEEAITLAMKDLGIKRAKIYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K +GEM +   KE++ V I+RPTI+TGTYKEPFPGW EGIRTIDSL LGYGKG+LTCFLG
Sbjct  241  KVMGEMFIEHLKENMSVAIVRPTIVTGTYKEPFPGWAEGIRTIDSLALGYGKGRLTCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>emb|CAN81280.1| hypothetical protein VITISV_041831 [Vitis vinifera]
Length=469

 Score =   427 bits (1098),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 203/301 (67%), Positives = 256/301 (85%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS ++FL+N +ILVTGA GFLAKIF+EKILR+QPNVKKL+LLLRAADT++A QR + 
Sbjct  1    MELGSIVEFLENKSILVTGATGFLAKIFVEKILRIQPNVKKLFLLLRAADTKSATQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GKE+F++L++K G   NS ISEKVT ++GD+S ENLGV + +L   +  EVD ++NL
Sbjct  61   EVLGKELFRVLRDKWGSNLNSFISEKVTPISGDISCENLGVTNLNLREEIWREVDVILNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT+G  HVLNF+KKC KL++LLHVSTAYVSG +EGLI ESP KM
Sbjct  121  AATTKFDERYDVALGINTLGASHVLNFSKKCVKLKMLLHVSTAYVSGEREGLILESPLKM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+ALNG SGLD+D+EK+++EE L +L    A++E+I+  MK+LG++RA MYGWPNTYVFT
Sbjct  181  GKALNGASGLDVDKEKKLVEEGLNELNELQATEETISLTMKELGMKRALMYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG+FKE+LP+VI+RPTIIT TY EPF GW+EGIRTIDS+   Y KGKLTCFL 
Sbjct  241  KAMGEMLLGQFKENLPLVILRPTIITSTYMEPFSGWIEGIRTIDSVLATYCKGKLTCFLA  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_010651912.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase isoform X2 
[Vitis vinifera]
Length=460

 Score =   427 bits (1098),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 203/301 (67%), Positives = 255/301 (85%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS ++FL+N +ILVTGA GFLAKIF+EKILR+QPNVKKL+LLLRAADT++A QR + 
Sbjct  1    MELGSIVEFLENKSILVTGATGFLAKIFVEKILRIQPNVKKLFLLLRAADTKSATQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GKE+F++LK+K G   NS ISEKVT + GD+S ENLGV + +L   +  EVD ++NL
Sbjct  61   EVLGKELFRVLKDKWGSNLNSFISEKVTPIPGDISCENLGVTNLNLREEIWREVDVILNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT+G  HVLNF+KKC KL++LLHVSTAYVSG +EGLI ESP KM
Sbjct  121  AATTKFDERYDVALGINTLGASHVLNFSKKCVKLKMLLHVSTAYVSGEREGLILESPLKM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+ALNG SGLD+D+EK+++EE L +L    A++E+I+  MK+LG++RA MYGWPNTYVFT
Sbjct  181  GKALNGASGLDVDKEKKLVEEGLNELNELQATEETISLTMKELGMKRALMYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG+FKE+LP+VI+RPTIIT TY EPF GW+EGIRTID++  GY KGKLTC L 
Sbjct  241  KAMGEMLLGQFKENLPLVILRPTIITSTYMEPFSGWIEGIRTIDNVLAGYCKGKLTCLLA  300

Query  5    D  3
            D
Sbjct  301  D  301



>gb|KDO58051.1| hypothetical protein CISIN_1g037479mg [Citrus sinensis]
Length=492

 Score =   427 bits (1099),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 204/301 (68%), Positives = 254/301 (84%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS L+FL+N TILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRAAD ++A  RF+ 
Sbjct  1    MELGSVLEFLENKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAADAKSATVRFHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKEK G   N++ISEK+T+V GD++ E+LGVKDS+L   M +++D V+NL
Sbjct  61   EIIGKDLFRVLKEKNGTHLNALISEKITLVPGDITREDLGVKDSNLREEMWNKLDVVINL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVAL +NT G KHVLNF+KKC KL +L+HVSTA+V G + G++ ES +KM
Sbjct  121  AATTNFDERYDVALDLNTFGAKHVLNFSKKCAKLIVLVHVSTAFVWGEESGMLYESSFKM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+ LNG SGLDID E++V+E+ L +L  + AS+E+IT AMKDLGI+RA++YGWPNTYVFT
Sbjct  181  GDTLNGASGLDIDVERQVVEQELNELQAEGASEEAITLAMKDLGIKRAKIYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K +GEM +   KE++ V I+RPTIITGTYKEPFPGW EGIRTIDSL +GYGKG+LTCFLG
Sbjct  241  KVMGEMFIEHLKENMSVAIVRPTIITGTYKEPFPGWAEGIRTIDSLAVGYGKGRLTCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>gb|ADK66305.1| gland-specific fatty acyl-CoA reductase 1 [Artemisia annua]
Length=493

 Score =   427 bits (1099),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 204/302 (68%), Positives = 251/302 (83%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELG  + FL+N  IL+TGA GFLAKIF+EKILRVQPNVKKLYLL+RA D  AALQRFNT
Sbjct  2    MELGRIVDFLENKVILITGATGFLAKIFVEKILRVQPNVKKLYLLVRAPDATAALQRFNT  61

Query  716  EIIGKEIFQILKEKCGNSV---ISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E + K++F++LKEK G ++   +SEKVT VAGD+++E+LG++D  L   ML ++D VVN+
Sbjct  62   EAVAKDLFKVLKEKHGTNLQKFLSEKVTPVAGDITFEDLGLQDPSLKVEMLRDIDVVVNI  121

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVAL +NT G K+VLNFAKKC  +++LLHVSTAYVSG K GLI E+P+ +
Sbjct  122  AATTNFDERYDVALALNTYGAKYVLNFAKKCANIKLLLHVSTAYVSGEKPGLILETPHYL  181

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRD-NASQESITSAMKDLGIQRARMYGWPNTYVF  189
            GE+LNG SGLDIDEE+++++E L+++  D NA+  SI  AMK LG++R+  YGWPNTYVF
Sbjct  182  GESLNGTSGLDIDEERKIVQEKLKEVKSDQNANDNSIKIAMKKLGMERSNHYGWPNTYVF  241

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKALGEM++G  K D+PVVIIRPTI+T TYKEPFPGWVEGIRTIDSL LGYGKGKLTCFL
Sbjct  242  TKALGEMIIGHLKGDMPVVIIRPTIVTSTYKEPFPGWVEGIRTIDSLVLGYGKGKLTCFL  301

Query  8    GD  3
            GD
Sbjct  302  GD  303



>ref|XP_010045241.1| PREDICTED: fatty acyl-CoA reductase 3-like [Eucalyptus grandis]
 gb|KCW87399.1| hypothetical protein EUGRSUZ_B03877 [Eucalyptus grandis]
Length=492

 Score =   427 bits (1099),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 200/301 (66%), Positives = 252/301 (84%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            M+L S LQFL+N TILVTGAAGFLAKIF+EK+LRVQPNVK LYLLLRAAD ++A QR ++
Sbjct  1    MKLESVLQFLENKTILVTGAAGFLAKIFVEKVLRVQPNVKNLYLLLRAADAKSATQRLHS  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+ GK++F+++KEK G   +S+ISEKVTVVAGD++ E+LGV DS L  +ML+++D V+NL
Sbjct  61   EVFGKDLFRVVKEKYGPDFSSLISEKVTVVAGDITCEDLGVMDSDLREQMLAQIDVVINL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALGVNT G K+V  FAKKC +L +L+HVST+YV G + GLI ESPY+M
Sbjct  121  AATTNFDERYDVALGVNTYGAKYVTEFAKKCSQLMVLVHVSTSYVCGERAGLIKESPYRM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDID EKR++E+ L +L R+ AS++    AMK LG++RA+MYGWPNTYVFT
Sbjct  181  GETLNGVAGLDIDAEKRIVEDRLAELRREGASEKETRVAMKQLGLKRAKMYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++GE KED+  VI+RPTI+T TYKEPFPGW EG+RT+D+L +GY  GKLTCFLG
Sbjct  241  KAMGEMLVGELKEDISAVIVRPTIVTSTYKEPFPGWAEGVRTVDTLAVGYATGKLTCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_009364297.1| PREDICTED: fatty acyl-CoA reductase 3-like [Pyrus x bretschneideri]
Length=490

 Score =   427 bits (1099),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 204/301 (68%), Positives = 252/301 (84%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L F+++  ILVTGA GFLAKIF+EKILRVQPNV+KLYLLLRA DT++A QR N 
Sbjct  1    MELESILYFIESKNILVTGATGFLAKIFVEKILRVQPNVEKLYLLLRAPDTKSATQRLNN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F+++KEK G   NS+ISEK+TVV GD+S E+LG+ DS+L   MLS++D +VNL
Sbjct  61   EIIGKDLFRVVKEKWGAGMNSIISEKLTVVPGDISLEDLGLNDSNLREEMLSQIDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYD+AL +NT+G KHVLNFAK+C KL++L+HVSTAYV G KEGL+ E+PY M
Sbjct  121  AATTNFDERYDIALALNTLGAKHVLNFAKQCVKLKVLVHVSTAYVCGEKEGLLLENPYHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDID E R++ E L++L  + AS+ +IT A+KD G++RA  YGWPNTYVFT
Sbjct  181  GETLNGTTGLDIDNEIRLVHEKLKELRAEEASERAITLALKDFGLKRAIQYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G+ KE+LPVVIIRPTIIT TYKEPFPGWVEGIRTIDS+ +GY KGKLT FL 
Sbjct  241  KAMGEMLIGDLKENLPVVIIRPTIITSTYKEPFPGWVEGIRTIDSIAVGYAKGKLTFFLC  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_002263184.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase isoform X1 
[Vitis vinifera]
 emb|CBI28354.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   426 bits (1095),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 203/301 (67%), Positives = 255/301 (85%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS ++FL+N +ILVTGA GFLAKIF+EKILR+QPNVKKL+LLLRAADT++A QR + 
Sbjct  1    MELGSIVEFLENKSILVTGATGFLAKIFVEKILRIQPNVKKLFLLLRAADTKSATQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GKE+F++LK+K G   NS ISEKVT + GD+S ENLGV + +L   +  EVD ++NL
Sbjct  61   EVLGKELFRVLKDKWGSNLNSFISEKVTPIPGDISCENLGVTNLNLREEIWREVDVILNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT+G  HVLNF+KKC KL++LLHVSTAYVSG +EGLI ESP KM
Sbjct  121  AATTKFDERYDVALGINTLGASHVLNFSKKCVKLKMLLHVSTAYVSGEREGLILESPLKM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+ALNG SGLD+D+EK+++EE L +L    A++E+I+  MK+LG++RA MYGWPNTYVFT
Sbjct  181  GKALNGASGLDVDKEKKLVEEGLNELNELQATEETISLTMKELGMKRALMYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG+FKE+LP+VI+RPTIIT TY EPF GW+EGIRTID++  GY KGKLTC L 
Sbjct  241  KAMGEMLLGQFKENLPLVILRPTIITSTYMEPFSGWIEGIRTIDNVLAGYCKGKLTCLLA  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_009338685.1| PREDICTED: fatty acyl-CoA reductase 3-like [Pyrus x bretschneideri]
Length=490

 Score =   425 bits (1092),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 203/301 (67%), Positives = 252/301 (84%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L F++N  ILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRA DT++A +R N 
Sbjct  1    MELESILYFIENKNILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAPDTKSATERLNN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKEK G   NS+ISEK+TVV GD+S E+LG+ DS L   MLS +D +VNL
Sbjct  61   EIIGKDLFRVLKEKWGAGMNSIISEKLTVVPGDISREDLGLNDSSLREEMLSHIDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYD+AL +NT+G  HVLNFAK+C  L++L+HVSTAYV G KEGL+ E+ Y+M
Sbjct  121  AATTNFDERYDIALALNTLGAMHVLNFAKQCNTLKVLVHVSTAYVCGEKEGLLLENAYRM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDID E R+++E L++L  + AS+++IT A+KD G++RA +YGWPNTYVFT
Sbjct  181  GETLNGTTGLDIDNEIRLVQEELKELRAEGASEQAITLALKDFGLKRAIVYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G+ KE+LPVVIIRPTII+ TYKEPFPGWVEGIRTIDS+ +GYGKGKLT FL 
Sbjct  241  KAMGEMLIGDLKENLPVVIIRPTIISSTYKEPFPGWVEGIRTIDSIAVGYGKGKLTFFLC  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_011090360.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X2 [Sesamum indicum]
Length=487

 Score =   424 bits (1091),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 201/300 (67%), Positives = 251/300 (84%), Gaps = 7/300 (2%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            +LGS LQFL+N +ILVTGA GFLAKIF+EKILRVQPNV+KLYLLLRA D + A+ RFNTE
Sbjct  3    QLGSILQFLENRSILVTGATGFLAKIFIEKILRVQPNVRKLYLLLRAPDAKTAMLRFNTE  62

Query  713  IIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            ++ K++F+++KEK G   +S+ISEKV VVAGD++ ENLGVKD+ LL  M  EVD VVNLA
Sbjct  63   VMAKDLFRVVKEKYGGGLSSLISEKVKVVAGDITCENLGVKDTVLLEEMWKEVDVVVNLA  122

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            A T FDERYDV+L +NT+G KHVLNF+K+C KL++ +HVSTAYVSG KEGLI E+PYKMG
Sbjct  123  ANTNFDERYDVSLAINTLGAKHVLNFSKRCDKLKVHVHVSTAYVSGEKEGLILETPYKMG  182

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E LNG SGL ID EK+++++ L+ L  +N S+E I SAMKDLGIQRAR +GWPNTYVF+K
Sbjct  183  ETLNGTSGLAIDAEKKLVDDTLKQLKAENCSEEFIKSAMKDLGIQRARKFGWPNTYVFSK  242

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM+LG  KE++P+VI+RPTI+T TYKEPFPGW EG+    SL +GYGKG++TCFLG+
Sbjct  243  AMGEMLLGHLKENIPLVIVRPTIVTSTYKEPFPGWAEGV----SLAVGYGKGRITCFLGN  298



>ref|XP_002263127.1| PREDICTED: fatty acyl-CoA reductase 3 [Vitis vinifera]
 emb|CBI28353.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   424 bits (1091),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 199/301 (66%), Positives = 251/301 (83%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS ++FL+N +ILVTGA GFLAKIF+E+ILR QPNVKKL+LLLRA DT++A QR + 
Sbjct  1    MELGSIVEFLENKSILVTGATGFLAKIFVERILRTQPNVKKLFLLLRAGDTKSATQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGKE+F +L+EK     NS +S+K+T V GD+S ++LGV DS+L   M  EVD VVNL
Sbjct  61   EVIGKELFWVLREKWASDFNSFVSKKLTPVPGDISCDDLGVTDSNLREEMWREVDIVVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+N +G +HVL+FAKKC K+++LLHVSTAYV+G + GLI E P++M
Sbjct  121  AATTNFDERYDVALGINALGARHVLDFAKKCVKIKMLLHVSTAYVAGEQSGLILEQPFQM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG  GLDI+EEK++MEE L +L  + A++E++T AMKD GIQRA+M+GWPNTYVFT
Sbjct  181  GETLNGTFGLDIEEEKKLMEERLDELQSEGATREAVTLAMKDFGIQRAKMHGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG  KE+LP+ I+RPTI++ TYKEPFPGWVEGIRTIDS  +GYGKG+LT FLG
Sbjct  241  KAMGEMLLGHLKENLPLAILRPTIVSSTYKEPFPGWVEGIRTIDSFAVGYGKGRLTFFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_002313668.2| hypothetical protein POPTR_0009s14720g [Populus trichocarpa]
 gb|EEE87623.2| hypothetical protein POPTR_0009s14720g [Populus trichocarpa]
Length=492

 Score =   424 bits (1089),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 200/302 (66%), Positives = 254/302 (84%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME GS +QFL++ TIL+TGA GFLAKI LEKILRVQP VKK+YLLLRAAD ++A QR   
Sbjct  1    MEFGSVVQFLEDKTILITGATGFLAKILLEKILRVQPKVKKIYLLLRAADAKSASQRLQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYEN-LGVKDSHLLTRMLSEVDAVVN  549
            E+IGK++F+ILKEK G   NS++++K+ +V GD+SYE+ LGVKDS+L   M S++D VVN
Sbjct  61   EVIGKDLFRILKEKWGENLNSIVTKKIVLVPGDISYEDDLGVKDSNLREEMWSQLDVVVN  120

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            LAATT FDE YDVALG+NTMG KHVL FAKKC +L++L+HVSTA+VSG + GLI E+PY 
Sbjct  121  LAATTNFDEGYDVALGINTMGAKHVLCFAKKCVRLKVLVHVSTAFVSGERAGLILETPYG  180

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            +G+ LNG  GLDIDEEK+++++ L +L  + A+ E+I  AMKD+G++RA++YGWPNTYVF
Sbjct  181  VGDTLNGVCGLDIDEEKKLVDQKLNELQAEGATAEAIKDAMKDMGMERAKVYGWPNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM++G  KEDL VVIIRPTI+T TY+EPFPGWVEG+RTIDSL +GYGKG+LTCFL
Sbjct  241  TKAMGEMLVGHLKEDLSVVIIRPTIVTSTYEEPFPGWVEGVRTIDSLAVGYGKGRLTCFL  300

Query  8    GD  3
            GD
Sbjct  301  GD  302



>ref|XP_002305561.2| hypothetical protein POPTR_0004s19580g [Populus trichocarpa]
 gb|EEE86072.2| hypothetical protein POPTR_0004s19580g [Populus trichocarpa]
Length=492

 Score =   424 bits (1089),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 204/302 (68%), Positives = 254/302 (84%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME GS +QFL++ TIL+TGA GFLAKI LEKILRVQPNVKK+YLLLRAAD ++A QR   
Sbjct  1    MEFGSVVQFLEDKTILITGATGFLAKILLEKILRVQPNVKKIYLLLRAADAKSASQRLQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYEN-LGVKDSHLLTRMLSEVDAVVN  549
            EI+GK++F +LKEK G   NS+IS+K+ +V GD+SY++ LGVKDS+L   + S++D VVN
Sbjct  61   EILGKDLFTLLKEKWGADLNSLISKKIVLVPGDISYDDDLGVKDSNLREEIWSQLDVVVN  120

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            LAATT FDERYDVALG+NTMG KHVL FAKKC KL++L+HVSTAYVSG + GLI E+ Y 
Sbjct  121  LAATTNFDERYDVALGINTMGAKHVLCFAKKCVKLKVLVHVSTAYVSGERAGLILEASYG  180

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
             G+ LNG SGLDIDEEK+++++ L +L  + A+ E+I  AMKD+GI+RA++YGWPNTYVF
Sbjct  181  RGDTLNGVSGLDIDEEKKLVDQKLNELQAEGATTEAIKEAMKDMGIERAKVYGWPNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM++G+ KE+L VVIIRPTI+T T KEPFPGWVEGIRTIDSL +GYGKG+LTCFL
Sbjct  241  TKAMGEMLVGDLKENLSVVIIRPTIVTSTLKEPFPGWVEGIRTIDSLAVGYGKGRLTCFL  300

Query  8    GD  3
            GD
Sbjct  301  GD  302



>gb|KDP42371.1| hypothetical protein JCGZ_01947 [Jatropha curcas]
Length=492

 Score =   423 bits (1088),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 202/302 (67%), Positives = 249/302 (82%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME GS LQFL+N  IL+TGA GFLAKI +EKILRVQPNV+KLYLLLRAAD ++A QRF+ 
Sbjct  1    MEFGSILQFLENKNILITGATGFLAKIMVEKILRVQPNVQKLYLLLRAADAKSASQRFHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSY-ENLGVKDSHLLTRMLSEVDAVVN  549
            EIIGK++F++LKEKCG   NS I+EK+ ++ GD+SY E+LGVK+S L   M  E+D +VN
Sbjct  61   EIIGKDLFRVLKEKCGANLNSFINEKIVLLTGDISYDEDLGVKESSLREEMWKELDVIVN  120

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            LAATT FDERYDVAL VNT+G KHV+ FA KC KL++L+HVSTAYVSG K GLI E+P+ 
Sbjct  121  LAATTNFDERYDVALEVNTIGAKHVMCFANKCVKLKVLIHVSTAYVSGEKSGLILENPFG  180

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
             GE LNG SGLDIDEEK++++  L +L    A+ ++I  AMKD+GIQRA++YGWPNTYVF
Sbjct  181  NGETLNGVSGLDIDEEKKLVDLKLDELQSQGATPQAIKEAMKDMGIQRAKVYGWPNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM++G  K +L VVI+RPTI+T TYKEPFPGWVEG+RTIDSL +GY KG+LTCFL
Sbjct  241  TKAMGEMLVGHLKGNLSVVIVRPTIVTSTYKEPFPGWVEGVRTIDSLAVGYAKGRLTCFL  300

Query  8    GD  3
            GD
Sbjct  301  GD  302



>ref|XP_009376588.1| PREDICTED: fatty acyl-CoA reductase 3-like [Pyrus x bretschneideri]
Length=490

 Score =   421 bits (1081),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 201/301 (67%), Positives = 252/301 (84%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L F++N  ILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRA DT++A +R N 
Sbjct  1    MELESILYFIENKNILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAPDTKSATERLNN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKEK G   NS+ISEK+TVV GD+S E+LG+ DS L   MLS +D VVNL
Sbjct  61   EIIGKDLFRVLKEKWGAGMNSIISEKLTVVPGDISREDLGLNDSSLREEMLSHIDVVVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYD+AL +N++G  HVLNFAK+C  L++L+HVSTAYV G KEGL+ E+ Y+M
Sbjct  121  AATTNFDERYDIALALNSLGAMHVLNFAKQCNTLKVLVHVSTAYVCGEKEGLLLENAYRM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDID E ++++E L++L  + AS+++IT A+KD G++RA ++GWPNTYVFT
Sbjct  181  GETLNGTTGLDIDNEIKLVQEKLKELRAEGASEQAITLALKDFGLKRAIVHGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G+ KE+LPVVIIRPTII+ TYKEPFPGWVEGIRTIDS+ +GYGKGKLT FL 
Sbjct  241  KAMGEMLIGDLKENLPVVIIRPTIISSTYKEPFPGWVEGIRTIDSIAVGYGKGKLTFFLC  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_011046268.1| PREDICTED: fatty acyl-CoA reductase 3-like [Populus euphratica]
Length=492

 Score =   419 bits (1076),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/302 (67%), Positives = 251/302 (83%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME GS +QFL++ TIL+TGA GFLAKI LEKILRVQPNVKK+YLLLRAAD ++A QR   
Sbjct  1    MEFGSVVQFLEDKTILITGATGFLAKILLEKILRVQPNVKKIYLLLRAADAKSASQRLQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYEN-LGVKDSHLLTRMLSEVDAVVN  549
            EI+GK++F +LKEK G   NS IS+K+ +V GD+SY++ LGVKDS+L   + S++D VVN
Sbjct  61   EILGKDLFTLLKEKWGADLNSFISKKIVLVPGDISYDDDLGVKDSNLREEIWSQLDVVVN  120

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            LAATT FDERYDVALG+NTMG  HVL FAKKC KL +L+HVSTAYVSG + GLI E+ Y 
Sbjct  121  LAATTNFDERYDVALGINTMGAMHVLCFAKKCVKLTVLVHVSTAYVSGERAGLIPETSYG  180

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
             G+ LNG SGLDI+EEK+++++ L +L  + A+ E+I  AMKD+GI+RA++YGWPNTYVF
Sbjct  181  WGDTLNGVSGLDINEEKKLVDQKLNELQAEGATAEAIKEAMKDMGIERAKVYGWPNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM++G+ KE+L VVIIRPTI+T T KEPFPGW+EGIRTIDSL +GYGKG+LTCFL
Sbjct  241  TKAMGEMLVGDLKENLSVVIIRPTIVTSTLKEPFPGWIEGIRTIDSLAVGYGKGRLTCFL  300

Query  8    GD  3
            GD
Sbjct  301  GD  302



>ref|XP_010089855.1| Fatty acyl-CoA reductase 3 [Morus notabilis]
 gb|EXB38471.1| Fatty acyl-CoA reductase 3 [Morus notabilis]
Length=492

 Score =   418 bits (1075),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/301 (67%), Positives = 245/301 (81%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L+FL+N +IL+TGA GFLAKIF EK+LR QP VKKLYLLLRA D ++A QR N 
Sbjct  1    MELESVLKFLENKSILITGATGFLAKIFAEKVLRAQPKVKKLYLLLRANDEKSATQRLNN  60

Query  716  EIIGKEIFQILKEKCGNSV---ISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKE+ G S    + EK++V+AGD++ E+LG+KD  L   ML+++D +VNL
Sbjct  61   EIIGKDLFKVLKERLGASFGTFVREKLSVMAGDITREDLGLKDLKLKEEMLNQLDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYD++L +NT+G KH LNFAK+C KL+IL+HVSTAYVSG K GLI E+PY M
Sbjct  121  AATTNFDERYDISLFLNTVGVKHCLNFAKQCQKLKILVHVSTAYVSGEKGGLILENPYHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+ LNG +GLDID E R++E  L+ L  + AS+  IT AMKD GIQRA  YGWPNTYVFT
Sbjct  181  GDTLNGATGLDIDNEVRLVEAKLKQLQAEEASEAEITLAMKDFGIQRANKYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEMVLG  KE++ VVIIRPTIIT TYKEPFPGWVEG+RTIDSL +GYGKGKLTCFLG
Sbjct  241  KAMGEMVLGHLKENVNVVIIRPTIITSTYKEPFPGWVEGLRTIDSLAVGYGKGKLTCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_007015865.1| Jojoba acyl CoA reductase-related male sterility protein, putative 
[Theobroma cacao]
 gb|EOY33484.1| Jojoba acyl CoA reductase-related male sterility protein, putative 
[Theobroma cacao]
Length=534

 Score =   419 bits (1078),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 201/301 (67%), Positives = 247/301 (82%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME GS LQFLDN +I V GA GFLAKIF+EKILRVQPNVKKLYLLLRA D+++A QRF+ 
Sbjct  43   MESGSVLQFLDNKSIFVIGATGFLAKIFVEKILRVQPNVKKLYLLLRAEDSKSATQRFHN  102

Query  716  EIIGKEIFQILKEKCGN---SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGKE+F++LKEK GN   S ISEK+ VV GD+S+E+LG+K+S L   +  EVD VVN 
Sbjct  103  EIIGKELFKVLKEKWGNNFNSFISEKIAVVPGDISHEDLGLKNSKLEKELRREVDVVVNS  162

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+N +G KHVL+FAKKC KL++ +HVSTAYV+G K GLI ES + M
Sbjct  163  AATTNFDERYDVALGLNVLGAKHVLDFAKKCAKLKVFVHVSTAYVAGEKSGLILESSFSM  222

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+ LNG SGLDI+ E +V EE L+ L    AS++ IT  MKDLG +RAR++GWPNTYVFT
Sbjct  223  GKTLNGVSGLDINVEMKVAEEELKQLQAQGASEKEITLVMKDLGAERARLFGWPNTYVFT  282

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G FK DLP+VI+RPTI+T T+KEPFPGW+EG+RTIDS+ +G GKGK+TCFLG
Sbjct  283  KAMGEMLVGNFKGDLPLVIVRPTIVTSTFKEPFPGWIEGLRTIDSVIVGLGKGKMTCFLG  342

Query  5    D  3
            +
Sbjct  343  N  343



>ref|XP_004139568.1| PREDICTED: LOW QUALITY PROTEIN: fatty acyl-CoA reductase 3-like 
[Cucumis sativus]
Length=492

 Score =   414 bits (1065),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 199/302 (66%), Positives = 244/302 (81%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  S LQFL N +I VTGA GFLAK+ +EKILRVQPNVKKLYLL+RAAD +AA QR NT
Sbjct  1    MEFQSVLQFLHNKSIFVTGATGFLAKVMVEKILRVQPNVKKLYLLIRAADEKAATQRLNT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKD-SHLLTRMLSEVDAVVN  549
            ++IGKE+F+ILKEK G    S+ISEK+  VAGD+S E L +K+ S L   +  ++D +VN
Sbjct  61   DVIGKELFRILKEKWGENFRSMISEKLVAVAGDISDELLVLKEYSKLREELYDQIDVIVN  120

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            LAATT FDERYDVAL VNT+G KHV+NFAK C K +  +HVSTAYVSG+KEGLI ESPY 
Sbjct  121  LAATTNFDERYDVALHVNTLGAKHVINFAKNCVKXKAFVHVSTAYVSGVKEGLILESPYV  180

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            MG+ LNGK GL I++E ++++  L DL  + A+Q+SIT  MKDLGIQR++ YGW NTYVF
Sbjct  181  MGDTLNGKCGLQIEDELKLVDHKLSDLRAEGATQQSITLTMKDLGIQRSQNYGWTNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM++ E KE++PVVIIRPTI++ TYKEPFPGWVEG+RTIDSL + YGKGK+TCFL
Sbjct  241  TKAMGEMLISELKENIPVVIIRPTIVSSTYKEPFPGWVEGVRTIDSLAVAYGKGKITCFL  300

Query  8    GD  3
            GD
Sbjct  301  GD  302



>gb|AID60102.1| alcohol-forming fatty acyl-CoA reductase [Brassica napus]
 emb|CDX75382.1| BnaA01g03200D [Brassica napus]
Length=493

 Score =   414 bits (1063),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 198/300 (66%), Positives = 246/300 (82%), Gaps = 3/300 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E+ S LQ+LDN +ILV GAAGFLA IF+EKILRV PNVKKLYLLLRA+  ++A QRF  E
Sbjct  6    EIVSVLQYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASTEKSATQRFKDE  65

Query  713  IIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            I+GK+++++LKEK G   N + SEKVTVV GDVS E+LG++D+ L   M+ +VDA+VNLA
Sbjct  66   ILGKDLYRVLKEKYGPNLNQLKSEKVTVVNGDVSLEDLGLQDTDLEHEMIHQVDAIVNLA  125

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            ATTKFDERYD+ALG+NT+G  +VLNFAK+C K+ I + VSTAYV G K GLI E+PY+MG
Sbjct  126  ATTKFDERYDIALGINTLGVLNVLNFAKRCAKINIFVQVSTAYVCGEKSGLIMETPYRMG  185

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E LNG +GLDI+ EK+++EE L  L    AS E+IT  MKD+G+ RAR YGWPNTYVFTK
Sbjct  186  ETLNGTTGLDINHEKKLVEEKLDQLRVTEASPETITQTMKDMGLTRARTYGWPNTYVFTK  245

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM++GE + +LP+V+IRP+IIT T KEPFPGW EGIRTIDSLG+GYGKG+LTCFLGD
Sbjct  246  AMGEMIVGEKRGNLPLVLIRPSIITSTIKEPFPGWTEGIRTIDSLGVGYGKGRLTCFLGD  305



>ref|XP_009119230.1| PREDICTED: fatty acyl-CoA reductase 3 [Brassica rapa]
Length=493

 Score =   412 bits (1060),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 198/300 (66%), Positives = 245/300 (82%), Gaps = 3/300 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E+ S LQ+LDN +ILV GAAGFLA IF+EKILRV PNVKKLYLLLRA+  ++A QRF  E
Sbjct  6    EIVSVLQYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASTDKSATQRFKDE  65

Query  713  IIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            I+GK+++++LKEK G   N + SEKVTVV GDVS E+LG++D+ L   M+ +VDA+VNLA
Sbjct  66   ILGKDLYRVLKEKYGPNLNQLKSEKVTVVNGDVSLEDLGLQDTDLEHEMIHQVDAIVNLA  125

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            ATTKFDERYD+ALG+NT+G  +VLNFAK+C K+ I + VSTAYV G K GLI E+PY+MG
Sbjct  126  ATTKFDERYDIALGINTLGVLNVLNFAKRCAKINIFVQVSTAYVCGEKSGLIMETPYRMG  185

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E LNG +GLDI+ EK+++EE L  L    AS E+IT  MKD+G+ RAR YGWPNTYVFTK
Sbjct  186  ETLNGTTGLDINHEKKLVEEKLDQLRVTEASPETITQTMKDMGLTRARTYGWPNTYVFTK  245

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM++G  + +LP+V+IRPTIIT T KEPFPGW EGIRTIDSLG+GYGKG+LTCFLGD
Sbjct  246  AMGEMIVGAKRGNLPLVLIRPTIITSTIKEPFPGWTEGIRTIDSLGVGYGKGRLTCFLGD  305



>emb|CDX69007.1| BnaC01g04460D [Brassica napus]
Length=493

 Score =   411 bits (1057),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 195/300 (65%), Positives = 246/300 (82%), Gaps = 3/300 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E+ S LQ+LDN +ILV GAAGFLA IF+EKILRV PNVKKLYLLLRA+  ++A QRF  E
Sbjct  6    EIVSVLQYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASTEKSATQRFKDE  65

Query  713  IIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            I+GK+++++LKEK G   N + SEKVTVV+GD+S E+LG++D+ L   M+ +VDA+VNLA
Sbjct  66   ILGKDLYRVLKEKYGPNLNQLTSEKVTVVSGDISLEDLGLQDTDLEHEMIHQVDAIVNLA  125

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            ATTKFDERYD+ALG+NT+G  +VLNFAK+C K+ I + VSTAYV G K GLI E+PY+MG
Sbjct  126  ATTKFDERYDIALGINTLGVLNVLNFAKRCAKINIFVQVSTAYVCGEKSGLIMETPYRMG  185

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E LNG +GLDI+ EK+++EE L  L    AS E+IT  MKD+G+ RAR YGWPNTYVFTK
Sbjct  186  ETLNGTTGLDINHEKKLVEEKLDQLRVTEASPETITQTMKDMGLTRARTYGWPNTYVFTK  245

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM++G  + +LP+V+IRP+IIT T KEPFPGW EGIRTID+LG+GYGKG+LTCFLGD
Sbjct  246  AMGEMIVGAKRGNLPLVLIRPSIITSTIKEPFPGWTEGIRTIDTLGVGYGKGRLTCFLGD  305



>ref|XP_004161427.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cucumis sativus]
Length=584

 Score =   414 bits (1065),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 199/302 (66%), Positives = 244/302 (81%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  S LQFL N +I VTGA GFLAK+ +EKILRVQPNVKKLYLL+RAAD +AA QR NT
Sbjct  1    MEFQSVLQFLHNKSIFVTGATGFLAKVMVEKILRVQPNVKKLYLLIRAADEKAATQRLNT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKD-SHLLTRMLSEVDAVVN  549
            ++IGKE+F+ILKEK G    S+ISEK+  VAGD+S E L +K+ S L   +  ++D +VN
Sbjct  61   DVIGKELFRILKEKWGENFRSMISEKLVAVAGDISDELLVLKEYSKLREELYDQIDVIVN  120

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            LAATT FDERYDVAL VNT+G KHV+NFAK C KL+  +HVSTAYVSG+KEGLI ESPY 
Sbjct  121  LAATTNFDERYDVALHVNTLGAKHVINFAKNCVKLKAFVHVSTAYVSGVKEGLILESPYV  180

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            MG+ LNGK GL I++E ++++  L DL  + A+Q+SIT  MKDLGIQR++ YGW NTYVF
Sbjct  181  MGDTLNGKCGLQIEDELKLVDHKLSDLRAEGATQQSITLTMKDLGIQRSQNYGWTNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM++ E KE++PVVIIRP I++ TYKEPFPGWVEG+RTIDSL + YGKGK+TCFL
Sbjct  241  TKAMGEMLISELKENIPVVIIRPAIVSSTYKEPFPGWVEGVRTIDSLAVAYGKGKITCFL  300

Query  8    GD  3
            GD
Sbjct  301  GD  302



>ref|XP_002529056.1| Male sterility protein, putative [Ricinus communis]
 gb|EEF33300.1| Male sterility protein, putative [Ricinus communis]
Length=493

 Score =   411 bits (1056),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 188/300 (63%), Positives = 246/300 (82%), Gaps = 3/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            M+LGS ++FLDN TILVTGA G+LAK+F+EK+LRVQPNVKKLYLLLRAAD  +A++R N 
Sbjct  1    MDLGSVIEFLDNKTILVTGATGYLAKVFVEKVLRVQPNVKKLYLLLRAADANSAMERLNK  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGK++F++L+E+ G   NS +SEK+T + GD+S E+LG+KDS+L   ML ++D V+N 
Sbjct  61   EVIGKDLFKVLRERYGASLNSFVSEKMTPIPGDISREDLGIKDSNLRNEMLKDIDVVINF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G  HVLNFAKKC K+R+L+HVSTAYV G   GLI E P+ M
Sbjct  121  AATTNFDERYDVALGINTLGALHVLNFAKKCLKIRMLVHVSTAYVCGEDTGLILEKPFPM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE   G S +DI+EEK++++E L +L  +NAS++ IT+ MKD GI+RAR  GWPNTYVFT
Sbjct  181  GEGKKGNSKIDIEEEKKLVQEKLNELESENASEKEITAIMKDFGIERARALGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+ EM+L   KE+LP++IIRPT+IT TYK+PFPGW+EG+RTIDS+ +GYGK K+TCF+ 
Sbjct  241  KAMAEMLLVHMKENLPLLIIRPTMITSTYKQPFPGWIEGVRTIDSVIVGYGKRKITCFVS  300



>ref|XP_010535678.1| PREDICTED: fatty acyl-CoA reductase 3-like [Tarenaya hassleriana]
Length=489

 Score =   410 bits (1055),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 192/301 (64%), Positives = 246/301 (82%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+GS LQFL+N +ILVTGA GFLAKI +EK+LRV PN+KK+YLLLRA+D ++A  RF  
Sbjct  1    MEIGSVLQFLENKSILVTGATGFLAKILVEKLLRVAPNLKKIYLLLRASDEKSAAHRFYN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GK++F ++KEK G   NS++SEKV +VAGD+S E+LGV+DS+L   M+  +DA++NL
Sbjct  61   EILGKDLFMVVKEKYGPSLNSLVSEKVALVAGDISSEDLGVQDSNLADEMIHGLDAIINL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT G  HVL+FAKKC K+++L+HVSTAYV G K G I E+PY++
Sbjct  121  AATTTFDERYDVALGINTFGAVHVLDFAKKCAKVKVLVHVSTAYVCGEKSGTITETPYRL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+ LNG +GLDID EK +++E L  L    AS E++T AMKDLG+ RA++YGWPNTYVFT
Sbjct  181  GQTLNGTTGLDIDNEKNLVDETLEKLRATGASPETVTRAMKDLGLSRAKVYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  +E+  +VI+RP IIT T KEPFPGW EG+RTIDSL +GYGKGKLTCFLG
Sbjct  241  KAMGEMLVGAKRENTSLVILRPAIITSTLKEPFPGWTEGVRTIDSLAVGYGKGKLTCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>gb|AFK38315.1| unknown [Medicago truncatula]
 gb|AES88360.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=492

 Score =   410 bits (1055),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 196/300 (65%), Positives = 241/300 (80%), Gaps = 3/300 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            + GS   FL++  +LV GAAGFLAKIF+EKILRVQPNVKKLYLLLRA D E+A +R + E
Sbjct  3    QFGSIAHFLEDKNVLVLGAAGFLAKIFVEKILRVQPNVKKLYLLLRATDAESATRRMHNE  62

Query  713  IIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            I+ K++F++LKE  G   NS ISEKVT+V GD+S EN  +KDS+LL  + ++ D +VNLA
Sbjct  63   ILRKDLFKLLKENHGAKFNSFISEKVTMVPGDISQENFNLKDSNLLQELYNKTDVIVNLA  122

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            ATT FDERYDVALG+NT G KHVLNFAK C  LR+L+HVSTAYV G + GLI E PY++G
Sbjct  123  ATTNFDERYDVALGLNTFGAKHVLNFAKNCINLRVLVHVSTAYVCGERGGLIVEDPYQLG  182

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
             +LNG  GLDIDEEKRV+EE L  L ++ A+++    AMKDLG++RA++YGWPNTYVFTK
Sbjct  183  VSLNGVQGLDIDEEKRVVEEKLNMLQQEGATEKDTRIAMKDLGMERAKLYGWPNTYVFTK  242

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM++G  KE L +VI+RPTIIT TYKEPFPGWVEG+RTIDSL + YGKGKLTCFL D
Sbjct  243  AMGEMLVGTMKEKLSIVIVRPTIITSTYKEPFPGWVEGVRTIDSLIVAYGKGKLTCFLAD  302



>ref|XP_006412311.1| hypothetical protein EUTSA_v10025005mg [Eutrema salsugineum]
 gb|ESQ53764.1| hypothetical protein EUTSA_v10025005mg [Eutrema salsugineum]
Length=494

 Score =   410 bits (1055),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/301 (65%), Positives = 247/301 (82%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+ S LQ+LDN +ILV GAAGFLAKIFLEKILRV PNVKKLYLLLRA + ++A QRFN 
Sbjct  5    MEVVSVLQYLDNKSILVIGAAGFLAKIFLEKILRVAPNVKKLYLLLRATNEKSATQRFND  64

Query  716  EIIGKEIFQILKEKCGNSV---ISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GK++++++KEK G ++    SEKVTVV GD+  ++LG++DS L   M+ EVDA+VNL
Sbjct  65   EILGKDLYRVVKEKYGANLYQLTSEKVTVVNGDICRDDLGLQDSDLAHEMIHEVDAIVNL  124

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT G   VLNFAK+C K++I +HVSTAYV G K G+I E+PY+M
Sbjct  125  AATTKFDERYDVALGINTSGALSVLNFAKRCAKVKIFVHVSTAYVCGEKSGVIMETPYRM  184

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GL+I+ EK++++E L  L    AS E+IT AMKDLG+ RA+MYGWPNTYVFT
Sbjct  185  GETLNGTTGLNINHEKKLVQEKLDQLRATGASPETITQAMKDLGLTRAKMYGWPNTYVFT  244

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  + ++ +V++RP+IIT T+KEPFPGW EGIRTIDSL +GYGKGKLTCFL 
Sbjct  245  KAMGEMLVGTKRGNISLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGKLTCFLA  304

Query  5    D  3
            D
Sbjct  305  D  305



>ref|XP_002867157.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43416.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=493

 Score =   410 bits (1054),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 193/300 (64%), Positives = 248/300 (83%), Gaps = 3/300 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E+ S L++LDN +ILV GAAGFLA IF+EKILRV PNVKKLYLLLRA++ ++A QRFN E
Sbjct  6    EVVSVLKYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASNGKSATQRFNDE  65

Query  713  IIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            I+ K++F+++KEK G   N +ISEKVT++ GD+  E+LG+ D  L   M+ +VDA+VNLA
Sbjct  66   ILRKDLFKVVKEKYGPNLNQLISEKVTIIDGDICLEDLGLHDFDLAHEMIHQVDAIVNLA  125

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            ATTKFDERYDVALG+NT+G  +VLNFAK+C K++IL+HVSTAYV G K GLI E+PY+MG
Sbjct  126  ATTKFDERYDVALGINTLGALNVLNFAKRCAKVKILVHVSTAYVCGEKSGLIMETPYRMG  185

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E LNG +GLDI+ EK+ ++E L  L    AS E++T AMKDLG++RA++YGWPNTYVFTK
Sbjct  186  ETLNGTTGLDINHEKKFVQEKLDQLRASGASPETVTQAMKDLGLRRAKVYGWPNTYVFTK  245

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM++G  +E+L +V++RP+IIT T+KEPFPGW EGIRTIDSL +GYGKGKLTCFL D
Sbjct  246  AMGEMMVGTKRENLSLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGKLTCFLCD  305



>ref|XP_011088867.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Sesamum 
indicum]
Length=442

 Score =   408 bits (1048),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 246/303 (81%), Gaps = 7/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L FL N TIL+TGA GFLAK+ +EKILRVQP VKKLYLLLRAAD+ +AL RFNT
Sbjct  1    MELCSILHFLQNKTILLTGATGFLAKVLIEKILRVQPEVKKLYLLLRAADSVSALHRFNT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GKE+F+++KEK G   NS+I EKVT++AGD++  NLG+ +S  L  +  +VD ++NL
Sbjct  61   EVMGKELFKVVKEKYGANLNSLIQEKVTLLAGDITRHNLGL-ESSTLEELFGQVDILINL  119

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA+T FDERYDVALG+NT+GP +V NF+KKC KLR+ LHVSTAYV G KEG++ E+P+K+
Sbjct  120  AASTDFDERYDVALGINTIGPANVFNFSKKCSKLRVFLHVSTAYVCGEKEGVVLETPFKL  179

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+ LNG SGL+ID EK ++EE L +L    AS++ ITSAM+DLGIQRAR YGWPNTY FT
Sbjct  180  GDTLNGTSGLNIDMEKALVEEKLEELRTTKASEKHITSAMRDLGIQRARKYGWPNTYSFT  239

Query  185  KALGEMVLGEFKED---LPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTC  15
            KA+GEM+LG  K+D   L +VIIRPTIIT T+KEPFPGW+EG+R IDS  +GYGKGK+TC
Sbjct  240  KAMGEMLLGHLKDDKTPLALVIIRPTIITSTFKEPFPGWLEGVRNIDSFIVGYGKGKMTC  299

Query  14   FLG  6
            F G
Sbjct  300  FPG  302



>gb|AEV53412.1| fatty acyl-CoA reductase 3 [Populus tomentosa]
Length=489

 Score =   409 bits (1052),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 193/300 (64%), Positives = 242/300 (81%), Gaps = 3/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS LQFLDN TILVTGA G+LAKIF+EKILRVQPNVKK YLLLRAAD ++A +R   
Sbjct  1    MELGSILQFLDNKTILVTGATGYLAKIFVEKILRVQPNVKKFYLLLRAADAKSATERLRD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+I K++F++L+EK G   +S ISEKVT V GD+S+E+LGVKDS L   M  E+D ++N 
Sbjct  61   EVIAKDLFRVLREKHGAGLHSFISEKVTPVPGDISHEDLGVKDSSLKDEMWREIDVMLNF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G  HVLNFAKKC K+++L+HVSTAYV G   GLI E PY M
Sbjct  121  AATTNFDERYDVALGINTLGALHVLNFAKKCVKIKMLVHVSTAYVCGEDAGLILEQPYHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G A  G   +DI+ EKR+++E L +L  +N  ++ ITSAMKD GI+RAR++GWPNTYVFT
Sbjct  181  GMAKKGDEKIDINFEKRMVQEKLNELKLENVPEKQITSAMKDFGIERARLFGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+L  FK+ LP+VIIRPT++  TYKEPFPGW+EG+RTIDS+ +GYGKG++TCF+ 
Sbjct  241  KAMGEMLLVNFKDGLPLVIIRPTMVASTYKEPFPGWIEGVRTIDSIIVGYGKGRVTCFIS  300



>ref|NP_567936.5| fatty acyl-CoA reductase CER4 [Arabidopsis thaliana]
 sp|Q93ZB9.1|FACR3_ARATH RecName: Full=Fatty acyl-CoA reductase 3; AltName: Full=Protein 
ECERIFERUM 4 [Arabidopsis thaliana]
 gb|AAL15288.1| AT4g33790/T16L1_280 [Arabidopsis thaliana]
 gb|AAL49822.1| putative male sterility 2 protein [Arabidopsis thaliana]
 gb|AEE86278.1| fatty acyl-CoA reductase CER4 [Arabidopsis thaliana]
Length=493

 Score =   409 bits (1051),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 194/301 (64%), Positives = 248/301 (82%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+ S L++LDN +ILV GAAGFLA IF+EKILRV PNVKKLYLLLRA+  ++A QRFN 
Sbjct  5    MEVVSVLKYLDNKSILVVGAAGFLANIFVEKILRVAPNVKKLYLLLRASKGKSATQRFND  64

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+ K++F++LKEK G   N + SEK+T+V GD+  E+LG++D  L   M+ +VDA+VNL
Sbjct  65   EILKKDLFKVLKEKYGPNLNQLTSEKITIVDGDICLEDLGLQDFDLAHEMIHQVDAIVNL  124

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT+G  +VLNFAK+C K++IL+HVSTAYV G K GLI E+PY+M
Sbjct  125  AATTKFDERYDVALGINTLGALNVLNFAKRCAKVKILVHVSTAYVCGEKSGLIMETPYRM  184

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDI+ EK++++E L  L    A+ E+IT  MKDLG++RA+MYGWPNTYVFT
Sbjct  185  GETLNGTTGLDINYEKKLVQEKLDQLRVIGAAPETITETMKDLGLRRAKMYGWPNTYVFT  244

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  +E+L +V++RP+IIT T+KEPFPGW EGIRTIDSL +GYGKGKLTCFL 
Sbjct  245  KAMGEMMVGTKRENLSLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGKLTCFLC  304

Query  5    D  3
            D
Sbjct  305  D  305



>ref|XP_007150088.1| hypothetical protein PHAVU_005G125500g [Phaseolus vulgaris]
 gb|ESW22082.1| hypothetical protein PHAVU_005G125500g [Phaseolus vulgaris]
Length=491

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/301 (63%), Positives = 247/301 (82%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS + FL + TILVTGA GFLAKIF+EKILRVQPNVKKLYLLLR  DT +A QR   
Sbjct  1    MELGSIIHFLQDKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRVKDTASATQRLEN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GK++F++LKEK G   NS +SEK+TVV GD+S+E+L +K+S L   + ++ D +VN+
Sbjct  61   EILGKDLFRLLKEKLGTRFNSFVSEKLTVVPGDISHEDLNLKNSILWEEICNQTDVIVNV  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA+TKFDERYDVALG+NT+G KHV++FAKKC KL++L+HVSTAYV G K GL+ E P++ 
Sbjct  121  AASTKFDERYDVALGINTLGVKHVMSFAKKCVKLKVLVHVSTAYVCGEKGGLVLEDPHQF  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG +GLDID EK++++E L +L  + A++  I  AMKDLG +RARMYGWPNTYVFT
Sbjct  181  GVSLNGATGLDIDMEKKMVDEKLNELREEGATEHDIELAMKDLGTKRARMYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  K ++ VVI+RPTI+T TY+EPFPGW+EG+RTIDSL + YG+GK+TCFLG
Sbjct  241  KAMGEMIVGTTKGNMNVVIVRPTIVTSTYREPFPGWIEGLRTIDSLVVAYGRGKITCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_011088866.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Sesamum 
indicum]
Length=494

 Score =   407 bits (1046),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 246/303 (81%), Gaps = 7/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L FL N TIL+TGA GFLAK+ +EKILRVQP VKKLYLLLRAAD+ +AL RFNT
Sbjct  1    MELCSILHFLQNKTILLTGATGFLAKVLIEKILRVQPEVKKLYLLLRAADSVSALHRFNT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GKE+F+++KEK G   NS+I EKVT++AGD++  NLG+ +S  L  +  +VD ++NL
Sbjct  61   EVMGKELFKVVKEKYGANLNSLIQEKVTLLAGDITRHNLGL-ESSTLEELFGQVDILINL  119

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA+T FDERYDVALG+NT+GP +V NF+KKC KLR+ LHVSTAYV G KEG++ E+P+K+
Sbjct  120  AASTDFDERYDVALGINTIGPANVFNFSKKCSKLRVFLHVSTAYVCGEKEGVVLETPFKL  179

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+ LNG SGL+ID EK ++EE L +L    AS++ ITSAM+DLGIQRAR YGWPNTY FT
Sbjct  180  GDTLNGTSGLNIDMEKALVEEKLEELRTTKASEKHITSAMRDLGIQRARKYGWPNTYSFT  239

Query  185  KALGEMVLGEFKED---LPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTC  15
            KA+GEM+LG  K+D   L +VIIRPTIIT T+KEPFPGW+EG+R IDS  +GYGKGK+TC
Sbjct  240  KAMGEMLLGHLKDDKTPLALVIIRPTIITSTFKEPFPGWLEGVRNIDSFIVGYGKGKMTC  299

Query  14   FLG  6
            F G
Sbjct  300  FPG  302



>ref|XP_002313667.2| acyl CoA reductase family protein [Populus trichocarpa]
 gb|EEE87622.2| acyl CoA reductase family protein [Populus trichocarpa]
Length=489

 Score =   405 bits (1042),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 190/300 (63%), Positives = 241/300 (80%), Gaps = 3/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS LQFL+N TILVTGA G+LAKIF+EKILRVQPNVK+ YLLLRAAD ++A +R   
Sbjct  1    MELGSILQFLENKTILVTGATGYLAKIFVEKILRVQPNVKRFYLLLRAADAKSATERLRD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGK++F++L+EK G   +S ISEKVT V GD+SYE+LGVKDS L   M  E+D V+N 
Sbjct  61   EVIGKDLFRVLREKHGASLHSFISEKVTPVPGDISYEDLGVKDSSLKDEMWREIDVVLNF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G  HVLNFAKKC K++ L+HVSTAYV G   GLI E PY M
Sbjct  121  AATTNFDERYDVALGINTLGALHVLNFAKKCVKIKTLVHVSTAYVCGEDAGLILEQPYHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G A  G   +DI+ EK++++E + +L   +  ++ ITSAMKD GI+RAR++GWPNTYVFT
Sbjct  181  GMAKRGDEKIDINFEKKMVQEKINELKLQDVPEKEITSAMKDFGIERARLFGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+L  FK+ LP++IIRPT++  TYKEPFPGW+EG+RTIDS+ +GYGKG++TCF+ 
Sbjct  241  KAMGEMLLVNFKDSLPLLIIRPTMVASTYKEPFPGWIEGVRTIDSVIVGYGKGRVTCFIS  300



>gb|KFK30008.1| hypothetical protein AALP_AA7G205800 [Arabis alpina]
Length=493

 Score =   405 bits (1042),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/301 (64%), Positives = 247/301 (82%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+ S L++LDN +ILV GAAGFLA IFLEKILRV PNVKKLYLLLR +D ++A QRF+ 
Sbjct  5    MEVVSVLEYLDNNSILVIGAAGFLANIFLEKILRVAPNVKKLYLLLRGSDGKSASQRFSD  64

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GK++++++KEK G   + +++EKVT+V GD+  E+LG++DS L+  M+ E+DA+VNL
Sbjct  65   EILGKDLYKVVKEKYGPKLHHLLTEKVTIVKGDICLEDLGLQDSDLIHEMVQELDAIVNL  124

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT+G  +VLNFAKKC K++IL+HVSTAYV G K GLI E+PY+M
Sbjct  125  AATTKFDERYDVALGINTIGALNVLNFAKKCTKVKILVHVSTAYVCGEKSGLILETPYRM  184

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDI+ EK+++ E L  L       E+IT  MKDLG  RA+M+GWPNTYVFT
Sbjct  185  GETLNGTTGLDINHEKKLVLEKLDQLRAAETPPETITQVMKDLGRTRAKMFGWPNTYVFT  244

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  +E++ +V+IRP+IIT T+KEPFPGW EGIRTIDSL +GYGKGKLTCFL 
Sbjct  245  KAMGEMIVGVKRENISLVLIRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGKLTCFLT  304

Query  5    D  3
            D
Sbjct  305  D  305



>ref|XP_009108773.1| PREDICTED: fatty acyl-CoA reductase 3-like [Brassica rapa]
Length=492

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 191/301 (63%), Positives = 246/301 (82%), Gaps = 4/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  S LQ+LDN +ILV GAAGFLA IF+EKILRV PNVKKLYLLLRA++ ++A QRF  
Sbjct  5    MEAVSVLQYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASNEKSATQRFKD  64

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GK++++++KEK G     + SEKVTVV GD+   +LG++DS L   M+ +VDA++NL
Sbjct  65   EILGKDLYKVVKEKYGPNLTQLTSEKVTVVNGDICLADLGIQDS-LAHEMIHQVDAIINL  123

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT+GP +VL+FAKKC   +I +HVSTAYVSG K GLI E+PY+M
Sbjct  124  AATTKFDERYDVALGINTLGPLNVLDFAKKCENAKIFVHVSTAYVSGEKSGLIMETPYRM  183

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDI+ E+++++E L  L       E+IT AMKD+G+ RA+MYGWPNTYVFT
Sbjct  184  GETLNGTTGLDINHERKLVQEKLDQLLVIKTPPETITQAMKDMGLTRAKMYGWPNTYVFT  243

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++GE ++++ +V+IRP+IIT T+KEPFPGW EGIRTIDSL +GYGKG+LTCFLG
Sbjct  244  KAMGEMMVGEKRDNISLVLIRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGRLTCFLG  303

Query  5    D  3
            D
Sbjct  304  D  304



>gb|KDP42364.1| hypothetical protein JCGZ_01940 [Jatropha curcas]
Length=492

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 187/301 (62%), Positives = 243/301 (81%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS L+F++N TILVTGA G+LAKIF+EKILRVQP VKK YLLLRA+D  +A +RF+ 
Sbjct  1    MELGSVLEFIENKTILVTGATGYLAKIFVEKILRVQPKVKKFYLLLRASDANSANERFHD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GK++F++L+EK G   NS +SEK+  VAGD+S E+LGVKDS+L   M  E+D V+N 
Sbjct  61   EVLGKDLFKVLREKYGANLNSFVSEKLIPVAGDISCEDLGVKDSYLRDEMFKEIDLVINF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYD+ALG+NT+G  HVLNFAKKC K ++L+HVSTAYV G   G+I E P+ M
Sbjct  121  AATTNFDERYDIALGINTLGALHVLNFAKKCLKAKMLVHVSTAYVCGEDSGIILEKPFTM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G    G S +DI+ EK+++EE L +L  +NAS++ IT+ MKD GI+RAR +GWPNTYVFT
Sbjct  181  GRPKKGTSEIDIEMEKKLLEEKLNELISENASEKEITAFMKDFGIERARAFGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+L  FK+++P++IIRPT+IT TYKEPFPGW+EG+RTIDS+  GY KGK+TCF+ 
Sbjct  241  KAIGEMLLMHFKKNMPLLIIRPTMITSTYKEPFPGWIEGVRTIDSVIAGYAKGKVTCFIS  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_006290474.1| hypothetical protein CARUB_v100190921mg, partial [Capsella rubella]
 gb|EOA23372.1| hypothetical protein CARUB_v100190921mg, partial [Capsella rubella]
Length=340

 Score =   400 bits (1027),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 187/301 (62%), Positives = 243/301 (81%), Gaps = 4/301 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E+ S LQ+LDN TILV GAAGFL KIF+EKILRV P V+KLYLLLRA+  ++A +RFN E
Sbjct  6    EVVSVLQYLDNKTILVIGAAGFLGKIFVEKILRVAPKVRKLYLLLRASGEKSASERFNDE  65

Query  713  IIGKEIFQILKEKCGNSV--ISEKVTVVAGDVSYENLGVK--DSHLLTRMLSEVDAVVNL  546
            I+GK++F+++KE+ G+++  I EKVT+V GD+  +++G+   DS L   M+ + DA+VNL
Sbjct  66   ILGKDLFKVVKEQYGSNLNDILEKVTIVNGDICLDDMGLNKLDSELEHEMVQQFDAIVNL  125

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G  + LNFAK+C K+++ +HVSTAYV G K GLI E+PY+M
Sbjct  126  AATTNFDERYDVALGINTLGAANALNFAKRCAKVKVFVHVSTAYVCGEKPGLIKETPYRM  185

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDI++EK++++E L  L    AS E+IT AMKD G  RA++YGWPNTYVFT
Sbjct  186  GETLNGATGLDINQEKKLVKEKLSQLQATGASHETITQAMKDFGHTRAKVYGWPNTYVFT  245

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  +ED+ +VIIRP+I+T TYKEPFPGW EGIRTIDSL +GYG GKLTCFLG
Sbjct  246  KAMGEMIVGANREDMSLVIIRPSIVTSTYKEPFPGWTEGIRTIDSLAVGYGTGKLTCFLG  305

Query  5    D  3
            D
Sbjct  306  D  306



>emb|CDY28321.1| BnaC03g66380D [Brassica napus]
Length=492

 Score =   405 bits (1040),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 192/301 (64%), Positives = 246/301 (82%), Gaps = 4/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  S LQ+LDN +ILV GAAGFLA IF+EKILRV PNVKKLYLLLRA++ ++A QRF  
Sbjct  5    MEAVSVLQYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASNEKSATQRFKD  64

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GK++++++KEK G     + SEKVTVV GD+   +LG++DS L   M+ +VDA++NL
Sbjct  65   EILGKDLYKVVKEKYGPNLTQLTSEKVTVVNGDICLADLGIQDS-LAHEMIHQVDAIINL  123

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG NT+GP +VL+FAKKC   +I +HVSTAYVSG K GLI E+PY+M
Sbjct  124  AATTKFDERYDVALGNNTLGPLNVLDFAKKCENAKIFVHVSTAYVSGEKSGLIMETPYRM  183

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDI+ E+++++E L  L    A  E+IT AMKD+G+ RA+MYGWPNTYVFT
Sbjct  184  GETLNGTTGLDINHERKLVQEKLDQLLVIKAPPETITQAMKDMGLTRAKMYGWPNTYVFT  243

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++GE ++++ +V+IRP+IIT T+KEPFPGW EGIRTIDSL +GYGKG+LTCFLG
Sbjct  244  KAMGEMMVGEKRDNISLVLIRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGRLTCFLG  303

Query  5    D  3
            D
Sbjct  304  D  304



>ref|XP_011044880.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Populus 
euphratica]
Length=490

 Score =   404 bits (1039),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 187/300 (62%), Positives = 243/300 (81%), Gaps = 3/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS LQFL+N TILVTGA G+LAKIF+EKILRVQPNVK+ +LLLRAAD ++A +R   
Sbjct  1    MELGSILQFLENKTILVTGATGYLAKIFVEKILRVQPNVKRFFLLLRAADAKSATERLRD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGK++F++L+EK G   +S ISEK+T V GD+SYE+LGV+DS L   M SE+D V+N 
Sbjct  61   EVIGKDLFRVLREKHGAGLHSFISEKITPVPGDISYEDLGVRDSFLKDEMWSEIDVVLNF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+N +G  HVLNFAKKC K+++L+HVSTAYV G   GLI E PY M
Sbjct  121  AATTNFDERYDVALGINALGALHVLNFAKKCIKIKMLVHVSTAYVCGEDAGLILEQPYHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G A  G   +DI+ EK++++E + +L  ++  ++ ITSAMKD GI+RAR++GWPNTYVFT
Sbjct  181  GMAKKGDEKIDINFEKKIVQEKINELKLEDVPEKEITSAMKDFGIERARLFGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+L  FK+ LP++IIRPT++  TYKEPFPGW+EG+RTIDSL +GYG+G++TCF+ 
Sbjct  241  KAMGEMLLVNFKDSLPLLIIRPTMVASTYKEPFPGWIEGVRTIDSLIVGYGQGRVTCFIS  300



>ref|XP_002305562.1| hypothetical protein POPTR_0004s19600g [Populus trichocarpa]
 gb|EEE86073.1| hypothetical protein POPTR_0004s19600g [Populus trichocarpa]
Length=490

 Score =   402 bits (1034),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 190/300 (63%), Positives = 240/300 (80%), Gaps = 3/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS LQFL+N TILVTGA G+LAKIF+EKILRVQPNVKKLYLLLRA D ++A +R + 
Sbjct  1    MELGSVLQFLENKTILVTGATGYLAKIFVEKILRVQPNVKKLYLLLRAVDAKSARERLHH  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGKE+F++++EK G   +S ISEKVT V GD+SYE LGVKD  L   M  E+D V+N 
Sbjct  61   EVIGKELFKVIREKHGASLHSFISEKVTPVPGDISYEELGVKDCSLKDEMWREIDVVLNF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G  HVLNFAKKC  +++L+HVSTAYV G   GLI E PY M
Sbjct  121  AATTNFDERYDVALGINTLGALHVLNFAKKCVNVKMLVHVSTAYVCGEDAGLIMEQPYHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G A  G   +DI+ EK+++++ L  L  ++  ++ ITSAMKDLGI+RAR +GWPNTYVFT
Sbjct  181  GMAKRGDDKVDINFEKKMVQDKLNQLVLEDVPEKEITSAMKDLGIERARRFGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++  FK+DLPV+IIRPT++  TYKEPFPGW+EG+RTIDS+ +GYG GK++CF+ 
Sbjct  241  KAMGEMLVVNFKDDLPVLIIRPTMVASTYKEPFPGWIEGLRTIDSIIVGYGIGKVSCFIS  300



>ref|XP_002523777.1| Male sterility protein, putative [Ricinus communis]
 gb|EEF38503.1| Male sterility protein, putative [Ricinus communis]
Length=493

 Score =   401 bits (1031),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/300 (62%), Positives = 245/300 (82%), Gaps = 3/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+GS L+FL+N TIL TGA G+LAKIF+EK+LRVQPNVKKLYLLLRAAD ++A++R N 
Sbjct  1    MEVGSILEFLENKTILATGATGYLAKIFVEKVLRVQPNVKKLYLLLRAADADSAMERLNR  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGK++F+ ++EK G   NS +SEK+T + GD+S E+LG++D +L   +L ++D V+N 
Sbjct  61   EVIGKDLFKGVREKYGSSLNSFVSEKMTPIPGDISREDLGIEDFNLRDEILKDIDVVINF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALGVNT+G  +VLNFAKKC K+R+L+HVSTAYV G   GLI E P+ M
Sbjct  121  AATTNFDERYDVALGVNTLGALNVLNFAKKCLKIRMLVHVSTAYVCGEDTGLILEKPFPM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GEA  G   +DI+EEK++++E L +L  +NAS++ IT+ MKD GI+RARM+GWPNTYVFT
Sbjct  181  GEAKKGNRKIDIEEEKKLVQEKLNELESENASEKEITAIMKDFGIERARMFGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+L   KEDL ++IIRPT+IT TY+EPFPGW+EG RT+DS+ +GYGKGK+ CF+ 
Sbjct  241  KAMGEMILMHMKEDLSLLIIRPTMITSTYREPFPGWIEGARTVDSVIVGYGKGKVGCFVS  300



>gb|KHN21439.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=490

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 194/301 (64%), Positives = 240/301 (80%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS + FL + TILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRA DTE+A QR + 
Sbjct  1    MELGSIIHFLQDKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRARDTESATQRLHA  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKEK G   NS +SEK+TVV GD+S E+L +KD  L   + +E D +VNL
Sbjct  61   EIIGKDLFRLLKEKLGTRFNSYVSEKLTVVPGDISQEDLNLKDPILGEEIFNETDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G  HVL+FAKKC KL++L+HVSTAYV G KEGLI E P+  
Sbjct  121  AATTNFDERYDVALGINTLGVMHVLSFAKKCVKLKVLIHVSTAYVCGEKEGLILEDPHHF  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  GLDID EK+ +E+ L  L  + A++  I  AMKDLG +RA+MYGWPNTYVFT
Sbjct  181  GVSLNGVPGLDIDMEKKNVEQKLIQLREEGATEHDIELAMKDLGSERAKMYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  K ++ VVI+RPT++T TY EPFPGW+EG+RTIDS+ + YGKGKL CFL 
Sbjct  241  KAMGEMLVGTTKGNMNVVIVRPTMVTSTYTEPFPGWIEGLRTIDSIVVAYGKGKLACFLA  300

Query  5    D  3
            +
Sbjct  301  N  301



>ref|XP_008462145.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Cucumis 
melo]
Length=488

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 190/302 (63%), Positives = 241/302 (80%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  S LQFL N +I VTGA GFLAK+ +EKILRVQPNVKK+YLL+RAAD +AA QR NT
Sbjct  1    MEFQSVLQFLQNKSIFVTGATGFLAKVMVEKILRVQPNVKKIYLLIRAADEKAATQRLNT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKD-SHLLTRMLSEVDAVVN  549
            ++IGKE+F+ILKEK G    ++ISEK+  VAGD+S E L +K+ S L   +  ++D +V+
Sbjct  61   DVIGKELFRILKEKWGENFRTMISEKLVAVAGDISDELLVLKEYSQLREELYDQIDVIVH  120

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            LAATT FDERYD+AL VNT+G KHV+NFAK C KL+  LHVSTAYV G+KEGLI ES Y 
Sbjct  121  LAATTNFDERYDIALHVNTLGAKHVINFAKNCVKLKAFLHVSTAYVCGVKEGLILESQYN  180

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            MG+ LNGK GL I++E  +++  + DL    A+Q+SIT  MK++G++R++ YGW NTYVF
Sbjct  181  MGDTLNGKCGLQIEDELNLVDYKISDLRAKGATQQSITLTMKEMGLERSQNYGWTNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM++ E KE++PVVIIRPTI++ TYKEPFPGWVEG+RTIDSL + YGKGK+TCFL
Sbjct  241  TKAMGEMLISELKENIPVVIIRPTIVSSTYKEPFPGWVEGVRTIDSLAVAYGKGKITCFL  300

Query  8    GD  3
            GD
Sbjct  301  GD  302



>ref|XP_008462137.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Cucumis 
melo]
Length=492

 Score =   400 bits (1027),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 190/302 (63%), Positives = 241/302 (80%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  S LQFL N +I VTGA GFLAK+ +EKILRVQPNVKK+YLL+RAAD +AA QR NT
Sbjct  1    MEFQSVLQFLQNKSIFVTGATGFLAKVMVEKILRVQPNVKKIYLLIRAADEKAATQRLNT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKD-SHLLTRMLSEVDAVVN  549
            ++IGKE+F+ILKEK G    ++ISEK+  VAGD+S E L +K+ S L   +  ++D +V+
Sbjct  61   DVIGKELFRILKEKWGENFRTMISEKLVAVAGDISDELLVLKEYSQLREELYDQIDVIVH  120

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            LAATT FDERYD+AL VNT+G KHV+NFAK C KL+  LHVSTAYV G+KEGLI ES Y 
Sbjct  121  LAATTNFDERYDIALHVNTLGAKHVINFAKNCVKLKAFLHVSTAYVCGVKEGLILESQYN  180

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            MG+ LNGK GL I++E  +++  + DL    A+Q+SIT  MK++G++R++ YGW NTYVF
Sbjct  181  MGDTLNGKCGLQIEDELNLVDYKISDLRAKGATQQSITLTMKEMGLERSQNYGWTNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM++ E KE++PVVIIRPTI++ TYKEPFPGWVEG+RTIDSL + YGKGK+TCFL
Sbjct  241  TKAMGEMLISELKENIPVVIIRPTIVSSTYKEPFPGWVEGVRTIDSLAVAYGKGKITCFL  300

Query  8    GD  3
            GD
Sbjct  301  GD  302



>ref|XP_004291620.1| PREDICTED: fatty acyl-CoA reductase 3-like [Fragaria vesca subsp. 
vesca]
Length=490

 Score =   399 bits (1026),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/301 (65%), Positives = 242/301 (80%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L F+ N  ILVTGAAGFLAKIF+EKILRVQP VKKLYLLLRA D + A QR + 
Sbjct  1    MELESLLDFIQNKNILVTGAAGFLAKIFVEKILRVQPYVKKLYLLLRAPDAKTATQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GK++F++ +EK G   NS++SEK+T+V GD+S E LG++DS L   +LS+VD +VNL
Sbjct  61   EILGKDLFRVSREKWGARMNSIVSEKLTMVPGDISKEGLGLQDSDLREEILSQVDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NTMG K+V++FAK C KL +L+HVSTAYV G K GL+ E P  M
Sbjct  121  AATTNFDERYDVALGLNTMGAKYVMSFAKLCVKLEVLVHVSTAYVWGEKAGLLPEHPCLM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G++LNG  GLDI+ E R+  E +R L  + AS+ +IT A+KD G++RA +YGWPNTYVFT
Sbjct  181  GKSLNGTPGLDIETEIRIANEEVRRLRSEQASEAAITLALKDFGLKRASIYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++GE + +LPVVI+RPTIIT TYKEPFPGWVEGIRTIDS+ +GYGKGKLT FL 
Sbjct  241  KAMGEMLIGEHRGNLPVVILRPTIITSTYKEPFPGWVEGIRTIDSVAVGYGKGKLTFFLC  300

Query  5    D  3
            D
Sbjct  301  D  301



>gb|KEH29873.1| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=491

 Score =   399 bits (1025),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 188/301 (62%), Positives = 244/301 (81%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS L FL + TIL+TGA GFLAKI LEKILRVQPNVKKLYLLLRA+D ++A  RF+ 
Sbjct  1    MELGSVLHFLQDKTILITGATGFLAKILLEKILRVQPNVKKLYLLLRASDAKSASHRFHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F+ LKEK G    + +SEK+T+V GD+S E+LG++DS L   + +++D +VNL
Sbjct  61   EIIGKDLFKCLKEKLGANFTTFLSEKLTLVPGDISLEDLGLEDSILKEEIHNQIDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA T FDERYD++LG+NT G K+++NFAKKC KL++L+HVSTAYV G  EGLI E PY +
Sbjct  121  AANTNFDERYDISLGLNTFGIKYIINFAKKCNKLKVLVHVSTAYVCGEGEGLILEKPYHL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG +GLD+D E++V+ + L +L +  A+++ I  AMK+LGI RA++YGWPNTYVFT
Sbjct  181  GHSLNGVNGLDVDIEEKVVRDKLCELQQLGATEDEIKMAMKNLGISRAKLYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G+ K +L VVIIRP I+T T+KEPFPGW EG+RTIDSL + YGKGKLTCFLG
Sbjct  241  KAMGEMLVGQLKGNLSVVIIRPAIVTSTFKEPFPGWSEGVRTIDSLAVAYGKGKLTCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>gb|AFK47309.1| unknown [Lotus japonicus]
Length=491

 Score =   399 bits (1024),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 188/301 (62%), Positives = 241/301 (80%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS   FL +  +LV GA GFLAKIF+EK+LRVQPNVKKLYLLLRA D E+A +R + 
Sbjct  1    MELGSITHFLQDKNVLVIGATGFLAKIFVEKVLRVQPNVKKLYLLLRATDAESATRRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+ K++F++LKE  G   N+ +SEKVTVV GD+S E+L +KDS L   + +++D +VNL
Sbjct  61   EIMRKDLFRLLKENLGLKFNNFVSEKVTVVPGDISKEDLNLKDSVLRQEICNQIDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT G KH+L+FAK C  L++L+HVSTAYV G + GLI E P ++
Sbjct  121  AATTNFDERYDVALGINTFGAKHILSFAKNCINLKVLVHVSTAYVCGERGGLILEDPCQL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  GLD+D EK+V++E L+ L  + AS++ I  AMKDLG++RA +YGWPNTYVFT
Sbjct  181  GVSLNGVPGLDVDVEKKVVDEKLKMLKEEGASEDEIKMAMKDLGMKRASVYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  KE++PVVI+RPTI+T TY+EPFPGWVEG+RTIDSL + YGKGKLTCFL 
Sbjct  241  KAMGEMLVGTLKENMPVVILRPTIVTSTYREPFPGWVEGVRTIDSLIVAYGKGKLTCFLA  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_004506152.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=490

 Score =   399 bits (1024),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 191/301 (63%), Positives = 237/301 (79%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME GS   FL +  ILV GA GFLAKIF+EKILRVQPNVKKLYLL+RA DTE+A +R N 
Sbjct  1    METGSITDFLRDKNILVLGATGFLAKIFIEKILRVQPNVKKLYLLMRATDTESATKRLNN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+ K++F++LKE  G   NS + EK++VV GD+S E+  +KDS+LL  +  + D +VNL
Sbjct  61   EILRKDLFKLLKENLGAKFNSFVLEKLSVVPGDISQEDFNLKDSNLLKEICDQTDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT G KHV+NFAKKC  LR+L+HVSTAYV G + GLI E P ++
Sbjct  121  AATTNFDERYDVALGLNTFGVKHVINFAKKCINLRVLVHVSTAYVCGERGGLIIEDPIQL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  GLDIDEEK+V+EE +  L ++ A++E I  AMKDLGI+RA +YGWPNTYVFT
Sbjct  181  GASLNGVKGLDIDEEKKVVEEKMNKLRQEGATEEDIKIAMKDLGIERANLYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++   KE L + I+RPT+IT TYKEPFPGWVEGIRTIDS+ + YGKGKLTCFL 
Sbjct  241  KAMGEMLIETMKETLSIFIVRPTMITSTYKEPFPGWVEGIRTIDSIIVAYGKGKLTCFLA  300

Query  5    D  3
            +
Sbjct  301  N  301



>ref|XP_011044902.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Populus 
euphratica]
Length=490

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 185/300 (62%), Positives = 240/300 (80%), Gaps = 3/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS LQFL+N TILVTGA G+LAKIF+EKILRVQPNVK+ +LLLRAAD ++A +R   
Sbjct  1    MELGSILQFLENKTILVTGATGYLAKIFVEKILRVQPNVKRFFLLLRAADAKSATERLRD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGK++F++L+EK G   +S I+EKVT V GD+SY++LGVKDS L   M  E+D V+N 
Sbjct  61   EVIGKDLFRVLREKHGAGLHSFITEKVTPVPGDISYDDLGVKDSSLKDEMWREIDVVLNF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G  HVLNFAKKC K+++L+HVSTAYV G   GLI E PY M
Sbjct  121  AATTNFDERYDVALGINTLGALHVLNFAKKCVKIKMLVHVSTAYVCGEDAGLILEQPYHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G A  G   +DI+ EK +++E + +L  ++  ++ ITSAMKD GI+RAR++GWPN YVFT
Sbjct  181  GMAKKGDEKIDINFEKNIVQEKINELKLEDVPEKEITSAMKDFGIERARLFGWPNPYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
             A+GEM+L  FK+ LP++IIRPT++  TYKEPFPGW+EG+RTIDS+ +GYGKG++TCF+ 
Sbjct  241  TAMGEMLLVNFKDSLPLLIIRPTMVASTYKEPFPGWIEGVRTIDSVIVGYGKGRVTCFIS  300



>ref|XP_006279378.1| hypothetical protein CARUB_v10007996mg [Capsella rubella]
 gb|EOA12276.1| hypothetical protein CARUB_v10007996mg [Capsella rubella]
Length=421

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/301 (62%), Positives = 242/301 (80%), Gaps = 4/301 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E+ S LQ+LDN TILV GAAGFL KIF+EKILRV P V+K+YLLLRA+  + A +RFN E
Sbjct  6    EVVSVLQYLDNKTILVIGAAGFLGKIFVEKILRVAPKVRKVYLLLRASGEKTATERFNDE  65

Query  713  IIGKEIFQILKEKCGNSV--ISEKVTVVAGDVSYENLGVK--DSHLLTRMLSEVDAVVNL  546
            I+GK++F+++KEK G+++  I EKVT+V GD+  +++G+   DS L   M+ ++DA+VNL
Sbjct  66   ILGKDLFKVVKEKYGSNLNDILEKVTIVNGDICLDDMGLNKLDSELEHEMVQQLDAIVNL  125

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G  + LNF+K+C K+++ +HVSTAYV G K GLI E+PY+M
Sbjct  126  AATTNFDERYDVALGINTLGAANALNFSKRCAKVKVFVHVSTAYVCGEKPGLITETPYRM  185

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG  GLDI++EK++++E L  L    AS E+IT AMKD G  RA++YGWPNTYVFT
Sbjct  186  GETLNGAIGLDINQEKKLVKEKLSQLQATGASPETITQAMKDFGHTRAKVYGWPNTYVFT  245

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  +ED+ +VIIRP+I+T TYKEPFPGW EGIRTIDSL +GYG GKLTCFLG
Sbjct  246  KAMGEMIVGANREDMSLVIIRPSIVTSTYKEPFPGWTEGIRTIDSLAVGYGTGKLTCFLG  305

Query  5    D  3
            D
Sbjct  306  D  306



>ref|XP_004515386.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=491

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 245/301 (81%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S LQFL++ TIL+TG  GFLAKI LEKILRVQPN++K+Y+ LRA D ++A+ R NT
Sbjct  1    MELESVLQFLEDKTILITGGTGFLAKILLEKILRVQPNIRKIYVHLRAVDDKSAMHRLNT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGKE+F++LKEK G    + +SEK+T++ GD+S E+LG++DS L   + ++ D +VNL
Sbjct  61   EIIGKELFRLLKEKMGANFTTFLSEKLTLIRGDISVEDLGLEDSILREEIYNQTDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA T FDERYD++LG+NT G KH++NFAKKC KL++L+HVSTAYV G  EGLI E PY++
Sbjct  121  AANTNFDERYDISLGLNTFGVKHLINFAKKCSKLKVLVHVSTAYVCGEGEGLILEKPYQL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG +GL+IDEE++V+++ L +L +  A+++ I   MK+LGI RA++YGWPNTYVFT
Sbjct  181  GHSLNGVNGLNIDEEEKVVQDKLGELQQLGATEDEIKMVMKNLGISRAKLYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+L + KE+L VV++RP I+T T+KEPFPGW EG+RTIDSL L YGKGKLTCF+G
Sbjct  241  KAMGEMLLEQLKENLSVVVVRPAIVTSTFKEPFPGWAEGVRTIDSLALAYGKGKLTCFIG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_006283617.1| hypothetical protein CARUB_v10004673mg [Capsella rubella]
 gb|EOA16515.1| hypothetical protein CARUB_v10004673mg [Capsella rubella]
Length=491

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 188/301 (62%), Positives = 243/301 (81%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+ S LQ+LDN +ILV GAAGFLA IF+EKILRV PNVKKLYLLLRA++ ++A +RFN 
Sbjct  5    MEVVSVLQYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASNEKSATERFND  64

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GK++++++K+  G   N + SE+VT+V GD+  E+LG++D  L   M+ +VDA+VNL
Sbjct  65   EILGKDLYRVVKDMYGPKLNELTSERVTIVGGDICLEDLGLQDFDLAHEMIHQVDAIVNL  124

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT G  +VLNFAK+C K++I +HVSTAYV G K GLI E+PY+M
Sbjct  125  AATTKFDERYDVALGINTFGALNVLNFAKRCTKVKICVHVSTAYVCGEKSGLIMETPYRM  184

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG SGLDI+ EK++++E L  L    AS E+I  AMK LG+ RA+MYGWPNTYVFT
Sbjct  185  GETLNGTSGLDINHEKKLVQEKLDQLQSIGASPETIKQAMKVLGLTRAKMYGWPNTYVFT  244

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEMV+G  + ++ +V++RP+IIT T+KEPF GW EG+RTIDSL +GYGKGKLTCFL 
Sbjct  245  KAMGEMVVGAKRGNISLVLLRPSIITSTFKEPFSGWTEGVRTIDSLAVGYGKGKLTCFLC  304

Query  5    D  3
            D
Sbjct  305  D  305



>ref|XP_004506277.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=491

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 185/301 (61%), Positives = 244/301 (81%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS L+FL+  TIL+TG  GFLAK+ LEKILRVQPN+KK+Y+LLRA D ++A  RF+T
Sbjct  1    MELGSVLEFLEEKTILITGGTGFLAKLLLEKILRVQPNIKKIYILLRAVDVKSAGHRFDT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGKE+F++LKEK G    + +SEK+T++ GDVS E+LG+KDS +   + +  D +VNL
Sbjct  61   EIIGKELFRLLKEKMGKNFTTFLSEKLTLIPGDVSLEDLGLKDSIIKEEIYNHTDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA T FDERYD++LG+NT G K+++NFAKKC KL++L+HVSTAYV G  EGLI E PY++
Sbjct  121  AANTNFDERYDISLGLNTFGTKYIINFAKKCNKLKVLVHVSTAYVCGEGEGLILEKPYQL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  GL+IDEE++V++E L +L +  A+++ I   MK+LG+ RA++YGWPNTYVFT
Sbjct  181  GHSLNGVHGLNIDEEEKVVQEKLFELQQLGATEDEIKVVMKNLGLSRAKLYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++ + KE+L VVI+RP I+T T+KEPFPGW EG+RTIDSL L YGKGKLTCFLG
Sbjct  241  KAMGEMLVEQLKENLSVVIVRPAIVTSTFKEPFPGWGEGVRTIDSLALAYGKGKLTCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_003539817.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
1 [Glycine max]
 gb|KHN21131.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=493

 Score =   397 bits (1019),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 242/303 (80%), Gaps = 5/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS L FL +  IL+TGA GFLAK+ LEKILRVQPNVKKLYLLLRAAD ++A  R N 
Sbjct  1    MELGSILHFLQDKNILITGATGFLAKVLLEKILRVQPNVKKLYLLLRAADAKSATHRLNN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKEK G   NS +S+K+T+V GD+S E+LG++DS L   +  + D ++NL
Sbjct  61   EIIGKDLFRVLKEKLGANFNSFVSKKLTLVPGDISREDLGLEDSILREEIYDQTDVIINL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGI--KEGLIAESPY  372
            AATT FDERYD++LG+NT G K+V+NFAKKC KL +L+HVSTAYV G   +EGLI E PY
Sbjct  121  AATTNFDERYDISLGLNTFGVKYVINFAKKCTKLEVLVHVSTAYVCGEGGREGLILEKPY  180

Query  371  KMGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
             +G++LNG SGLDI+ E++V+ + L +L +  A+++ I   MKDLGI RA++YGWPNTYV
Sbjct  181  HLGDSLNGVSGLDINAEEKVVRDKLSELQQLGATEKEIKEVMKDLGISRAKLYGWPNTYV  240

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GEM++ + K +L VV IRPTI+T T+KEPFPGW EG+RTIDSL + YGKGKLTCF
Sbjct  241  FTKAMGEMLVEQLKGNLSVVTIRPTIVTSTFKEPFPGWAEGVRTIDSLAVAYGKGKLTCF  300

Query  11   LGD  3
            LGD
Sbjct  301  LGD  303



>gb|AES67032.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=492

 Score =   397 bits (1019),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 191/301 (63%), Positives = 240/301 (80%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS L FL+  TILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRA D+E+A QRF  
Sbjct  1    MELGSILHFLEGRTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAKDSESAAQRFRN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKE  G   NS +SEK+T+V GD+S E L +K+S L   + ++ D +VNL
Sbjct  61   EIIGKDLFKLLKENQGPKFNSFVSEKLTLVPGDISKEGLNLKESILEEEICNQTDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT+G KHVL+FAKKC +L++L+HVSTAYV G + GLI E P++ 
Sbjct  121  AATTKFDERYDVALGINTLGVKHVLSFAKKCIQLKVLVHVSTAYVCGERGGLILEDPHRY  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  GLDID EK+++EE L        ++  I  AMKDLG++RA  YGWPNTYVFT
Sbjct  181  GVSLNGVPGLDIDMEKKLVEEKLNQFQAQGTTEHDIEVAMKDLGMERATKYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++  FKE++ VVI+RPTI+T T++EPFPGWVEG+RTIDS+ + YGKGKLT F+ 
Sbjct  241  KAMGEMLVETFKENMSVVIVRPTIVTSTFREPFPGWVEGLRTIDSIVVAYGKGKLTSFMA  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_010447195.1| PREDICTED: fatty acyl-CoA reductase 3-like [Camelina sativa]
Length=491

 Score =   396 bits (1018),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 188/301 (62%), Positives = 242/301 (80%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+ + LQ+LDN +ILV GAAGFLA IF+EKILRV PNVKKLYLLLRA+  + A QRFN 
Sbjct  5    MEVVNVLQYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASKEKTATQRFND  64

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GK++F+++KEK G     + SEK+T+V GD+  E+LG+++  L   M+ +VDA+VNL
Sbjct  65   EILGKDLFKVVKEKYGPNLKQLTSEKITIVNGDICLEDLGIQNLDLAHEMIHQVDAIVNL  124

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYD+ALG+NT G  +VLNFAK+C K++I + VSTAYV G K GLI E+P+ M
Sbjct  125  AATTKFDERYDIALGINTFGALNVLNFAKRCAKVKICVQVSTAYVCGEKPGLIMETPHHM  184

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDI+ EK++++E L  L    AS E+IT AM+ LG+ RA+MYGWPNTYVFT
Sbjct  185  GETLNGTTGLDINLEKKLVQEKLDQLQAIGASPETITEAMRVLGLTRAKMYGWPNTYVFT  244

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEMV+G  +E++ +V++RP+IIT T+KEPFPGW EGIRTIDSL +GYGKGKLTCFL 
Sbjct  245  KAMGEMVVGAKRENISLVMLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGKLTCFLC  304

Query  5    D  3
            D
Sbjct  305  D  305



>ref|XP_010432512.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Camelina 
sativa]
 ref|XP_010432513.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Camelina 
sativa]
Length=511

 Score =   397 bits (1019),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 241/301 (80%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+ S LQ+LDN +ILV GAAGFLA IF+EKILRV PNVKKLYLLLRA+  + A QRFN 
Sbjct  25   MEVVSVLQYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASKEKTATQRFND  84

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GK++F+++KEK G   N + SEKVT+V GD+  E+LG+++  L   M+ +VDA+VNL
Sbjct  85   EILGKDLFKVVKEKYGPNLNQLTSEKVTIVNGDICLEDLGIQNLDLAHEMIHQVDAIVNL  144

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYD ALG+NT G  +VLNFA +C K++I + VSTAYV G K GLI E+P+++
Sbjct  145  AATTKFDERYDTALGINTFGALNVLNFANRCAKVKICVQVSTAYVCGEKPGLIMETPHRV  204

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDI+ EK++++E L  L    AS E+I  AMK LG+ RA+MYGWPNTYVFT
Sbjct  205  GETLNGTTGLDINREKKLVQEKLDQLQAIGASPETIREAMKVLGLTRAKMYGWPNTYVFT  264

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEMV+G  +E++ +V++RP+IIT T+KEPFPGW EGIRTIDSL +GYGKGKLTCFL 
Sbjct  265  KAMGEMVVGAKRENISLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGKLTCFLC  324

Query  5    D  3
            D
Sbjct  325  D  325



>ref|XP_007132412.1| hypothetical protein PHAVU_011G092500g [Phaseolus vulgaris]
 gb|ESW04406.1| hypothetical protein PHAVU_011G092500g [Phaseolus vulgaris]
Length=492

 Score =   396 bits (1017),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 243/303 (80%), Gaps = 5/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS L FL + TIL+TGA GFLAK+ LEKILRVQPNVKKLYLLLRAAD ++A  R + 
Sbjct  1    MELGSVLHFLQDKTILITGATGFLAKVLLEKILRVQPNVKKLYLLLRAADAKSATHRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EII K++F++LKEK G   NS+I EK+T+V GD+S E+LG++D+ L   +  + D ++NL
Sbjct  61   EIIAKDLFRVLKEKMGANFNSLILEKLTLVPGDISREDLGLEDTILREEIYDQTDVIINL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGI--KEGLIAESPY  372
            AATT FDERYD++LG+NT G K+V+NFAKKC KL +L+HVSTAYVSG   +EGLI E PY
Sbjct  121  AATTNFDERYDISLGLNTFGVKYVINFAKKCTKLEVLVHVSTAYVSGEGGEEGLILEKPY  180

Query  371  KMGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
             +G++LNG SGLDI+ E +++ E L +L +  A+++ I   MKDLG+ RA++YGWPNTYV
Sbjct  181  HLGDSLNGVSGLDINAEDKLVREKLTELQQLGATEKEIKEVMKDLGLSRAKLYGWPNTYV  240

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GEM++ + K +L VVIIRPTI+T T+KEPFPGW EG+RTIDSL + YGKGKLTCF
Sbjct  241  FTKAMGEMLVEQLKGNLSVVIIRPTIVTSTFKEPFPGWAEGVRTIDSLAVAYGKGKLTCF  300

Query  11   LGD  3
            LGD
Sbjct  301  LGD  303



>gb|KDP34806.1| hypothetical protein JCGZ_10586 [Jatropha curcas]
Length=401

 Score =   392 bits (1007),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/301 (60%), Positives = 240/301 (80%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL    QFL++ T+LVTGA GFLAK+FLEK+LRVQPNVKKLYLLLRAADT +  QRF  
Sbjct  1    MELEKITQFLEHKTVLVTGATGFLAKVFLEKLLRVQPNVKKLYLLLRAADTSSVNQRFYN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGK++F+++KEK G   NS+I++K+ +V GDVSYE+LG KDS L   M++++D ++N 
Sbjct  61   EVIGKDLFRVVKEKLGANLNSIIAKKIAIVPGDVSYEDLGAKDSSLREEMINDLDFILNF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT+FDERYDVALG N +G K+VL FAK C KL++ +H+STAYV G   GLI E  Y++
Sbjct  121  AATTRFDERYDVALGTNALGAKNVLCFAKNCLKLKLFIHISTAYVCGESSGLIMEKSYQL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG  GL+I+EEK++++  L  L R+ A++ +I  AM D+G +RA+ YGWPNTYVFT
Sbjct  181  GETLNGVLGLNIEEEKKLIDRKLNQLRREGATEANIKKAMIDMGTERAKAYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEMV+G  KE+LPVVIIRPT++T T++EPFPGW+EG RTID+L +GYG GK++ F+ 
Sbjct  241  KAMGEMVIGHLKENLPVVIIRPTMVTSTWREPFPGWIEGARTIDALTVGYGSGKMSFFVA  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_010514781.1| PREDICTED: fatty acyl-CoA reductase 3-like [Camelina sativa]
Length=495

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 242/301 (80%), Gaps = 4/301 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E  S LQ+LDN +ILV GAAGFL KIF+EKILRV P+V+KLYLLLRA+  ++A +RFN E
Sbjct  6    EFVSVLQYLDNKSILVIGAAGFLGKIFVEKILRVAPHVRKLYLLLRASGEKSATERFNNE  65

Query  713  IIGKEIFQILKEKCGNSV--ISEKVTVVAGDVSYENLGVK--DSHLLTRMLSEVDAVVNL  546
            I+GK++F+++KEK G ++  I EKVT+V GD+  +NLG+   DS L  +M+ ++DA++NL
Sbjct  66   ILGKDLFKVVKEKYGQNLNLILEKVTIVNGDICLDNLGLNHIDSELEDQMVQQLDAIINL  125

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G  + LNFAK+C K+++ +HVSTAYVSG K G++ E+PY+M
Sbjct  126  AATTNFDERYDVALGINTLGSANALNFAKRCAKVKVFVHVSTAYVSGEKSGVVMETPYRM  185

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG  GLDI++E+++++E    L    AS E+IT AMKD G  RA++YGWPNTYVFT
Sbjct  186  GETLNGAIGLDINQEQKLVKEKHSQLQATGASPETITKAMKDFGHARAKVYGWPNTYVFT  245

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  +ED+ +VIIRP+I+T TYKEPFPGW EGIRTIDS+  GYG GKLTCFLG
Sbjct  246  KAMGEMIIGAKREDMSLVIIRPSIVTSTYKEPFPGWTEGIRTIDSIAAGYGTGKLTCFLG  305

Query  5    D  3
            D
Sbjct  306  D  306



>ref|XP_010425870.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Camelina 
sativa]
Length=456

 Score =   394 bits (1011),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 242/302 (80%), Gaps = 5/302 (2%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTE-AALQRFNT  717
            E  S LQ+LDN +ILV GAAGFL KIF+EKILRV P V+KLYLLLRA+  E +A +RFN 
Sbjct  6    EFVSVLQYLDNKSILVIGAAGFLGKIFVEKILRVAPKVRKLYLLLRASSGEKSATERFND  65

Query  716  EIIGKEIFQILKEKCGNSV--ISEKVTVVAGDVSYENLGVK--DSHLLTRMLSEVDAVVN  549
            EI+GK++F+++KEK G ++  I EKVT+V GD+  +NLG+   DS L  +M+ ++DA++N
Sbjct  66   EILGKDLFKVVKEKYGQNLNLILEKVTIVNGDICLDNLGLNHIDSELEDQMVQQLDAIIN  125

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            LAATT FDERYDVALG+NT+G  + LNFAK+C K+++ +HVSTAYVSG K G++ E+PY+
Sbjct  126  LAATTNFDERYDVALGINTLGAANALNFAKRCAKVKVFVHVSTAYVSGEKSGVVMETPYR  185

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            MGE LNG  GLDI++E+++++E L  L    AS E+IT AMKD G  RA++YGWPNTYVF
Sbjct  186  MGETLNGAIGLDINQEQKLVKEKLSQLQATGASPETITKAMKDFGHARAKVYGWPNTYVF  245

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM++G  +ED+ +VIIRP+I+T TYKEPFPGW EGIRTIDS+  GYG GKLTCFL
Sbjct  246  TKAMGEMIVGAKREDMSLVIIRPSIVTSTYKEPFPGWTEGIRTIDSIAAGYGTGKLTCFL  305

Query  8    GD  3
            GD
Sbjct  306  GD  307



>ref|XP_003540237.1| PREDICTED: fatty acyl-CoA reductase 3-like [Glycine max]
Length=490

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 190/301 (63%), Positives = 238/301 (79%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS + FL + TILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRA DTE+A QR +T
Sbjct  1    MELGSIMHFLQDKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRARDTESATQRLHT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKEK G   NS +SEK+ VV GD+S E+L ++D  L   + ++ D +VNL
Sbjct  61   EIIGKDLFRLLKEKLGTRFNSFVSEKLAVVPGDISQEDLNLEDPILGEEIFNQTDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYD+AL +NT+G  HVL+FAKKC KL++L+HVSTAYV G +EGLI E+P+  
Sbjct  121  AATTNFDERYDIALSINTLGVLHVLSFAKKCVKLKVLIHVSTAYVCGEREGLILEAPHHF  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  G DID EK+ +E+ L  L  + A +  I  AMKDLG QRA MYGWPNTYVFT
Sbjct  181  GVSLNGVPGPDIDMEKKKVEDKLNQLREEGAIEHDIELAMKDLGTQRATMYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  K ++ VVI+RPT++T TYKEPFPGW+EG+RTIDS+ + YGKGKL CFL 
Sbjct  241  KAMGEMLVGTTKGNMNVVIVRPTMVTSTYKEPFPGWIEGLRTIDSIVVAYGKGKLVCFLA  300

Query  5    D  3
            +
Sbjct  301  N  301



>ref|XP_003543435.1| PREDICTED: fatty acyl-CoA reductase 3-like [Glycine max]
Length=490

 Score =   394 bits (1013),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 191/301 (63%), Positives = 239/301 (79%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS + FL + TILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRA DTE+A QR + 
Sbjct  1    MELGSIIHFLQDKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRARDTESATQRLHA  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKEK G   NS +SEK+TVV GD+S E+L +KD  L   + ++ D +VNL
Sbjct  61   EIIGKDLFRLLKEKLGTRFNSYVSEKLTVVPGDISQEDLNLKDPILGEEIFNQTDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G  HVL+FAKKC KL++L+HVSTAYV G KEGLI E P+  
Sbjct  121  AATTNFDERYDVALGINTLGVMHVLSFAKKCVKLKVLIHVSTAYVCGEKEGLILEDPHHF  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  GLDID EK+ +E+ L  L  + A++  I  AMKDLG +RA+MYGW NTYVFT
Sbjct  181  GVSLNGVPGLDIDMEKKNVEQKLIQLREEGATEHDIELAMKDLGSERAKMYGWANTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  K ++ VVI+RPT++T T+ EPFPGW+EG+RTIDS+ + YGKGKL CFL 
Sbjct  241  KAMGEMLVGTTKGNMNVVIVRPTMVTSTHTEPFPGWIEGLRTIDSIVVAYGKGKLACFLA  300

Query  5    D  3
            +
Sbjct  301  N  301



>ref|XP_010503101.1| PREDICTED: fatty acyl-CoA reductase 3-like [Camelina sativa]
Length=495

 Score =   394 bits (1012),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 241/301 (80%), Gaps = 4/301 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E  S LQ+LDN +ILV GAAGFL KIF+EKILRV P V+KLYLLLRA+  ++A +RFN E
Sbjct  6    EFVSVLQYLDNKSILVIGAAGFLGKIFVEKILRVAPKVRKLYLLLRASGEKSATERFNDE  65

Query  713  IIGKEIFQILKEKCGNSV--ISEKVTVVAGDVSYENLGVK--DSHLLTRMLSEVDAVVNL  546
            I+GK++F+++KEK G ++  I EKVT+V GD+  +NLG+   DS L  +M+ ++DA++NL
Sbjct  66   ILGKDLFKVVKEKYGQNLNLILEKVTIVNGDICLDNLGLNHIDSELEDQMVQQLDAIINL  125

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G  + LNFAK+C K+++ +HVSTAYVSG K G++ E+PY+M
Sbjct  126  AATTNFDERYDVALGINTLGAANALNFAKRCAKVKVFVHVSTAYVSGEKSGVVMETPYRM  185

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG  GLDI++E+++++E L  L    AS E+I  AMKD G  RA++YGWPNTYVFT
Sbjct  186  GETLNGAIGLDINQEQKLVKEKLSQLQATGASPETIKKAMKDFGHARAKVYGWPNTYVFT  245

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  +ED+ +VIIRP+I+T TYKEPFPGW EGIRTIDS+  GYG GKLTCFLG
Sbjct  246  KAMGEMIIGAKREDMSLVIIRPSIVTSTYKEPFPGWTEGIRTIDSIAAGYGTGKLTCFLG  305

Query  5    D  3
            D
Sbjct  306  D  306



>gb|KHN38645.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=493

 Score =   394 bits (1011),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 187/303 (62%), Positives = 243/303 (80%), Gaps = 5/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS L FL + +IL+TGA GFLAK+ LEKILRVQPNVKKLYLLLRA D ++A  R + 
Sbjct  1    MELGSILHFLQDKSILITGATGFLAKVLLEKILRVQPNVKKLYLLLRAEDAKSATHRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKEK G   NS +S+K+T+V GD+S E+LG++DS L   +  + D ++NL
Sbjct  61   EIIGKDLFRVLKEKLGANFNSFVSKKLTLVPGDISREDLGLEDSILREEIYDQTDVIINL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGI--KEGLIAESPY  372
            AATT FDERYD++LG+NT G K+V+NFAKKC KL++L+HVSTAYV G   +EGLI E PY
Sbjct  121  AATTNFDERYDISLGLNTFGVKYVINFAKKCTKLKVLVHVSTAYVCGEGGREGLILEKPY  180

Query  371  KMGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
             +G++LNG SGLDI+ E++V+ + L +L +  A+++ I   MKDLGI RA++YGWPNTYV
Sbjct  181  HLGDSLNGVSGLDINAEEKVVRDKLSELQQLGATEKEIKEVMKDLGISRAKLYGWPNTYV  240

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GEM++ + K +L VVIIRP+I+T T KEPFPGW EG+RTIDSL + YGKGKLTCF
Sbjct  241  FTKAMGEMLVEQLKGNLSVVIIRPSIVTSTLKEPFPGWAEGVRTIDSLAVAYGKGKLTCF  300

Query  11   LGD  3
            LGD
Sbjct  301  LGD  303



>ref|XP_003543433.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
1 [Glycine max]
 gb|KHN21438.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=490

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 238/301 (79%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+GS L FL++ TIL+ GA GFLAKIFLEKILRVQPNVKKL+LLLRA+D ++A  R   
Sbjct  1    MEVGSVLNFLEDKTILIVGATGFLAKIFLEKILRVQPNVKKLFLLLRASDAKSANYRLQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EII K++F +LKEK G    S ISEKVT+V GD+SYE+LG+KDS L   + ++ D +VNL
Sbjct  61   EIIAKDLFIVLKEKLGANFKSFISEKVTLVPGDISYEDLGLKDSILREEICNQTDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYD+ALG+N  G KHV+NFAK+C KL+++LHVSTAYV G + GLI E PY  
Sbjct  121  AATTNFDERYDIALGLNIFGVKHVMNFAKQCTKLKVVLHVSTAYVCGERGGLILEEPYNF  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G++LNG SGLDID E+ ++ + L +L    A++  I  AMK+LGI RA++YGWPNTYVFT
Sbjct  181  GDSLNGVSGLDIDAERTIVCDKLDELREQGATEREIKIAMKNLGISRAKVYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++ + K  L VVI+RPTI+T T +EPFPGWVEG+RTIDSL + YGKGKLTCFLG
Sbjct  241  KAVGEMLVEQLKGRLSVVIMRPTIVTSTLREPFPGWVEGVRTIDSLAVTYGKGKLTCFLG  300

Query  5    D  3
            +
Sbjct  301  N  301



>ref|XP_010425869.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Camelina 
sativa]
Length=496

 Score =   393 bits (1010),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 242/302 (80%), Gaps = 5/302 (2%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTE-AALQRFNT  717
            E  S LQ+LDN +ILV GAAGFL KIF+EKILRV P V+KLYLLLRA+  E +A +RFN 
Sbjct  6    EFVSVLQYLDNKSILVIGAAGFLGKIFVEKILRVAPKVRKLYLLLRASSGEKSATERFND  65

Query  716  EIIGKEIFQILKEKCGNSV--ISEKVTVVAGDVSYENLGVK--DSHLLTRMLSEVDAVVN  549
            EI+GK++F+++KEK G ++  I EKVT+V GD+  +NLG+   DS L  +M+ ++DA++N
Sbjct  66   EILGKDLFKVVKEKYGQNLNLILEKVTIVNGDICLDNLGLNHIDSELEDQMVQQLDAIIN  125

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            LAATT FDERYDVALG+NT+G  + LNFAK+C K+++ +HVSTAYVSG K G++ E+PY+
Sbjct  126  LAATTNFDERYDVALGINTLGAANALNFAKRCAKVKVFVHVSTAYVSGEKSGVVMETPYR  185

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            MGE LNG  GLDI++E+++++E L  L    AS E+IT AMKD G  RA++YGWPNTYVF
Sbjct  186  MGETLNGAIGLDINQEQKLVKEKLSQLQATGASPETITKAMKDFGHARAKVYGWPNTYVF  245

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM++G  +ED+ +VIIRP+I+T TYKEPFPGW EGIRTIDS+  GYG GKLTCFL
Sbjct  246  TKAMGEMIVGAKREDMSLVIIRPSIVTSTYKEPFPGWTEGIRTIDSIAAGYGTGKLTCFL  305

Query  8    GD  3
            GD
Sbjct  306  GD  307



>ref|XP_008458592.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cucumis melo]
Length=487

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 244/295 (83%), Gaps = 4/295 (1%)
 Frame = -3

Query  878  LQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKE  699
            ++FL+N +IL+TGA GFLAKI +EKILRVQPNVKKLYLLLRA D   A +RF+ E++ K 
Sbjct  1    MEFLENKSILITGATGFLAKILVEKILRVQPNVKKLYLLLRADDEITAKKRFHNEVVEKA  60

Query  698  IFQILKEKCG---NSVISEKVTVVAGDVSYENLGVK-DSHLLTRMLSEVDAVVNLAATTK  531
            +FQ+LK+K G   N++ISEK+ +V G++S   LG+K DS  + ++ S+V+ ++NLAATT 
Sbjct  61   LFQVLKKKYGANLNTLISEKICLVPGEISLPQLGLKHDSIWIDKIKSQVEIIINLAATTN  120

Query  530  FDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALN  351
            FDERYDVALG N +G KHV+NFAK+C  L++++HVSTAYVSG +EGLI E+PYKMGE+LN
Sbjct  121  FDERYDVALGTNALGAKHVINFAKQCSNLKLVVHVSTAYVSGEREGLIMETPYKMGESLN  180

Query  350  GKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGE  171
               GLDI+ E+ V+E+ L+ L  + A+ E+IT AMKDLG++R+++YGWPNTYVFTKA+GE
Sbjct  181  WMKGLDIEAEQMVIEDKLKQLKENGATNETITLAMKDLGLERSKLYGWPNTYVFTKAMGE  240

Query  170  MVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            M++G+ K+D+P+++IRPTI+T TYKEPFPGW+EG+RTIDSL +GY KGKLTCF+ 
Sbjct  241  MIIGDLKDDVPLIVIRPTIVTSTYKEPFPGWIEGVRTIDSLIVGYAKGKLTCFVA  295



>ref|XP_010520426.1| PREDICTED: fatty acyl-CoA reductase 3-like [Tarenaya hassleriana]
Length=501

 Score =   392 bits (1007),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 185/300 (62%), Positives = 239/300 (80%), Gaps = 3/300 (1%)
 Frame = -3

Query  899  AMELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFN  720
            +ME GS LQFL++ +ILVTGA GFLAKIF EK+LRV PN+KKLYLL+RA+D + A QRF+
Sbjct  4    SMEAGSVLQFLEDKSILVTGATGFLAKIFAEKLLRVSPNIKKLYLLVRASDEKFATQRFS  63

Query  719  TEIIGKEIFQILKEKCGNSVI---SEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
             EI+G E+F ++KEK G ++I   SEKV +V GD+S+E+LG++DS L   M+ E+D +VN
Sbjct  64   DEILGNELFGVVKEKYGPNLIPLISEKVKLVVGDISFEDLGLQDSKLALDMIHELDVIVN  123

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            +AATT F+ERYDVALG N +G  HVLNFAKKC K+++L+HVSTAYV G + G+I E+PY 
Sbjct  124  MAATTNFNERYDVALGTNALGSAHVLNFAKKCAKVKVLVHVSTAYVCGERSGVIRETPYH  183

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            +G+ LNGK GLDID EK + EE L +L    AS  +IT AMKDLG+ RARMYGWPNTYVF
Sbjct  184  VGQTLNGKGGLDIDHEKNLAEEKLEELRATGASPGTITRAMKDLGLSRARMYGWPNTYVF  243

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM++G  +E++ VVI+RPTIIT T+KEPFPGW EG R  D++ +GYG+GK+T FL
Sbjct  244  TKAMGEMLIGAKRENVAVVILRPTIITSTFKEPFPGWTEGFRAADNIPIGYGQGKITSFL  303



>ref|XP_004487512.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=492

 Score =   392 bits (1006),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 190/301 (63%), Positives = 240/301 (80%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS +QFL+  TILVTGA GFLAKIF+EKILRVQP VKKLYLLLRA D+E+A QR  T
Sbjct  1    MELGSIMQFLEGRTILVTGATGFLAKIFVEKILRVQPKVKKLYLLLRAKDSESATQRLRT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKE  G   +S +SEK+TVV GD+S E L +K+S L   + ++ D ++NL
Sbjct  61   EIIGKDLFKLLKENLGTKFDSFVSEKLTVVPGDISQEGLNLKESILEENICNQTDVIINL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT+G KHVL+FAKKC KL++L+HVSTAYV G + GLI E P+  
Sbjct  121  AATTKFDERYDVALGINTLGAKHVLSFAKKCVKLKVLVHVSTAYVCGERGGLILEDPHPF  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  GLDI  EK+++E  L+ L  + A++  I  AMKDLG++RA  YGWPNTYVFT
Sbjct  181  GVSLNGVHGLDICMEKKLVERKLKQLQAEGATEHDIEVAMKDLGMERANEYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++   KE++ VVI+RPTI+T TY+EPFPGWVEG+RTIDS+ + YGKGKLT F+ 
Sbjct  241  KAMGEMLVEASKENMSVVILRPTIVTSTYREPFPGWVEGLRTIDSIIVAYGKGKLTSFMA  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_006591085.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Glycine 
max]
Length=493

 Score =   392 bits (1006),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 242/303 (80%), Gaps = 5/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS L FL + +IL+TGA GFLAK+ LEKILRVQPNVKKLYLLLR  D ++A  R + 
Sbjct  1    MELGSILHFLQDKSILITGATGFLAKVLLEKILRVQPNVKKLYLLLRTEDAKSATHRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKEK G   NS +S+K+T+V GD+S E+LG++DS L   +  + D ++NL
Sbjct  61   EIIGKDLFRVLKEKLGANFNSFVSKKLTLVPGDISREDLGLEDSILREEIYDQTDVIINL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGI--KEGLIAESPY  372
            AATT FDERYD++LG+NT G K+V+NFAKKC KL++L+HVSTAYV G   +EGLI E PY
Sbjct  121  AATTNFDERYDISLGLNTFGVKYVINFAKKCTKLKVLVHVSTAYVCGEGGREGLILEKPY  180

Query  371  KMGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
             +G++LNG SGLDI+ E++V+ + L +L +  A+++ I   MKDLGI RA++YGWPNTYV
Sbjct  181  HLGDSLNGVSGLDINAEEKVVRDKLSELQQLGATEKEIKEVMKDLGISRAKLYGWPNTYV  240

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GEM++ + K +L VVIIRP+I+T T KEPFPGW EG+RTIDSL + YGKGKLTCF
Sbjct  241  FTKAMGEMLVEQLKGNLSVVIIRPSIVTSTLKEPFPGWAEGVRTIDSLAVAYGKGKLTCF  300

Query  11   LGD  3
            LGD
Sbjct  301  LGD  303



>ref|XP_010271727.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Nelumbo 
nucifera]
Length=490

 Score =   391 bits (1005),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 187/301 (62%), Positives = 241/301 (80%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL   L+ L+N TILVTGA GF+AKIF+EK+LRVQPNVKKLYLLLRA  T++A+QR + 
Sbjct  1    MELVGILESLENKTILVTGATGFVAKIFVEKVLRVQPNVKKLYLLLRAPHTKSAIQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GKE+F++L++K G   +S +SEKV  V GD++ +NLGV+++ L  +M  EVD VVN+
Sbjct  61   EVLGKEVFRVLRQKLGSGFDSFMSEKVIPVPGDITCKNLGVEETDLRDKMWREVDIVVNI  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AAT  FDERYD +L +NTMG KHVL FAKKC KL+I +HVSTAYV G +EGL+ E PY+M
Sbjct  121  AATVNFDERYDDSLFINTMGAKHVLEFAKKCSKLQIFVHVSTAYVGGQQEGLMLEKPYQM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG  GLDI +E +V EE L++L  +  + +    AMK+LG++RAR+YGWPNTY FT
Sbjct  181  GETLNGTLGLDIQQELKVAEERLKELQAEKITIKEERIAMKELGLKRARLYGWPNTYAFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG ++E++P+VIIRPTIIT TY EPFPGW+EG+RTIDSL LGYGKG+LT F G
Sbjct  241  KAMGEMLLGHYRENIPLVIIRPTIITSTYNEPFPGWIEGVRTIDSLILGYGKGRLTGFPG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_004145801.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cucumis sativus]
Length=487

 Score =   391 bits (1004),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 244/295 (83%), Gaps = 4/295 (1%)
 Frame = -3

Query  878  LQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKE  699
            ++FL+N +IL+TGA GFLAKI +EKILRVQPNVKKLYLLLRA D   A +RF+ E++ K 
Sbjct  1    MEFLENKSILITGATGFLAKILVEKILRVQPNVKKLYLLLRADDEITAKKRFHNEVVEKA  60

Query  698  IFQILKEKCG---NSVISEKVTVVAGDVSYENLGVK-DSHLLTRMLSEVDAVVNLAATTK  531
            +FQ+LK+K G   N++ISEK+ +V G++S   +G+K DS  + ++ S+V+ ++NLAATT 
Sbjct  61   LFQVLKKKHGANLNTLISEKICLVPGEISLPQMGLKHDSIWIDKLKSQVEIIINLAATTN  120

Query  530  FDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALN  351
            FDERYDVALG N +G KHV+NFAK+C  L++++HVSTAYVSG +EGLI E+PYKMGE+LN
Sbjct  121  FDERYDVALGTNALGAKHVINFAKQCSNLKLVVHVSTAYVSGEREGLIMETPYKMGESLN  180

Query  350  GKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGE  171
               GLDI+ E+ V+E+ L+ L  D A+ E+IT AMKDLG++R+++YGWPNTYVFTKA+GE
Sbjct  181  WFKGLDIEVEQMVIEDKLKQLKEDGATNETITLAMKDLGLERSKLYGWPNTYVFTKAMGE  240

Query  170  MVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            M++G+ K+++P+++IRPTI+T TYKEPFPGW+EG+RTIDSL +GY KGKLTCF+ 
Sbjct  241  MIIGDLKDEVPLIVIRPTIVTSTYKEPFPGWIEGVRTIDSLIVGYAKGKLTCFVA  295



>ref|XP_004166245.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cucumis sativus]
Length=487

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 243/295 (82%), Gaps = 4/295 (1%)
 Frame = -3

Query  878  LQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKE  699
            ++FL+N +IL+TGA GFLAKI +EKILRVQPNVKKLYLLLRA D   A +RF+ E++ K 
Sbjct  1    MEFLENKSILITGATGFLAKILVEKILRVQPNVKKLYLLLRADDEITAKKRFHNEVVEKA  60

Query  698  IFQILKEKCG---NSVISEKVTVVAGDVSYENLGVK-DSHLLTRMLSEVDAVVNLAATTK  531
            +FQ+LK+K G   N++ISEK+ +V G++S   +G+K DS  + ++ S+V+ ++NLAATT 
Sbjct  61   LFQVLKKKHGANLNTLISEKICLVPGEISLPQMGLKHDSIWIDKLKSQVEIIINLAATTN  120

Query  530  FDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALN  351
            FDERYDVALG N +G KHV+NFAK+C  L++++HVSTAYVSG +EGLI E+PYKMGE+LN
Sbjct  121  FDERYDVALGTNALGAKHVMNFAKQCSNLKLVVHVSTAYVSGEREGLIMETPYKMGESLN  180

Query  350  GKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGE  171
               GLDI+ E+ V+E+ L+ L  D A+ E IT AMKDLG++R+++YGWPNTYVFTKA+GE
Sbjct  181  WFKGLDIEVEQMVIEDKLKQLKEDGATNEMITLAMKDLGLERSKLYGWPNTYVFTKAMGE  240

Query  170  MVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            M++G+ K+++P+++IRPTI+T TYKEPFPGW+EG+RTIDSL +GY KGKLTCF+ 
Sbjct  241  MIIGDLKDEIPLIVIRPTIVTSTYKEPFPGWIEGVRTIDSLIVGYAKGKLTCFVA  295



>ref|XP_007150087.1| hypothetical protein PHAVU_005G125400g [Phaseolus vulgaris]
 gb|ESW22081.1| hypothetical protein PHAVU_005G125400g [Phaseolus vulgaris]
Length=524

 Score =   392 bits (1006),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/300 (63%), Positives = 234/300 (78%), Gaps = 3/300 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E+GS L FL N TIL+ G  GFLAKI LEKILRVQPNVKK++LLLRA+D  +A  R + E
Sbjct  36   EVGSVLHFLQNKTILIAGGTGFLAKILLEKILRVQPNVKKIFLLLRASDANSATYRLHNE  95

Query  713  IIGKEIFQILKEKCGN---SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            IIGK++F +LKEK G+   S I+EKVT+V GD++YE LG+KDS L   + ++ D +VNLA
Sbjct  96   IIGKDLFIVLKEKLGSNFKSFIAEKVTLVPGDITYEGLGLKDSTLREEICNQTDVIVNLA  155

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            ATT FDERYD+AL +NT G K+V+NFAK+C KL++LLHVSTAYV G + GLI E PY  G
Sbjct  156  ATTNFDERYDIALDLNTFGVKYVMNFAKQCTKLKVLLHVSTAYVCGERGGLILEDPYHFG  215

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E LNG SGLDID EK ++   L +L    A++  +  AMK+LGI RA++YGWPNTYVFTK
Sbjct  216  ETLNGVSGLDIDAEKTIVCNKLDELREQGATERDVKIAMKNLGISRAKVYGWPNTYVFTK  275

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM++ + K +L VVIIRPTI+T T KEPFPGWVEGIRTIDSL + YGKGKLTCFLGD
Sbjct  276  AVGEMLVEKLKGNLSVVIIRPTIVTSTMKEPFPGWVEGIRTIDSLAVTYGKGKLTCFLGD  335



>ref|XP_004487511.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=491

 Score =   390 bits (1001),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/300 (62%), Positives = 238/300 (79%), Gaps = 3/300 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E+GS L F+ + TIL+ GA GFLAKIFLEK+LRVQPNVKKL+LLLRA+D ++A  R   E
Sbjct  3    EVGSILHFIQDKTILIVGATGFLAKIFLEKVLRVQPNVKKLFLLLRASDDKSAACRLQNE  62

Query  713  IIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            I+ K++F +LK+K G    S ISEK+T+V GD+S E+LG+K+S L   +L + D ++NLA
Sbjct  63   ILAKDLFNLLKDKMGANFESFISEKLTLVPGDISCEDLGLKNSILRDDILCQTDVIINLA  122

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            ATT FDERYD+ALG+NT G KH++NFAK+C KL++L+H+STAYV G K GLI ESPY  G
Sbjct  123  ATTNFDERYDIALGLNTFGVKHIINFAKQCNKLKVLVHISTAYVCGEKSGLILESPYLFG  182

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E LNG SGLDI+ EK+++ E L +L    A++  I  AMKDLGI+RA +YGWPNTYVFTK
Sbjct  183  ETLNGVSGLDINAEKKLVTEKLDELQEMGATEREIKLAMKDLGIKRANVYGWPNTYVFTK  242

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM++ + + +L VVI+RPTI+T T+KEPFPGW EGIRTIDSL + YGKGKL+CFLGD
Sbjct  243  AVGEMLVEQLRGNLSVVILRPTIVTSTFKEPFPGWSEGIRTIDSLAVAYGKGKLSCFLGD  302



>ref|XP_010244271.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Nelumbo 
nucifera]
Length=492

 Score =   389 bits (1000),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 187/301 (62%), Positives = 238/301 (79%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME G  ++ + N TILVTGA GF+AK+F+EK+LRVQPNVKKLYLLLRA DT++A QR + 
Sbjct  1    MESGGIVESIGNKTILVTGATGFVAKLFVEKVLRVQPNVKKLYLLLRAPDTKSATQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+I KE+F++L++K G   +S ISEKVT V GD+S ENLGV+D  L   M  E+D VVN+
Sbjct  61   EVIEKEVFRVLRQKHGAGFDSFISEKVTPVPGDISCENLGVEDCDLRDEMWREIDIVVNM  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AAT  FDERYD AL  NT+G KHVLNFAKKC KL++ +HVSTAYV+G +EG+I E PY+M
Sbjct  121  AATVNFDERYDDALYTNTLGVKHVLNFAKKCAKLQMFVHVSTAYVAGQQEGVIMEKPYRM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG  GLDI++E +V EE  +++     +++    AMK+LG+ RAR+YGWPNTY FT
Sbjct  181  GETLNGTPGLDIEQELKVAEERSKEVQDLGFTKKQERIAMKELGLTRARLYGWPNTYTFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  +E++PVVIIRPT+IT TY EPFPGW+EG+RTIDSL LGYGKGKLT FLG
Sbjct  241  KAMGEMLIGNLRENMPVVIIRPTMITSTYYEPFPGWIEGLRTIDSLALGYGKGKLTFFLG  300

Query  5    D  3
            +
Sbjct  301  N  301



>ref|XP_010271728.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Nelumbo nucifera]
Length=490

 Score =   389 bits (998),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 186/301 (62%), Positives = 239/301 (79%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL   ++ L+N TIL TGA GF+AKIF+EK+LRVQPNVKKLYLLLRA  T++A+QR + 
Sbjct  1    MELVGIMESLENKTILATGATGFVAKIFVEKVLRVQPNVKKLYLLLRAPHTKSAIQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GKE+F++L++K G   +S +SEKV  V GD++ +NLGV+++ L  +M  EVD VVN+
Sbjct  61   EVLGKEVFRVLRQKLGSGFDSFMSEKVIPVPGDITCKNLGVEETDLRDKMWREVDIVVNI  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AAT  FDERYD +L +NTMG KHVL FAKKC KL+I +HVSTAYV G +EGLI E PY+M
Sbjct  121  AATVNFDERYDDSLHINTMGAKHVLEFAKKCSKLQIFVHVSTAYVGGQQEGLILEKPYQM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG  GLDI +E +V EE L++L  +  + +    AMK+LG++RAR+YGWPNTYVFT
Sbjct  181  GETLNGTLGLDIQQELKVAEERLKELQAEKITIKEERIAMKELGLKRARLYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG ++E++P+VIIRPTIIT TY EPFPGW+EG+RTIDSL LGY KG LT F G
Sbjct  241  KAMGEMLLGHYRENIPLVIIRPTIITSTYNEPFPGWIEGVRTIDSLILGYSKGGLTGFPG  300

Query  5    D  3
            D
Sbjct  301  D  301



>gb|AFK33782.1| unknown [Medicago truncatula]
Length=492

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 238/302 (79%), Gaps = 3/302 (1%)
 Frame = -3

Query  899  AMELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFN  720
            A E+GS L FL+  TILV GA GFLAKIFLEK+LRVQPNVKKL+LLLRA+D ++A  R  
Sbjct  2    AQEVGSILNFLEGKTILVIGATGFLAKIFLEKVLRVQPNVKKLFLLLRASDDKSAASRLQ  61

Query  719  TEIIGKEIFQILKEKCGN---SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
             EI+ K++F +L EK G    S ISEK+TVV GD+++E+LG+KDS L   + S+ D ++N
Sbjct  62   NEILAKDLFNLLNEKMGTNFKSFISEKLTVVPGDITFEDLGLKDSILREDISSQTDVIIN  121

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            LAATT FDERYD+AL +NT G KH+++FAK+C +L++L+HVSTAYV G K GLI ESPY 
Sbjct  122  LAATTNFDERYDIALDLNTFGVKHIMSFAKQCIRLKVLVHVSTAYVCGEKSGLILESPYL  181

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            +G++LNG +GLDI+ EK+++ E L +L    A++  I  AMKDLGI RA +YGWPNTYVF
Sbjct  182  LGDSLNGVAGLDINAEKKLVTEKLGELQEKGATEHEIKVAMKDLGITRANVYGWPNTYVF  241

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKALGEM++ + K +L VVI+RP I+TGT +EPFPGWVEG+RTID L + YGKGKLTCFL
Sbjct  242  TKALGEMLVEKLKGNLSVVILRPAIVTGTLREPFPGWVEGLRTIDCLAVVYGKGKLTCFL  301

Query  8    GD  3
            GD
Sbjct  302  GD  303



>ref|XP_006419126.1| hypothetical protein EUTSA_v10002497mg [Eutrema salsugineum]
 gb|ESQ37562.1| hypothetical protein EUTSA_v10002497mg [Eutrema salsugineum]
Length=495

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/303 (61%), Positives = 246/303 (81%), Gaps = 6/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  S LQ+LD  +ILV GAAGFLAKIF+EKILRV PNVKKLYLLLRA+D ++A QRFN 
Sbjct  5    MEAVSVLQYLDKKSILVIGAAGFLAKIFVEKILRVAPNVKKLYLLLRASDGKSATQRFN-  63

Query  716  EIIGKEIFQILKEKCGNSV--ISEKVTVVAGDVSYENLGVKD---SHLLTRMLSEVDAVV  552
            EI+G ++++++KEK G ++  ISEK+T+V GDVS E+LG+ +   S L   M+ ++DA+V
Sbjct  64   EILGTDLYKVMKEKYGENLNHISEKITIVNGDVSLEDLGLHNEDSSDLEHEMVHQLDAIV  123

Query  551  NLAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPY  372
            NLAATT F+ERYDVALG+NT+G  + LNFAK+C K+++ +HVSTAYV G + GLI E+P 
Sbjct  124  NLAATTNFEERYDVALGINTLGAANALNFAKRCAKVKVFVHVSTAYVCGEQTGLIMETPI  183

Query  371  KMGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
            +MGE LNG +GLDI++EK++++E L +L    A  E+IT AMKDLG+ RA++YGWPNTYV
Sbjct  184  RMGETLNGATGLDINQEKKLVKEKLGELRATGALPETITQAMKDLGLTRAKLYGWPNTYV  243

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GEM++G  +E++ +VI+RP+II+ T+KEPFPGW EGIRTID + +GYG GKLTCF
Sbjct  244  FTKAMGEMMVGATRENMSLVILRPSIISSTFKEPFPGWTEGIRTIDGIAVGYGTGKLTCF  303

Query  11   LGD  3
            LGD
Sbjct  304  LGD  306



>ref|XP_002875671.1| oxidoreductase, acting on the CH-CH group of donors [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH51930.1| oxidoreductase, acting on the CH-CH group of donors [Arabidopsis 
lyrata subsp. lyrata]
Length=493

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 239/299 (80%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL N TILVTG  GFLAK+F+EKILR+QPNVKKL+L LRAAD E+A+QRF++E++
Sbjct  3    SNCIQFLQNKTILVTGVPGFLAKVFVEKILRIQPNVKKLFLFLRAADNESAMQRFHSEVL  62

Query  707  GKEIFQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++L+   G+    +++SEKV  +AGD+S +NLGVKDS+LL  M +E+D +VN+AA
Sbjct  63   EKDLFRVLRNALGDENLEALVSEKVVPIAGDISVDNLGVKDSNLLQHMWNEIDIIVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV L +NT GP +VLNFAKKC K +++LHVSTAYV G K GL+ E  + MGE
Sbjct  123  TTNFDERYDVGLSINTFGPLNVLNFAKKCVKGQLVLHVSTAYVCGEKSGLLQEKTFHMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   L I+ E  +M++ L++L + + S+E I+ +MKDLG+ RA+++GWPNTYVFTK+
Sbjct  183  TLNGHGKLVIETEVELMKQKLKELQKQDCSEEEISQSMKDLGMSRAKLHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG  +E+LP+VIIRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLLGNHRENLPIVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_010686043.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Beta 
vulgaris subsp. vulgaris]
Length=491

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 241/301 (80%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L+FL+N +ILVTG AGFLAKIF EK+LR QPNV+K+YLLLRAAD ++A  R   
Sbjct  1    MELCSILKFLENKSILVTGGAGFLAKIFAEKVLRSQPNVRKVYLLLRAADNKSATLRLQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+I K++F++LK+K G   NS ISEKVTVV GD++ E+L +K+ +L   + + +D +VNL
Sbjct  61   EVIAKDLFKVLKQKMGAKFNSFISEKVTVVPGDITCEDLAIKELNLKEELWTNIDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDV+L +NT G K+VL+FAKKC KL++L+ VSTAYVSG   GL+ ESPY M
Sbjct  121  AATTNFDERYDVSLYLNTFGAKYVLDFAKKCTKLKVLVQVSTAYVSGETAGLVKESPYFM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G++LNG+ GL+I+ EKR++++ L +L  + A+QE+I   M+DLG++R++ +GWPN YVFT
Sbjct  181  GDSLNGRPGLNIEVEKRLIQDKLEELQAEGATQETIKFTMRDLGLERSKHWGWPNVYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KALGEM+L   K D+P+VIIRPTI+T T+KEP PGWVEGIRTIDSL + YGKG+L CFLG
Sbjct  241  KALGEMMLLHEKGDIPLVIIRPTIVTSTFKEPIPGWVEGIRTIDSLAVAYGKGRLPCFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_010514784.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X2 [Camelina 
sativa]
Length=433

 Score =   385 bits (989),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 235/299 (79%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL+N TILVTG  GFLAK+F+EKILR+QPNVKKL+LLLRAAD E+A+QRF +E++
Sbjct  3    SNCVQFLENKTILVTGVPGFLAKVFVEKILRIQPNVKKLFLLLRAADNESAMQRFRSEVL  62

Query  707  GKEIFQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++L+   G+    +++S+KV  + GD+S +NLGVKDS LL RM +E+D VVN+AA
Sbjct  63   EKDLFRVLRNNLGDENLKALVSDKVVPIPGDISVDNLGVKDSDLLKRMWNEIDIVVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV + +NT GP +VLNFAKKC K ++LLHVSTAYV G K GL+ E  + MGE
Sbjct  123  TTNFDERYDVGIRINTFGPLNVLNFAKKCVKGQLLLHVSTAYVCGEKSGLLQEKTFHMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   L I+ E  +M++ L++L + +  +E I   MKDLG+ RA+++GWPNTYVFTK+
Sbjct  183  TLNGHGNLVIETEMELMKQKLKELQKLDCPEEEIAQTMKDLGMSRAKLHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+L   KEDLPVVIIRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLLNNHKEDLPVVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|NP_001030809.1| fatty acyl-CoA reductase 4 [Arabidopsis thaliana]
 dbj|BAE99400.1| acyl CoA reductase - protein [Arabidopsis thaliana]
 gb|ACF22894.1| At3g44540 [Arabidopsis thaliana]
 gb|AEE77913.1| fatty acid reductase 4 [Arabidopsis thaliana]
Length=433

 Score =   385 bits (989),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 236/299 (79%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL + TILVTG  GFLAK+F+EKILR+QP VKKL+LLLRAAD E+A+QRF++E++
Sbjct  3    SNCIQFLHDKTILVTGVPGFLAKVFVEKILRIQPKVKKLFLLLRAADNESAMQRFHSEVL  62

Query  707  GKEIFQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++LK   G+    + I+EKV  + GD+S +NLGVK S LL  M +E+D +VN+AA
Sbjct  63   EKDLFRVLKNALGDENLKAFITEKVVPIPGDISVDNLGVKGSDLLQHMWNEIDIIVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV L VNT GP +VLNFAKKC K ++LLHVSTAYV G K GL+ E  + MGE
Sbjct  123  TTNFDERYDVGLSVNTFGPLNVLNFAKKCVKGQLLLHVSTAYVRGEKSGLLHEKTFHMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   L I+ E  +M++ L++L + N S+E I+ +MKDLG+ RA+++GWPNTYVFTK+
Sbjct  183  TLNGHRKLVIETEMELMKQKLKELQKQNCSEEEISQSMKDLGMSRAKLHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG ++E+LP+VIIRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLLGNYRENLPIVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_003596783.1| Fatty acyl-CoA reductase [Medicago truncatula]
 gb|AES67034.1| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=492

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 238/302 (79%), Gaps = 3/302 (1%)
 Frame = -3

Query  899  AMELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFN  720
            A E+GS L FL+  TILV GA GFLAKIFLEK+LRVQPNVKKL+LLLRA+D ++A  R  
Sbjct  2    AQEVGSILNFLEGKTILVIGATGFLAKIFLEKVLRVQPNVKKLFLLLRASDDKSAASRLQ  61

Query  719  TEIIGKEIFQILKEKCGN---SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
             EI+ K++F +L EK G    S ISEK+TVV GD+++E+LG+KDS L   + S+ D ++N
Sbjct  62   NEILAKDLFNLLNEKMGTNFKSFISEKLTVVPGDITFEDLGLKDSILREDISSQTDVIIN  121

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            LAATT FDERYD+AL +NT G KH+++FAK+C +L++L+HVSTAYV G K GLI ESPY 
Sbjct  122  LAATTNFDERYDIALDLNTFGVKHIMSFAKQCIRLKVLVHVSTAYVCGEKSGLILESPYL  181

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            +G++LNG +GLDI+ EK+++ E L +L    A++  I  AMKDLGI RA +YGWPNTYVF
Sbjct  182  LGDSLNGVAGLDINAEKKLVTEKLGELQEKGATEHEIKVAMKDLGITRANVYGWPNTYVF  241

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKALGEM++ + K +L VVI+RP I+T T +EPFPGWVEG+RTIDSL + YGKGKLTCFL
Sbjct  242  TKALGEMLVEKLKGNLSVVILRPAIVTSTLREPFPGWVEGLRTIDSLAVVYGKGKLTCFL  301

Query  8    GD  3
            GD
Sbjct  302  GD  303



>ref|XP_003539173.1| PREDICTED: fatty acyl-CoA reductase 3-like [Glycine max]
 gb|KHN38646.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=493

 Score =   387 bits (993),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 182/301 (60%), Positives = 235/301 (78%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME GS + FL++  +LV GAAGFLAKIF+EKILRVQPNVKKLYLLLRA D E+A QR + 
Sbjct  1    MEFGSIIHFLEDKNVLVIGAAGFLAKIFVEKILRVQPNVKKLYLLLRATDAESASQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EII K++F++LKE  G   N+ +SEK+T+V GD+S E+  +KD  L   + S+   ++N 
Sbjct  61   EIIQKDLFRLLKENLGAKFNTFVSEKLTLVPGDISQEDFNLKDPILREEICSQTHCIINF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G KHVLNFAK C KL++L+HVSTAYV G + GLI E   ++
Sbjct  121  AATTNFDERYDVALGINTLGVKHVLNFAKSCIKLKVLVHVSTAYVCGERGGLIIEDSCQL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  GLDID EK+ +E+ L  L ++ A+++ I  AMKD G++RA +YGWPNTYVFT
Sbjct  181  GVSLNGVPGLDIDMEKKAVEDKLYQLQQEGATEDDIKMAMKDFGMKRATIYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++   KE++ VVI+RPT++T TY+EPFPGWVEG+RTIDSL + YGKGKLTCFL 
Sbjct  241  KAMGEMLIETLKENVSVVIVRPTMVTSTYREPFPGWVEGVRTIDSLIVAYGKGKLTCFLA  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_006591086.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Glycine 
max]
Length=443

 Score =   384 bits (987),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 234/301 (78%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS   FL N  ILV GA GFLAKIF+EK+LRVQPNVKKLYLLLRA D E+A QR + 
Sbjct  1    MELGSITDFLQNKNILVIGATGFLAKIFVEKVLRVQPNVKKLYLLLRATDAESASQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+ K++F++LKE  G   N+ +SEK+T+V GD+S E+L +KD  L   + +++  +VN 
Sbjct  61   EIMRKDLFRLLKENVGAKFNAFVSEKLTLVPGDISQEDLNLKDPILREEIYNQIHCIVNF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT G KHVLNFAK C KL++L+HVSTAYV G + GLI E P ++
Sbjct  121  AATTNFDERYDVALGINTFGVKHVLNFAKSCIKLKVLVHVSTAYVCGERGGLIVEDPCQL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  GLDI  EKRV+E+ +  L  + A++E +  AMKDLG++RA +YGWPNTYVFT
Sbjct  181  GVSLNGVPGLDIGMEKRVVEDKMNQLHEEGATEEDVKMAMKDLGMKRATLYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++   K+++ V+I+RPT+IT TYKEPFPGWVEG+RTIDS+ + YGKGKL CFL 
Sbjct  241  KAMGEMLVETLKKNMSVIIVRPTMITSTYKEPFPGWVEGVRTIDSVIVAYGKGKLPCFLL  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_003540238.1| PREDICTED: fatty acyl-CoA reductase 3-like [Glycine max]
 gb|KHN27658.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=490

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/301 (62%), Positives = 234/301 (78%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+GS L FL + TIL+ GA GFLAKIFLEKILRVQPNVKKL+LLLRA+D ++A  R   
Sbjct  1    MEVGSVLNFLQDRTILIVGATGFLAKIFLEKILRVQPNVKKLFLLLRASDAKSANYRLQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EII K++F +LKEK G    S ISEKVT+V GD+SYE+LG+ DS L   + ++ D +VNL
Sbjct  61   EIIAKDLFIVLKEKLGANFKSFISEKVTLVPGDISYEDLGLTDSILREEICNQTDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYD+ALG+N  G KHV+ FAK+C KL+ILLHVSTAYV G + GLI E PY  
Sbjct  121  AATTKFDERYDLALGLNIFGVKHVMKFAKQCAKLKILLHVSTAYVCGERGGLILEDPYHF  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G++LNG SGLDI+ E+ ++ + L +L    A++  I  AMK+LGI RA++YGWPNTYVFT
Sbjct  181  GDSLNGVSGLDIEAERTIVCDKLDELREQGATEREIEIAMKNLGISRAKVYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++ + K  L VVI+RPTI+T T +EPFPGW EG+RTIDSL + YGKGKL CFLG
Sbjct  241  KAVGEMLVEQLKGSLSVVIMRPTIVTSTLREPFPGWAEGVRTIDSLAVTYGKGKLKCFLG  300

Query  5    D  3
            +
Sbjct  301  N  301



>ref|XP_010514783.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X1 [Camelina 
sativa]
Length=493

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 235/299 (79%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL+N TILVTG  GFLAK+F+EKILR+QPNVKKL+LLLRAAD E+A+QRF +E++
Sbjct  3    SNCVQFLENKTILVTGVPGFLAKVFVEKILRIQPNVKKLFLLLRAADNESAMQRFRSEVL  62

Query  707  GKEIFQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++L+   G+    +++S+KV  + GD+S +NLGVKDS LL RM +E+D VVN+AA
Sbjct  63   EKDLFRVLRNNLGDENLKALVSDKVVPIPGDISVDNLGVKDSDLLKRMWNEIDIVVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV + +NT GP +VLNFAKKC K ++LLHVSTAYV G K GL+ E  + MGE
Sbjct  123  TTNFDERYDVGIRINTFGPLNVLNFAKKCVKGQLLLHVSTAYVCGEKSGLLQEKTFHMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   L I+ E  +M++ L++L + +  +E I   MKDLG+ RA+++GWPNTYVFTK+
Sbjct  183  TLNGHGNLVIETEMELMKQKLKELQKLDCPEEEIAQTMKDLGMSRAKLHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+L   KEDLPVVIIRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLLNNHKEDLPVVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_010503104.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X3 [Camelina 
sativa]
Length=433

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 234/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL+N TILVTG  GFLAK+F+EKILR+QPNVKKL+LLLRAAD E+A+QRF +E++
Sbjct  3    SNCVQFLENKTILVTGVPGFLAKVFVEKILRIQPNVKKLFLLLRAADNESAMQRFRSEVL  62

Query  707  GKEIFQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++L+ K G+    +++S+KV  + GD+S +NLGVKDS LL RM +E+D VVN+AA
Sbjct  63   EKDLFRVLRNKLGDGNLKALVSDKVIPIPGDISVDNLGVKDSDLLKRMWNEIDIVVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV + +NT GP +VLNFAKKC K ++LLHVSTAYV G K GL+ E  + MGE
Sbjct  123  TTNFDERYDVGIRINTFGPLNVLNFAKKCVKGQLLLHVSTAYVCGEKSGLLQEKTFHMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   L I+ E  +M++ L++L + +   E I   MKDLG+ RA+ +GWPNTYVFTK+
Sbjct  183  TLNGHGNLVIETEMELMKQKLKELQKLDCPVEEIAQTMKDLGMSRAKFHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+L   KEDLPVV+IRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLLNNHKEDLPVVVIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_003538130.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Glycine 
max]
Length=492

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 234/301 (78%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS   FL N  ILV GA GFLAKIF+EK+LRVQPNVKKLYLLLRA D E+A QR + 
Sbjct  1    MELGSITDFLQNKNILVIGATGFLAKIFVEKVLRVQPNVKKLYLLLRATDAESASQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+ K++F++LKE  G   N+ +SEK+T+V GD+S E+L +KD  L   + +++  +VN 
Sbjct  61   EIMRKDLFRLLKENVGAKFNAFVSEKLTLVPGDISQEDLNLKDPILREEIYNQIHCIVNF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT G KHVLNFAK C KL++L+HVSTAYV G + GLI E P ++
Sbjct  121  AATTNFDERYDVALGINTFGVKHVLNFAKSCIKLKVLVHVSTAYVCGERGGLIVEDPCQL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  GLDI  EKRV+E+ +  L  + A++E +  AMKDLG++RA +YGWPNTYVFT
Sbjct  181  GVSLNGVPGLDIGMEKRVVEDKMNQLHEEGATEEDVKMAMKDLGMKRATLYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++   K+++ V+I+RPT+IT TYKEPFPGWVEG+RTIDS+ + YGKGKL CFL 
Sbjct  241  KAMGEMLVETLKKNMSVIIVRPTMITSTYKEPFPGWVEGVRTIDSVIVAYGKGKLPCFLL  300

Query  5    D  3
            D
Sbjct  301  D  301



>gb|KHN38647.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=492

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 234/301 (78%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS   FL N  ILV GA GFLAKIF+EK+LRVQPNVKKLYLLLRA D E+A QR + 
Sbjct  1    MELGSITDFLQNKNILVIGATGFLAKIFVEKVLRVQPNVKKLYLLLRATDAESASQRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+ K++F++LKE  G   N+ +SEK+T+V GD+S E+L +KD  L   + +++  +VN 
Sbjct  61   EIMRKDLFRLLKENVGAKFNAFVSEKLTLVPGDISQEDLNLKDPILREEIYNQIHCIVNF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT G KHVLNFAK C KL++L+HVSTAYV G + GLI E P ++
Sbjct  121  AATTNFDERYDVALGINTFGVKHVLNFAKSCIKLKVLVHVSTAYVCGERGGLIVEDPCQL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  GLDI  EKRV+E+ +  L  + A++E +  AMKDLG++RA +YGWPNTYVFT
Sbjct  181  GVSLNGVPGLDIGMEKRVVEDKMNQLHEEGATEEDVKMAMKDLGMKRATLYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++   K+++ V+I+RPT+IT TYKEPFPGWVEG+RTIDS+ + YGKGKL CFL 
Sbjct  241  KAMGEMLVETLKKNMSVIIVRPTMITSTYKEPFPGWVEGVRTIDSVIVAYGKGKLPCFLL  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_010425873.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X2 [Camelina 
sativa]
Length=433

 Score =   382 bits (982),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 233/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL N TILVTG  GFLAK+F+EKILR+QPNVKKL+LLLRAAD E+A+QRF +E++
Sbjct  3    SNCVQFLQNKTILVTGVPGFLAKVFVEKILRIQPNVKKLFLLLRAADNESAMQRFRSEVL  62

Query  707  GKEIFQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K +F++L+   G+    +++S+KV  + GD+S +NLGVKDS LL RM +E+D VVN+AA
Sbjct  63   EKGLFRVLRNNLGDENLKALVSDKVVPIPGDISVDNLGVKDSDLLKRMWNEIDIVVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV L +NT GP +VLNFAKKC K ++LLHVSTAYV G K GL+ E  + MGE
Sbjct  123  TTNFDERYDVGLRINTFGPLNVLNFAKKCVKGQLLLHVSTAYVCGEKSGLLQEKTFHMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   L I+ E  +M++ L++L + +  +E I   MKDLG+ RA+++GWPNTYVFTK+
Sbjct  183  TLNGHGNLVIETEMELMKQKLKELQKLDCPEEEIAQTMKDLGMSRAKLHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+L   KEDLPVVIIRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLLNYHKEDLPVVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|NP_190040.3| fatty acyl-CoA reductase 4 [Arabidopsis thaliana]
 sp|Q9LXN3.1|FACR4_ARATH RecName: Full=Probable fatty acyl-CoA reductase 4 [Arabidopsis 
thaliana]
 emb|CAB88536.1| acyl CoA reductase-protein [Arabidopsis thaliana]
 gb|AEE77912.1| fatty acid reductase 4 [Arabidopsis thaliana]
Length=493

 Score =   384 bits (987),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 236/299 (79%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL + TILVTG  GFLAK+F+EKILR+QP VKKL+LLLRAAD E+A+QRF++E++
Sbjct  3    SNCIQFLHDKTILVTGVPGFLAKVFVEKILRIQPKVKKLFLLLRAADNESAMQRFHSEVL  62

Query  707  GKEIFQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++LK   G+    + I+EKV  + GD+S +NLGVK S LL  M +E+D +VN+AA
Sbjct  63   EKDLFRVLKNALGDENLKAFITEKVVPIPGDISVDNLGVKGSDLLQHMWNEIDIIVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV L VNT GP +VLNFAKKC K ++LLHVSTAYV G K GL+ E  + MGE
Sbjct  123  TTNFDERYDVGLSVNTFGPLNVLNFAKKCVKGQLLLHVSTAYVRGEKSGLLHEKTFHMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   L I+ E  +M++ L++L + N S+E I+ +MKDLG+ RA+++GWPNTYVFTK+
Sbjct  183  TLNGHRKLVIETEMELMKQKLKELQKQNCSEEEISQSMKDLGMSRAKLHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG ++E+LP+VIIRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLLGNYRENLPIVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>gb|KFK33883.1| hypothetical protein AALP_AA5G072700, partial [Arabis alpina]
Length=481

 Score =   384 bits (986),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 232/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             S +QFL N TILVTG  GFLAK+F+EKILRVQP VKKLYLL RAAD  +A+QRF+ E++
Sbjct  3    SSCVQFLQNKTILVTGVPGFLAKVFVEKILRVQPKVKKLYLLFRAADNVSAMQRFHNEVV  62

Query  707  GKEIFQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++L+   G+    +++SEKV  + GD+S +NLG+KDS LL  M +E+D VVN+AA
Sbjct  63   EKDLFRVLRNNLGDEKLKALVSEKVVPIPGDISVDNLGLKDSDLLQHMWNEIDIVVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV L +NT GP +VLNFAKKC K ++LLHVSTAYV G K GL+ E  + MGE
Sbjct  123  TTNFDERYDVGLSINTFGPLNVLNFAKKCVKGQLLLHVSTAYVCGEKSGLLEEKTFNMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   LDI  E  +M++ L++L + + S+E I  +MKDLG+ RA+++GWPNTYVFTK+
Sbjct  183  TLNGHGKLDIQAEVDLMKQKLKELQKQDCSEEEIAQSMKDLGMSRAKLHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG  KE+ P+VIIRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLLGNHKENFPLVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_006387900.1| hypothetical protein POPTR_0490s00210g, partial [Populus trichocarpa]
 gb|ERP46814.1| hypothetical protein POPTR_0490s00210g, partial [Populus trichocarpa]
Length=280

 Score =   375 bits (963),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/280 (63%), Positives = 224/280 (80%), Gaps = 3/280 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS LQFL+N TILVTGA G+LAKIF+EKILRVQPNVK+ YLLLRAAD ++A +R   
Sbjct  1    MELGSILQFLENKTILVTGATGYLAKIFVEKILRVQPNVKRFYLLLRAADAKSATERLRD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGK++F++L+EK G   +S ISEKVT V GD+SYE+LGVKDS L   M  E+D V+N 
Sbjct  61   EVIGKDLFRVLREKHGASLHSFISEKVTPVPGDISYEDLGVKDSSLKDEMWREIDVVLNF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+G  HVLNFAKKC K+++L+HVSTAYV G   GLI E PY M
Sbjct  121  AATTNFDERYDVALGINTLGALHVLNFAKKCVKIKMLVHVSTAYVCGEDAGLILEQPYHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G A  G   +DI+ EK++++E + +L   +  ++ ITSAMKD GI+RAR++GWPNTYVFT
Sbjct  181  GMAKRGDEKIDINFEKKMVQEKINELKLQDVPEKEITSAMKDFGIERARLFGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGI  66
            KA+GEM+L  FK+ LP++IIRPT++  TYKEPFPGW+EG+
Sbjct  241  KAMGEMLLVNFKDSLPLLIIRPTMVASTYKEPFPGWIEGV  280



>ref|XP_010503102.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X1 [Camelina 
sativa]
Length=493

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 234/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL+N TILVTG  GFLAK+F+EKILR+QPNVKKL+LLLRAAD E+A+QRF +E++
Sbjct  3    SNCVQFLENKTILVTGVPGFLAKVFVEKILRIQPNVKKLFLLLRAADNESAMQRFRSEVL  62

Query  707  GKEIFQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++L+ K G+    +++S+KV  + GD+S +NLGVKDS LL RM +E+D VVN+AA
Sbjct  63   EKDLFRVLRNKLGDGNLKALVSDKVIPIPGDISVDNLGVKDSDLLKRMWNEIDIVVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV + +NT GP +VLNFAKKC K ++LLHVSTAYV G K GL+ E  + MGE
Sbjct  123  TTNFDERYDVGIRINTFGPLNVLNFAKKCVKGQLLLHVSTAYVCGEKSGLLQEKTFHMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   L I+ E  +M++ L++L + +   E I   MKDLG+ RA+ +GWPNTYVFTK+
Sbjct  183  TLNGHGNLVIETEMELMKQKLKELQKLDCPVEEIAQTMKDLGMSRAKFHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+L   KEDLPVV+IRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLLNNHKEDLPVVVIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_010503103.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X2 [Camelina 
sativa]
Length=493

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 234/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL+N TILVTG  GFLAK+F+EKILR+QPNVKKL+LLLRAAD E+A+QRF +E++
Sbjct  3    SNCVQFLENKTILVTGVPGFLAKVFVEKILRIQPNVKKLFLLLRAADNESAMQRFRSEVL  62

Query  707  GKEIFQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++L+ K G+    +++S+KV  + GD+S +NLGVKDS LL RM +E+D VVN+AA
Sbjct  63   EKDLFRVLRNKLGDGNLKALVSDKVIPIPGDISVDNLGVKDSDLLKRMWNEIDIVVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV + +NT GP +VLNFAKKC K ++LLHVSTAYV G K GL+ E  + MGE
Sbjct  123  TTNFDERYDVGIRINTFGPLNVLNFAKKCVKGQLLLHVSTAYVCGEKSGLLQEKTFHMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   L I+ E  +M++ L++L + +   E I   MKDLG+ RA+ +GWPNTYVFTK+
Sbjct  183  TLNGHGNLVIETEMELMKQKLKELQKLDCPVEEIAQTMKDLGMSRAKFHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+L   KEDLPVV+IRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLLNNHKEDLPVVVIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>emb|CAB80096.1| male sterility 2-like protein [Arabidopsis thaliana]
Length=480

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 238/301 (79%), Gaps = 12/301 (4%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME+ S L++LDN +ILV G+           ILRV PNVKKLYLLLRA+  ++A QRFN 
Sbjct  1    MEVVSVLKYLDNKSILVVGSCW---------ILRVAPNVKKLYLLLRASKGKSATQRFND  51

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+ K++F++LKEK G   N + SEK+T+V GD+  E+LG++D  L   M+ +VDA+VNL
Sbjct  52   EILKKDLFKVLKEKYGPNLNQLTSEKITIVDGDICLEDLGLQDFDLAHEMIHQVDAIVNL  111

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT+G  +VLNFAK+C K++IL+HVSTAYV G K GLI E+PY+M
Sbjct  112  AATTKFDERYDVALGINTLGALNVLNFAKRCAKVKILVHVSTAYVCGEKSGLIMETPYRM  171

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDI+ EK++++E L  L    A+ E+IT  MKDLG++RA+MYGWPNTYVFT
Sbjct  172  GETLNGTTGLDINYEKKLVQEKLDQLRVIGAAPETITETMKDLGLRRAKMYGWPNTYVFT  231

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  +E+L +V++RP+IIT T+KEPFPGW EGIRTIDSL +GYGKGKLTCFL 
Sbjct  232  KAMGEMMVGTKRENLSLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGKLTCFLC  291

Query  5    D  3
            D
Sbjct  292  D  292



>gb|KDP34802.1| hypothetical protein JCGZ_10582 [Jatropha curcas]
Length=394

 Score =   378 bits (971),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 178/301 (59%), Positives = 235/301 (78%), Gaps = 10/301 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL    QFL+  T+LVTGA GFLAK+FLEK+LRVQPNVKKLYLLLRAADT +  QRF  
Sbjct  1    MELEKITQFLERKTVLVTGATGFLAKVFLEKLLRVQPNVKKLYLLLRAADTSSVNQRFYN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGK++F+++KEK G   NS+I++K+ +V GDVSYE+LG KDS L   M++++D ++N 
Sbjct  61   EVIGKDLFRVVKEKLGANLNSIIAKKIAIVPGDVSYEDLGAKDSSLREEMINDLDFILNF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT+FDERYDVALG NT+G K+VL FAK C           AYV G   GLI E PY++
Sbjct  121  AATTRFDERYDVALGTNTLGAKNVLCFAKNCLNF-------AAYVCGESSGLIMEKPYQL  173

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GEALNG  GL+I EEK++++  L  L R+ A++ +I  AM D+GI+RA+ YGWPNTYVFT
Sbjct  174  GEALNGVLGLNIVEEKKLIDRKLNQLQREGATEANIKKAMIDMGIERAKTYGWPNTYVFT  233

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G  KE+LP+VI+RPT++T T++EPFPGW+EG+RTID+L +GYG GK++ F+G
Sbjct  234  KAMGEMIVGHSKENLPIVIVRPTMVTSTWREPFPGWIEGVRTIDALIVGYGSGKISFFVG  293

Query  5    D  3
            D
Sbjct  294  D  294



>gb|KGN46944.1| hypothetical protein Csa_6G151810 [Cucumis sativus]
Length=499

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 244/307 (79%), Gaps = 16/307 (5%)
 Frame = -3

Query  878  LQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKE  699
            ++FL+N +IL+TGA GFLAKI +EKILRVQPNVKKLYLLLRA D   A +RF+ E++ K 
Sbjct  1    MEFLENKSILITGATGFLAKILVEKILRVQPNVKKLYLLLRADDEITAKKRFHNEVVEKA  60

Query  698  IFQILKEKCG---NSVISEKVTVVAGDVSYENLGVK-DSHLLTRMLSEVDAVVNLAATTK  531
            +FQ+LK+K G   N++ISEK+ +V G++S   +G+K DS  + ++ S+V+ ++NLAATT 
Sbjct  61   LFQVLKKKHGANLNTLISEKICLVPGEISLPQMGLKHDSIWIDKLKSQVEIIINLAATTN  120

Query  530  FDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALN  351
            FDERYDVALG N +G KHV+NFAK+C  L++++HVSTAYVSG +EGLI E+PYKMGE+LN
Sbjct  121  FDERYDVALGTNALGAKHVINFAKQCSNLKLVVHVSTAYVSGEREGLIMETPYKMGESLN  180

Query  350  GKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGE  171
               GLDI+ E+ V+E+ L+ L  D A+ E+IT AMKDLG++R+++YGWPNTYVFTKA+GE
Sbjct  181  WFKGLDIEVEQMVIEDKLKQLKEDGATNETITLAMKDLGLERSKLYGWPNTYVFTKAMGE  240

Query  170  MVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGI------------RTIDSLGLGYGKG  27
            M++G+ K+++P+++IRPTI+T TYKEPFPGW+EG+            RTIDSL +GY KG
Sbjct  241  MIIGDLKDEVPLIVIRPTIVTSTYKEPFPGWIEGVRIWGQTLCINLCRTIDSLIVGYAKG  300

Query  26   KLTCFLG  6
            KLTCF+ 
Sbjct  301  KLTCFVA  307



>ref|XP_010425872.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X1 [Camelina 
sativa]
Length=496

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 233/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL N TILVTG  GFLAK+F+EKILR+QPNVKKL+LLLRAAD E+A+QRF +E++
Sbjct  3    SNCVQFLQNKTILVTGVPGFLAKVFVEKILRIQPNVKKLFLLLRAADNESAMQRFRSEVL  62

Query  707  GKEIFQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K +F++L+   G+    +++S+KV  + GD+S +NLGVKDS LL RM +E+D VVN+AA
Sbjct  63   EKGLFRVLRNNLGDENLKALVSDKVVPIPGDISVDNLGVKDSDLLKRMWNEIDIVVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV L +NT GP +VLNFAKKC K ++LLHVSTAYV G K GL+ E  + MGE
Sbjct  123  TTNFDERYDVGLRINTFGPLNVLNFAKKCVKGQLLLHVSTAYVCGEKSGLLQEKTFHMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   L I+ E  +M++ L++L + +  +E I   MKDLG+ RA+++GWPNTYVFTK+
Sbjct  183  TLNGHGNLVIETEMELMKQKLKELQKLDCPEEEIAQTMKDLGMSRAKLHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+L   KEDLPVVIIRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLLNYHKEDLPVVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_010535677.1| PREDICTED: fatty acyl-CoA reductase 1-like [Tarenaya hassleriana]
Length=487

 Score =   380 bits (977),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 179/298 (60%), Positives = 230/298 (77%), Gaps = 4/298 (1%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + +QFL N TILVTGA+GFLAK+F+EKILRVQPNVKKLYLL+RA D EAA+QR  +E+I 
Sbjct  4    NCVQFLHNKTILVTGASGFLAKVFVEKILRVQPNVKKLYLLVRAPDKEAAMQRLRSEVIE  63

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++L+   G    N ++SEKV  V GD+S ++LGV DS L  RM  ++D VVN+AAT
Sbjct  64   KDLFKVLRNDLGVENLNKLVSEKVVPVPGDISVDDLGVGDSDLKQRMRKDIDVVVNVAAT  123

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYDV LG+NT G  +VLNFAK C   ++LLHVSTAYV G K GL+ E P+ MGE 
Sbjct  124  TNFDERYDVGLGINTFGALNVLNFAKSCVNPQLLLHVSTAYVCGEKSGLLMEKPFAMGET  183

Query  356  LNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKAL  177
            LNG   LDI  E  VM + L++L     S+E IT+++KDLG++RA+++GWPNTYVFTKA+
Sbjct  184  LNGNDKLDISTEMEVMRQKLKELRNQECSEEEITNSLKDLGMKRAKLHGWPNTYVFTKAM  243

Query  176  GEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            GEM+LG  +E +P+VIIRPT+IT T  EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  244  GEMLLGSHRESMPLVIIRPTMITSTLSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_008458693.1| PREDICTED: LOW QUALITY PROTEIN: fatty acyl-CoA reductase 3-like 
[Cucumis melo]
Length=520

 Score =   382 bits (980),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 243/325 (75%), Gaps = 31/325 (10%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEI-  711
            G A++FL+N +I VTGA GFLAKI +EKILR+QPNVKKLYLL+RA D   A +RF  EI 
Sbjct  5    GIAMEFLENKSIFVTGATGFLAKILVEKILRIQPNVKKLYLLIRAKDKMTATKRFYNEIQ  64

Query  710  -IGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLG-VKDSHLLTRMLSEVDAVVNL  546
             IGK++F++LK+  G   +++ISEKV VV G+VS   +G + DS+L+  M ++V+ +VNL
Sbjct  65   EIGKDLFKVLKKMWGGEFDTLISEKVCVVPGEVSLTQMGLIDDSNLVEEMKNQVEIIVNL  124

Query  545  AATTKFDERY-------------------------DVALGVNTMGPKHVLNFAKKCPKLR  441
            AATTKFDERY                         DVAL  NT+G KHV++FAK+CP L+
Sbjct  125  AATTKFDERYKQNTEYFVPFVSSLKSIVHFFFTRYDVALATNTLGAKHVISFAKQCPNLK  184

Query  440  ILLHVSTAYVSGIKEGLIAESPYKMGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQES  261
            +L+HVSTAYVSG +EG I E+PYK+GE+LNG  GLDI  E++V EE  + L  + A +E+
Sbjct  185  LLVHVSTAYVSGEREGHILETPYKLGESLNGMEGLDIATEQKVAEEKFKQLQENGAMEET  244

Query  260  ITSAMKDLGIQRARMYGWPNTYVFTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPG  81
            I  A+KDLG++RARMYGWPNTYVFTKA+GEMV+ + K +LP++IIRPTI+T TYKEPFPG
Sbjct  245  INLALKDLGLERARMYGWPNTYVFTKAMGEMVVSDPKNNLPLIIIRPTIVTSTYKEPFPG  304

Query  80   WVEGIRTIDSLGLGYGKGKLTCFLG  6
            W+EG+RTIDSL LGY KGKLTCFLG
Sbjct  305  WIEGVRTIDSLILGYAKGKLTCFLG  329



>sp|Q9XGY7.1|FAR_SIMCH RecName: Full=Alcohol-forming fatty acyl-CoA reductase [Simmondsia 
chinensis]
 gb|AAD38039.1|AF149917_1 acyl CoA reductase [Simmondsia chinensis]
 gb|AAD38040.1|AF149918_1 acyl CoA reductase [synthetic construct]
 gb|AFI74369.1| acyl-CoA reductase [synthetic construct]
Length=493

 Score =   379 bits (974),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 185/298 (62%), Positives = 232/298 (78%), Gaps = 3/298 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E+GS L+FLDN  ILVTGA G LAKIF+EK+LR QPNVKKLYLLLRA D E A  R   E
Sbjct  3    EMGSILEFLDNKAILVTGATGSLAKIFVEKVLRSQPNVKKLYLLLRATDDETAALRLQNE  62

Query  713  IIGKEIFQILKEKCGN---SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            + GKE+F++LK+  G    S +SEKVTVV GD++ E+L +KD +L   M  E+D VVNLA
Sbjct  63   VFGKELFKVLKQNLGANFYSFVSEKVTVVPGDITGEDLCLKDVNLKEEMWREIDVVVNLA  122

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            AT  F ERYDV+L +NT G K+VL+FAKKC KL+I +HVSTAYVSG K GLI E PY MG
Sbjct  123  ATINFIERYDVSLLINTYGAKYVLDFAKKCNKLKIFVHVSTAYVSGEKNGLILEKPYYMG  182

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E+LNG+ GLDI+ EK+++E  + +L    A+++SI S MKD+GI+RAR +GWPN YVFTK
Sbjct  183  ESLNGRLGLDINVEKKLVEAKINELQAAGATEKSIKSTMKDMGIERARHWGWPNVYVFTK  242

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            ALGEM+L ++K D+P+ IIRPTIIT T+KEPFPGWVEG+RTID++ + YGKG+L C L
Sbjct  243  ALGEMLLMQYKGDIPLTIIRPTIITSTFKEPFPGWVEGVRTIDNVPVYYGKGRLRCML  300



>ref|XP_006419124.1| hypothetical protein EUTSA_v10002499mg [Eutrema salsugineum]
 gb|ESQ37560.1| hypothetical protein EUTSA_v10002499mg [Eutrema salsugineum]
Length=493

 Score =   379 bits (973),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 232/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + + FL N TILVTG  GFLAK+FLEKILRVQP VKKLYLLLR+ + E+A+QRF TE++
Sbjct  3    SNCVHFLQNKTILVTGIPGFLAKVFLEKILRVQPKVKKLYLLLRSVNNESAMQRFRTEVL  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++L+   G    N ++ EKV  + GD+S +NLG+KDS+LL  M +E+D VVN+AA
Sbjct  63   EKDLFRVLRNDIGDASLNDLVMEKVVPIPGDISIDNLGLKDSNLLEHMWNEIDIVVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYD+ L +NT GP +VLNFAKKC K ++LLHVSTAYV G K GL+ E  ++MGE
Sbjct  123  TTNFDERYDIGLSINTFGPLNVLNFAKKCVKAQLLLHVSTAYVCGEKSGLLQEKTFRMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   L ID E  +M++ L++L + + S+E I   MKDLG+ RA+++GWPNTYVFTK+
Sbjct  183  TLNGNGKLVIDTELELMKQKLKELQKQDCSEEEIAETMKDLGMSRAKLHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG  +E+LP+VIIRPT+IT T+ EPFPGW+EG+RTIDS+ + +GKG+L CFL D
Sbjct  243  MGEMLLGYHRENLPLVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAFGKGRLKCFLAD  301



>ref|XP_004171145.1| PREDICTED: fatty acyl-CoA reductase 3-like, partial [Cucumis 
sativus]
Length=400

 Score =   375 bits (963),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 240/296 (81%), Gaps = 4/296 (1%)
 Frame = -3

Query  893  ELGS-ALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            E GS A+ FL+N TIL+TG+ GFLAKI LEKILR+QPNVKKLYLLLRA D   A+QRF  
Sbjct  3    ECGSTAIGFLENKTILITGSTGFLAKILLEKILRIQPNVKKLYLLLRATDETTAMQRFCN  62

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GK++F++LKEK G   +S ISEKV+VV+ D+S  ++G+KDS L+  +   V  ++NL
Sbjct  63   EVMGKDLFKVLKEKWGANLDSFISEKVSVVSSDISVSDMGLKDSILVEEIKHNVQIIINL  122

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT F+ERYDVALG NT+G KHV++FAK+CP  ++L+HVSTAY+SG KEG I E+P+K+
Sbjct  123  AATTNFNERYDVALGTNTLGAKHVVDFAKQCPNFKLLVHVSTAYISGEKEGFILETPHKL  182

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE+LNG  GL+I+ E++++E+ L+ L  + AS++ +T AMKDLGIQRA  YGWPNTYVFT
Sbjct  183  GESLNGTEGLNIEIEQKIIEQRLKQLKDNGASEKDVTIAMKDLGIQRANQYGWPNTYVFT  242

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLT  18
            KA+GEM++ + K +LP++IIRPTIIT TYKEPF GW+EG RTIDSL +GY KGKLT
Sbjct  243  KAMGEMLINDLKHNLPLIIIRPTIITSTYKEPFSGWIEGTRTIDSLIVGYAKGKLT  298



>emb|CDY48435.1| BnaA08g11440D [Brassica napus]
Length=480

 Score =   378 bits (970),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 181/301 (60%), Positives = 238/301 (79%), Gaps = 16/301 (5%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  S LQ+LDN +ILV GAAGFLA IF+EKILRV PNVKKLYLLLRA++ ++A QRF  
Sbjct  5    MEAVSVLQYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASNEKSATQRFKD  64

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GK++++++KEK G     + SEKVTVV GD+   +LG++DS L   M+ +VDA++NL
Sbjct  65   EILGKDLYKVVKEKYGPNLTQLTSEKVTVVNGDICLADLGIQDS-LAHEMIHQVDAIINL  123

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT+GP +VL+FAKKC   +I +HVSTAYVSG K GLI E+PY+M
Sbjct  124  AATTKFDERYDVALGINTLGPLNVLDFAKKCENAKIFVHVSTAYVSGEKSGLIMETPYRM  183

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDI+ E++++++   ++  +  +            I RA+MYGWPNTYVFT
Sbjct  184  GETLNGTTGLDINHERKLVQDVYGEMIINLHN------------IYRAKMYGWPNTYVFT  231

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++GE ++++ +V+IRP+IIT T+KEPFPGW EGIRTIDSL +GYGKG+LTCFLG
Sbjct  232  KAMGEMMVGEKRDNISLVLIRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGRLTCFLG  291

Query  5    D  3
            D
Sbjct  292  D  292



>gb|KFK39898.1| hypothetical protein AALP_AA3G303100 [Arabis alpina]
Length=495

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/300 (57%), Positives = 238/300 (79%), Gaps = 5/300 (2%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL+N TI VTGA GFLAK+ +EKILR+QPNVKK+YLLLRA D E+A+QR  +E++
Sbjct  3    SNCVQFLENKTIFVTGAPGFLAKVLVEKILRLQPNVKKMYLLLRAPDNESAMQRLRSEVL  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
              ++F++L++  G    N+++ EK+  VAGD+S +N+GVKD+ LL RM SE+D ++N+AA
Sbjct  63   EIDLFKVLRKNLGEENLNALVREKIVPVAGDISVKNMGVKDTDLLQRMWSEIDIIINIAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GL+ E P+KMGE
Sbjct  123  TTNFDERYDIGLGINTFGVLNVLNFAKKCVKGQLLLHVSTAYVCGEKSGLLLEKPFKMGE  182

Query  359  ALNG-KSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
             L+  K  LDID E+ +M++ L++L   + S+E I+ +MKD+G+ RA+++GWPNTYVFTK
Sbjct  183  TLSEIKKVLDIDAERELMKQKLKELEHQDCSEEEISQSMKDIGMARAKVHGWPNTYVFTK  242

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM++G ++E+ P++IIRPT+IT T  EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  AMGEMLMGHYRENFPLIIIRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  302



>emb|CAB88537.1| acyl CoA reductase-like protein [Arabidopsis thaliana]
Length=402

 Score =   374 bits (960),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 236/303 (78%), Gaps = 6/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL + +QFL N TILVTGA GFLAK+F+EKILRVQPNVKKLYLL+RA+D EAA +R  T
Sbjct  1    MEL-NCVQFLRNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLLVRASDNEAATKRLRT  59

Query  716  EIIGKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
            E+  KE+F++L++  G    N+++ EKV  V GD++ + LG+ DSHL  RM  E+D VVN
Sbjct  60   EVFEKELFKVLRQNLGDEKLNTLLYEKVVSVPGDIATDQLGINDSHLRERMQKEIDIVVN  119

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            +AATT FDERYDV LG+NT G  +VLNFAKKC K+++LLHVSTAYV G K GLI E P+ 
Sbjct  120  VAATTNFDERYDVGLGINTFGALNVLNFAKKCVKVQLLLHVSTAYVCGEKPGLIPEKPFI  179

Query  368  MGEALNGKS-GLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
            M E  N     LDI+ E+ +M++ L++L   + S+E IT +MK+LG++RA+++GWPNTYV
Sbjct  180  MEEIRNENGLQLDINLERELMKQRLKELNEQDCSEEDITLSMKELGMERAKLHGWPNTYV  239

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTK++GEM+LG+ KE+LP+VIIRPT+IT T  EPFPGW+EG+RT+DS+ + YGKG L CF
Sbjct  240  FTKSMGEMLLGKHKENLPLVIIRPTMITSTLSEPFPGWIEGLRTVDSVIIAYGKGVLKCF  299

Query  11   LGD  3
            L D
Sbjct  300  LVD  302



>emb|CDY09144.1| BnaA02g05700D [Brassica napus]
Length=492

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/299 (58%), Positives = 234/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL N TIL+TGA GFLAK+ +EKILR+QPNVKK+YLLLRAADT+AA+QR  +E++
Sbjct  3    SNCVQFLGNKTILITGAPGFLAKVLVEKILRLQPNVKKMYLLLRAADTKAAMQRLRSEVV  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
               +F++L+   G    N ++ EK+  V GD+S  NLGVKDS LL RM SE+D V+N+AA
Sbjct  63   EINLFKVLRNDLGEENLNDMVREKIVPVPGDISIHNLGVKDSDLLQRMWSEIDIVINIAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYV G   GL  E P+ MG+
Sbjct  123  TTNFDERYDIGLGINTFGALNVLNFAKKCVKGQLLLHVSTAYVCGENSGLFLEKPFTMGQ  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             L+G + LDI+ E  +M++ L++L   + S++ I+ +MKDLG+ RA+++GWPNTYVFTKA
Sbjct  183  TLSGDTKLDINVEFELMKQKLKELQHQDFSEQEISQSMKDLGMARAKVHGWPNTYVFTKA  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM++G+++E+LP+VI+RPT+IT T  EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLVGKYRENLPLVIVRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_009126546.1| PREDICTED: fatty acyl-CoA reductase 1-like [Brassica rapa]
Length=492

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/299 (58%), Positives = 234/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL N TIL+TGA GFLAK+ +EKILR+QPNVKK+YLLLRAADT+AA+QR  +E++
Sbjct  3    SNCVQFLGNKTILITGAPGFLAKVLVEKILRLQPNVKKMYLLLRAADTKAAMQRLRSEVV  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
               +F++L+   G    N ++ EK+  V GD+S  NLGVKDS LL RM SE+D V+N+AA
Sbjct  63   EINLFKVLRNDLGEENLNDLVREKIVPVPGDISIHNLGVKDSDLLQRMWSEIDIVINIAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYV G   GL  E P+ MG+
Sbjct  123  TTNFDERYDIGLGINTFGALNVLNFAKKCVKGQLLLHVSTAYVCGENSGLFLEKPFTMGQ  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             L+G + LDI+ E  +M++ L++L   + S++ I+ +MKDLG+ RA+++GWPNTYVFTKA
Sbjct  183  TLSGDTKLDINVEFELMKQKLKELQHQDFSEQEISQSMKDLGMARAKVHGWPNTYVFTKA  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM++G+++E+LP+VI+RPT+IT T  EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLVGKYRENLPLVIVRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_006400757.1| hypothetical protein EUTSA_v10013355mg [Eutrema salsugineum]
 gb|ESQ42210.1| hypothetical protein EUTSA_v10013355mg [Eutrema salsugineum]
Length=493

 Score =   377 bits (967),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 237/299 (79%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL + TIL+TGA GFLAK+ +EKILR+QPNVKK+YLLLRA D +AA+QR  +E++
Sbjct  3    SNCVQFLADKTILITGAPGFLAKVLVEKILRLQPNVKKMYLLLRAPDNKAAMQRLRSEVV  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
              ++F++L+   G    N+++ EK+  + GD+S  NLG+KDS LL RM SE+D ++N+AA
Sbjct  63   EIDLFRVLRNDLGEENLNALVREKIVPIPGDISVHNLGLKDSDLLQRMWSEIDIIINIAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GL+ E P++MGE
Sbjct  123  TTNFDERYDIGLGINTFGALNVLNFAKKCVKGQLLLHVSTAYVCGEKSGLLQEKPFEMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             L+G + LDI+ E  +M++ L++L   + S++ I+ +MKDLG+ RA+++GWPNTYVFTKA
Sbjct  183  TLSGNTKLDINVEFELMKQKLKELEHQDCSEKEISQSMKDLGMTRAKLHGWPNTYVFTKA  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM++G+++E+LP+VI+RPT+IT T  EPFPGW+EG+RTIDS+ + YGKGKL CFL D
Sbjct  243  MGEMLMGKYRENLPLVILRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGKLKCFLAD  301



>emb|CAA20592.1| male sterility 2-like protein [Arabidopsis thaliana]
Length=463

 Score =   375 bits (962),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 176/275 (64%), Positives = 227/275 (83%), Gaps = 3/275 (1%)
 Frame = -3

Query  818  IFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKEIFQILKEKCG---NSVISEK  648
            +F+EKILRV PNVKKLYLLLRA+  ++A QRFN EI+ K++F++LKEK G   N + SEK
Sbjct  1    VFVEKILRVAPNVKKLYLLLRASKGKSATQRFNDEILKKDLFKVLKEKYGPNLNQLTSEK  60

Query  647  VTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKFDERYDVALGVNTMGPKHVLN  468
            +T+V GD+  E+LG++D  L   M+ +VDA+VNLAATTKFDERYDVALG+NT+G  +VLN
Sbjct  61   ITIVDGDICLEDLGLQDFDLAHEMIHQVDAIVNLAATTKFDERYDVALGINTLGALNVLN  120

Query  467  FAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNGKSGLDIDEEKRVMEEALRDL  288
            FAK+C K++IL+HVSTAYV G K GLI E+PY+MGE LNG +GLDI+ EK++++E L  L
Sbjct  121  FAKRCAKVKILVHVSTAYVCGEKSGLIMETPYRMGETLNGTTGLDINYEKKLVQEKLDQL  180

Query  287  TRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGEMVLGEFKEDLPVVIIRPTIIT  108
                A+ E+IT  MKDLG++RA+MYGWPNTYVFTKA+GEM++G  +E+L +V++RP+IIT
Sbjct  181  RVIGAAPETITETMKDLGLRRAKMYGWPNTYVFTKAMGEMMVGTKRENLSLVLLRPSIIT  240

Query  107  GTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
             T+KEPFPGW EGIRTIDSL +GYGKGKLTCFL D
Sbjct  241  STFKEPFPGWTEGIRTIDSLAVGYGKGKLTCFLCD  275



>ref|XP_004145802.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cucumis sativus]
 gb|KGN46945.1| hypothetical protein Csa_6G152310 [Cucumis sativus]
Length=493

 Score =   376 bits (965),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 184/296 (62%), Positives = 240/296 (81%), Gaps = 4/296 (1%)
 Frame = -3

Query  893  ELGS-ALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            E GS A+ FL+N TIL+TGA GFLAKI LEKILR+QPNVKKLYLLLRA D   A+QRF  
Sbjct  3    ECGSTAIGFLENKTILITGATGFLAKILLEKILRIQPNVKKLYLLLRATDETTAMQRFCN  62

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GK++F++LKEK G   +S ISEKV+VV+ D+S  ++G+KDS L+  +   V  ++NL
Sbjct  63   EVMGKDLFKVLKEKWGANLDSFISEKVSVVSSDISVSDMGLKDSILVEEIKHNVQIIINL  122

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT F+ERYDVALG NT+G KHV++FAK+CP  ++L+HVSTAY+SG KEG I E+P+K+
Sbjct  123  AATTNFNERYDVALGTNTLGAKHVVDFAKQCPNFKLLVHVSTAYISGEKEGFILETPHKL  182

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE+LNG  GL+I+ E++++E+ L+ L  + AS++ +T AMKDLGIQRA  YGWPNTYVFT
Sbjct  183  GESLNGTEGLNIEIEQKIIEQRLKQLKDNGASEKDVTIAMKDLGIQRANQYGWPNTYVFT  242

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLT  18
            KA+GEM++ + K +LP++IIRPTIIT TYKEPF GW+EG RTIDSL +GY KGKLT
Sbjct  243  KAMGEMLINDLKHNLPLIIIRPTIITSTYKEPFSGWIEGTRTIDSLIVGYAKGKLT  298



>ref|XP_008458595.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Cucumis 
melo]
Length=401

 Score =   372 bits (955),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/300 (59%), Positives = 241/300 (80%), Gaps = 3/300 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E G+A+ FL+N TIL+TG+ GFLAKI LEKILR+QPNVKKLYLLLRA D   A+QRF  E
Sbjct  3    ESGNAIGFLENKTILITGSTGFLAKILLEKILRIQPNVKKLYLLLRATDETTAMQRFCNE  62

Query  713  IIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            ++GK++F++LK+K G   +  ISEKV+VV+ D+S  ++G++DS L+  +   V  ++NLA
Sbjct  63   VMGKDLFKVLKKKWGANLDRFISEKVSVVSSDISVSDMGLEDSTLVEEIKHNVQIIINLA  122

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            ATTKF+ERYDVALG NT+G KHV+NFAK+CP  ++L+HVSTAY+SG KEG I E+P+K+G
Sbjct  123  ATTKFNERYDVALGTNTLGAKHVVNFAKQCPNFKLLVHVSTAYISGEKEGFILETPHKLG  182

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E+LNG  GL+I+ E++++E+ L+ L  + AS++ +T AMKDLGIQRA  +GWPNTYVFTK
Sbjct  183  ESLNGTEGLNIEIEQKIIEQRLKQLKANGASEKDVTIAMKDLGIQRANQHGWPNTYVFTK  242

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM++ + K +LP++IIRPTI+T TYKEPF GW+EG+RTID+  +GY KGKLT    D
Sbjct  243  AMGEMLINDLKHNLPLIIIRPTIVTSTYKEPFSGWIEGMRTIDNFIVGYAKGKLTFIPCD  302



>ref|XP_006279365.1| hypothetical protein CARUB_v10007993mg [Capsella rubella]
 gb|EOA12263.1| hypothetical protein CARUB_v10007993mg [Capsella rubella]
Length=493

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 233/298 (78%), Gaps = 4/298 (1%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + +QFL + TILVTG  GFLAK+F+EKILR+QP VKKL+LLLRAAD E+A+QRF+ E++ 
Sbjct  4    NCVQFLQDKTILVTGVPGFLAKVFVEKILRIQPKVKKLFLLLRAADNESAMQRFHNEVLE  63

Query  704  KEIFQILKEKCGNS----VISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++L+   G++    ++SEKV  + GD+S +NLGVKDS LL  M +E+D +VN+AAT
Sbjct  64   KDLFRVLRNNLGDANLKALVSEKVVPIPGDISVDNLGVKDSDLLQLMWNEIDIIVNVAAT  123

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYDV L +NT GP +VLNFAKKC K ++LLHVSTAY+ G + GL+ E  + MGE 
Sbjct  124  TNFDERYDVGLRINTFGPLNVLNFAKKCVKGQLLLHVSTAYICGEQSGLLQEKTFNMGET  183

Query  356  LNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKAL  177
            LNG   L I+ E  +M++ +++L + +  +E I   MKDLG+ RA+++GWPNTYVFTK++
Sbjct  184  LNGHGKLVIETEMEIMKQKMKELHKQDCPEEEIAQTMKDLGMSRAKLHGWPNTYVFTKSM  243

Query  176  GEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            GEM+LG  +E+LPVVIIRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  244  GEMLLGNQRENLPVVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_010943712.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Elaeis guineensis]
Length=490

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 235/301 (78%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME G  L+ L +  +LVTG  GFLAKIF+EK+LRVQPNVKKL+LL+RA DT +A+ R  T
Sbjct  1    MEAGGILERLKDKNLLVTGCTGFLAKIFVEKVLRVQPNVKKLFLLVRAIDTTSAMHRVQT  60

Query  716  EIIGKEIFQILKEKCGN---SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGKE+F+ILKE  GN   S I+EK+  VAGD+ +ENLG++DS L+  +  ++D VVN+
Sbjct  61   EVIGKELFKILKEGHGNGFQSFIAEKLFPVAGDIIHENLGIRDSDLIEELRKKIDIVVNV  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVAL +N +G KHVL FAKKC KL +LLHVS+A+V+G+KEGLI E+ ++M
Sbjct  121  AATTAFDERYDVALDINVIGAKHVLEFAKKCVKLEMLLHVSSAFVAGMKEGLILETAFRM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE L   S LDI+ E  ++EE  R+L  + + ++  T+AMK++G++RAR +GWPNTYV+T
Sbjct  181  GETLKENSYLDIEAELMLVEEKKRELRANRSVEDDETTAMKEMGMKRARFFGWPNTYVYT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KALGEM+LG  + DLP+VI+RPTIIT  YKEP PGW+EG RTID L +GY KGKL+CF G
Sbjct  241  KALGEMLLGHLRGDLPLVILRPTIITSIYKEPLPGWIEGSRTIDILIIGYAKGKLSCFFG  300

Query  5    D  3
            +
Sbjct  301  E  301



>emb|CDY26934.1| BnaC09g36490D [Brassica napus]
Length=493

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 170/299 (57%), Positives = 234/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL + TIL+TGA GFLAK+ +EKILR+QPNVKK+YLLLRA+D +AA+QR  +E++
Sbjct  3    SNCVQFLGDKTILITGAPGFLAKVLVEKILRLQPNVKKMYLLLRASDDKAAMQRLRSEVV  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
              ++F++L++  G    N ++ EK+  V GD+S  NLG+KD  LL RM SE+D ++N+AA
Sbjct  63   EIDLFRVLRKDLGEENLNELVHEKIVPVPGDISVHNLGLKDPDLLQRMWSEIDIIINIAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYV G  +GL  E P+KMGE
Sbjct  123  TTNFDERYDIGLGINTFGALNVLNFAKKCVKRQLLLHVSTAYVCGENKGLFLEKPFKMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
            +L+G   LDI+ E  +M++ L++L   N ++E I+ +MKDLG+ RA+++GWPNTYVFTKA
Sbjct  183  SLSGDKKLDINVEFELMKQKLKELEHQNCTEEEISQSMKDLGMTRAKLHGWPNTYVFTKA  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM++G  +E+LP+VIIRPT+IT T  EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLIGSSRENLPLVIIRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_010493337.1| PREDICTED: fatty acyl-CoA reductase 1 [Camelina sativa]
Length=491

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 172/298 (58%), Positives = 235/298 (79%), Gaps = 6/298 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + +QFL N TIL+TGA GFLAK+ +EKILR+QPNVKK+YLLLRA DT++A+QR  +E++ 
Sbjct  4    NCVQFLGNKTILITGAPGFLAKVLIEKILRLQPNVKKMYLLLRAGDTKSAMQRLRSEVLE  63

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
             ++F++L+   G    N+++ +K+  V GD+S +NLGVKDS L+ RM SE+D ++N+AAT
Sbjct  64   IDLFRVLRNDLGEEKLNALVRDKIVPVPGDISIDNLGVKDSDLIQRMWSEIDTIINIAAT  123

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYVSG K GL+ E P+KMGE 
Sbjct  124  TNFDERYDIGLGINTFGALNVLNFAKKCVKGQLLLHVSTAYVSGEKPGLLPEKPFKMGET  183

Query  356  LNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKAL  177
            L+G   LDI+ E  +M++ L++L   + S+E I+  MKD G+ RAR++GWPNTYVFTKA+
Sbjct  184  LSGNGKLDINIEHDLMKQKLKEL--QDCSEEEISQTMKDFGMARARLHGWPNTYVFTKAM  241

Query  176  GEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            GEM++G +KE LP+VIIRPT+IT T  EPFPGW+EG++T+DS+ + YGKG+L CFL D
Sbjct  242  GEMLMGYYKETLPLVIIRPTMITSTIAEPFPGWIEGLKTLDSVIVAYGKGRLKCFLAD  299



>ref|XP_008458594.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Cucumis 
melo]
Length=442

 Score =   372 bits (955),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 240/295 (81%), Gaps = 3/295 (1%)
 Frame = -3

Query  893  ELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTE  714
            E G+A+ FL+N TIL+TG+ GFLAKI LEKILR+QPNVKKLYLLLRA D   A+QRF  E
Sbjct  3    ESGNAIGFLENKTILITGSTGFLAKILLEKILRIQPNVKKLYLLLRATDETTAMQRFCNE  62

Query  713  IIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
            ++GK++F++LK+K G   +  ISEKV+VV+ D+S  ++G++DS L+  +   V  ++NLA
Sbjct  63   VMGKDLFKVLKKKWGANLDRFISEKVSVVSSDISVSDMGLEDSTLVEEIKHNVQIIINLA  122

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            ATTKF+ERYDVALG NT+G KHV+NFAK+CP  ++L+HVSTAY+SG KEG I E+P+K+G
Sbjct  123  ATTKFNERYDVALGTNTLGAKHVVNFAKQCPNFKLLVHVSTAYISGEKEGFILETPHKLG  182

Query  362  EALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            E+LNG  GL+I+ E++++E+ L+ L  + AS++ +T AMKDLGIQRA  +GWPNTYVFTK
Sbjct  183  ESLNGTEGLNIEIEQKIIEQRLKQLKANGASEKDVTIAMKDLGIQRANQHGWPNTYVFTK  242

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLT  18
            A+GEM++ + K +LP++IIRPTI+T TYKEPF GW+EG+RTID+  +GY KGKLT
Sbjct  243  AMGEMLINDLKHNLPLIIIRPTIVTSTYKEPFSGWIEGMRTIDNFIVGYAKGKLT  297



>ref|XP_010687363.1| PREDICTED: fatty acyl-CoA reductase 3-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score =   374 bits (959),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 180/301 (60%), Positives = 228/301 (76%), Gaps = 4/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            M+ GS  +FL N TI VTGA GF+AKI LEKILR+QPNVKK+YLL+RA D + A  R   
Sbjct  1    MDFGSITEFLRNKTIFVTGATGFIAKILLEKILRIQPNVKKMYLLIRAKDAKVANVRLRD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++ KE+F +L++KCG    S ISEK+T VAGD SY NLG+ D  L   M +++D ++++
Sbjct  61   EVLSKELFDVLRKKCGANFESFISEKITPVAGDASYGNLGLTDDEL-NAMYNDIDIIISV  119

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALGVNT+G KHV+NFAKKC K+++L+HVSTAYV G K GLI+E PY M
Sbjct  120  AATTKFDERYDVALGVNTLGAKHVVNFAKKCTKIQLLIHVSTAYVCGEKAGLISEKPYAM  179

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG  GLDID EK +  + L +L      ++ I   MK+LG QRA++YGWPNTYVFT
Sbjct  180  GETLNGVGGLDIDSEKMLAAQFLCNLKAQGLPEKEIRQRMKNLGNQRAKLYGWPNTYVFT  239

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G+ + +LPVVI+RPTI+  T KEPFPGWVEG RTIDS+ + YGKG L+ F  
Sbjct  240  KAMGEMLVGQQRGNLPVVIMRPTIVCSTLKEPFPGWVEGCRTIDSVAVMYGKGSLSLFPA  299

Query  5    D  3
            D
Sbjct  300  D  300



>ref|XP_006287458.1| hypothetical protein CARUB_v10000664mg [Capsella rubella]
 gb|EOA20356.1| hypothetical protein CARUB_v10000664mg [Capsella rubella]
Length=536

 Score =   375 bits (962),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 240/303 (79%), Gaps = 7/303 (2%)
 Frame = -3

Query  899  AMELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFN  720
            +ME  + +QFL+N TIL+TGA GFLAK+ +EKILR+QPNVKK+YLLLRA DT++A+QR +
Sbjct  44   SME-SNCVQFLENKTILITGAPGFLAKVLVEKILRLQPNVKKMYLLLRAHDTKSAMQRIH  102

Query  719  TEIIGKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVV  552
            +E++  ++F++L+   G    N+++ EK+  V GD+S +NLGVKDS L+ RM SE+D ++
Sbjct  103  SEVLEIDLFRVLRNDLGEENLNALVREKIVPVPGDISIDNLGVKDSDLIQRMWSEIDTII  162

Query  551  NLAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPY  372
            N+AATT FDERYDV LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K+GL+ E P+
Sbjct  163  NIAATTNFDERYDVGLGINTFGALNVLNFAKKCVKGQLLLHVSTAYVCGEKQGLLPEKPF  222

Query  371  KMGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
            KMGE L+G   LDI+ E  +M++ L++L   + S E I+  MKD G+ RA+++GWPNTYV
Sbjct  223  KMGETLSGDRKLDINLELELMKQKLKEL--QDCSDEEISQTMKDFGMGRAKLHGWPNTYV  280

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GEM++G +KE+LP+VIIRPT+IT T  EPFPGW+EG++T+DS+ + YGKG+L CF
Sbjct  281  FTKAMGEMLMGYYKENLPLVIIRPTMITSTIAEPFPGWIEGLKTLDSVIVAYGKGRLKCF  340

Query  11   LGD  3
            L D
Sbjct  341  LAD  343



>emb|CDY65611.1| BnaCnng47950D [Brassica napus]
Length=490

 Score =   373 bits (958),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 170/299 (57%), Positives = 239/299 (80%), Gaps = 5/299 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            S +QFL+N T+LVTGA+GFLAK+F+E++LR+QP V++LYLL+RA+D +AA QR ++E+  
Sbjct  4    SCVQFLENKTVLVTGASGFLAKVFVERVLRLQPKVRRLYLLVRASDNKAAKQRLHSEVFE  63

Query  704  KEIFQILK----EKCGNSVISEKVTVVAGDVSYENLGV-KDSHLLTRMLSEVDAVVNLAA  540
            K++F++L+    ++C N++ISEKV  + GD+S  N+GV +DS+LL  M+ E+D +VN AA
Sbjct  64   KDLFRVLRKNVGDECLNALISEKVVPIPGDISLNNMGVIRDSNLLQDMMQEIDIIVNSAA  123

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT+FDERYDVALG+NT GP ++LNFAKKC K ++LLHVSTAYV G + GLI E P+ MGE
Sbjct  124  TTRFDERYDVALGINTFGPLNILNFAKKCAKPQLLLHVSTAYVCGERSGLILEKPFAMGE  183

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
            +LNGK+ +DID E  ++E+ L+ L +   S+E    AMKDLG++RA++YGWPNTYVFTKA
Sbjct  184  SLNGKNKVDIDAEMLLVEQKLKQLKKLGYSEEETKQAMKDLGLKRAKLYGWPNTYVFTKA  243

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM++G  ++ +P+VIIRPTIIT T+ +PFPGW+E I+TIDS+ + + KG L CFL D
Sbjct  244  MGEMLIGYCRKSMPIVIIRPTIITSTFSDPFPGWIESIKTIDSVIVSFRKGLLKCFLVD  302



>gb|KDO44391.1| hypothetical protein CISIN_1g0083151mg, partial [Citrus sinensis]
Length=392

 Score =   370 bits (949),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 235/301 (78%), Gaps = 9/301 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS ++FL+N  ILV+G  GF+AK+F+EKILRVQPNVKKLYLL+RAADTE+A  RF  
Sbjct  1    MELGSVVEFLENKIILVSGVTGFVAKVFIEKILRVQPNVKKLYLLIRAADTESAALRFQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++ K++F +LKEK G   NS ISEK+T VAGD+S E+LG+KDS+L   + +E+D +VN 
Sbjct  61   EVLAKDLFNVLKEKWGTRLNSFISEKITFVAGDISSEDLGLKDSNLKEELWNELDVMVNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA TKFDERYDVA G+NT+G  H++NFAKKC KL++ +HVSTAYV+G + GLI E+P   
Sbjct  121  AAITKFDERYDVAFGINTLGAIHLVNFAKKCVKLKVFVHVSTAYVAGERTGLILENP---  177

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
               L+G SGLD D E +V+++ L +L    A Q+ IT  MK+LG +RA+++GWPNTYVFT
Sbjct  178  ---LDGASGLDFDAEMKVIDQKLNELKTKGAPQKEITLFMKNLGTERAKIHGWPNTYVFT  234

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K +GEM++ + KE+L +VIIRPTI++GTYKEPFPGWVE ++TI++L +   +G L C +G
Sbjct  235  KTMGEMIMQQSKENLSLVIIRPTIVSGTYKEPFPGWVEDLKTINALFVASAQGNLPCLVG  294

Query  5    D  3
            +
Sbjct  295  E  295



>ref|NP_190041.2| fatty acyl-CoA reductase 5 [Arabidopsis thaliana]
 sp|Q0WRB0.1|FACR5_ARATH RecName: Full=Probable fatty acyl-CoA reductase 5 [Arabidopsis 
thaliana]
 dbj|BAF00339.1| acyl CoA reductase -like protein [Arabidopsis thaliana]
 gb|AEE77914.1| fatty acyl-CoA reductase 5 [Arabidopsis thaliana]
Length=496

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 236/303 (78%), Gaps = 6/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL + +QFL N TILVTGA GFLAK+F+EKILRVQPNVKKLYLL+RA+D EAA +R  T
Sbjct  1    MEL-NCVQFLRNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLLVRASDNEAATKRLRT  59

Query  716  EIIGKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
            E+  KE+F++L++  G    N+++ EKV  V GD++ + LG+ DSHL  RM  E+D VVN
Sbjct  60   EVFEKELFKVLRQNLGDEKLNTLLYEKVVSVPGDIATDQLGINDSHLRERMQKEIDIVVN  119

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            +AATT FDERYDV LG+NT G  +VLNFAKKC K+++LLHVSTAYV G K GLI E P+ 
Sbjct  120  VAATTNFDERYDVGLGINTFGALNVLNFAKKCVKVQLLLHVSTAYVCGEKPGLIPEKPFI  179

Query  368  MGEALNGKS-GLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
            M E  N     LDI+ E+ +M++ L++L   + S+E IT +MK+LG++RA+++GWPNTYV
Sbjct  180  MEEIRNENGLQLDINLERELMKQRLKELNEQDCSEEDITLSMKELGMERAKLHGWPNTYV  239

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTK++GEM+LG+ KE+LP+VIIRPT+IT T  EPFPGW+EG+RT+DS+ + YGKG L CF
Sbjct  240  FTKSMGEMLLGKHKENLPLVIIRPTMITSTLSEPFPGWIEGLRTVDSVIIAYGKGVLKCF  299

Query  11   LGD  3
            L D
Sbjct  300  LVD  302



>ref|XP_010454514.1| PREDICTED: fatty acyl-CoA reductase 1-like [Camelina sativa]
Length=491

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 234/298 (79%), Gaps = 6/298 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + +QFL N TIL+TGA GFLAK+ +EKILR+QPNVKK+YLLLRA DT++A+QR  +E++ 
Sbjct  4    NCVQFLANKTILITGAPGFLAKVLVEKILRLQPNVKKMYLLLRARDTKSAMQRLRSEVLE  63

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
             ++F++L+   G    N+++ +K+  V GD+S +NLGVKDS L+ RM  E+D ++N+AAT
Sbjct  64   IDLFRVLRNNLGEEKLNALVRDKIVPVPGDISIDNLGVKDSDLIQRMWREIDTIINIAAT  123

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYVSG K GL+ E P+KMGE 
Sbjct  124  TNFDERYDIGLGINTFGALNVLNFAKKCVKGQLLLHVSTAYVSGEKSGLLPEKPFKMGET  183

Query  356  LNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKAL  177
            L+G   LDI+ E  +M++ L++L   + S+E I+  MKD G+ RAR++GWPNTYVFTKA+
Sbjct  184  LSGNGKLDINIEHDLMKQKLKEL--QDCSEEEISQTMKDFGMARARLHGWPNTYVFTKAM  241

Query  176  GEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            GEM++G +KE LP+VIIRPT+IT T  EPFPGW+EG++T+DS+ + YGKG+L CFL D
Sbjct  242  GEMLMGYYKETLPLVIIRPTMITSTIAEPFPGWIEGLKTLDSVIVAYGKGRLKCFLAD  299



>emb|CDY35688.1| BnaC02g09540D [Brassica napus]
Length=492

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 231/299 (77%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL N TIL+TGA GFLAK+ +EKILR+QPNVKK+YLLLRAADT+AA+QR  +E++
Sbjct  3    SNCVQFLGNKTILITGAPGFLAKVLVEKILRLQPNVKKIYLLLRAADTKAAMQRLRSEVV  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
              ++F++L+   G    N ++ E +  V GD+S  NLGVKDS LL RM SE+D +VN+AA
Sbjct  63   EIDLFKVLRNDLGEENLNDLVRENIVPVPGDISIHNLGVKDSDLLQRMWSEIDIIVNIAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYD+ LG+NT G  +VL FAKKC   ++LLHVSTAYV     GL  E P+ MG+
Sbjct  123  TTNFDERYDIGLGINTFGALNVLKFAKKCVNGQLLLHVSTAYVCRENSGLFLEKPFTMGQ  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             L+G + LDI+ E  +M++ L++L   + S++ I+ +MKDLG+ RA+++GWPNTYVFTKA
Sbjct  183  TLSGDTKLDINVEFELMKQKLKELQHQDCSEQEISQSMKDLGMTRAKLHGWPNTYVFTKA  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM++G+++EDLP+VI+RPT+IT T  EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLMGKYREDLPLVIVRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_008801227.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Phoenix dactylifera]
Length=490

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 233/301 (77%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME G   + L +  ILVTG+ GFLAKIF+EK+LRVQPNVKKL+LL+RA D  +A++R  T
Sbjct  1    MEAGGIPECLKDKNILVTGSTGFLAKIFVEKVLRVQPNVKKLFLLVRAVDNTSAMRRVQT  60

Query  716  EIIGKEIFQILKEKCGN---SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGKE+F+ILKE  GN   S I+EK+  +AGD+ +ENLG++DS L+  +  ++D VVN+
Sbjct  61   EVIGKELFKILKESHGNGFHSFIAEKLFPIAGDIIHENLGIRDSDLIEELWKKIDIVVNV  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVAL VN  G KHVL FAKKC KL +LLHVS+A+VSG+KEGLI E P+ M
Sbjct  121  AATTNFDERYDVALDVNVFGAKHVLEFAKKCVKLEMLLHVSSAFVSGMKEGLILEKPFHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+ L   S LDI+ E +++EE  R L  + + +++  +A+K++G++RA  +GWPNTYV+T
Sbjct  181  GQTLKENSYLDIEAELQLVEEKKRKLHANKSMEDAEDTALKEMGMKRAEFFGWPNTYVYT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG  + DLP+VI+RPT+IT  YKEP PGW+EG RTIDSL +GY KGKL+CF G
Sbjct  241  KAMGEMLLGHLRGDLPLVILRPTMITSIYKEPLPGWIEGTRTIDSLIIGYAKGKLSCFFG  300

Query  5    D  3
            +
Sbjct  301  E  301



>ref|XP_009150272.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Brassica rapa]
Length=493

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/297 (57%), Positives = 231/297 (78%), Gaps = 4/297 (1%)
 Frame = -3

Query  881  ALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGK  702
             +QF  N TILVTG  GFLAK+FLEKILRVQP+VK+LYLLLR++D E+A++RF TE++ K
Sbjct  5    CVQFFQNKTILVTGVPGFLAKVFLEKILRVQPDVKRLYLLLRSSDNESAMERFRTEVLEK  64

Query  701  EIFQILKEKCGNS----VISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATT  534
            ++F++L+   G++    ++ +KV  + GD+S  NLGVKDS LL  M +E++ +VN+AATT
Sbjct  65   DLFRVLRNDLGDANLKNLVLKKVAPIPGDISVVNLGVKDSDLLQHMWNEIEIIVNVAATT  124

Query  533  KFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEAL  354
             FDERYDV L +NT GP +VLNFAKKC K ++LLHVSTAYV G K G++ E  +KMGE L
Sbjct  125  NFDERYDVGLSINTFGPLNVLNFAKKCVKGQLLLHVSTAYVCGEKPGILPEKTFKMGETL  184

Query  353  NGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALG  174
            N    L I+ E  +M++ L++L +   S+E I  +MKDLG+ RA+++GWPNTYVFTK++G
Sbjct  185  NSNGKLVIETEMELMKQKLKELQKQECSEEEIAQSMKDLGMSRAKLHGWPNTYVFTKSMG  244

Query  173  EMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            EM+LG  +E+LP+VIIRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  245  EMLLGNHRENLPLVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_006419123.1| hypothetical protein EUTSA_v10002495mg [Eutrema salsugineum]
 gb|ESQ37559.1| hypothetical protein EUTSA_v10002495mg [Eutrema salsugineum]
Length=457

 Score =   370 bits (950),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 232/301 (77%), Gaps = 7/301 (2%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL N TILVTGA GFLAK+F+EKILRVQPNVKKLYL++RA+D EAA +R  TE+ 
Sbjct  3    SNCVQFLQNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLVVRASDNEAATKRLRTEVF  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++L+E  G    N+++SEK+  VAGD+S +NL VKDS L  RM  E+D VVN+AA
Sbjct  63   EKDLFKVLRENLGEVNLNALLSEKIVPVAGDISTDNLDVKDSSLRERMQKEIDVVVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GL+ E P+ M E
Sbjct  123  TTNFDERYDVGLGINTFGALNVLNFAKKCVKAQLLLHVSTAYVCGEKPGLLREKPFSMEE  182

Query  359  ALNGKSGL--DIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
              N K+GL  DI  E  +M++ L++L     S+E I+ +MK+LG++RA+++GWPNTYVFT
Sbjct  183  IRN-KNGLHLDIKIEMELMKQRLKELHEQECSEEDISLSMKELGMERAKLHGWPNTYVFT  241

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K++GEM+LG  KEDLP+VIIRPT+IT T  EPF GW+EG+RT+DS+ + YGKG L CFL 
Sbjct  242  KSMGEMLLGNHKEDLPLVIIRPTMITSTIYEPFSGWIEGLRTVDSVIIAYGKGALKCFLA  301

Query  5    D  3
            D
Sbjct  302  D  302



>ref|XP_002875673.1| oxidoreductase, acting on the CH-CH group of donors [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH51932.1| oxidoreductase, acting on the CH-CH group of donors [Arabidopsis 
lyrata subsp. lyrata]
Length=485

 Score =   371 bits (952),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 232/299 (78%), Gaps = 5/299 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + + FL N TILVTGA GFLAK+F+EKILRVQPNV KLYL++RA+DT+AA +R  TE   
Sbjct  4    NCVHFLQNKTILVTGATGFLAKVFVEKILRVQPNVNKLYLVVRASDTDAATKRLRTEAFE  63

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++L+E  G    N+++SEKV  VAGD++ ++LG+KDS L  RM  E+D VVN+AAT
Sbjct  64   KDLFKVLRESLGDENFNTLLSEKVVPVAGDIAMDHLGMKDSKLRERMQKEIDIVVNVAAT  123

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYDV LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GL+ E P+ M E 
Sbjct  124  TNFDERYDVGLGINTFGALNVLNFAKKCVKAQLLLHVSTAYVCGEKPGLLPEKPFVMEEI  183

Query  356  LNGKS-GLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             N     LDI  E+ +M++ L++L   + S+E IT AMK+LG++RA+++GWPNTYVFTK+
Sbjct  184  RNENDFQLDIHRERELMKQRLKELNEQDCSEEDITRAMKELGMERAKLHGWPNTYVFTKS  243

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG +KE+LP+VIIRPT+IT T  EPFPGW+EG+RT+DS+ + YGKG L CFL D
Sbjct  244  MGEMLLGNYKENLPLVIIRPTMITSTLSEPFPGWIEGLRTVDSVIIAYGKGVLKCFLVD  302



>ref|XP_009131879.1| PREDICTED: putative fatty acyl-CoA reductase 7 isoform X2 [Brassica 
rapa]
 emb|CDX88797.1| BnaA03g08520D [Brassica napus]
Length=490

 Score =   371 bits (952),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 236/299 (79%), Gaps = 5/299 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            S +QFL+N T+LVTGA+GFLAK+F+E++LR+QP V++LYLL+RA+D +AA QR ++E+  
Sbjct  4    SCVQFLENKTVLVTGASGFLAKVFVERVLRLQPKVRRLYLLVRASDNKAAKQRLHSEVFE  63

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGV-KDSHLLTRMLSEVDAVVNLAA  540
            K++F++L++  G    N++ISEKV  + GD+S   +GV +DS+ L  M+ E+D +VN AA
Sbjct  64   KDLFRVLRKNVGDERLNALISEKVVPIPGDISLNIMGVIRDSNFLQDMMQEIDIIVNSAA  123

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT+FDERYDVALG+NT GP ++LNFAKKC K ++LLHVSTAYV G + GLI E P+ MGE
Sbjct  124  TTRFDERYDVALGINTFGPLNILNFAKKCAKPQLLLHVSTAYVCGERSGLILEKPFAMGE  183

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNGK+ +DID E  ++E+ L+ L +   S+E    AMKDLG++RA++YGWPNTYVFTKA
Sbjct  184  TLNGKNKVDIDAEMLLVEQKLKQLKKLGYSEEETKQAMKDLGLKRAKLYGWPNTYVFTKA  243

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG  +E +P+VIIRPTIIT T+ +PFPGW+EGI+TIDS+ + + KG L CFL D
Sbjct  244  MGEMLLGYCRESMPIVIIRPTIITSTFSDPFPGWIEGIKTIDSVIVSFRKGLLKCFLVD  302



>ref|XP_010255716.1| PREDICTED: fatty acyl-CoA reductase 3-like [Nelumbo nucifera]
Length=493

 Score =   371 bits (952),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 168/289 (58%), Positives = 233/289 (81%), Gaps = 3/289 (1%)
 Frame = -3

Query  869  LDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKEIFQ  690
            L+N +ILVTG+ GFLAK+F+EK+LR+QPNVK+L+LLLR AD ++A +R + E++GKE+F+
Sbjct  11   LENKSILVTGSTGFLAKMFVEKVLRIQPNVKRLFLLLRVADAKSAQERLSNEVVGKELFR  70

Query  689  ILKEK---CGNSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKFDER  519
            +L++K   C +S IS+KVT VAGDV++ENLG+ DS+LL  +  EVD +V+ AATTKFDER
Sbjct  71   VLRQKHGECMDSFISDKVTPVAGDVTWENLGISDSNLLEEIWGEVDFIVHSAATTKFDER  130

Query  518  YDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNGKSG  339
            YD AL +N +G KHVL+FAK C KL+ L+HVSTAY +G K G+I E P+KMGE LNGK  
Sbjct  131  YDTALNINVLGAKHVLDFAKGCVKLQTLIHVSTAYAAGEKPGIILEKPFKMGETLNGKLS  190

Query  338  LDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGEMVLG  159
            LDI +E +++E+ L+DL    A+++    AMK LG+QRAR++GWPNTYVFTKA+GEM+LG
Sbjct  191  LDIMKELKIVEQGLQDLWAKRATKDEEKLAMKQLGLQRARLHGWPNTYVFTKAMGEMLLG  250

Query  158  EFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            + +E++P+VI+RPTI+T TY+EPFPGW+EG RT+D++   Y K K+T +
Sbjct  251  QMRENVPLVIMRPTIVTSTYREPFPGWIEGFRTVDAMMTAYAKAKMTFW  299



>ref|XP_009131878.1| PREDICTED: putative fatty acyl-CoA reductase 7 isoform X1 [Brassica 
rapa]
Length=497

 Score =   371 bits (952),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 236/299 (79%), Gaps = 5/299 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            S +QFL+N T+LVTGA+GFLAK+F+E++LR+QP V++LYLL+RA+D +AA QR ++E+  
Sbjct  4    SCVQFLENKTVLVTGASGFLAKVFVERVLRLQPKVRRLYLLVRASDNKAAKQRLHSEVFE  63

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGV-KDSHLLTRMLSEVDAVVNLAA  540
            K++F++L++  G    N++ISEKV  + GD+S   +GV +DS+ L  M+ E+D +VN AA
Sbjct  64   KDLFRVLRKNVGDERLNALISEKVVPIPGDISLNIMGVIRDSNFLQDMMQEIDIIVNSAA  123

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT+FDERYDVALG+NT GP ++LNFAKKC K ++LLHVSTAYV G + GLI E P+ MGE
Sbjct  124  TTRFDERYDVALGINTFGPLNILNFAKKCAKPQLLLHVSTAYVCGERSGLILEKPFAMGE  183

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNGK+ +DID E  ++E+ L+ L +   S+E    AMKDLG++RA++YGWPNTYVFTKA
Sbjct  184  TLNGKNKVDIDAEMLLVEQKLKQLKKLGYSEEETKQAMKDLGLKRAKLYGWPNTYVFTKA  243

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG  +E +P+VIIRPTIIT T+ +PFPGW+EGI+TIDS+ + + KG L CFL D
Sbjct  244  MGEMLLGYCRESMPIVIIRPTIITSTFSDPFPGWIEGIKTIDSVIVSFRKGLLKCFLVD  302



>ref|XP_011005176.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X4 [Populus euphratica]
Length=433

 Score =   368 bits (945),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 232/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS  +FL+N +ILV GAAGFLAKIF+EKILRVQP VKKLYLLLRA DT++A +R + 
Sbjct  1    MELGSITEFLNNKSILVIGAAGFLAKIFVEKILRVQPKVKKLYLLLRAVDTKSAEERLHN  60

Query  716  EIIGKEIFQILKEKCGNSVIS---EKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IG  +F +L+E+ G S+ S   EK+T V GD+S  +LG++DS L  ++ +E+D V+N 
Sbjct  61   EVIGMALFDVLREQHGASLYSFVYEKLTPVPGDISCVDLGIRDSLLKDQIWNEIDTVINF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+GP H+LNF KKC  +++L+HVSTAYV G   GLI E P+ +
Sbjct  121  AATTNFDERYDVALGINTLGPLHLLNFVKKCNNVKVLVHVSTAYVCGEDAGLIQEKPFPL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G++  G   +DID EK ++EE L +L  ++A + +ITS MKD G +RARM+GWPNTYVFT
Sbjct  181  GKSKKGTEMIDIDMEKILVEEKLTNLHSEHAEESAITSYMKDYGSKRARMFGWPNTYVFT  240

Query  185  KALGEMVLGEFKED-LPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            KA+GEM+L  +  D +P+VIIRPT++T TY+EPFPGW+EG+RTID + +GY KGKL  F
Sbjct  241  KAMGEMLLVHYSRDTVPLVIIRPTMVTSTYQEPFPGWIEGVRTIDGVAVGYAKGKLKHF  299



>ref|XP_011005175.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X3 [Populus euphratica]
Length=445

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 232/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS  +FL+N +ILV GAAGFLAKIF+EKILRVQP VKKLYLLLRA DT++A +R + 
Sbjct  1    MELGSITEFLNNKSILVIGAAGFLAKIFVEKILRVQPKVKKLYLLLRAVDTKSAEERLHN  60

Query  716  EIIGKEIFQILKEKCGNSVIS---EKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IG  +F +L+E+ G S+ S   EK+T V GD+S  +LG++DS L  ++ +E+D V+N 
Sbjct  61   EVIGMALFDVLREQHGASLYSFVYEKLTPVPGDISCVDLGIRDSLLKDQIWNEIDTVINF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+GP H+LNF KKC  +++L+HVSTAYV G   GLI E P+ +
Sbjct  121  AATTNFDERYDVALGINTLGPLHLLNFVKKCNNVKVLVHVSTAYVCGEDAGLIQEKPFPL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G++  G   +DID EK ++EE L +L  ++A + +ITS MKD G +RARM+GWPNTYVFT
Sbjct  181  GKSKKGTEMIDIDMEKILVEEKLTNLHSEHAEESAITSYMKDYGSKRARMFGWPNTYVFT  240

Query  185  KALGEMVLGEFKED-LPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            KA+GEM+L  +  D +P+VIIRPT++T TY+EPFPGW+EG+RTID + +GY KGKL  F
Sbjct  241  KAMGEMLLVHYSRDTVPLVIIRPTMVTSTYQEPFPGWIEGVRTIDGVAVGYAKGKLKHF  299



>gb|KFK39899.1| hypothetical protein AALP_AA3G303200 [Arabis alpina]
Length=495

 Score =   370 bits (950),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/300 (57%), Positives = 234/300 (78%), Gaps = 5/300 (2%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL N TI +TG+ GFLAK+ +EKILR+QPNVKK+YLLLRA D ++A+QR  +E++
Sbjct  3    SNCVQFLGNKTIFITGSPGFLAKVLVEKILRLQPNVKKIYLLLRAPDNQSAMQRLRSEVL  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
              ++F++L++  G    N+++ EK+T V GD+S ENLGVKD+ LL RM SE+D ++N+AA
Sbjct  63   EIDLFKVLRKDLGEENLNALVWEKITTVPGDISVENLGVKDTGLLQRMWSEIDIIINIAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYD+ L +NT G  +VLNFAKKC + ++LLHVSTAYV G K GL+ E P KMGE
Sbjct  123  TTNFDERYDIGLSINTFGVLNVLNFAKKCVRGQLLLHVSTAYVCGEKSGLLLEKPLKMGE  182

Query  359  ALNGKSG-LDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
             L  K   LDI+ E  +M++ L++L   + S+E I+ +MKDLG+ RA+++GWPNTYVFTK
Sbjct  183  TLREKRKVLDINAELELMKQKLKELEHQDCSEEEISQSMKDLGMARAKLHGWPNTYVFTK  242

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            A+GEM++G ++E+LP+VIIRPT+IT T  EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  AMGEMLMGNYRENLPLVIIRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  302



>emb|CDY21232.1| BnaC03g53920D [Brassica napus]
Length=492

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/296 (57%), Positives = 229/296 (77%), Gaps = 3/296 (1%)
 Frame = -3

Query  881  ALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGK  702
             +QF  N TILVTG  GFLAK+FLEKILRVQP+VK+LYLLLR+ D E+A++RF TE++ K
Sbjct  5    CVQFFQNKTILVTGVPGFLAKVFLEKILRVQPDVKRLYLLLRSTDNESAMERFRTEVLEK  64

Query  701  EIFQILKEKCGNS---VISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTK  531
            ++F++L+   G++   ++ +KV  + GD+S  NLG+KDS LL  M +E++ +VN+AATT 
Sbjct  65   DLFRVLRNDLGDANLKIVLKKVVPIPGDISVVNLGLKDSDLLQHMWNEIEIIVNVAATTN  124

Query  530  FDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALN  351
            FDERYDV L +NT GP +VLNFAKKC K ++LLHVSTAYV G K G++ E  +KMGE LN
Sbjct  125  FDERYDVGLSINTFGPLNVLNFAKKCVKGQLLLHVSTAYVCGEKPGILPEKTFKMGETLN  184

Query  350  GKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGE  171
                L I+ E  +M++ L++L +   S+E I  +MKDLG+ RA ++GWPNTYVFTK++GE
Sbjct  185  SNGKLVIETEMELMKQKLKELQKQECSEEEIAQSMKDLGMSRATLHGWPNTYVFTKSMGE  244

Query  170  MVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            M+LG  +E+LP+VIIRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  245  MLLGNHRENLPLVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  300



>gb|EYU36959.1| hypothetical protein MIMGU_mgv1a0177801mg, partial [Erythranthe 
guttata]
Length=467

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/270 (66%), Positives = 218/270 (81%), Gaps = 12/270 (4%)
 Frame = -3

Query  776  KLYLLLRAADTEAALQRFNTEIIGKEIFQILKEKCG-------NSVISEKVTVVAGDVSY  618
            KLYLLLRA+DT +A+ RFNTEIIGK++F++LKEK G       NS ISEK+ VVAGD++ 
Sbjct  1    KLYLLLRASDTNSAMLRFNTEIIGKDLFRVLKEKYGGDNNYYFNSFISEKIRVVAGDITR  60

Query  617  ENLGV--KDSHLLTRMLSEVDAVVNLAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKL  444
             +LG+   D++LL  M  ++D VVNLAATT FDERYDV+L +NT+G K V +F KKC +L
Sbjct  61   HHLGIINDDNNLLQEMWHQIDVVVNLAATTNFDERYDVSLALNTLGAKRVFDFCKKCNRL  120

Query  443  RILLHVSTAYVSGIKEGLIAESPYKMGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQE  264
            ++ LHVSTAYVSG KEGLI E PYKMGE LNG  GLDIDEE ++++  L  L ++N SQE
Sbjct  121  KVFLHVSTAYVSGEKEGLILERPYKMGETLNGTRGLDIDEENQLVDATLTHLNQNNYSQE  180

Query  263  SITSAMKDLGIQRARMYGWPNTYVFTKALGEMVLGEF-KED--LPVVIIRPTIITGTYKE  93
             I S+MKDLGIQRAR YGWPNTYVFTKA+GEM+LG+  KED  +P+VIIRPTI+T TY+E
Sbjct  181  HIKSSMKDLGIQRARKYGWPNTYVFTKAMGEMLLGQLVKEDQTVPLVIIRPTIVTSTYRE  240

Query  92   PFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            PFPGWVEG+RTIDSL +GYGKGK+TCFLGD
Sbjct  241  PFPGWVEGLRTIDSLAVGYGKGKITCFLGD  270



>ref|XP_006290972.1| hypothetical protein CARUB_v10017087mg [Capsella rubella]
 gb|EOA23870.1| hypothetical protein CARUB_v10017087mg [Capsella rubella]
Length=493

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/299 (57%), Positives = 231/299 (77%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL + TILVTG  GFLAK+F+EKILR+QP VKKL+LLLRA D E+A+QRF++E++
Sbjct  3    SNCVQFLQDKTILVTGVPGFLAKVFVEKILRLQPKVKKLFLLLRAPDNESAMQRFHSEVL  62

Query  707  GKEIFQILKEKCGNS----VISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++L+   G++    ++SEKV  + GD+S +N+GVKDS LL  M +E+D +VN+AA
Sbjct  63   EKDLFRVLRNNLGDANLKALVSEKVVPIPGDISVDNIGVKDSDLLQLMWNEIDIIVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV L +NT GP +VLNFAKKC K ++LLHVSTAYV G + GL+ E  + MGE
Sbjct  123  TTNFDERYDVGLRINTFGPLNVLNFAKKCVKGQLLLHVSTAYVCGEQSGLLHEKTFHMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             LNG   L ID E  +M++ L++L + +  +E I   MKDLG+ RA+++GWPNTYVFTK+
Sbjct  183  TLNGHGKLVIDTEMEIMKQKLKELHKQDCPEEEIAQTMKDLGMSRAKLHGWPNTYVFTKS  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG  +E LP+VIIRPT+IT T+ EPF GW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLLGNQRETLPIVIIRPTMITSTFSEPFSGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>emb|CDY30935.1| BnaA06g19780D [Brassica napus]
Length=493

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/297 (57%), Positives = 230/297 (77%), Gaps = 4/297 (1%)
 Frame = -3

Query  881  ALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGK  702
             +QF  N TILVTG  GFLAK+FLEKILRVQP+VK+LYLLLR++D E+A++RF  E++ K
Sbjct  5    CVQFFQNKTILVTGVPGFLAKVFLEKILRVQPDVKRLYLLLRSSDNESAMERFRAEVLEK  64

Query  701  EIFQILKEKCGNS----VISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATT  534
            ++F++L+   G++    ++ +KV  + GD+S  NLGVKDS LL  M +E++ +VN+AATT
Sbjct  65   DLFRVLRNDLGDANLKNLVLKKVAPIPGDISVVNLGVKDSDLLQHMWNEIEIIVNVAATT  124

Query  533  KFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEAL  354
             FDERYDV L +NT GP +VLNFAKKC K ++LLHVSTAYV G K G++ E  +KMGE L
Sbjct  125  NFDERYDVGLSINTFGPLNVLNFAKKCVKGQLLLHVSTAYVCGEKPGILPEKTFKMGETL  184

Query  353  NGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALG  174
            N    L I+ E  +M++ L++L +   S+E I  +MKDLG+ RA+++GWPNTYVFTK++G
Sbjct  185  NSNGKLVIETEMELMKQKLKELQKQECSEEEIAQSMKDLGMSRAKLHGWPNTYVFTKSMG  244

Query  173  EMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            EM+LG  +E+LP+VIIRPT+IT T+ EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  245  EMLLGNHRENLPLVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_006487981.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Citrus 
sinensis]
Length=533

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 236/301 (78%), Gaps = 9/301 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS ++FL+N TILV+G  GF+AK+F+EKILRVQPNVKKLYLL+RAADT++A  RF  
Sbjct  1    MELGSVVEFLENKTILVSGVTGFVAKVFIEKILRVQPNVKKLYLLVRAADTDSAALRFQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++ K++F +LKEK G   NS ISEK+T V GD+S E+LG+KDS+L   + +E+D +VN 
Sbjct  61   EVLAKDVFNVLKEKWGTRLNSFISEKITFVPGDISSEDLGLKDSNLKEELWNELDIMVNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA TKFDERYDVA G+NT+G  H++NFAKKC KL++++HVSTAYV+G + GLI E+P   
Sbjct  121  AAITKFDERYDVAFGINTLGAIHLVNFAKKCVKLKVIVHVSTAYVAGERTGLILENP---  177

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
               L+G SGLD D E +V+++ L +L    A Q+ IT  MK+LG +RA+++GWPNTYVFT
Sbjct  178  ---LDGASGLDFDAEMKVIDQKLNELKTKGAPQKEITLVMKNLGTERAKLHGWPNTYVFT  234

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K +GEM++ + KE+L +VIIRPT++TGTYKEPFPGWVE ++TI++L  G  +G L C +G
Sbjct  235  KTMGEMLMQQSKENLSLVIIRPTVVTGTYKEPFPGWVEDLKTINTLFAGSAQGNLRCLVG  294

Query  5    D  3
            +
Sbjct  295  E  295



>ref|XP_011005174.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X2 [Populus euphratica]
Length=459

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 232/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS  +FL+N +ILV GAAGFLAKIF+EKILRVQP VKKLYLLLRA DT++A +R + 
Sbjct  1    MELGSITEFLNNKSILVIGAAGFLAKIFVEKILRVQPKVKKLYLLLRAVDTKSAEERLHN  60

Query  716  EIIGKEIFQILKEKCGNSVIS---EKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IG  +F +L+E+ G S+ S   EK+T V GD+S  +LG++DS L  ++ +E+D V+N 
Sbjct  61   EVIGMALFDVLREQHGASLYSFVYEKLTPVPGDISCVDLGIRDSLLKDQIWNEIDTVINF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+GP H+LNF KKC  +++L+HVSTAYV G   GLI E P+ +
Sbjct  121  AATTNFDERYDVALGINTLGPLHLLNFVKKCNNVKVLVHVSTAYVCGEDAGLIQEKPFPL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G++  G   +DID EK ++EE L +L  ++A + +ITS MKD G +RARM+GWPNTYVFT
Sbjct  181  GKSKKGTEMIDIDMEKILVEEKLTNLHSEHAEESAITSYMKDYGSKRARMFGWPNTYVFT  240

Query  185  KALGEMVLGEFKED-LPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            KA+GEM+L  +  D +P+VIIRPT++T TY+EPFPGW+EG+RTID + +GY KGKL  F
Sbjct  241  KAMGEMLLVHYSRDTVPLVIIRPTMVTSTYQEPFPGWIEGVRTIDGVAVGYAKGKLKHF  299



>emb|CDX92346.1| BnaA10g13850D [Brassica napus]
Length=493

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/299 (56%), Positives = 234/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL + TIL+TGA GFLAK+ +EKILR+QPNVKK+YLLLRA+D +AA+QR  +E++
Sbjct  3    SNCVQFLGDKTILITGAPGFLAKVLVEKILRLQPNVKKMYLLLRASDDKAAMQRLRSEVV  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
              ++F++L++  G    + ++ EK+  V GD+S  NLG+KD  LL RM +E+D ++N+AA
Sbjct  63   EIDLFRVLRKDLGEENLDELVHEKIVPVPGDISVHNLGLKDPDLLQRMWNEIDIIINIAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYV G  +GL  E P+KMGE
Sbjct  123  TTNFDERYDIGLGINTFGALNVLNFAKKCVKRQLLLHVSTAYVCGENKGLFLEKPFKMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
            +L+G   LDI+ E  +M++ L++L   + ++E I+ +MKDLG+ RA+++GWPNTYVFTKA
Sbjct  183  SLSGDKKLDINVEFELMKQKLKELKHQDCTEEEISQSMKDLGMTRAKLHGWPNTYVFTKA  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM++G  +E+LP+VIIRPT+IT T  EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLIGSSRENLPLVIIRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_006371440.1| hypothetical protein POPTR_0019s10390g [Populus trichocarpa]
 gb|ERP49237.1| hypothetical protein POPTR_0019s10390g [Populus trichocarpa]
Length=496

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 233/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS ++FL+N +ILV GA GFLAKIF+EKILRVQP VKKLYLLLRA DT++A +R + 
Sbjct  1    MELGSIVEFLNNKSILVIGATGFLAKIFVEKILRVQPKVKKLYLLLRAVDTKSAEERLHN  60

Query  716  EIIGKEIFQILKEKCGNSVIS---EKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IG  +F +L+E+ G S+ S   EKVT V GD+S  +LG++DS L  ++ +E+D V+N 
Sbjct  61   EVIGMALFDVLREQHGASLYSFVYEKVTPVPGDISCVDLGIRDSLLKDQIWNEIDTVINC  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+GP H+LNF KKC  +++L+H+STAYV G   G I E P+++
Sbjct  121  AATTNFDERYDVALGINTLGPLHLLNFVKKCNNVKVLVHLSTAYVCGEDAGFIQEKPFRL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+A  G   +DID EK+++EE LR L  ++A + ++TS MKD G +RARM+GWPNTYVFT
Sbjct  181  GKAKKGTGMIDIDIEKKLVEEKLRKLHSEHAEESAVTSYMKDYGTERARMFGWPNTYVFT  240

Query  185  KALGEMVLGEFKED-LPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            KA+GEM+L  +  D +P+VIIRPT++T TY+EPFPGW+EG+RTID + +GY KGKL  F
Sbjct  241  KAMGEMLLVHYNRDTVPLVIIRPTMVTSTYQEPFPGWIEGVRTIDGVVVGYAKGKLKHF  299



>ref|XP_009120651.1| PREDICTED: fatty acyl-CoA reductase 1 [Brassica rapa]
Length=493

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/299 (56%), Positives = 234/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL + TIL+TGA GFLAK+ +EKILR+QPNVKK+YLLLRA+D +AA+QR  +E++
Sbjct  3    SNCVQFLGDKTILITGAPGFLAKVLVEKILRLQPNVKKMYLLLRASDDKAAMQRLRSEVV  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
              ++F++L++  G    + ++ EK+  V GD+S  NLG+KD  LL RM +E+D ++N+AA
Sbjct  63   EIDLFRVLRKDLGEENLDKLVHEKIVPVPGDISVHNLGLKDPDLLQRMWNEIDIIINIAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYV G  +GL  E P+KMGE
Sbjct  123  TTNFDERYDIGLGINTFGALNVLNFAKKCVKRQLLLHVSTAYVCGENKGLFLEKPFKMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
            +L+G   LDI+ E  +M++ L++L   + ++E I+ +MKDLG+ RA+++GWPNTYVFTKA
Sbjct  183  SLSGDKKLDINVEFELMKQKLKELKHQDCTEEEISQSMKDLGMTRAKLHGWPNTYVFTKA  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM++G  +E+LP+VIIRPT+IT T  EPFPGW+EG+RTIDS+ + YGKG+L CFL D
Sbjct  243  MGEMLIGSSRENLPLVIIRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGRLKCFLAD  301



>ref|XP_006478011.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Citrus 
sinensis]
Length=570

 Score =   372 bits (955),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 236/301 (78%), Gaps = 9/301 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS ++FL+N  ILV+G  GF+AK+F+EKILRVQPNVKKLYLL+RAADTE+A  RF  
Sbjct  1    MELGSVVEFLENKIILVSGVTGFVAKVFIEKILRVQPNVKKLYLLIRAADTESAALRFQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++ K++F +LKEK G   NS ISEK+T VAGD+S E+LG+KDS+L   + +E+D +VN 
Sbjct  61   EVLAKDLFNVLKEKWGTRLNSFISEKITFVAGDISSEDLGLKDSNLKEELWNELDVMVNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA TKFDERYDVA G+NT+G  H++NFAKKC KL++ +HVSTAYV+G + GLI E+P   
Sbjct  121  AAITKFDERYDVAFGINTLGAIHLVNFAKKCVKLKVFVHVSTAYVAGERTGLILENP---  177

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
               L+G SGLD D E +V+++ L ++    ASQ+ IT  MK+LG +RA+++GWPNTYVFT
Sbjct  178  ---LDGASGLDFDAEMKVIDQKLNEIKTKGASQKEITLVMKNLGTERAKIHGWPNTYVFT  234

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K +GEM++ + KE+L +VIIRPT++TGTYKEPFPGWVE ++TI++L  G  +G L C +G
Sbjct  235  KTMGEMIMQQSKENLSLVIIRPTVVTGTYKEPFPGWVEDLKTINTLFAGSAQGNLRCLVG  294

Query  5    D  3
            +
Sbjct  295  E  295



>ref|XP_006419122.1| hypothetical protein EUTSA_v10002495mg [Eutrema salsugineum]
 gb|ESQ37558.1| hypothetical protein EUTSA_v10002495mg [Eutrema salsugineum]
Length=496

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 232/301 (77%), Gaps = 7/301 (2%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL N TILVTGA GFLAK+F+EKILRVQPNVKKLYL++RA+D EAA +R  TE+ 
Sbjct  3    SNCVQFLQNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLVVRASDNEAATKRLRTEVF  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             K++F++L+E  G    N+++SEK+  VAGD+S +NL VKDS L  RM  E+D VVN+AA
Sbjct  63   EKDLFKVLRENLGEVNLNALLSEKIVPVAGDISTDNLDVKDSSLRERMQKEIDVVVNVAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYDV LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GL+ E P+ M E
Sbjct  123  TTNFDERYDVGLGINTFGALNVLNFAKKCVKAQLLLHVSTAYVCGEKPGLLREKPFSMEE  182

Query  359  ALNGKSGL--DIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
              N K+GL  DI  E  +M++ L++L     S+E I+ +MK+LG++RA+++GWPNTYVFT
Sbjct  183  IRN-KNGLHLDIKIEMELMKQRLKELHEQECSEEDISLSMKELGMERAKLHGWPNTYVFT  241

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K++GEM+LG  KEDLP+VIIRPT+IT T  EPF GW+EG+RT+DS+ + YGKG L CFL 
Sbjct  242  KSMGEMLLGNHKEDLPLVIIRPTMITSTIYEPFSGWIEGLRTVDSVIIAYGKGALKCFLA  301

Query  5    D  3
            D
Sbjct  302  D  302



>gb|KDO39573.1| hypothetical protein CISIN_1g0083242mg, partial [Citrus sinensis]
Length=341

 Score =   363 bits (932),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/301 (56%), Positives = 233/301 (77%), Gaps = 9/301 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS ++FL+N TILV+G  GF+AK+F+EKILRVQPNVKKLYL +RAAD ++A  RF  
Sbjct  1    MELGSVVEFLENKTILVSGVTGFVAKVFIEKILRVQPNVKKLYLFVRAADIDSAALRFQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++ K++F +LKEK G   NS ISEK+T V GD+S E+LG+KDS+L   + +E+D +VN 
Sbjct  61   EVLAKDVFNVLKEKWGTRLNSFISEKITFVPGDISSEDLGLKDSNLKEELWNELDIMVNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA TKFDERYDVA G+NT+G  H++NFAKKC KL++ +HVSTAYV+G + GLI E+P   
Sbjct  121  AAITKFDERYDVAFGINTLGVIHLVNFAKKCVKLKVFVHVSTAYVAGERTGLILENP---  177

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
               L+G SGLD D E +V+++ L +L    A Q+ IT  MK+LG +RA+++GWPNTYVFT
Sbjct  178  ---LDGASGLDFDAEMKVIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFT  234

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K +GEM++ + KE+L +VIIRPT+++GTYKEPFPGWVE ++TI++L +   +G L C +G
Sbjct  235  KTMGEMLMQQSKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVG  294

Query  5    D  3
            +
Sbjct  295  E  295



>ref|XP_011005173.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Populus euphratica]
Length=495

 Score =   368 bits (945),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 232/299 (78%), Gaps = 4/299 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS  +FL+N +ILV GAAGFLAKIF+EKILRVQP VKKLYLLLRA DT++A +R + 
Sbjct  1    MELGSITEFLNNKSILVIGAAGFLAKIFVEKILRVQPKVKKLYLLLRAVDTKSAEERLHN  60

Query  716  EIIGKEIFQILKEKCGNSVIS---EKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IG  +F +L+E+ G S+ S   EK+T V GD+S  +LG++DS L  ++ +E+D V+N 
Sbjct  61   EVIGMALFDVLREQHGASLYSFVYEKLTPVPGDISCVDLGIRDSLLKDQIWNEIDTVINF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+GP H+LNF KKC  +++L+HVSTAYV G   GLI E P+ +
Sbjct  121  AATTNFDERYDVALGINTLGPLHLLNFVKKCNNVKVLVHVSTAYVCGEDAGLIQEKPFPL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G++  G   +DID EK ++EE L +L  ++A + +ITS MKD G +RARM+GWPNTYVFT
Sbjct  181  GKSKKGTEMIDIDMEKILVEEKLTNLHSEHAEESAITSYMKDYGSKRARMFGWPNTYVFT  240

Query  185  KALGEMVLGEFKED-LPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            KA+GEM+L  +  D +P+VIIRPT++T TY+EPFPGW+EG+RTID + +GY KGKL  F
Sbjct  241  KAMGEMLLVHYSRDTVPLVIIRPTMVTSTYQEPFPGWIEGVRTIDGVAVGYAKGKLKHF  299



>gb|KFK23136.1| hypothetical protein AALP_AAs65178U000500 [Arabis alpina]
Length=490

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/296 (58%), Positives = 227/296 (77%), Gaps = 4/296 (1%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + +QFL+N TILV GA+GFLAK+F+E+ILR+QPNVK+LYLL+RA D ++A QR ++EI  
Sbjct  4    NCVQFLENKTILVIGASGFLAKVFVERILRLQPNVKRLYLLVRAVDKKSAEQRLHSEIFE  63

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++L+   G    N++I EKV  + GD+S  N+GV DS+LL  M  E+D VVN AAT
Sbjct  64   KDLFRVLRNNVGDESLNALILEKVVPIPGDISLNNMGVSDSNLLQDMRQEIDIVVNSAAT  123

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYDVALG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GLI E  + MGEA
Sbjct  124  TIFDERYDVALGINTYGANNVLNFAKKCVKPQLLLHVSTAYVCGEKSGLILEKHFAMGEA  183

Query  356  LNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKAL  177
            L+G + +DI+ E R++E+ L  L     S E    AMKDLG++RA++YGWPNTY FTKA+
Sbjct  184  LSGSNKIDINAEMRLVEQKLNQLIEKGCSDEETKQAMKDLGLRRAKLYGWPNTYAFTKAM  243

Query  176  GEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            GEM++G ++E +P+VIIRPTIIT T+ +PFPGW+EG++T+DS+   YGKG L CFL
Sbjct  244  GEMLIGHYRESMPIVIIRPTIITSTFSDPFPGWIEGLKTVDSVIASYGKGMLKCFL  299



>ref|XP_010421031.1| PREDICTED: putative fatty acyl-CoA reductase 7 [Camelina sativa]
Length=489

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/299 (56%), Positives = 230/299 (77%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + LQFL+N TILVTGA+GFLAK+ +E+ILR+QPNVKKLYLL+RA+D ++A +R + E+ 
Sbjct  3    ANCLQFLENKTILVTGASGFLAKVLVERILRLQPNVKKLYLLVRASDKKSAERRLHCEVF  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             KE+F++L++  G    N++ISEKV  V GD+S +++GV D++LL  M+ ++D ++N AA
Sbjct  63   KKELFRVLRKNLGDEGLNALISEKVVPVPGDISLKDIGVHDANLLQDMMQDIDIIINSAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT+FDERYDVALG+NT G  +VLNFAKKC K ++LLHVSTAYV G + G I E P+ MGE
Sbjct  123  TTRFDERYDVALGINTFGAINVLNFAKKCVKPKLLLHVSTAYVCGERSGHILEKPFAMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             L GK+ +DI+ E R+ E+ L+ L     S+E    AMKD  ++RA++YGWPNTYVFTKA
Sbjct  183  TLKGKNKVDINTEMRLAEQKLKRLIEQGCSKEQTEQAMKDFALKRAKLYGWPNTYVFTKA  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG ++  +P+VIIRPTIIT T   PFPGW+EG++T+DS+ + YGKG L CFL D
Sbjct  243  MGEMLLGHYRGSMPIVIIRPTIITSTISNPFPGWIEGLKTVDSVIISYGKGMLRCFLVD  301



>ref|XP_009405296.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Musa acuminata 
subsp. malaccensis]
Length=490

 Score =   367 bits (941),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 172/301 (57%), Positives = 236/301 (78%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME    ++FL   +ILVTG+ GFLAKIF+EK++RVQP+VK+L+LL+RAAD  +A +R  +
Sbjct  1    MESSRLMEFLKGKSILVTGSTGFLAKIFVEKVMRVQPDVKRLFLLVRAADASSAEKRVQS  60

Query  716  EIIGKEIFQILKEKCGN---SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GKE+F+++K+K G+   S +S K+  VAGD+  +NLG++DS++  ++  EVD VVN+
Sbjct  61   EILGKELFKVVKDKHGDGFHSFVSSKLFPVAGDIVQQNLGIRDSNIREKLWEEVDIVVNV  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT F ERYDVALG+N +G KHVL FAK+C KL++LLHVSTAY +G + GLI E  ++M
Sbjct  121  AATTSFGERYDVALGINVLGAKHVLEFAKQCVKLQVLLHVSTAYAAGEQRGLILEKRFRM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GEAL G S LDI+ E R+++E  R L   NA++E+   AMK+LGI RAR++GWPNTYV+T
Sbjct  181  GEALKGDSYLDIEGELRLVDERRRQLGAQNATKEAEAQAMKELGINRARLFGWPNTYVYT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+ EM+LGE + +LP+VI+RPTIIT  +++P PGW+EG RTIDSL +GY KGK+TCF G
Sbjct  241  KAMAEMLLGELRGNLPLVILRPTIITSIHRDPVPGWIEGTRTIDSLIMGYVKGKITCFFG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_006349112.1| PREDICTED: probable fatty acyl-CoA reductase 5-like, partial 
[Solanum tuberosum]
Length=352

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 229/294 (78%), Gaps = 4/294 (1%)
 Frame = -3

Query  872  FLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKEIF  693
            FL+  TI +TGA GFLAKI +EKILRVQPNV+KL+LL+RA+D+++A +RFN E++  E+F
Sbjct  4    FLEGKTIFITGATGFLAKILVEKILRVQPNVRKLFLLVRASDSKSARKRFNDEVMQTELF  63

Query  692  QILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKFD  525
             +L+E+ G    NS+I EKV  VAGD+S+E+ G+++S +   ML E+D ++N AATT+FD
Sbjct  64   SVLREQIGANNLNSLIEEKVFPVAGDISFEDFGIENSEMKNEMLKEIDIIINSAATTRFD  123

Query  524  ERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNGK  345
            ERYD+A+ +N +G  +VLNFAK+C  ++I++HVSTAYV G  EG+I E  + +GE LN  
Sbjct  124  ERYDIAMDINVLGALNVLNFAKRCENVKIIVHVSTAYVCGEGEGVIPEKSFSLGETLNKN  183

Query  344  SGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGEMV  165
            S L+ID E++V++E L++L   + + + +T AM+DLGIQRA ++GWPNTY FTKA+GEM+
Sbjct  184  SKLNIDVERKVIDEKLKELEAQSLTTKEVTIAMRDLGIQRANLHGWPNTYSFTKAMGEML  243

Query  164  LGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            LG +KEDL +VIIRPTIIT TYKEPFPGW+EG++T+DS  L YGKG +    GD
Sbjct  244  LGHYKEDLQLVIIRPTIITSTYKEPFPGWIEGVKTVDSFILAYGKGVMNFCFGD  297



>gb|KDO39572.1| hypothetical protein CISIN_1g0083242mg, partial [Citrus sinensis]
Length=392

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/301 (56%), Positives = 233/301 (77%), Gaps = 9/301 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS ++FL+N TILV+G  GF+AK+F+EKILRVQPNVKKLYL +RAAD ++A  RF  
Sbjct  1    MELGSVVEFLENKTILVSGVTGFVAKVFIEKILRVQPNVKKLYLFVRAADIDSAALRFQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++ K++F +LKEK G   NS ISEK+T V GD+S E+LG+KDS+L   + +E+D +VN 
Sbjct  61   EVLAKDVFNVLKEKWGTRLNSFISEKITFVPGDISSEDLGLKDSNLKEELWNELDIMVNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA TKFDERYDVA G+NT+G  H++NFAKKC KL++ +HVSTAYV+G + GLI E+P   
Sbjct  121  AAITKFDERYDVAFGINTLGVIHLVNFAKKCVKLKVFVHVSTAYVAGERTGLILENP---  177

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
               L+G SGLD D E +V+++ L +L    A Q+ IT  MK+LG +RA+++GWPNTYVFT
Sbjct  178  ---LDGASGLDFDAEMKVIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFT  234

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K +GEM++ + KE+L +VIIRPT+++GTYKEPFPGWVE ++TI++L +   +G L C +G
Sbjct  235  KTMGEMLMQQSKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVG  294

Query  5    D  3
            +
Sbjct  295  E  295



>ref|NP_197642.1| fatty acyl-CoA reductase 1 [Arabidopsis thaliana]
 sp|Q39152.1|FACR1_ARATH RecName: Full=Fatty acyl-CoA reductase 1 [Arabidopsis thaliana]
 emb|CAA68191.1| male sterility 2-like protein [Arabidopsis thaliana]
 dbj|BAB09122.1| male sterility 2-like protein [Arabidopsis thaliana]
 gb|AAK59547.1| putative male sterility 2 protein [Arabidopsis thaliana]
 gb|AAK93752.1| putative male sterility 2 protein [Arabidopsis thaliana]
 gb|ABZ10951.1| fatty acyl CoA reductase [Arabidopsis thaliana]
 gb|AED93034.1| fatty acyl-CoA reductase 1 [Arabidopsis thaliana]
Length=491

 Score =   366 bits (940),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 166/299 (56%), Positives = 235/299 (79%), Gaps = 6/299 (2%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL N TIL+TGA GFLAK+ +EKILR+QPNVKK+YLLLRA D ++A+QR  +E++
Sbjct  3    SNCVQFLGNKTILITGAPGFLAKVLVEKILRLQPNVKKIYLLLRAPDEKSAMQRLRSEVM  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
              ++F++L+   G    N+++ EK+  V GD+S +NLG+KD+ L+ RM SE+D ++N+AA
Sbjct  63   EIDLFKVLRNNLGEDNLNALMREKIVPVPGDISIDNLGLKDTDLIQRMWSEIDIIINIAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAY+SG + GL+ E P+KMGE
Sbjct  123  TTNFDERYDIGLGINTFGALNVLNFAKKCVKGQLLLHVSTAYISGEQPGLLLEKPFKMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             L+G   LDI+ E  +M++ L++L   + S E I+  MKD G+ RA+++GWPNTYVFTKA
Sbjct  183  TLSGDRELDINIEHDLMKQKLKEL--QDCSDEEISQTMKDFGMARAKLHGWPNTYVFTKA  240

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM++G+++E+LP+VIIRPT+IT T  EPFPGW+EG++T+DS+ + YGKG+L CFL D
Sbjct  241  MGEMLMGKYRENLPLVIIRPTMITSTIAEPFPGWIEGLKTLDSVIVAYGKGRLKCFLAD  299



>gb|KDO39571.1| hypothetical protein CISIN_1g0083242mg [Citrus sinensis]
Length=399

 Score =   363 bits (931),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 170/301 (56%), Positives = 233/301 (77%), Gaps = 9/301 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS ++FL+N TILV+G  GF+AK+F+EKILRVQPNVKKLYL +RAAD ++A  RF  
Sbjct  1    MELGSVVEFLENKTILVSGVTGFVAKVFIEKILRVQPNVKKLYLFVRAADIDSAALRFQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++ K++F +LKEK G   NS ISEK+T V GD+S E+LG+KDS+L   + +E+D +VN 
Sbjct  61   EVLAKDVFNVLKEKWGTRLNSFISEKITFVPGDISSEDLGLKDSNLKEELWNELDIMVNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA TKFDERYDVA G+NT+G  H++NFAKKC KL++ +HVSTAYV+G + GLI E+P   
Sbjct  121  AAITKFDERYDVAFGINTLGVIHLVNFAKKCVKLKVFVHVSTAYVAGERTGLILENP---  177

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
               L+G SGLD D E +V+++ L +L    A Q+ IT  MK+LG +RA+++GWPNTYVFT
Sbjct  178  ---LDGASGLDFDAEMKVIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFT  234

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K +GEM++ + KE+L +VIIRPT+++GTYKEPFPGWVE ++TI++L +   +G L C +G
Sbjct  235  KTMGEMLMQQSKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVG  294

Query  5    D  3
            +
Sbjct  295  E  295



>ref|XP_010493325.1| PREDICTED: putative fatty acyl-CoA reductase 7 [Camelina sativa]
Length=493

 Score =   366 bits (939),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 229/299 (77%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + LQFL+N TILVTGA+GFLAK+ +E+ILR+QPNVKKLYLL+RA+D ++A QR + E+ 
Sbjct  3    ANCLQFLENKTILVTGASGFLAKVLVERILRLQPNVKKLYLLVRASDKKSAEQRLHCEVF  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             KE+F++L++  G    N++I EKV  V GD+S +++GV D++LL  M+ ++D ++N AA
Sbjct  63   KKELFRVLRKNLGDEGLNALILEKVVPVPGDISLKDIGVHDANLLQDMMQDIDIIINSAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT+FDERYDVALG+NT G  +VLNFAKKC K ++LLHVSTAYV G + G I E P+ MGE
Sbjct  123  TTRFDERYDVALGINTFGAINVLNFAKKCVKPKLLLHVSTAYVCGERSGHILEKPFAMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             L GK+ +DI+ E R+ E+ L+ L     S+E    AMKD  ++RA++YGWPNTYVFTKA
Sbjct  183  TLKGKNKVDINTEMRLAEQKLKQLIEQGCSKEQTEQAMKDFALKRAKLYGWPNTYVFTKA  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG  +  +P+V+IRPTIIT T  +PFPGW+EG++TIDS+ L YGKG L CFL D
Sbjct  243  MGEMLLGHCRGSMPIVVIRPTIITSTISDPFPGWIEGLKTIDSVILSYGKGMLKCFLVD  301



>ref|XP_002872004.1| hypothetical protein ARALYDRAFT_910242 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48263.1| hypothetical protein ARALYDRAFT_910242 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/299 (56%), Positives = 235/299 (79%), Gaps = 6/299 (2%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + +QFL N TIL+TGA GFLAK+ +EKILR+QPNVKK+YLLLRA D ++A+QR  TE+I
Sbjct  3    SNCVQFLGNKTILITGAPGFLAKVLVEKILRLQPNVKKMYLLLRAPDEKSAMQRLYTEVI  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
              ++F++L+   G    N+++ +K+  V GD+S +NLG+KD+ L+ R+ SE+D ++N+AA
Sbjct  63   EIDLFKVLRNDLGEENLNALVRKKIVPVPGDISIDNLGLKDTDLIQRLWSEIDIIINIAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYVSG + GL+ E P+KMGE
Sbjct  123  TTNFDERYDIGLGINTFGALNVLNFAKKCVKGQLLLHVSTAYVSGEQSGLLLEKPFKMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             L+ K  LDI+ E  +M++ L++L   + S E I+  MKD G+ RA+++GWPNTYVFTKA
Sbjct  183  TLSEKRKLDINIEHELMKQKLKEL--QDCSDEEISQTMKDFGMARAKLHGWPNTYVFTKA  240

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM++G+++E+LP+VIIRPT+IT T  EPFPGW+EG++T+DS+ + YGKG+L CFL D
Sbjct  241  MGEMLMGKYRENLPLVIIRPTMITSTIAEPFPGWIEGLKTLDSVIVAYGKGRLKCFLAD  299



>ref|XP_009150309.1| PREDICTED: probable fatty acyl-CoA reductase 5 [Brassica rapa]
Length=497

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 230/299 (77%), Gaps = 5/299 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + +QFL N TILVTGA GFLAK+F+EKILRVQPNVKKLYL++RA+D+EAA++R   E+  
Sbjct  5    NCVQFLQNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLVVRASDSEAAMKRLRAEVFE  64

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++L+E  G    N++ SEKV  VAGD+S +  GVKDS+L  RM  E+D VVN+AAT
Sbjct  65   KDLFKVLRENIGEENLNTLFSEKVVPVAGDISTDCFGVKDSNLRERMQKEIDIVVNVAAT  124

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYDV LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GL+ E P+ M E 
Sbjct  125  TNFDERYDVGLGINTFGALNVLNFAKKCVKAQLLLHVSTAYVCGEKSGLLREKPFAMEEI  184

Query  356  LN-GKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             N     LDI+ E  +M++ L++L   + S E IT +MK+LG++RA+++GWPNTYVFTK+
Sbjct  185  RNEAGHQLDINFEMELMKKRLKELHDQDCSDEDITLSMKELGMERAKLHGWPNTYVFTKS  244

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM++G  +E LP+VIIRPT+IT T  EPFPGW+EG+RT+DS+ + YGKG L CFL D
Sbjct  245  MGEMLIGNHRESLPLVIIRPTMITSTLSEPFPGWIEGLRTVDSVIVAYGKGVLKCFLVD  303



>gb|KFK33885.1| hypothetical protein AALP_AA5G072900 [Arabis alpina]
Length=496

 Score =   365 bits (937),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 176/300 (59%), Positives = 233/300 (78%), Gaps = 7/300 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + +QF  N TILVTGA GFLAK+F+EKILRVQPNV KLYLL+RA++ EAA  R  TE+  
Sbjct  4    NCVQFFQNKTILVTGATGFLAKVFVEKILRVQPNVNKLYLLVRASNNEAATNRLRTEVFE  63

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K +F++L+E  G    N+++ EKV  VAGD+S +NLGVKDS+L  RM +E+D VVN+AAT
Sbjct  64   KSLFKVLRENLGDESLNTLLLEKVVPVAGDISTDNLGVKDSNLRERMQNEIDIVVNVAAT  123

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYDV LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GL+ E P+ M E 
Sbjct  124  TNFDERYDVGLGINTFGALNVLNFAKKCVKAKLLLHVSTAYVCGEKSGLLLEKPFAM-EE  182

Query  356  LNGKSGL--DIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTK  183
            +  K+GL  DI+ E+ +M++ L++L   + S+E I  +MK+LG++RA+++GWPNTYVFTK
Sbjct  183  ICDKNGLQLDINLERELMKQRLKELNEQDCSEEDINLSMKELGMKRAKIHGWPNTYVFTK  242

Query  182  ALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            ++GEM+LG  KE+L +VIIRPT+IT T+ EPFPGW+EG+RT+DS+ + YGKG L CFL D
Sbjct  243  SMGEMLLGNHKENLSLVIIRPTMITSTFSEPFPGWMEGLRTVDSVIIAYGKGVLKCFLVD  302



>ref|XP_003596781.1| DNA-directed RNA polymerase [Medicago truncatula]
Length=568

 Score =   368 bits (944),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/282 (63%), Positives = 224/282 (79%), Gaps = 3/282 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS L FL+  TILVTGA GFLAKIF+EKILRVQPNVKKLYLLLRA D+E+A QRF  
Sbjct  1    MELGSILHFLEGRTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAKDSESAAQRFRN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK++F++LKE  G   NS +SEK+T+V GD+S E L +K+S L   + ++ D +VNL
Sbjct  61   EIIGKDLFKLLKENQGPKFNSFVSEKLTLVPGDISKEGLNLKESILEEEICNQTDVIVNL  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALG+NT+G KHVL+FAKKC +L++L+HVSTAYV G + GLI E P++ 
Sbjct  121  AATTKFDERYDVALGINTLGVKHVLSFAKKCIQLKVLVHVSTAYVCGERGGLILEDPHRY  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G +LNG  GLDID EK+++EE L        ++  I  AMKDLG++RA  YGWPNTYVFT
Sbjct  181  GVSLNGVPGLDIDMEKKLVEEKLNQFQAQGTTEHDIEVAMKDLGMERATKYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRT  60
            KA+GEM++  FKE++ VVI+RPTI+T T++EPFPGWVEG+ +
Sbjct  241  KAMGEMLVETFKENMSVVIVRPTIVTSTFREPFPGWVEGLSS  282



>emb|CDX99193.1| BnaA06g18840D [Brassica napus]
Length=496

 Score =   365 bits (937),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 230/299 (77%), Gaps = 5/299 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + +QFL N TILVTGA GFLAK+F+EKILRVQPNVKKLYL++RA+D+EAA++R   E+  
Sbjct  4    NCVQFLQNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLVVRASDSEAAMKRLRAEVFE  63

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++L+E  G    N++ SEKV  VAGD+S +  GVKDS+L  RM  E+D VVN+AAT
Sbjct  64   KDLFKVLRENIGEENLNTLFSEKVVPVAGDISTDCFGVKDSNLRERMQKEIDIVVNVAAT  123

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYDV LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GL+ E P+ M E 
Sbjct  124  TNFDERYDVGLGINTFGALNVLNFAKKCVKAQLLLHVSTAYVCGEKSGLLREKPFAMEEI  183

Query  356  LN-GKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             N     LDI+ E  +M++ L++L   + S E IT +MK+LG++RA+++GWPNTYVFTK+
Sbjct  184  RNEAGHQLDINFEMELMKKRLKELHDQDCSDEDITLSMKELGMERAKLHGWPNTYVFTKS  243

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM++G  +E LP+VIIRPT+IT T  EPFPGW+EG+RT+DS+ + YGKG L CFL D
Sbjct  244  MGEMLIGNHRESLPLVIIRPTMITSTLSEPFPGWIEGLRTVDSVIVAYGKGVLKCFLVD  302



>gb|EYU36962.1| hypothetical protein MIMGU_mgv1a0098192mg, partial [Erythranthe 
guttata]
Length=277

 Score =   357 bits (916),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/278 (60%), Positives = 222/278 (80%), Gaps = 4/278 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  S +QFL+N +ILV GA GFLAK+ +EKI+RVQP VKKLYLLLRA D+ +AL RFNT
Sbjct  1    MECLSIVQFLENKSILVAGATGFLAKVLIEKIMRVQPKVKKLYLLLRAEDSVSALHRFNT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IGK++F ++KEK G   NS+I EK+TV+ GD++ ++LG+++S +L  +  EVD +VN 
Sbjct  61   EVIGKDLFGVVKEKYGANLNSLILEKITVLNGDITRDDLGLQES-ILEELFQEVDIIVNS  119

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT GP ++LNF+ KC  LR+LLHVSTAYV G KEGL+ E+P+ M
Sbjct  120  AATTDFDERYDVALGINTYGPANILNFSMKCRNLRLLLHVSTAYVCGEKEGLVLETPFNM  179

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G  LNG  GLDI+ EK++++E L+ L  ++A ++ I S MK+LGIQRA  YGWPNTY FT
Sbjct  180  GATLNGTRGLDIENEKKIVDELLKKLRAESAPEKYIASTMKELGIQRANKYGWPNTYAFT  239

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVE  72
            KA+GEM+LG  +E+ P+VIIRPTIIT T++EPFPGW++
Sbjct  240  KAMGEMLLGHLREETPLVIIRPTIITSTFQEPFPGWLD  277



>ref|XP_010687495.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Beta 
vulgaris subsp. vulgaris]
Length=489

 Score =   364 bits (934),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 176/301 (58%), Positives = 223/301 (74%), Gaps = 4/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            M+L S  +FL + TIL+TGA GF+AKI L+KILRVQPNVKK+YLL+RA D   A  R   
Sbjct  1    MDLSSINEFLGSKTILITGATGFIAKILLDKILRVQPNVKKIYLLIRARDANGANTRLQD  60

Query  716  EIIGKEIFQILKEKCGNS---VISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GKE+F +L+EK G +   +IS+K+T VAGD SYEN G+    L T M  ++D V+N+
Sbjct  61   EVLGKELFNVLREKMGPNFERLISDKITPVAGDTSYENFGLTAGQL-TEMNEDIDIVINV  119

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYDVALGVNT G KHV+NFAKKC  +++L+HVSTAYV G K GLI+E P  M
Sbjct  120  AATTKFDERYDVALGVNTFGAKHVVNFAKKCANIQLLIHVSTAYVCGEKRGLISEKPTAM  179

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG +GLDI  E ++ E+ L DL      ++ I   MK LG QRA++YGWPNTYVFT
Sbjct  180  GETLNGATGLDIGSEMKLAEQTLMDLKAREVPEKEIRRTMKILGSQRAKLYGWPNTYVFT  239

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM + + + +LPV+I+RPTI+  T KEPFPGWVEG RT+DS+ + YGKG L  FL 
Sbjct  240  KAMGEMHVAQLRGNLPVIIMRPTIVCSTLKEPFPGWVEGCRTLDSVAVAYGKGSLKLFLA  299

Query  5    D  3
            D
Sbjct  300  D  300



>ref|XP_007020562.1| Fatty acid reductase 4 [Theobroma cacao]
 gb|EOY12087.1| Fatty acid reductase 4 [Theobroma cacao]
Length=523

 Score =   365 bits (936),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 176/300 (59%), Positives = 228/300 (76%), Gaps = 3/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL + ++FL   TILVTGA GFLAK+F+EKILR+QPNV KLYLLLRAADT +A +R N 
Sbjct  3    MELDNVVKFLQGKTILVTGATGFLAKVFVEKILRLQPNVNKLYLLLRAADTNSATKRLNG  62

Query  716  EIIGKEIFQILKEKCGNSV---ISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EII  E+F+IL+++ G+     +S KV  V GD+S E+LG+ +S L   ML E++ VV++
Sbjct  63   EIISTELFRILRDRWGSEFDLFLSTKVIAVPGDISSESLGLNESKLREHMLREIEIVVHV  122

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT F+E YDVAL +NT G  +VL+FAKKC K+++ LH STAYV G + G+I E P+ +
Sbjct  123  AATTGFNESYDVALAINTFGALNVLSFAKKCDKIKLFLHTSTAYVCGEQAGIILEKPFSV  182

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
             + L     LDI EEKR++EE L +L   +A  E I S MK+ G++RA++YGWPNTYVFT
Sbjct  183  DDTLLKTCKLDIIEEKRIVEEKLDELRFQHAPNEVIKSEMKEFGLKRAKLYGWPNTYVFT  242

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG FK DLP+VIIRPT+I  TYKEPFPGW+EG+RTIDS+ + YGKGKLTCF G
Sbjct  243  KAMGEMLLGNFKGDLPLVIIRPTMIASTYKEPFPGWIEGVRTIDSVIVSYGKGKLTCFPG  302



>gb|AIE57506.1| CER4 [Camelina sativa]
Length=468

 Score =   363 bits (931),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 220/275 (80%), Gaps = 3/275 (1%)
 Frame = -3

Query  818  IFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKEIFQILKEKCG---NSVISEK  648
            +F+EKILRV PNVKKLYLLLRA+  + A QRFN EI+GK++F+++KEK G   N + SEK
Sbjct  8    VFVEKILRVAPNVKKLYLLLRASKEKTATQRFNDEILGKDLFKVVKEKYGPNLNQLTSEK  67

Query  647  VTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKFDERYDVALGVNTMGPKHVLN  468
            VT+V GD+  E+LG+++  L   M+ +VDA+VNLAATTKFDERYD ALG+NT G  +VLN
Sbjct  68   VTIVNGDICLEDLGIQNLDLAHEMIHQVDAIVNLAATTKFDERYDTALGINTFGALNVLN  127

Query  467  FAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNGKSGLDIDEEKRVMEEALRDL  288
            FA +C K++I + VSTAYV G K GLI E+P++MGE LNG +GLDI+ EK++++E L  L
Sbjct  128  FANRCAKVKICVQVSTAYVCGEKPGLIMETPHRMGETLNGTTGLDINREKKLVQEKLDQL  187

Query  287  TRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGEMVLGEFKEDLPVVIIRPTIIT  108
                AS E+I  AMK LG+ RA+MYGWPNTYVFTKA+GEMV+G  +E++ +V++RP+IIT
Sbjct  188  QAIGASPETIREAMKVLGLTRAKMYGWPNTYVFTKAMGEMVVGAKRENISLVLLRPSIIT  247

Query  107  GTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
             T+KEPFPGW EGIRTIDSL +GYGKGKLTCFL D
Sbjct  248  STFKEPFPGWTEGIRTIDSLAVGYGKGKLTCFLCD  282



>ref|XP_007020558.1| Fatty acid reductase 4 [Theobroma cacao]
 gb|EOY12083.1| Fatty acid reductase 4 [Theobroma cacao]
Length=492

 Score =   363 bits (933),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/300 (59%), Positives = 227/300 (76%), Gaps = 3/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL   ++FL   TILVTGA GFLAKIF+EKILR+QPNV KLYLLL+AAD ++A +R ++
Sbjct  3    MELDHVVKFLQGKTILVTGATGFLAKIFVEKILRIQPNVNKLYLLLKAADAKSATKRLHS  62

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EII  E+F IL++  G   +S I  KV  V GD+S ENLGV +S L  +ML E++ VV++
Sbjct  63   EIIDTELFTILRDNWGSEFDSFILTKVIAVPGDISSENLGVNESKLREQMLKEIEIVVHV  122

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT F+E YDVAL +NT G  +VL+FAKKC K+++ LH STAYV G + G+I E P+ +
Sbjct  123  AATTGFNESYDVALAINTFGALNVLSFAKKCDKIKLFLHTSTAYVCGEEAGIILEKPFSV  182

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
             + L     LDI EEKR++EE L +L   +A  E I S MK+ G++RA++YGWPNTYVFT
Sbjct  183  DDTLLKTCKLDIIEEKRIVEEKLDELRFQHAPNEVIKSEMKEFGLKRAKLYGWPNTYVFT  242

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG FK DLP+VIIRPT+I  TYKEPFPGW+EG+RTIDS+ + YGKGKLTCF G
Sbjct  243  KAMGEMLLGNFKGDLPLVIIRPTMIASTYKEPFPGWIEGVRTIDSVIVSYGKGKLTCFPG  302



>ref|XP_006279387.1| hypothetical protein CARUB_v10008006mg [Capsella rubella]
 gb|EOA12285.1| hypothetical protein CARUB_v10008006mg [Capsella rubella]
Length=496

 Score =   363 bits (933),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/304 (59%), Positives = 235/304 (77%), Gaps = 8/304 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S +QFL N TILVTGA GFLAK+F+EKILRVQPNVKKLYLL+RA+D EAA +R  T
Sbjct  1    MELNS-VQFLRNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLLVRASDNEAAAKRLRT  59

Query  716  EIIGKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
            E   K++F++L+E  G    N ++ EKV  V GD+  ++L +KD  L+ RM  E+D VVN
Sbjct  60   EAFEKDLFKVLRENLGDEKLNRLLYEKVVSVPGDIGTDHLDIKDYDLVERMQKEIDVVVN  119

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            +AATT FDERYDV LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GL+ E P+ 
Sbjct  120  VAATTNFDERYDVGLGINTFGALNVLNFAKKCVKAQLLLHVSTAYVCGEKPGLLPEKPFV  179

Query  368  MGEALNGKSGL--DIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTY  195
            M E +  ++GL  DI+ E+ +M++ L++L   + S+E IT AMK+LG++RA+++GWPNTY
Sbjct  180  M-EDIRNENGLRLDINLERELMKKKLKELNEQDCSEEDITLAMKELGMERAKLHGWPNTY  238

Query  194  VFTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTC  15
            VFTK++GEM+LG  KE+LP+VIIRPT+IT T+ EPFPGW+EG+RT+DS+ + +GKG L C
Sbjct  239  VFTKSMGEMLLGNHKENLPLVIIRPTMITSTFSEPFPGWIEGLRTVDSVIIAFGKGVLKC  298

Query  14   FLGD  3
            FL D
Sbjct  299  FLVD  302



>ref|XP_002875672.1| oxidoreductase, acting on the CH-CH group of donors [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH51931.1| oxidoreductase, acting on the CH-CH group of donors [Arabidopsis 
lyrata subsp. lyrata]
Length=496

 Score =   363 bits (932),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 176/303 (58%), Positives = 232/303 (77%), Gaps = 6/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL + +QFL N TILVTGA GFLAK+F+EKILRVQPNVKKLYLL+RA+D EAA +R + 
Sbjct  1    MEL-NCVQFLQNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLLVRASDNEAATKRLHM  59

Query  716  EIIGKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
            E+  K++F++L+E  G    N+++ EKV  V GD++ + LG+ DS L  RM  E+D VVN
Sbjct  60   EVFEKDLFKVLRENLGDEKLNTLLYEKVVSVPGDIATDQLGINDSDLKERMRKEIDIVVN  119

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            +AATT FDERYDV LG+NT G  +VLNFAKKC K+ +LLHVSTAYV G K GLI E P+ 
Sbjct  120  VAATTNFDERYDVGLGINTFGALNVLNFAKKCVKVELLLHVSTAYVCGEKPGLIPEKPFI  179

Query  368  MGEALNGKS-GLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
            M +  N     LDI+ E+ +M++ L++L   + S+E IT +MK+LG++RA+ +GWPNTYV
Sbjct  180  MEDIRNDNGLQLDINLERELMKQRLKELNEQDCSEEDITLSMKELGMERAKRHGWPNTYV  239

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTK++GEM+LG  KE+LP+VIIRPT+IT T  EPFPGW+EG++T+DS+ + YGKG L CF
Sbjct  240  FTKSMGEMLLGNHKENLPLVIIRPTMITSTLSEPFPGWIEGLKTVDSVIIAYGKGVLKCF  299

Query  11   LGD  3
            L D
Sbjct  300  LVD  302



>emb|CAB88538.1| acyl CoA reductase-like protein [Arabidopsis thaliana]
Length=449

 Score =   360 bits (925),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 229/299 (77%), Gaps = 5/299 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            S + FL N TILVTGA GFLAK+F+EKILRVQPNV KLYL++RA+D EAA +R  TE   
Sbjct  4    SCVHFLQNKTILVTGATGFLAKVFVEKILRVQPNVNKLYLVVRASDNEAATKRLRTEAFE  63

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++L++  G    N+++SEKV  VAGD++ ++LG+KDS+L  RM  E+D VVN+AAT
Sbjct  64   KDLFKVLRDNLGDEKLNTLLSEKVVPVAGDIAMDHLGMKDSNLRERMQKEIDIVVNVAAT  123

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GL+ E P+ M E 
Sbjct  124  TNFDERYDIGLGINTFGALNVLNFAKKCVKAQLLLHVSTAYVCGEKPGLLPEKPFVMEEI  183

Query  356  LNGKS-GLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             N     LDI+ E+ +M++ L++L     S+E  T  MK+LG++RA+++GWPNTYVFTK+
Sbjct  184  CNENGLQLDINLERELMKQRLKELNEQGCSEEGTTFYMKELGMERAKLHGWPNTYVFTKS  243

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG  KE+LP+VIIRPT+IT T  EPFPGW+EG+RT+DS+ + YGKG L CFL D
Sbjct  244  MGEMLLGNHKENLPLVIIRPTMITSTLFEPFPGWIEGLRTVDSVIIAYGKGVLKCFLVD  302



>ref|XP_007020559.1| Fatty acid reductase 4 [Theobroma cacao]
 gb|EOY12084.1| Fatty acid reductase 4 [Theobroma cacao]
Length=492

 Score =   362 bits (928),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/300 (59%), Positives = 223/300 (74%), Gaps = 3/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL   ++FL   TILVT A GFLAKIF+EKILR+QPNV KLYLLLRAAD ++A +R ++
Sbjct  3    MELDHVVKFLQGKTILVTDATGFLAKIFVEKILRIQPNVNKLYLLLRAADAKSATKRLHS  62

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EII  E+F IL++  G   +S IS KV  V GD+S ENLGV +S L  +ML E++ VV++
Sbjct  63   EIIDTELFTILRDNWGSEFDSFISTKVIAVPGDISSENLGVNESKLREQMLKEIEIVVHV  122

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT F+ERYDVAL +NT G  + LNFAKKC  +++ LH STAYV G + G+I E P+ M
Sbjct  123  AATTGFNERYDVALAINTFGAFNALNFAKKCDAIKLFLHTSTAYVCGEQVGIILEKPFSM  182

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
             + L     LDI EEKR++EE L +L   +A  E I S M + G++RA++YGWPNTYVFT
Sbjct  183  DDTLLKTCKLDITEEKRIVEEKLDELRFHHAPNEVIKSEMMEFGLKRAKLYGWPNTYVFT  242

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG FK DLP+VIIRPT+I   YKEPFPGW+EG+RTID + + YGKGKLTCF G
Sbjct  243  KAMGEMLLGNFKGDLPLVIIRPTMIASPYKEPFPGWIEGVRTIDRVIVSYGKGKLTCFPG  302



>ref|XP_009610475.1| PREDICTED: fatty acyl-CoA reductase 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   361 bits (926),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/302 (55%), Positives = 228/302 (75%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME     QFL+  TI +TGA GFLAKI +EKILRVQPN KKLYLL+RA+DT++A +RF+ 
Sbjct  1    MESSKIQQFLEGKTIFITGATGFLAKILVEKILRVQPNAKKLYLLVRASDTKSAQKRFHE  60

Query  716  EIIGKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
            E++  E+F++L EK G    NS++ EKV  VAGD+S+E+ G+++S +   M  E+D ++N
Sbjct  61   EVMQTELFKVLTEKIGAKNLNSLVEEKVFPVAGDISFEDFGIQNSEIKDEMFKEIDIIIN  120

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
             AATT+FDERYD+A+ +N +G  ++L FAK+C K++I++HVSTAYV G  EG+I E  + 
Sbjct  121  SAATTRFDERYDIAMNINVLGAVNILKFAKRCEKVKIIVHVSTAYVCGEGEGVIPEKSFI  180

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            +GE LN  S LDID E++V+E+ L++L   N + + +T AMKDLGIQRA ++GWPNTY F
Sbjct  181  LGETLNKNSYLDIDVERKVIEDKLKELEAQNLTSKEVTIAMKDLGIQRATLHGWPNTYSF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM+LG  KE+L + IIRPTIIT TYKEPFPGW+EG++T+DS  + YGKG L    
Sbjct  241  TKAMGEMLLGHLKENLQLAIIRPTIITSTYKEPFPGWIEGVKTVDSFIVAYGKGILNFCF  300

Query  8    GD  3
            GD
Sbjct  301  GD  302



>ref|NP_190042.2| fatty acyl-CoA reductase 8 [Arabidopsis thaliana]
 sp|Q1PEI6.1|FACR8_ARATH RecName: Full=Fatty acyl-CoA reductase 8 [Arabidopsis thaliana]
 gb|ABE65991.1| acyl CoA reductase [Arabidopsis thaliana]
 gb|ABZ10955.1| fatty acyl CoA reductase [Arabidopsis thaliana]
 gb|AEE77915.1| fatty acyl-CoA reductase 8 [Arabidopsis thaliana]
Length=496

 Score =   361 bits (926),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 229/299 (77%), Gaps = 5/299 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            S + FL N TILVTGA GFLAK+F+EKILRVQPNV KLYL++RA+D EAA +R  TE   
Sbjct  4    SCVHFLQNKTILVTGATGFLAKVFVEKILRVQPNVNKLYLVVRASDNEAATKRLRTEAFE  63

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++L++  G    N+++SEKV  VAGD++ ++LG+KDS+L  RM  E+D VVN+AAT
Sbjct  64   KDLFKVLRDNLGDEKLNTLLSEKVVPVAGDIAMDHLGMKDSNLRERMQKEIDIVVNVAAT  123

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GL+ E P+ M E 
Sbjct  124  TNFDERYDIGLGINTFGALNVLNFAKKCVKAQLLLHVSTAYVCGEKPGLLPEKPFVMEEI  183

Query  356  LNGKS-GLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             N     LDI+ E+ +M++ L++L     S+E  T  MK+LG++RA+++GWPNTYVFTK+
Sbjct  184  CNENGLQLDINLERELMKQRLKELNEQGCSEEGTTFYMKELGMERAKLHGWPNTYVFTKS  243

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG  KE+LP+VIIRPT+IT T  EPFPGW+EG+RT+DS+ + YGKG L CFL D
Sbjct  244  MGEMLLGNHKENLPLVIIRPTMITSTLFEPFPGWIEGLRTVDSVIIAYGKGVLKCFLVD  302



>ref|XP_008382348.1| PREDICTED: LOW QUALITY PROTEIN: probable fatty acyl-CoA reductase 
5 [Malus domestica]
Length=311

 Score =   354 bits (909),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 224/303 (74%), Gaps = 8/303 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  +   +L   TILVTGA GFLA +FLEKILRVQP+VKK+Y LLRA D  +A  R + 
Sbjct  1    MESKTIQGYLQKKTILVTGATGFLAMVFLEKILRVQPDVKKVYXLLRAPDINSARDRMHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGKE+F++L+EK G   +S ISEKV  + GDVS ENLGVKDS+    ML+E+  ++N 
Sbjct  61   EIIGKELFKVLREKMGAYFDSFISEKVVAIPGDVSSENLGVKDSNXREEMLNEIQIILNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAE--SPY  372
            AATTKFDERYD+AL VNT G  HVL+FAKKC KL +LLHVSTAYV G + GLIAE  S  
Sbjct  121  AATTKFDERYDIALDVNTFGVLHVLSFAKKCLKLEMLLHVSTAYVCGERAGLIAEDLSSS  180

Query  371  KMGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
             + + +N    L    EK+++EE L +     AS+E IT  MKDLGI+RA++YGWPNTYV
Sbjct  181  LIDDIINNNFEL---HEKKLVEEKLNERKAQGASEEIITRTMKDLGIERAKLYGWPNTYV  237

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GE+ L   K++LP+VIIRP+++T TYKEPFPGW +G+RTIDS+  GYGKGKL C 
Sbjct  238  FTKAIGEIFLHHSKDNLPLVIIRPSVVTSTYKEPFPGWTQGLRTIDSIIAGYGKGKLKCL  297

Query  11   LGD  3
            L D
Sbjct  298  LVD  300



>ref|XP_007206366.1| hypothetical protein PRUPE_ppa017843mg [Prunus persica]
 gb|EMJ07565.1| hypothetical protein PRUPE_ppa017843mg [Prunus persica]
Length=493

 Score =   360 bits (925),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 227/303 (75%), Gaps = 5/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L +L N TILVTGA GFLA +F+EKILRVQP+VKK+YLLLRA++T +A  R + 
Sbjct  1    MELKSILAYLQNKTILVTGATGFLAMVFVEKILRVQPDVKKIYLLLRASNTNSATNRMHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GKE+F++L++K G   +S +S+KV  VAGDV+ E LGVKD  L   M +E + ++N 
Sbjct  61   EILGKELFRVLRDKHGADFDSFVSQKVVAVAGDVTSEKLGVKDFKLTEEMCNETEIILNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAES-PYK  369
            AATT FDERYD+AL VNT G  HV++FAKKC KL +LLHVSTAYV G + GLI E  P  
Sbjct  121  AATTNFDERYDIALDVNTFGILHVVSFAKKCLKLEMLLHVSTAYVCGERVGLIPEDLPSL  180

Query  368  MGEALNGKSGLDID-EEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
              + + G +  D   +EK V+E+ L +L    AS+E ITS MKD GI+RA+ YGWPNTYV
Sbjct  181  TDDIVKGTTKFDFKAQEKIVVEKKLTELKAQGASEEVITSTMKDFGIERAKHYGWPNTYV  240

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GE+ LG  K++LPVVIIRPT++T TYKEPFPGW++G RTIDS+  GY KGKLTC 
Sbjct  241  FTKAMGEVFLGRSKDELPVVIIRPTVVTSTYKEPFPGWIQGFRTIDSVIAGYCKGKLTCL  300

Query  11   LGD  3
            L D
Sbjct  301  LAD  303



>gb|ABK28586.1| unknown [Arabidopsis thaliana]
Length=497

 Score =   360 bits (925),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 229/299 (77%), Gaps = 5/299 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            S + FL N TILVTGA GFLAK+F+EKILRVQPNV KLYL++RA+D EAA +R  TE   
Sbjct  4    SCVHFLQNKTILVTGATGFLAKVFVEKILRVQPNVNKLYLVVRASDNEAATKRLRTEAFE  63

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++L++  G    N+++SEKV  VAGD++ ++LG+KDS+L  RM  E+D VVN+AAT
Sbjct  64   KDLFKVLRDNLGDEKLNTLLSEKVVPVAGDIAMDHLGMKDSNLRERMQKEIDIVVNVAAT  123

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYD+ LG+NT G  +VLNFAKKC K ++LLHVSTAYV G K GL+ E P+ M E 
Sbjct  124  TNFDERYDIGLGINTFGALNVLNFAKKCVKAQLLLHVSTAYVCGEKPGLLPEKPFVMEEI  183

Query  356  LNGKS-GLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             N     LDI+ E+ +M++ L++L     S+E  T  MK+LG++RA+++GWPNTYVFTK+
Sbjct  184  CNENGLQLDINLERELMKQRLKELNEQGCSEEGTTFYMKELGMERAKLHGWPNTYVFTKS  243

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG  KE+LP+VIIRPT+IT T  EPFPGW+EG+RT+DS+ + YGKG L CFL D
Sbjct  244  MGEMLLGNHKENLPLVIIRPTMITSTLFEPFPGWIEGLRTVDSVIIAYGKGVLKCFLVD  302



>ref|XP_010503105.1| PREDICTED: probable fatty acyl-CoA reductase 5 [Camelina sativa]
Length=497

 Score =   360 bits (925),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 177/304 (58%), Positives = 232/304 (76%), Gaps = 8/304 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S +QFL N TILVTGA GFLAK+F+EKILRVQPNVKKLYLL+RA+D EAA  R  T
Sbjct  1    MEL-SCVQFLRNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLLVRASDNEAATNRLRT  59

Query  716  EIIGKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
            E   K++F++L+E  G    N ++ EKV  V GD++ ++L + DS L  RM +E+D VVN
Sbjct  60   EAFEKDLFKVLRENLGDEKLNRLLYEKVVPVPGDIATDHLDINDSDLRERMQNEIDIVVN  119

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            +AATT FDERYDV LG+NT G  +VLNFAKKC K ++ LHVSTAYV G K GL+ E P+ 
Sbjct  120  VAATTNFDERYDVGLGINTFGALNVLNFAKKCDKAQLFLHVSTAYVCGEKAGLLPERPFV  179

Query  368  MGEALNGKSG--LDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTY  195
            M E +  ++G  LDI+ E+ +M++ L++L   + S+E  T AMK LG++RA+++GWPNTY
Sbjct  180  M-EDIRKENGFQLDINLERELMKQRLKELNEQDCSEEDTTLAMKKLGMERAKLHGWPNTY  238

Query  194  VFTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTC  15
            VFTK++GEM+LG  KE+LP+VIIRPT+IT T+ EPFPGW+EG+RT+DS+ + YGKG L C
Sbjct  239  VFTKSMGEMLLGNHKENLPLVIIRPTMITSTFSEPFPGWIEGLRTVDSVIIAYGKGVLKC  298

Query  14   FLGD  3
            FL D
Sbjct  299  FLVD  302



>ref|XP_006400746.1| hypothetical protein EUTSA_v10015841mg [Eutrema salsugineum]
 gb|ESQ42199.1| hypothetical protein EUTSA_v10015841mg [Eutrema salsugineum]
Length=503

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 235/310 (76%), Gaps = 17/310 (5%)
 Frame = -3

Query  881  ALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGK  702
             +QFL+N T+L+TGA+GFLAK+FLE+ILR+QPNVK+LYLL+RA+D ++A +R ++E+  K
Sbjct  5    CVQFLENKTMLITGASGFLAKVFLERILRLQPNVKRLYLLVRASDKKSAEKRLHSEVFEK  64

Query  701  EIFQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATT  534
            ++F++L++  GN    ++ISEKV  V GDVS  N+GV DS+LL  M+ EVD V++ AATT
Sbjct  65   DLFRVLRKNVGNETLNALISEKVVPVPGDVSLNNMGVSDSNLLQAMMQEVDIVLHSAATT  124

Query  533  KFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEAL  354
            +FD+RYDVALG+NT G  +VLNFAKKC K  +LLHVSTAYV G + GLI E+ + MGE L
Sbjct  125  RFDDRYDVALGINTFGALNVLNFAKKCVKSELLLHVSTAYVCGERSGLILENSFAMGETL  184

Query  353  NGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQR-------------ARMY  213
            NGK+ +DI+ E +++E+ L+ L     S+E I  AM+DL I++             A++Y
Sbjct  185  NGKAKVDINAEMQLVEQKLKQLREQRCSEEEINEAMRDLRIEKVCVQFQIQKLETWAKLY  244

Query  212  GWPNTYVFTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYG  33
            GWPNTY F+KA+GEM++G+++E +P+VIIRPTIIT T  +PFPGW+EG++T+DS+   YG
Sbjct  245  GWPNTYAFSKAMGEMLIGQYRESMPIVIIRPTIITSTISDPFPGWIEGLKTVDSVITSYG  304

Query  32   KGKLTCFLGD  3
            KG L CFL D
Sbjct  305  KGMLKCFLVD  314



>ref|XP_010676595.1| PREDICTED: fatty acyl-CoA reductase 3-like [Beta vulgaris subsp. 
vulgaris]
Length=434

 Score =   356 bits (914),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 170/301 (56%), Positives = 224/301 (74%), Gaps = 4/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            M+ GS  +FL N TI VTGA GF+AKI LEKILRVQPNVK+LYLL+RA D  +A  R   
Sbjct  1    MDFGSIAEFLRNKTIFVTGATGFIAKILLEKILRVQPNVKRLYLLVRATDANSADSRLRD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GKE+F++L+EK G   +S +SEK+  VAGD SYENLG+    +   M   +D V+N+
Sbjct  61   EVLGKELFKVLREKWGSDFDSFVSEKIIAVAGDASYENLGLAADQI-EEMYENIDIVINV  119

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA TKF ERYDVALGVNT+G K+V+NFAK C  + +L+HVSTAYV G K GLI+E+ Y M
Sbjct  120  AAATKFKERYDVALGVNTLGAKNVVNFAKNCANIELLIHVSTAYVCGEKAGLISENLYAM  179

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE L+G++ LDID EK+++EE +R+L      +++I   MK LG QRA++YGWPNTYVFT
Sbjct  180  GETLSGEAALDIDSEKKLIEETIRNLVARKVPEQAIRERMKILGSQRAKLYGWPNTYVFT  239

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEMV+ + + +LPVV++RPTI+  T KEPF GW+EG RTID++ + YGKG L+    
Sbjct  240  KAMGEMVIRKLRGNLPVVVMRPTIVCSTLKEPFSGWLEGCRTIDTVTVMYGKGTLSVLSA  299

Query  5    D  3
            D
Sbjct  300  D  300



>gb|KDP42365.1| hypothetical protein JCGZ_01941 [Jatropha curcas]
Length=367

 Score =   353 bits (907),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 219/301 (73%), Gaps = 33/301 (11%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS +QFL+N T+LVTGA GFLAKIF+EKI RVQPN KKLYLLLRAADT +A QRF  
Sbjct  1    MELGSIVQFLENKTVLVTGATGFLAKIFVEKICRVQPNAKKLYLLLRAADTTSANQRFYD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++GK++F+++ EK G   NS+I++K+ +V                              
Sbjct  61   EVLGKDLFRVVTEKLGANLNSIIAKKIGIVP-----------------------------  91

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
             ATT+FDERYDVALG NTMG K+VL FAK C KL++L+HVSTAYV G   G I E PY++
Sbjct  92   -ATTRFDERYDVALGTNTMGAKNVLCFAKNCLKLKLLIHVSTAYVCGESSGFIMEKPYQL  150

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG  GL+I+EEK++++E L  L  + A++  I  AMKD+GI+RA+ YGWPNTYVFT
Sbjct  151  GETLNGVLGLNIEEEKKLVDEKLNQLQSERAAEADIKKAMKDMGIKRAKTYGWPNTYVFT  210

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM++G+ KE LPVVIIRPTI+T TYKEPFPGW+EG RTID+L   YG+G+L  F+ 
Sbjct  211  KAMGEMIIGQLKETLPVVIIRPTIVTSTYKEPFPGWIEGARTIDALITSYGRGELPFFVA  270

Query  5    D  3
            D
Sbjct  271  D  271



>ref|XP_011005177.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Populus 
euphratica]
Length=282

 Score =   350 bits (898),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 166/282 (59%), Positives = 221/282 (78%), Gaps = 4/282 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MELGS  +FL+N +ILV GAAGFLAKIF+EKILRVQP VKKLYLLLRA DT++A +R + 
Sbjct  1    MELGSITEFLNNKSILVIGAAGFLAKIFVEKILRVQPKVKKLYLLLRAVDTKSAEERLHN  60

Query  716  EIIGKEIFQILKEKCGNSVIS---EKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+IG  +F +L+E+ G S+ S   EK+T V GD+S  +LG++DS L  ++ +E+D V+N 
Sbjct  61   EVIGMALFDVLREQHGASLYSFVYEKLTPVPGDISCVDLGIRDSLLKDQIWNEIDTVINF  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+NT+GP H+LNF KKC  +++L+HVSTAYV G   GLI E P+ +
Sbjct  121  AATTNFDERYDVALGINTLGPLHLLNFVKKCNNVKVLVHVSTAYVCGEDAGLIQEKPFPL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G++  G   +DID EK+++EE L +L  ++A + +ITS MKD G +RARM+GWPNTYVFT
Sbjct  181  GKSKKGTEMIDIDMEKKLVEEKLTNLHSEHAEESAITSYMKDYGSKRARMFGWPNTYVFT  240

Query  185  KALGEMVLGEFKED-LPVVIIRPTIITGTYKEPFPGWVEGIR  63
            KA+GEM+L  +  D +P+VIIRPTI+T TY+EPFPGW+EG+R
Sbjct  241  KAMGEMLLVHYSRDTVPLVIIRPTIVTSTYQEPFPGWIEGVR  282



>ref|XP_010514782.1| PREDICTED: probable fatty acyl-CoA reductase 5 [Camelina sativa]
Length=497

 Score =   358 bits (918),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 231/304 (76%), Gaps = 8/304 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL + +Q L N TILVTGA GFLAK+F+EKILRVQPNVKKLYLL+RA+D EAA +R  T
Sbjct  1    MEL-TCVQLLRNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLLVRASDNEAATKRLRT  59

Query  716  EIIGKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
            E   K++F++L+E  G    N ++ EK+  V GD++ ++L + DS L  RM  E+D VVN
Sbjct  60   EAFEKDLFKVLRENLGDEKLNRLLHEKIVPVPGDIATDHLDINDSDLRERMQKEIDIVVN  119

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
            +AATT FDERYDV LG+NT G  +VLNFAKKC K ++ LHVSTAYV G K GL+ E P+ 
Sbjct  120  VAATTNFDERYDVGLGINTFGALNVLNFAKKCDKAQLFLHVSTAYVCGEKAGLLPEKPFV  179

Query  368  MGEALNGKSGL--DIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTY  195
            M E +  ++GL  DI+ E+ +M++ L++L   + S+E  T AMK LG++RA+++GWPNTY
Sbjct  180  M-EDIRNENGLQLDINLERELMKQRLKELNEQDCSEEDTTLAMKKLGMERAKLHGWPNTY  238

Query  194  VFTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTC  15
            VFTK++GEM+LG  KE+LP+VIIRPT+IT T+ EPFPGW+EG+RT+DS+ + YGKG L C
Sbjct  239  VFTKSMGEMLLGNHKENLPLVIIRPTMITSTFSEPFPGWIEGLRTVDSVIIAYGKGVLKC  298

Query  14   FLGD  3
            FL D
Sbjct  299  FLVD  302



>ref|XP_010313342.1| PREDICTED: fatty acyl-CoA reductase 1-like isoform X2 [Solanum 
lycopersicum]
Length=395

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/294 (55%), Positives = 224/294 (76%), Gaps = 4/294 (1%)
 Frame = -3

Query  872  FLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKEIF  693
            FL+  TI +TGA GFLAKI +EKILR+QPNV+KL+LL+RA+D ++  +RFN E++  E+F
Sbjct  4    FLEGKTIFITGATGFLAKILIEKILRIQPNVRKLFLLIRASDAKSVRKRFNDEVMQTELF  63

Query  692  QILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKFD  525
             +L+EK G    NS+I EKV  VAGD+S+E+ G+++S +  +M  E+D ++N AATT+FD
Sbjct  64   SVLREKIGANNLNSLIEEKVFPVAGDISFEDFGIENSDMKNKMFKEIDIIINSAATTRFD  123

Query  524  ERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNGK  345
            ERYD+A+ +N +G  +VL FAK+C  ++I++HVSTAYV G  EG+I E  + +GE LN  
Sbjct  124  ERYDIAMDINVLGALNVLKFAKRCENVKIIVHVSTAYVCGEGEGVIPEKSFTLGETLNKN  183

Query  344  SGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGEMV  165
            S LDID E+ V++E L+ L   + + + +T AM+DLGIQRA ++GWPNTY FTKA+GEM+
Sbjct  184  SKLDIDVEREVIDEKLKVLEAQSLTTKEVTIAMRDLGIQRANLHGWPNTYSFTKAMGEML  243

Query  164  LGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            LG +KE+L +VIIRPTIIT TYKEPFPGW+EG++T+DS  L YGKG +    GD
Sbjct  244  LGHYKEELKLVIIRPTIITSTYKEPFPGWIEGVKTVDSFILAYGKGVMNFCFGD  297



>ref|XP_007208215.1| hypothetical protein PRUPE_ppa018909mg [Prunus persica]
 gb|EMJ09414.1| hypothetical protein PRUPE_ppa018909mg [Prunus persica]
Length=493

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/302 (58%), Positives = 229/302 (76%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L +L N TILVTGA GFL  +F+EKILRVQP+VKK+YLLLRA+DT++A  R + 
Sbjct  1    MELKSILGYLQNKTILVTGATGFLGMVFVEKILRVQPDVKKIYLLLRASDTKSATDRMHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            +IIGKE+F++L+EK G   +S I++KV  V GDV++++LGVK+  L   M ++++ ++N 
Sbjct  61   QIIGKELFRVLREKWGSEFDSFIAKKVVAVPGDVTFDDLGVKEFKLREEMWTDIEIILNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            A TT FDERYD+AL VNT G +HVL+FAKKC KL ILLHVSTAY+ G +EGLI E    M
Sbjct  121  AGTTNFDERYDIALSVNTFGVQHVLSFAKKCLKLEILLHVSTAYICGEREGLILEDSSCM  180

Query  365  GEALNGKSGLDID-EEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
             E     +  D   +EK ++EE L +L   NA++E IT+ MKD GI+RA+++GWPNTYVF
Sbjct  181  EEMEKEITTFDFKVQEKNLVEEKLNELKAQNATEEVITTTMKDFGIERAKLHGWPNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GE++L   K++L VVIIRPT++T TYKEPFPGWV+G RTIDS+  GY KGKLTC L
Sbjct  241  TKAMGEILLRHSKDNLSVVIIRPTVVTSTYKEPFPGWVQGFRTIDSVIAGYCKGKLTCLL  300

Query  8    GD  3
             D
Sbjct  301  VD  302



>ref|XP_008228895.1| PREDICTED: fatty acyl-CoA reductase 3-like [Prunus mume]
Length=507

 Score =   357 bits (917),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/303 (58%), Positives = 226/303 (75%), Gaps = 4/303 (1%)
 Frame = -3

Query  899  AMELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFN  720
             MEL S L +L N TILVTGA GFL  +F+EKILRVQP+VKKLYLLLRA+DT++A  R  
Sbjct  14   TMELKSILGYLQNKTILVTGATGFLGMVFVEKILRVQPDVKKLYLLLRASDTKSATDRMQ  73

Query  719  TEIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
             +IIGKE+F++L+EK G   +S I++KV  V GDV++++LGVK+  L   M ++++ ++N
Sbjct  74   NQIIGKELFRVLREKWGAEFDSFIAKKVVAVPGDVTFDDLGVKEFRLREEMCTDIEIILN  133

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
             A TT FDERYD+AL VNT G +HVL+FAKKC +L +LLHVSTAYV G +EGLI E    
Sbjct  134  SAGTTNFDERYDIALSVNTFGVQHVLSFAKKCLRLEMLLHVSTAYVCGEREGLILEDSSC  193

Query  368  MGEALNGKSGLDID-EEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
            M E     +  D   +EK ++EE L +L   NA++E IT  MKD GI+RA++YGWPNTYV
Sbjct  194  MDEMEKEITKFDFKVQEKNLVEEKLNELKAQNATEEVITITMKDFGIERAKLYGWPNTYV  253

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GE++L   KE+L VVIIRPT+IT TYKEPFPGWV+G RTIDS+   Y KGKLTC 
Sbjct  254  FTKAIGEILLRHSKENLSVVIIRPTVITSTYKEPFPGWVQGFRTIDSVIAAYCKGKLTCL  313

Query  11   LGD  3
            L D
Sbjct  314  LVD  316



>ref|XP_008228881.1| PREDICTED: fatty acyl-CoA reductase 3-like [Prunus mume]
Length=493

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 226/302 (75%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L +L N TILVTGA GFL  +F+EKILRVQP+V KLYLLLRA+DT++A  R   
Sbjct  1    MELKSILGYLQNKTILVTGATGFLGMVFVEKILRVQPDVTKLYLLLRASDTKSATDRMQN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            +IIGKE+F++L+EK G   +S I++KV  V GDV++++LGVK+  L   M ++++ ++N 
Sbjct  61   QIIGKELFRVLREKWGAEFDSFIAKKVVAVPGDVTFDDLGVKEFRLREEMCTDIEIILNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            A TT FDERYD+AL VNT G +HVL+FAKKC +L +LLHVSTAYV G +EGLI E    M
Sbjct  121  AGTTNFDERYDIALSVNTFGVQHVLSFAKKCLRLEMLLHVSTAYVCGEREGLILEDSSCM  180

Query  365  GEALNGKSGLDID-EEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
             E     +  D   +EK ++EE L +L   NA++E IT+ MKD GI+RA++YGWPNTYVF
Sbjct  181  DEMEKEITKFDFKVQEKNLVEEKLNELKAQNATEEVITTTMKDFGIERAKLYGWPNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GE++L   KE+L VVIIRPT+IT TYKEPFPGWV+G RTIDS+   Y KGKLTC L
Sbjct  241  TKAIGEILLRHSKENLSVVIIRPTVITSTYKEPFPGWVQGFRTIDSVIAAYCKGKLTCLL  300

Query  8    GD  3
             D
Sbjct  301  VD  302



>ref|XP_006349114.1| PREDICTED: fatty acyl-CoA reductase 1-like [Solanum tuberosum]
Length=485

 Score =   356 bits (913),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 225/294 (77%), Gaps = 8/294 (3%)
 Frame = -3

Query  872  FLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKEIF  693
            FL+  TI +TGA GFLAKI +EKILR+QPNV+KL+LL+RA+DT++A +RFN E++  E+F
Sbjct  4    FLEGKTIFITGATGFLAKILVEKILRIQPNVRKLFLLVRASDTKSAKKRFNDEVMQTELF  63

Query  692  QILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKFD  525
             +L+EK G    NS+I EKV  + GD+S E+ G+++S     M  E+D ++N AATT+FD
Sbjct  64   SVLREKIGANNLNSLIKEKVFPIVGDISLEDFGIENS----EMFKEIDIIINSAATTRFD  119

Query  524  ERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNGK  345
            ERYD+A+ +N +G  +VL FAKKC  ++IL+HVSTAYV G  EG+I E  + +GE LN  
Sbjct  120  ERYDIAMNINVLGAFNVLKFAKKCSNVKILVHVSTAYVCGEGEGVIPEKSFVLGETLNKN  179

Query  344  SGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGEMV  165
            + L+ID E++V+EE L++L   N + + +T AM+DLGIQRA ++GWPNTY FTKA+GEM+
Sbjct  180  TKLEIDVERKVIEEKLKELEDQNLTTKEVTIAMRDLGIQRANLHGWPNTYSFTKAMGEML  239

Query  164  LGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            LG +KEDL +VIIRPTIIT TYKEPFPGW+EG++T+DS  LGYGKG L    GD
Sbjct  240  LGHYKEDLRLVIIRPTIITSTYKEPFPGWIEGVKTVDSFILGYGKGVLNFCFGD  293



>ref|XP_009364296.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Pyrus 
x bretschneideri]
Length=492

 Score =   355 bits (912),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 178/303 (59%), Positives = 226/303 (75%), Gaps = 5/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL + L +L +  ILVTGA GFLA +FLEKILRVQPNV+K+YLL+RA DT +A  R + 
Sbjct  1    MELKTILGYLKDKIILVTGATGFLAMVFLEKILRVQPNVEKVYLLVRAPDTNSAKDRMHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK +F++L+EK G   ++ IS+KV  V GDV++ENLGVKD  L   M + V  ++N 
Sbjct  61   EIIGKALFKVLREKLGADFDNFISKKVVAVPGDVTFENLGVKDIKLREEMFNGVQIILNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK-  369
            AATT FDERYD+AL VNT G  H+L+FAKKC KL +LLH+STAYV G +EGLI E     
Sbjct  121  AATTNFDERYDIALDVNTFGVLHLLSFAKKCLKLEMLLHISTAYVCGEREGLIPEDLSSF  180

Query  368  MGEALNGKSGLDID-EEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
            M E + G +  +   +EK+V+EE L DL  + AS+E+I S MKD GI+RA++YGWPNTYV
Sbjct  181  MDEKVKGTTKFNFQVQEKKVVEEKLNDLKAEGASEENIRSTMKDFGIERAKLYGWPNTYV  240

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GE+ L   K +LP+VIIRPT++T TYKEPFPGW++G RTIDS+  GY KGKLTC 
Sbjct  241  FTKAMGEIFLENSKGNLPLVIIRPTVVTSTYKEPFPGWIQGFRTIDSVIAGYCKGKLTCL  300

Query  11   LGD  3
            L D
Sbjct  301  LAD  303



>ref|XP_009610473.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=491

 Score =   355 bits (912),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 169/301 (56%), Positives = 224/301 (74%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME     QFL+  TI +TGA GFLAKI +EKILR+QPNVKKL+LLLR +DT++A  RF  
Sbjct  1    MESSKIEQFLEGKTIFITGATGFLAKILVEKILRIQPNVKKLFLLLRGSDTKSARIRFKE  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+  E+F +L+EK G   N++I EKV  VAGDVS+E+ G+++  +   M  E+D +++ 
Sbjct  61   EILQAELFNVLREKLGAKLNNLIEEKVFPVAGDVSFEDFGIENMEMKDEMFKEIDTIIHS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA+T+FDERYD+A+  N  G  +VL FAK+C KL+IL+HVSTAYV G  EG+IAE  +++
Sbjct  121  AASTRFDERYDIAMKTNVQGAVNVLKFAKRCAKLKILVHVSTAYVCGEGEGVIAEKSFRL  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LN    LDID EK+V+E+ L++L   N + + +T  M+DLGIQRA ++GWPNTY FT
Sbjct  181  GETLNKDLYLDIDVEKKVIEDKLKELGAQNLTSKEVTMTMRDLGIQRATLHGWPNTYSFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG  KE+L +VIIRPTIIT TY EPFPGW+EG++T+DS  L YGKG    FLG
Sbjct  241  KAMGEMLLGHLKENLHLVIIRPTIITSTYYEPFPGWIEGVKTVDSFFLAYGKGISNIFLG  300

Query  5    D  3
            D
Sbjct  301  D  301



>ref|XP_009373003.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Pyrus 
x bretschneideri]
Length=490

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 222/303 (73%), Gaps = 8/303 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  +  ++L   T+LVTGA GFLA +FLEKILRVQP+VKK+YLLLRA D  +A  R + 
Sbjct  1    MESKTIQEYLQKKTVLVTGATGFLAMVFLEKILRVQPDVKKVYLLLRAPDINSARDRMHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGKE+F++L+EK G   +S ISEKV  + GDVS ENLGVKDS     M +E+  ++N 
Sbjct  61   EIIGKELFKVLREKMGAYFDSFISEKVVAIPGDVSSENLGVKDSKFREEMFNEIQIILNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAE--SPY  372
            AATTKFDERYD+AL VNT G  HVL+FAKKC KL +LLHVSTAYV   K GLIAE  S  
Sbjct  121  AATTKFDERYDIALDVNTFGVLHVLSFAKKCLKLEMLLHVSTAYVCAEKAGLIAEDLSTS  180

Query  371  KMGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
             + + +N    L    EK+++EE L +     AS+E IT  MKDLG +RA++YGWPNTYV
Sbjct  181  LIDDIINNNFEL---HEKKLVEEKLNERKAQGASEEIITRTMKDLGTERAKLYGWPNTYV  237

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GE+ L   K++LP+VIIRPTI+T TYKEPFPGW +G+RTIDS+  GYGKGKL C 
Sbjct  238  FTKAIGEIFLHHSKDNLPLVIIRPTIVTSTYKEPFPGWTQGLRTIDSVFAGYGKGKLKCL  297

Query  11   LGD  3
            L D
Sbjct  298  LVD  300



>ref|XP_004241312.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X1 [Solanum 
lycopersicum]
Length=491

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/302 (54%), Positives = 224/302 (74%), Gaps = 5/302 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  +  QF    TIL+ GA GFLAKI +EKILRVQPNVKKLYLL+RA+D  +A QRF  
Sbjct  1    MESRTIEQF-QGKTILIIGATGFLAKILVEKILRVQPNVKKLYLLIRASDNNSARQRFTN  59

Query  716  EIIGKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
            E++  E+F +++E+ G    +SV+ +KV  ++GD+S +N+G+K+S L   M  E+D ++N
Sbjct  60   EVVMSELFNVIRERMGTIYLSSVVDDKVLPISGDISKKNMGIKNSQLREHMFKEIDIIIN  119

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
             AATT FDERYD+A+ +N +G K+VL FAK C K+++LLHVSTAYV G   G+++E    
Sbjct  120  SAATTNFDERYDIAMNINVIGAKNVLKFAKSCKKVKMLLHVSTAYVCGKTTGILSEKSLV  179

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            MGE LN  S LD+D+E+ ++    R+L   NA+ + +T AMK+LG+QRAR++GW NTY F
Sbjct  180  MGETLNKNSYLDMDKERSIIASKFRELRAQNATAKELTIAMKELGLQRARLHGWQNTYSF  239

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM+LG  KE+L +V+IRPTIITGTYKEPFPGW+EG++T+DS  L YGKG +  + 
Sbjct  240  TKAMGEMILGHLKENLEIVVIRPTIITGTYKEPFPGWIEGVKTVDSFLLAYGKGGMKFYY  299

Query  8    GD  3
            GD
Sbjct  300  GD  301



>ref|XP_004291621.1| PREDICTED: fatty acyl-CoA reductase 1-like [Fragaria vesca subsp. 
vesca]
Length=493

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/302 (57%), Positives = 226/302 (75%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            M L S L +L N TIL+TGA GFL  +F+EKILRVQPN+KKLYLL+RA+DT++A  R + 
Sbjct  1    MGLDSVLGYLQNKTILITGATGFLGMVFVEKILRVQPNLKKLYLLVRASDTKSATHRMHD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGKE+F++L++K G   +S ISEKV  + GDV+ ENLGV +  L+  + SE+  + N 
Sbjct  61   EIIGKELFRVLRQKWGTDFDSFISEKVVALPGDVTIENLGVSEPRLMEELCSEIQIIFNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYD++L VNT G   VL+FAKKC KL++LLHVSTAYV G + GLI E    M
Sbjct  121  AATTNFDERYDISLAVNTFGTLRVLSFAKKCLKLQMLLHVSTAYVCGERAGLIPEDSSSM  180

Query  365  GEALNGKSGLDIDE-EKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
             + +     +D ++ EK +++E L +L   +AS+E +T+ MKD GI+RAR+YGWPNTYVF
Sbjct  181  DKMIKEMDNIDFEKVEKNLVKEKLNELKGQDASKEVVTNTMKDFGIKRARLYGWPNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GE+ L   K++LP+VI+RPTI+T TYKEPFPGW++G RTIDS+  GY KGKLTC L
Sbjct  241  TKAMGEIFLQRSKDNLPLVIVRPTIVTSTYKEPFPGWIQGFRTIDSVIAGYCKGKLTCLL  300

Query  8    GD  3
             D
Sbjct  301  VD  302



>ref|XP_011090362.1| PREDICTED: fatty acyl-CoA reductase 3-like [Sesamum indicum]
Length=495

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/303 (55%), Positives = 221/303 (73%), Gaps = 5/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME     ++ +  TI +TGA GFLAKIF EKILRVQPN+KKL+LL+R      + QR   
Sbjct  1    MEDTQIFEYFEGKTIFITGATGFLAKIFAEKILRVQPNIKKLFLLIRETTKTTSKQRLQE  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++  E+F++L+E+ G   N+ +  K+  V+GDVS ENLG+ D  +   M  E+D +VN 
Sbjct  61   EVVDTELFRVLREEYGVNFNTALLSKIVPVSGDVSLENLGIVDPEVRENMWEEIDIIVNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYD+AL +N +G  HV NFA KC KL +L+HVSTA+V G + GLI E P+ M
Sbjct  121  AATTKFDERYDIALRINALGASHVRNFASKCSKLEMLVHVSTAFVHGTRIGLIPEKPFSM  180

Query  365  GEALNGK--SGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
            GE L+G   S LDI++EK+++EE L  L    A+++ IT AM+DLGI+RA ++GWPNTYV
Sbjct  181  GETLDGSKISYLDINKEKKIIEEKLSRLQTQKATEKEITRAMRDLGIERATLHGWPNTYV  240

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GEM L  FKE   V+IIRPTIIT TY+EPFPGW+EG+RT+DS+ +GYG+GKL  F
Sbjct  241  FTKAIGEMFLENFKEKATVIIIRPTIITSTYREPFPGWIEGVRTLDSIFVGYGQGKLKFF  300

Query  11   LGD  3
            +GD
Sbjct  301  VGD  303



>ref|XP_010313341.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Solanum 
lycopersicum]
Length=489

 Score =   353 bits (907),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/294 (55%), Positives = 224/294 (76%), Gaps = 4/294 (1%)
 Frame = -3

Query  872  FLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKEIF  693
            FL+  TI +TGA GFLAKI +EKILR+QPNV+KL+LL+RA+D ++  +RFN E++  E+F
Sbjct  4    FLEGKTIFITGATGFLAKILIEKILRIQPNVRKLFLLIRASDAKSVRKRFNDEVMQTELF  63

Query  692  QILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKFD  525
             +L+EK G    NS+I EKV  VAGD+S+E+ G+++S +  +M  E+D ++N AATT+FD
Sbjct  64   SVLREKIGANNLNSLIEEKVFPVAGDISFEDFGIENSDMKNKMFKEIDIIINSAATTRFD  123

Query  524  ERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNGK  345
            ERYD+A+ +N +G  +VL FAK+C  ++I++HVSTAYV G  EG+I E  + +GE LN  
Sbjct  124  ERYDIAMDINVLGALNVLKFAKRCENVKIIVHVSTAYVCGEGEGVIPEKSFTLGETLNKN  183

Query  344  SGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGEMV  165
            S LDID E+ V++E L+ L   + + + +T AM+DLGIQRA ++GWPNTY FTKA+GEM+
Sbjct  184  SKLDIDVEREVIDEKLKVLEAQSLTTKEVTIAMRDLGIQRANLHGWPNTYSFTKAMGEML  243

Query  164  LGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            LG +KE+L +VIIRPTIIT TYKEPFPGW+EG++T+DS  L YGKG +    GD
Sbjct  244  LGHYKEELKLVIIRPTIITSTYKEPFPGWIEGVKTVDSFILAYGKGVMNFCFGD  297



>emb|CDY08707.1| BnaC03g54750D [Brassica napus]
Length=499

 Score =   353 bits (905),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 228/301 (76%), Gaps = 7/301 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAK--IFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEI  711
            + +QFL N TILVTGA GFLAK  I L KILRVQPNVKKLYL++RA+D+EAA++R   E+
Sbjct  5    NCVQFLQNKTILVTGATGFLAKGIIILSKILRVQPNVKKLYLVVRASDSEAAMKRLRAEV  64

Query  710  IGKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLA  543
              K++F++L+E  G    N+++SEKV  VAGD+S +  GVKDS+L  RM  E+D VVN+A
Sbjct  65   FEKDLFKVLRENIGEENLNTLLSEKVVPVAGDISTDCFGVKDSNLRERMQKEIDIVVNVA  124

Query  542  ATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMG  363
            ATT FDERYDV L +NT G  +VLNFAKKC K ++LLHVSTAYV G + GL+ E P+ M 
Sbjct  125  ATTNFDERYDVGLEINTFGALNVLNFAKKCVKAQLLLHVSTAYVCGEESGLLREKPFAME  184

Query  362  EALN-GKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            E  N     LDI+ E  +M++ L++L   + S E IT +MK+LG++RA+++GWPNTYVFT
Sbjct  185  EIRNEAGHQLDINFEMDLMKKRLKELHDQDCSDEDITLSMKELGMERAKLHGWPNTYVFT  244

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K++GEM++G  +E LP+VIIRPT+IT T  EPFPGW+EG+RT+DS+ + YGKG L CFL 
Sbjct  245  KSMGEMLIGNHRESLPLVIIRPTMITSTLSEPFPGWIEGLRTVDSVIVAYGKGVLKCFLV  304

Query  5    D  3
            D
Sbjct  305  D  305



>ref|XP_009120662.1| PREDICTED: putative fatty acyl-CoA reductase 7 [Brassica rapa]
Length=491

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/296 (54%), Positives = 229/296 (77%), Gaps = 4/296 (1%)
 Frame = -3

Query  878  LQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKE  699
            +QFL+N T+LVTGA+GFL+K+F+E++L +QPNVKKLYLL+RA+D ++A QR + E+  K+
Sbjct  6    VQFLENKTLLVTGASGFLSKVFVERVLSLQPNVKKLYLLVRASDNKSAEQRLHNEVFEKD  65

Query  698  IFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTK  531
            +F++L++  G    N+++SEKV  V GDV+  N+GV DS+LL  M+ E D VV+ AATT+
Sbjct  66   LFKVLRKNIGDESLNALVSEKVVPVPGDVTLNNMGVSDSNLLQDMMQETDIVVHAAATTR  125

Query  530  FDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALN  351
            FDERYDVAL +NT G  +VLNFAKK  K ++LLHVSTAYV G + GLI E P+ MG+ L+
Sbjct  126  FDERYDVALRINTFGALNVLNFAKKSVKAQLLLHVSTAYVCGERSGLIQEIPFAMGDTLH  185

Query  350  GKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGE  171
            GK+ +DI+ E +++E+ L+ L     S+E    AM+DLG++RA+ +G PNTYVFTK +GE
Sbjct  186  GKNKVDINTEMQLVEQRLKQLVEQGCSEEETKHAMRDLGLKRAKHFGLPNTYVFTKVMGE  245

Query  170  MVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            M LG ++E++P+V+IRP +IT T+ +PFPGW+EG++T+D++ + YGKG L CFL D
Sbjct  246  MFLGHYRENMPIVVIRPAMITSTFSDPFPGWIEGVKTVDTVIVSYGKGMLKCFLVD  301



>ref|XP_010454504.1| PREDICTED: putative fatty acyl-CoA reductase 7 [Camelina sativa]
Length=489

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/299 (57%), Positives = 228/299 (76%), Gaps = 4/299 (1%)
 Frame = -3

Query  887  GSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEII  708
             + LQFL+N TILVTGA+GFLAK+ +E+ILR+QPNVKKLYLL+RA+D ++A QR   E+ 
Sbjct  3    ATCLQFLENKTILVTGASGFLAKVLVERILRLQPNVKKLYLLVRASDKKSAEQRLYKEVF  62

Query  707  GKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAA  540
             KE+F+++K   G    N++ISEKV  V GD+S +++GV D++LL  M+ ++D ++N AA
Sbjct  63   KKELFRVIKRNIGDEGLNTLISEKVVPVPGDISLKDIGVHDANLLQDMMQDIDIIINSAA  122

Query  539  TTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGE  360
            TT+FDERYDVALG+NT G  +VLNFAKKC K ++LLHVSTAYV G + G I E P+ MGE
Sbjct  123  TTRFDERYDVALGINTFGAINVLNFAKKCLKPKLLLHVSTAYVCGERSGHILEKPFAMGE  182

Query  359  ALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKA  180
             L GK+ +DI+ E R+ E+ L+ L     S+E     MKDL ++RA++YGWPNTYVFTKA
Sbjct  183  TLKGKNKVDINTEMRLAEQKLKQLIEQGCSKEQTEQVMKDLALKRAKLYGWPNTYVFTKA  242

Query  179  LGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +GEM+LG ++  +P VIIRPTIIT T  +PFPGW+EG++T+DS+ L YGKG L CFL D
Sbjct  243  MGEMLLGHYRGSMPTVIIRPTIITSTISDPFPGWIEGLKTVDSVILSYGKGMLKCFLVD  301



>ref|XP_010520424.1| PREDICTED: fatty acyl-CoA reductase 1-like isoform X3 [Tarenaya 
hassleriana]
Length=502

 Score =   352 bits (902),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 223/298 (75%), Gaps = 7/298 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + +QFL N TILVTGA+GFLAK+F+EKILRVQPNVKKLYLL+RA   E+A+QR   E++ 
Sbjct  21   NCVQFLHNKTILVTGASGFLAKVFVEKILRVQPNVKKLYLLVRAPTKESAMQRLRIEVLE  80

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++LK+  G    N  +SEKV  V GD+S ++LGV D  L  +M   +D VVN+A  
Sbjct  81   KDLFRVLKKDLGDENLNKFVSEKVVPVPGDISMDDLGVDDFDLRQQMWEHIDVVVNVAGN  140

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYD+ALG+NT G  +VLNFAK C K ++LLHVSTAYV G K GL+ E   K  E 
Sbjct  141  TNFDERYDIALGINTFGALNVLNFAKNCVKPQLLLHVSTAYVCGEKSGLLLE---KSLET  197

Query  356  LNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKAL  177
            LNG   LDI+ E  +M   L++L   + S++    ++KDLG++RAR++GWPNTYVFTKA+
Sbjct  198  LNGNGKLDINAEMELMRRTLKELHNRDCSEDETADSLKDLGMKRARLHGWPNTYVFTKAM  257

Query  176  GEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            GEM+LG+ +  +P+VI+RP++IT T+ EPFPGW+EG+RTIDS+ + YGKGKL CFLGD
Sbjct  258  GEMLLGDNRGSMPLVIVRPSMITSTFSEPFPGWIEGLRTIDSVIVAYGKGKLKCFLGD  315



>ref|XP_010520425.1| PREDICTED: fatty acyl-CoA reductase 1-like isoform X4 [Tarenaya 
hassleriana]
Length=501

 Score =   351 bits (901),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 223/298 (75%), Gaps = 7/298 (2%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + +QFL N TILVTGA+GFLAK+F+EKILRVQPNVKKLYLL+RA   E+A+QR   E++ 
Sbjct  21   NCVQFLHNKTILVTGASGFLAKVFVEKILRVQPNVKKLYLLVRAPTKESAMQRLRIEVLE  80

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++LK+  G    N  +SEKV  V GD+S ++LGV D  L  +M   +D VVN+A  
Sbjct  81   KDLFRVLKKDLGDENLNKFVSEKVVPVPGDISMDDLGVDDFDLRQQMWEHIDVVVNVAGN  140

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYD+ALG+NT G  +VLNFAK C K ++LLHVSTAYV G K GL+ E   K  E 
Sbjct  141  TNFDERYDIALGINTFGALNVLNFAKNCVKPQLLLHVSTAYVCGEKSGLLLE---KSLET  197

Query  356  LNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKAL  177
            LNG   LDI+ E  +M   L++L   + S++    ++KDLG++RAR++GWPNTYVFTKA+
Sbjct  198  LNGNGKLDINAEMELMRRTLKELHNRDCSEDETADSLKDLGMKRARLHGWPNTYVFTKAM  257

Query  176  GEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            GEM+LG+ +  +P+VI+RP++IT T+ EPFPGW+EG+RTIDS+ + YGKGKL CFLGD
Sbjct  258  GEMLLGDNRGSMPLVIVRPSMITSTFSEPFPGWIEGLRTIDSVIVAYGKGKLKCFLGD  315



>ref|XP_006349135.1| PREDICTED: probable fatty acyl-CoA reductase 5-like [Solanum 
tuberosum]
Length=330

 Score =   345 bits (884),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/302 (54%), Positives = 228/302 (75%), Gaps = 9/302 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            M+L     FL+  TIL+TGA GFLAKI +EKILRVQP+VKKL+LLLRA+D ++A +RF+ 
Sbjct  1    MKLSKIEPFLEGKTILITGATGFLAKILVEKILRVQPDVKKLFLLLRASDIKSARKRFSD  60

Query  716  EIIGKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
            EI+  E+F +L+EK G    NS++ EKV  +AGD+S E+ G+++S +   ML E+D +++
Sbjct  61   EILQAELFNVLREKIGTNNLNSLVEEKVFPIAGDISIEDFGIENSEMKDEMLKEIDIIIH  120

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
             AATT+FDERYD+A+ +N +G  +VL FAK+C  ++IL+HVSTAYV G  EG+I+E  + 
Sbjct  121  SAATTRFDERYDIAMNINVLGASNVLKFAKRCANVKILVHVSTAYVGGEGEGVISEKSFN  180

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
             G+       +DID E++V+E+ L++L   N + + +T AM++LGI+RA ++GWPNTY F
Sbjct  181  FGDYY-----IDIDVERKVIEDKLKELEAQNLTSKEVTMAMRNLGIKRASLHGWPNTYSF  235

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM+LG FKE+L +VIIRPTIIT TYKEPFPGW+EG++T+D+  L YGKG    FL
Sbjct  236  TKAMGEMMLGHFKENLQLVIIRPTIITSTYKEPFPGWIEGLKTLDTFMLIYGKGISNVFL  295

Query  8    GD  3
            GD
Sbjct  296  GD  297



>ref|XP_008353939.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Malus 
domestica]
Length=493

 Score =   350 bits (898),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 178/303 (59%), Positives = 222/303 (73%), Gaps = 5/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL + L +L   TILVTGA GFLA +FLEKILRVQP+VKK+YLLLRA DT +A  + + 
Sbjct  1    MELKTILGYLQEKTILVTGATGFLAMVFLEKILRVQPDVKKVYLLLRAPDTNSANDQMHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGK +F++L+EK G   +S ISEKV  V GDV+ ENLGV+D  L   M +E+  ++N 
Sbjct  61   EIIGKALFKVLREKLGADFDSFISEKVVAVPGDVTSENLGVQDFKLREEMFTEIQIILNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAE-SPYK  369
            AATT FDERYD+AL VNT G  HVL+FA KC  L +LLHVSTAYV G +EGLI E S   
Sbjct  121  AATTNFDERYDIALDVNTFGVLHVLSFAMKCILLEMLLHVSTAYVCGEREGLIPEDSSSF  180

Query  368  MGEALNGKSGLDID-EEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
            M E   G +  +    EK+V+E+ L +L    AS+E+I S MKD GI+RA++YGWPNTYV
Sbjct  181  MDEKAKGTTKFNFQVREKKVVEKKLNELKARGASEENIRSTMKDFGIERAKLYGWPNTYV  240

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GE+ L   +E+LP+VIIRPT++T TYKEPFPGW++G RTIDS+   Y KGKLTC 
Sbjct  241  FTKAMGEIFLENSRENLPLVIIRPTVVTSTYKEPFPGWIQGFRTIDSVIAAYCKGKLTCL  300

Query  11   LGD  3
            L D
Sbjct  301  LVD  303



>gb|KHN38648.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=493

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/300 (55%), Positives = 220/300 (73%), Gaps = 3/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S   FL   TILVTGA GFLAK+F+EKILRVQPN+KKLYLLLRA +   A QR + 
Sbjct  1    MELASVHDFLKGKTILVTGATGFLAKLFVEKILRVQPNIKKLYLLLRAENPHIATQRLHD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++ K++F++++E  G    S ISEKV  VAGDVS ENLG+KD +L  +M  ++D +V+ 
Sbjct  61   EVLAKDLFKVVREMWGADFGSFISEKVLAVAGDVSLENLGLKDLNLREKMWEDIDIIVHA  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA TKFDER+D+A+ +NTMG  H LNFAK C K++ILLH+STAYV G  +GL+ E P+ M
Sbjct  121  AAATKFDERFDIAMSINTMGALHALNFAKNCSKMQILLHLSTAYVCGEAKGLVPEEPFHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+  N  S LDI+ EK ++EE + +L   NA +++ TS MK+LGI RA ++GWPN YVFT
Sbjct  181  GQTPNRSSTLDINVEKLLIEEKMEELRAQNAGEQTATSVMKNLGIIRANLHGWPNAYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+L   K D+P++I RPT +  T+ EPFPGW+EG+RT+D   + YGKGKL   +G
Sbjct  241  KAMGEMILFNMKGDVPLIIARPTTVLSTHSEPFPGWIEGVRTVDVFVVLYGKGKLRRSVG  300



>ref|XP_003538131.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Glycine 
max]
Length=494

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/300 (55%), Positives = 220/300 (73%), Gaps = 3/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S   FL   TILVTGA GFLAK+F+EKILRVQPN+KKLYLLLRA +   A QR + 
Sbjct  1    MELASVHDFLKGKTILVTGATGFLAKLFVEKILRVQPNIKKLYLLLRAENPHIATQRLHD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++ K++F++++E  G    S ISEKV  VAGDVS ENLG+KD +L  +M  ++D +V+ 
Sbjct  61   EVLAKDLFKVVREMWGADFGSFISEKVLAVAGDVSLENLGLKDLNLREKMWEDIDIIVHA  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA TKFDER+D+A+ +NTMG  H LNFAK C K++ILLH+STAYV G  +GL+ E P+ M
Sbjct  121  AAATKFDERFDIAMSINTMGALHALNFAKNCSKMQILLHLSTAYVCGEAKGLVPEEPFHM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            G+  N  S LDI+ EK ++EE + +L   NA +++ TS MK+LGI RA ++GWPN YVFT
Sbjct  181  GQTPNRSSTLDINVEKLLIEEKMEELRAQNAGEQTATSVMKNLGIIRANLHGWPNAYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+L   K D+P++I RPT +  T+ EPFPGW+EG+RT+D   + YGKGKL   +G
Sbjct  241  KAMGEMILFNMKGDVPLIIARPTTVLSTHSEPFPGWIEGVRTVDVFVVLYGKGKLRRSVG  300



>ref|XP_006349136.1| PREDICTED: fatty acyl-CoA reductase 3-like [Solanum tuberosum]
Length=515

 Score =   349 bits (896),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 224/294 (76%), Gaps = 8/294 (3%)
 Frame = -3

Query  872  FLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKEIF  693
            FL+  TI +TGA GFLAKI +EKILR+Q NV+KL+LL+RA+DT++A +RFN E++  E+F
Sbjct  4    FLEGKTIFITGATGFLAKILVEKILRIQSNVRKLFLLVRASDTKSARKRFNDEVMQTELF  63

Query  692  QILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKFD  525
             +L+EK G    NS+I EKV  VAGD S+E+ G+++S     M  E+D ++N AATT+FD
Sbjct  64   SVLREKIGTNILNSLIEEKVFPVAGDNSFEDFGIENS----EMFKEIDIIINSAATTRFD  119

Query  524  ERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNGK  345
            ERYD+A+ +N +G  +VL FAKKC  ++IL+HVSTAYV G  EG+I E  + +GE LN  
Sbjct  120  ERYDIAMNINVLGAFNVLKFAKKCSNVKILVHVSTAYVCGEGEGVIPEKSFVLGETLNKN  179

Query  344  SGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGEMV  165
            + L+ID E++V+EE L++L   N + + +T AM+DLGIQRA ++GWPNTY FTKA+GEM+
Sbjct  180  TKLEIDVERKVIEEKLKELEDQNLTTKEVTIAMRDLGIQRAILHGWPNTYSFTKAMGEML  239

Query  164  LGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            LG +KEDL +VIIRPTIIT TYK+PFPGW+EG++T+DS  L YGKG +    GD
Sbjct  240  LGHYKEDLQLVIIRPTIITSTYKDPFPGWIEGVKTVDSFILAYGKGVMNFCFGD  293



>ref|XP_009610474.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=488

 Score =   348 bits (893),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 168/301 (56%), Positives = 222/301 (74%), Gaps = 6/301 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME     QFL+  TI +TGA GFLAKI +EKILR+QPNVKKL+LLLR +DT++A  RF  
Sbjct  1    MESSKIEQFLEGKTIFITGATGFLAKILVEKILRIQPNVKKLFLLLRGSDTKSARIRFKE  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E    E+F +L+EK G   N++I EKV  VAGDVS+E+ G+++  +   M  E+D +++ 
Sbjct  61   E---AELFNVLREKLGAKLNNLIEEKVFPVAGDVSFEDFGIENMEMKDEMFKEIDTIIHS  117

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA+T+FDERYD+A+  N  G  +VL FAK+C KL+IL+HVSTAYV G  EG+IAE  +++
Sbjct  118  AASTRFDERYDIAMKTNVQGAVNVLKFAKRCAKLKILVHVSTAYVCGEGEGVIAEKSFRL  177

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LN    LDID EK+V+E+ L++L   N + + +T  M+DLGIQRA ++GWPNTY FT
Sbjct  178  GETLNKDLYLDIDVEKKVIEDKLKELGAQNLTSKEVTMTMRDLGIQRATLHGWPNTYSFT  237

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG  KE+L +VIIRPTIIT TY EPFPGW+EG++T+DS  L YGKG    FLG
Sbjct  238  KAMGEMLLGHLKENLHLVIIRPTIITSTYYEPFPGWIEGVKTVDSFFLAYGKGISNIFLG  297

Query  5    D  3
            D
Sbjct  298  D  298



>ref|XP_008229411.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Prunus 
mume]
Length=789

 Score =   356 bits (913),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 225/303 (74%), Gaps = 5/303 (2%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L +L N TILVTGA GFLA +F+EKILRVQP+VKK+YLLLRA++T +A  R + 
Sbjct  1    MELKSILAYLQNKTILVTGATGFLAMVFVEKILRVQPDVKKIYLLLRASNTNSATNRMHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GKE+F++L++K G   +S +S KV  VAGDV+ ENLGVKD  L   M +E + ++N 
Sbjct  61   EILGKELFRVLRDKHGADFDSFVSHKVAAVAGDVTSENLGVKDFKLTEEMCNETEIILNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAE-SPYK  369
            AATT FDERYD+AL VNT G  HV++FAKKC KL +LLHVSTAYV G + GLI E SP  
Sbjct  121  AATTNFDERYDIALDVNTFGILHVVSFAKKCLKLEMLLHVSTAYVCGERVGLIPEDSPSL  180

Query  368  MGEALNGKSGLDID-EEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYV  192
              + +      D   +EK V+E+ L +L    AS+E ITS MKD GI+RA+ YGWPNTYV
Sbjct  181  TDDIVKKTIKFDFKAQEKIVVEKKLTELKARGASEEDITSTMKDFGIERAKHYGWPNTYV  240

Query  191  FTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCF  12
            FTKA+GE+ L   K++LPVVIIRPT++T TYKEPFPGW++G RTIDS+  GY KGKLTC 
Sbjct  241  FTKAMGEVFLRRSKDELPVVIIRPTVVTSTYKEPFPGWIQGFRTIDSVIAGYCKGKLTCL  300

Query  11   LGD  3
            L D
Sbjct  301  LAD  303


 Score =   164 bits (416),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 100/141 (71%), Gaps = 2/141 (1%)
 Frame = -3

Query  419  AYVSGIKEGLIAE-SPYKMGEALNGKSGLDID-EEKRVMEEALRDLTRDNASQESITSAM  246
            AYV G + GLI E SP    + +      D   +EK V+E+ L +L    AS+E ITS M
Sbjct  459  AYVCGERVGLIPEDSPSLTDDIVKKTIKFDFKAQEKIVVEKKLTELKARGASEEDITSTM  518

Query  245  KDLGIQRARMYGWPNTYVFTKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGI  66
            KD GI+RA+ YGWPNTYVFTKA+GE+ L   K++LPVVIIRPT++T TYKEPFPGW++G 
Sbjct  519  KDFGIERAKHYGWPNTYVFTKAMGEVFLRRSKDELPVVIIRPTVVTSTYKEPFPGWIQGF  578

Query  65   RTIDSLGLGYGKGKLTCFLGD  3
            RTIDS+  GY KGKLTC L D
Sbjct  579  RTIDSVIAGYCKGKLTCLLAD  599



>ref|XP_006349384.1| PREDICTED: fatty acyl-CoA reductase 3-like [Solanum tuberosum]
Length=488

 Score =   346 bits (888),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/300 (56%), Positives = 221/300 (74%), Gaps = 4/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME     QFL+  TI +TGA G+LAKI  EKILRVQPNVKK+YLL+RA D+ +A QRFN 
Sbjct  1    MESCCIEQFLEGKTIFITGATGYLAKILTEKILRVQPNVKKMYLLIRAPDSNSAKQRFNN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+I  ++F +L+EK G   +  I +KV  VAGD+  ++LG+ +S L   M  E+D +VN 
Sbjct  61   EVIKADLFGVLREKLGANLHGFIEDKVFPVAGDIDCDSLGI-NSELKDEMCREIDIIVNS  119

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT+FDERYD A+  N +G  HVLNF+K+C KL +LLHVSTA+V G KEGLI E P   
Sbjct  120  AATTRFDERYDTAIRTNVLGAMHVLNFSKQCSKLMMLLHVSTAHVCGEKEGLILEKPLNY  179

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG S LDID E++++EEAL++L   NA+++ +  AM+ LGI+RAR +GWPNTY FT
Sbjct  180  GETLNGSSHLDIDMEQKLVEEALKELQDRNATEKEVRLAMRVLGIERARQHGWPNTYSFT  239

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K++GEM+L   KEDL ++I+RPTII  TYKEPFPGW+EG++T D+  +GYGKGK    +G
Sbjct  240  KSMGEMLLVHLKEDLQLIILRPTIILSTYKEPFPGWIEGMKTADTFIVGYGKGKQKLAMG  299



>ref|XP_009785725.1| PREDICTED: fatty acyl-CoA reductase 3-like [Nicotiana sylvestris]
 ref|XP_009785726.1| PREDICTED: fatty acyl-CoA reductase 3-like [Nicotiana sylvestris]
Length=489

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 222/301 (74%), Gaps = 4/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME     QFL+  TI + GA G+LAKI +EKILRVQPNVKKLYLL+RA D+  A +RFN 
Sbjct  1    MESCGINQFLEGKTIFIAGATGYLAKILIEKILRVQPNVKKLYLLIRAPDSNLAKERFNN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+I  ++F +L++K G    ++I ++V +VAGD++ +NLG+ +S L   M  E+D +VN 
Sbjct  61   EVIKTDLFGVLRKKLGANLQALIEDRVFLVAGDIACDNLGI-NSELKNEMFKEIDIIVNS  119

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA T+FDERYD A+  NT+G  ++L F+K+C KL +LLH+STAYV G  +GLI E P   
Sbjct  120  AAATRFDERYDTAIRTNTLGALNILKFSKQCSKLNMLLHISTAYVCGENDGLILEKPLHY  179

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG S LDI+ E++V+EE L DL   NA+++ +T AM+ LGI+RA+++GWPNTY FT
Sbjct  180  GETLNGGSQLDIEVEQKVVEETLNDLKARNAAEKEVTLAMRVLGIERAKIHGWPNTYTFT  239

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG  KEDL ++I+RPTII  TYKEPFPGW+EG+RT D+  + YGKGK    +G
Sbjct  240  KAMGEMLLGHLKEDLQLIILRPTIILSTYKEPFPGWIEGMRTADTFIVAYGKGKQNVIMG  299

Query  5    D  3
            D
Sbjct  300  D  300



>ref|XP_010314793.1| PREDICTED: fatty acyl-CoA reductase 3-like [Solanum lycopersicum]
Length=488

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 219/300 (73%), Gaps = 4/300 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME     QFL+  TI +TG  G+LAKI  EKILRVQPNVKKLYLL+RA D+  A QRFN 
Sbjct  1    MESCCIEQFLEGKTIFITGVTGYLAKILSEKILRVQPNVKKLYLLIRAPDSNLAKQRFNN  60

Query  716  EIIGKEIFQILKEKCGNSV---ISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+I  ++F +L+EK G ++   I +KV  V GD+  ++LG+ +S L   M  E+D +VN 
Sbjct  61   EVIKTDLFGVLREKLGTNLHGFIEDKVFPVVGDIDCDSLGI-NSELKDEMFREIDIIVNS  119

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT+FDERYD A+  N +G  HVLNF+K+C KL +LLHVSTAYV G KEGLI E     
Sbjct  120  AATTRFDERYDTAIRTNVLGALHVLNFSKQCSKLMMLLHVSTAYVCGEKEGLILEKTLNY  179

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG S LDID E++++EEAL+DL   NA+++ +  AM+ LGI+RAR++GW NTY FT
Sbjct  180  GETLNGSSHLDIDVEQKLVEEALKDLQHRNATEKEVRLAMRVLGIERARLHGWANTYSFT  239

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            K++GEM+LG  KEDL ++I+RPTII  TYKEPFPGW+EG+RT D+  +GYGKGK    +G
Sbjct  240  KSMGEMLLGHLKEDLQLIILRPTIILSTYKEPFPGWIEGMRTTDTFIVGYGKGKQKVAMG  299



>ref|XP_010520423.1| PREDICTED: fatty acyl-CoA reductase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=504

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 168/301 (56%), Positives = 223/301 (74%), Gaps = 10/301 (3%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + +QFL N TILVTGA+GFLAK+F+EKILRVQPNVKKLYLL+RA   E+A+QR   E++ 
Sbjct  21   NCVQFLHNKTILVTGASGFLAKVFVEKILRVQPNVKKLYLLVRAPTKESAMQRLRIEVLE  80

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++LK+  G    N  +SEKV  V GD+S ++LGV D  L  +M   +D VVN+A  
Sbjct  81   KDLFRVLKKDLGDENLNKFVSEKVVPVPGDISMDDLGVDDFDLRQQMWEHIDVVVNVAGN  140

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYD+ALG+NT G  +VLNFAK C K ++LLHVSTAYV G K GL+ E   K  E 
Sbjct  141  TNFDERYDIALGINTFGALNVLNFAKNCVKPQLLLHVSTAYVCGEKSGLLLE---KSLET  197

Query  356  LNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQR---ARMYGWPNTYVFT  186
            LNG   LDI+ E  +M   L++L   + S++    ++KDLG++R   AR++GWPNTYVFT
Sbjct  198  LNGNGKLDINAEMELMRRTLKELHNRDCSEDETADSLKDLGMKRLIRARLHGWPNTYVFT  257

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG+ +  +P+VI+RP++IT T+ EPFPGW+EG+RTIDS+ + YGKGKL CFLG
Sbjct  258  KAMGEMLLGDNRGSMPLVIVRPSMITSTFSEPFPGWIEGLRTIDSVIVAYGKGKLKCFLG  317

Query  5    D  3
            D
Sbjct  318  D  318



>ref|XP_010520422.1| PREDICTED: fatty acyl-CoA reductase 1-like isoform X1 [Tarenaya 
hassleriana]
Length=505

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 168/301 (56%), Positives = 223/301 (74%), Gaps = 10/301 (3%)
 Frame = -3

Query  884  SALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIG  705
            + +QFL N TILVTGA+GFLAK+F+EKILRVQPNVKKLYLL+RA   E+A+QR   E++ 
Sbjct  21   NCVQFLHNKTILVTGASGFLAKVFVEKILRVQPNVKKLYLLVRAPTKESAMQRLRIEVLE  80

Query  704  KEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAAT  537
            K++F++LK+  G    N  +SEKV  V GD+S ++LGV D  L  +M   +D VVN+A  
Sbjct  81   KDLFRVLKKDLGDENLNKFVSEKVVPVPGDISMDDLGVDDFDLRQQMWEHIDVVVNVAGN  140

Query  536  TKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEA  357
            T FDERYD+ALG+NT G  +VLNFAK C K ++LLHVSTAYV G K GL+ E   K  E 
Sbjct  141  TNFDERYDIALGINTFGALNVLNFAKNCVKPQLLLHVSTAYVCGEKSGLLLE---KSLET  197

Query  356  LNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQR---ARMYGWPNTYVFT  186
            LNG   LDI+ E  +M   L++L   + S++    ++KDLG++R   AR++GWPNTYVFT
Sbjct  198  LNGNGKLDINAEMELMRRTLKELHNRDCSEDETADSLKDLGMKRLIRARLHGWPNTYVFT  257

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG+ +  +P+VI+RP++IT T+ EPFPGW+EG+RTIDS+ + YGKGKL CFLG
Sbjct  258  KAMGEMLLGDNRGSMPLVIVRPSMITSTFSEPFPGWIEGLRTIDSVIVAYGKGKLKCFLG  317

Query  5    D  3
            D
Sbjct  318  D  318



>ref|XP_008228906.1| PREDICTED: fatty acyl-CoA reductase 3-like [Prunus mume]
Length=493

 Score =   345 bits (886),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 225/302 (75%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L +L N TILVTGA GFL  +F+EKILRVQP+VK+LYLLLRA+DT++A  R + 
Sbjct  1    MELESILGYLQNKTILVTGATGFLGMLFVEKILRVQPDVKRLYLLLRASDTKSATDRMHD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            +IIGKE+F +LK+K G   +S I+EKV  V GDV++++LGVK+  L   M + ++ ++N 
Sbjct  61   QIIGKELFTVLKDKWGTNFDSFIAEKVVAVPGDVTFDDLGVKEIKLREEMCNGIEIILNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            A TT FDERYD+AL VN  G +HVL+FAKKC KL +LLHVSTAYV G + GLI E    M
Sbjct  121  AGTTNFDERYDIALSVNAFGVQHVLSFAKKCLKLEMLLHVSTAYVCGERAGLILEDSSCM  180

Query  365  GEALNGKSGLDID-EEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
             E     +  D   +E  ++EE L +L   +A+++ IT+ MKD+GI+RA++YGWPNTYVF
Sbjct  181  DELEKEITRFDFKVQEMNLVEEKLNELKAQDATEQVITTTMKDIGIERAKLYGWPNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GE+ LG+ K+  P+VIIRP++IT +YKEPFPGWV+G RTIDS+  GY KGK+TC L
Sbjct  241  TKAVGEIFLGQSKDHFPIVIIRPSVITSSYKEPFPGWVQGFRTIDSVIAGYCKGKVTCLL  300

Query  8    GD  3
             D
Sbjct  301  VD  302



>ref|XP_004251041.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Solanum lycopersicum]
Length=488

 Score =   345 bits (886),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 226/302 (75%), Gaps = 9/302 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL     FL+  TIL+TGA GFLAKI +EKILRVQPN+K+L+LLLRA+DTE+A +RFN 
Sbjct  1    MELSKIEPFLEGNTILITGATGFLAKILVEKILRVQPNIKRLFLLLRASDTESARKRFNV  60

Query  716  EIIGKEIFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVN  549
            EI+  E+F +L+EK G    NS++ EKV  +AGD+S E+ G+++S +   ML E+D +++
Sbjct  61   EILQAELFNVLREKIGTNNLNSLVEEKVFPIAGDISIEDFGIENSEMKHEMLKEIDIIIH  120

Query  548  LAATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYK  369
             AATT+FDERYD+A+ +N +G  +VL FAK+C  ++IL+HVSTAYV G  EG+I+E  + 
Sbjct  121  SAATTRFDERYDIAMNINVLGAFNVLKFAKRCANVKILVHVSTAYVGGEGEGVISEKSFN  180

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
              +       +DID E++V+++ L++L   N + + +T AM++LGIQRA ++GWPNTY F
Sbjct  181  FDDYY-----IDIDVERKVIDDKLKELEAQNLTSKEVTMAMRNLGIQRASLHGWPNTYSF  235

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM+LG FKE++ +VIIRPTIIT TYKEPFPGW+E ++T+D+  L YGKG    FL
Sbjct  236  TKAMGEMMLGHFKENIQLVIIRPTIITSTYKEPFPGWIESMKTLDTFMLIYGKGISNVFL  295

Query  8    GD  3
             D
Sbjct  296  AD  297



>ref|XP_007205112.1| hypothetical protein PRUPE_ppa004772mg [Prunus persica]
 gb|EMJ06311.1| hypothetical protein PRUPE_ppa004772mg [Prunus persica]
Length=492

 Score =   345 bits (885),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 225/302 (75%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L +L N TILVTGA GFL  +F+EKILRVQP+VK+LYLLLRA+D ++A  R + 
Sbjct  1    MELESILGYLQNKTILVTGATGFLGMVFVEKILRVQPDVKRLYLLLRASDIKSATDRMHD  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            +IIGKE+F++LK+K G   +S I+EKV  V GDV++++LGVK+  L   M + ++ ++N 
Sbjct  61   QIIGKELFRVLKDKWGTDFDSFIAEKVVAVPGDVTFDDLGVKEIKLREEMCNGIEIILNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            A  T FDERYD+AL VNT G +HVL+ AKKC KL +LLHVSTA+V G + GLI E    M
Sbjct  121  AGATNFDERYDIALSVNTFGVQHVLSLAKKCLKLEMLLHVSTAFVCGERAGLILEDSSCM  180

Query  365  GEALNGKSGLDID-EEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
             E     +  D   +E +++EE L +L   +A+++ IT+ MKD+GI+RA+ YGWPNTYVF
Sbjct  181  DEMEKEITKFDFKVQEMKLVEEKLNELKAQDATEQVITTTMKDIGIERAKSYGWPNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GE+ LGE K+ LP+VIIRP++IT +YKEPFPGWV+G RTIDS+  GY KGKLTC L
Sbjct  241  TKAMGEIFLGESKDHLPIVIIRPSVITSSYKEPFPGWVQGFRTIDSVIAGYCKGKLTCLL  300

Query  8    GD  3
             D
Sbjct  301  VD  302



>ref|XP_009419621.1| PREDICTED: fatty acyl-CoA reductase 3-like [Musa acuminata subsp. 
malaccensis]
Length=490

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 228/301 (76%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME    L+FL + +IL+TG+ GFLAKIF+EK+LRVQP VK+L+LL+RAAD  +A QR  T
Sbjct  1    MESSRILEFLKDKSILITGSTGFLAKIFVEKVLRVQPEVKRLFLLVRAADAASANQRVQT  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+GK++F++L++K G   +  ++ KV  VAGD+  E+LG++DS+L  ++  EV  VVN+
Sbjct  61   EILGKDLFKVLRDKHGDGFHPFVASKVFPVAGDIVREDLGIQDSNLREKLWKEVGIVVNV  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FD+RYDV+LG+N +G KH+L FA++C +L +LLHVSTAYV+G + GLI E  + M
Sbjct  121  AATTSFDDRYDVSLGINALGAKHILEFARRCVRLEMLLHVSTAYVAGEQSGLILEKKFLM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE L G S LDI+ E R++++  R+L  + A++E    AMK LG++RAR +GWPNTYV T
Sbjct  181  GETLKGGSYLDIEAELRLVDKKKRELRAEYATEEVEKLAMKRLGMKRARYFGWPNTYVCT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG  + DLP+VI+RPTIIT  +++P PGW+EG RTIDSL +GY K K+ C  G
Sbjct  241  KAMGEMLLGHLRGDLPLVILRPTIITSVHRDPLPGWIEGTRTIDSLIMGYVKEKIGCLFG  300

Query  5    D  3
            D
Sbjct  301  D  301



>emb|CDX98566.1| BnaC05g38090D [Brassica napus]
Length=491

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/296 (53%), Positives = 225/296 (76%), Gaps = 4/296 (1%)
 Frame = -3

Query  878  LQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKE  699
            ++FL+N T+LVTGA+GFLAK+F+E++L +QPNVK+LYLL+RA+  ++A QR ++E+  K+
Sbjct  6    VKFLENKTLLVTGASGFLAKVFVERVLSLQPNVKRLYLLVRASGKKSAEQRLHSEVFEKD  65

Query  698  IFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTK  531
            +F++L+   G    N++ISEKV  V GD S  N+GV DS+L+  M+ E+D V + AATT+
Sbjct  66   LFRVLRNNIGDETLNALISEKVVPVPGDTSLHNMGVSDSNLVQDMMQEIDIVFHAAATTR  125

Query  530  FDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALN  351
            FDERYDVAL +NT G  +VLNFAKKC K ++LLHVSTAYV G + GLI E P+ MGE L+
Sbjct  126  FDERYDVALRINTFGALNVLNFAKKCVKAKLLLHVSTAYVCGERSGLIQEIPFAMGETLH  185

Query  350  GKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGE  171
             K+ +DI+ E +++E+  +       S+E    AM+DLG++RA+++G PNTY FTK +GE
Sbjct  186  RKNKVDINIEMQLVEQKSKQFVEQGCSEEETKHAMRDLGLKRAKLFGLPNTYAFTKVMGE  245

Query  170  MVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            M LG ++E++ +VIIRPT+IT T+ +PFPGW+EG++T+D+  L YGKG LTCFL D
Sbjct  246  MFLGHYRENMSIVIIRPTMITSTFSDPFPGWIEGVKTLDTAILSYGKGMLTCFLID  301



>ref|XP_004291622.1| PREDICTED: fatty acyl-CoA reductase 3-like [Fragaria vesca subsp. 
vesca]
Length=489

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/302 (56%), Positives = 220/302 (73%), Gaps = 8/302 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  S L++L+  TILVTG  GFL  +FLEKILRVQP+V+K+YLLLRA+DT++A +R N 
Sbjct  1    MESASILRYLEGKTILVTGGTGFLGMVFLEKILRVQPDVQKIYLLLRASDTKSATKRMNN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EIIGKE+F++LKEK G   +S ISEKV  + GDV+ ENLGVKD     ++ +E+  + N 
Sbjct  61   EIIGKELFRVLKEKRGADFDSFISEKVVALPGDVTSENLGVKD----LKVYNEIQIIFNC  116

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYD+AL VNT G  + ++FAKKC KL + LHVSTAYV G + GL+ E    M
Sbjct  117  AATTNFDERYDIALDVNTFGVLYAIDFAKKCSKLEMFLHVSTAYVCGERGGLLLEDSSSM  176

Query  365  GEALNGKSGLDIDE-EKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
             E +   +  D +  EK++++E L +L     SQE IT+ MKD GI+RA++YGWPNTYVF
Sbjct  177  DEMIKQMTKFDFEAVEKKLVKEKLNELKAQGVSQEVITNTMKDFGIERAKVYGWPNTYVF  236

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GE+ +G  K +LP VI+RPT++T TYKEPFPGW++G RTIDS+   Y KGKL C L
Sbjct  237  TKAMGEIYIGRLKHNLPHVIVRPTVVTSTYKEPFPGWIQGFRTIDSVIASYYKGKLPCLL  296

Query  8    GD  3
             D
Sbjct  297  VD  298



>ref|XP_003606214.1| Fatty acyl-CoA reductase [Medicago truncatula]
Length=313

 Score =   337 bits (865),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/297 (54%), Positives = 219/297 (74%), Gaps = 7/297 (2%)
 Frame = -3

Query  872  FLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKEIF  693
            FL   TILVTGAAGFLAK+F+EKILR+QP ++KLYLLLRA++T+ A  R   E+   ++F
Sbjct  6    FLKGKTILVTGAAGFLAKVFVEKILRIQPEIQKLYLLLRASNTDLAENRLRNEVFEIDLF  65

Query  692  QILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKFDE  522
            ++L+ K G   +S IS+KV  +AGDV+ ENLG+KD  L   +  E+D +V+ AA+TKFDE
Sbjct  66   RVLRAKWGENFSSFISKKVVAIAGDVAIENLGIKDEKLKREIFEEIDLLVHFAASTKFDE  125

Query  521  RYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSG-IKEG---LIAESPYKMGEAL  354
            R+D+ + VNT G  H LN AK C +++  +H+STAYV G  K+G   ++ E+P++MGE+L
Sbjct  126  RFDILMAVNTQGALHALNVAKNCKRIKAFVHISTAYVCGDAKDGDSIILRENPFEMGESL  185

Query  353  NGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALG  174
             G S LDI EE  ++E  L +L   N  + +IT AMKD G++RA +YGWPNTY FTKA+G
Sbjct  186  KGTSKLDIHEEMNLLERKLAELQAMNVDENTITCAMKDYGMERANLYGWPNTYTFTKAMG  245

Query  173  EMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            EM+L   K+++P++IIRPT+IT T K+PFPGW+EG+RTIDSL   YG GK+ CFLG+
Sbjct  246  EMLLVHHKDNVPLIIIRPTMITSTNKDPFPGWIEGLRTIDSLIYAYGHGKVKCFLGN  302



>ref|XP_006441009.1| hypothetical protein CICLE_v100206971mg, partial [Citrus clementina]
 gb|ESR54249.1| hypothetical protein CICLE_v100206971mg, partial [Citrus clementina]
Length=278

 Score =   336 bits (861),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/278 (58%), Positives = 211/278 (76%), Gaps = 3/278 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME  S LQFL + TILVTGA GFLAKIF+EKILR+QPN+KKLYLL+RA D ++A QR   
Sbjct  1    MESFSVLQFLKDKTILVTGATGFLAKIFVEKILRIQPNLKKLYLLIRAEDDKSAKQRMFR  60

Query  716  EIIGKEIFQILKEKCGNSV---ISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E+I K++F++L++  G+S+   I EKV  V GD+ YE+LG+KDS+L   M  ++D VVN+
Sbjct  61   EVIEKDLFRVLRDTWGDSLDSFILEKVAAVPGDILYEDLGIKDSNLKEEMYRQIDLVVNV  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AA TKFDERYD  L  NTMG  HVL+FAK C K+++L+H+STAY  G K GLI E+ + M
Sbjct  121  AAITKFDERYDALLDTNTMGAFHVLSFAKHCTKIQMLVHLSTAYACGEKSGLIPENSFTM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE +     LDI  EK+++E+ L  L    A+++ +TS MKDLG +RA+ YGWPNTYVFT
Sbjct  181  GEMVKWPRKLDIMAEKKLVEKKLNQLQTTGAAEDEVTSIMKDLGTERAKWYGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVE  72
            KA+GEM+L  +K++LP++IIRPT+IT TYKEPFPGW+E
Sbjct  241  KAMGEMLLDHYKDNLPIIIIRPTMITSTYKEPFPGWIE  278



>gb|KCW58995.1| hypothetical protein EUGRSUZ_H01619 [Eucalyptus grandis]
Length=484

 Score =   343 bits (879),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 164/297 (55%), Positives = 224/297 (75%), Gaps = 7/297 (2%)
 Frame = -3

Query  878  LQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKE  699
            +QFL+N TILVTGA GFLAKIF+EK+LR+QPNVKK+Y+L+RA D +AA QR + E+I K+
Sbjct  6    VQFLENKTILVTGATGFLAKIFVEKLLRIQPNVKKIYVLIRAMDKQAATQRLHEELIQKK  65

Query  698  IFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKF  528
            +F IL+E+     NS++ EK++ + GDVS ENLGV D  L + M  E+D +V+ AATTKF
Sbjct  66   LFGILREEWAENFNSIV-EKLSPIPGDVSCENLGVHDFDLRSGMWREIDIIVSSAATTKF  124

Query  527  DERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNG  348
            DERYD+AL VNT G KHV  FA +C  +++LLH+STAYV G   G+I E  + MGE LNG
Sbjct  125  DERYDIALAVNTFGAKHVAEFAVRCVNIKMLLHISTAYVCGNMTGIIQEKAFSMGETLNG  184

Query  347  KSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGEM  168
               LD++EEK ++EE + +L   NAS+  I  A+K+LG+QRAR++GWPNTY  TKA+GEM
Sbjct  185  SRKLDVNEEKLLVEELMNELRERNASEREIIIALKNLGLQRARLHGWPNTYTLTKAMGEM  244

Query  167  VLG-EFKEDLPVVIIRPTIITGTYKEPFPGWVEGI--RTIDSLGLGYGKGKLTCFLG  6
            ++    K+++P+ ++RPTIIT TY+EPF GW+EG   RT+DS+ + YG+G+L  FLG
Sbjct  245  MVRYHLKQNIPLAVMRPTIITSTYREPFAGWIEGFPPRTMDSIAISYGRGRLEYFLG  301



>emb|CDX92353.1| BnaA10g13920D [Brassica napus]
Length=492

 Score =   343 bits (879),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 156/297 (53%), Positives = 228/297 (77%), Gaps = 5/297 (2%)
 Frame = -3

Query  878  LQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKE  699
            +QFL+N T+LVTGA+GFL+K+F+E++L +QPNVKKLYLL+RA+D ++A QR + E+  K+
Sbjct  6    VQFLENKTLLVTGASGFLSKVFVERVLSLQPNVKKLYLLVRASDNKSAEQRLHNEVFEKD  65

Query  698  IFQILKEKCG----NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTK  531
            +F++L++  G    N+++SEKV  V GDV+  N+GV +++LL  M+ E D VV+ AATT+
Sbjct  66   LFKVLRKNIGDESLNALVSEKVVPVPGDVTLNNMGVSETNLLQDMMQETDIVVHAAATTR  125

Query  530  FDER-YDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEAL  354
            FDER YDVAL +NT G  +VLNFAKK  K ++LLHVSTAYV G + GL  E P+ MG+ L
Sbjct  126  FDERLYDVALRINTFGALNVLNFAKKSVKAQLLLHVSTAYVCGERSGLTQEIPFAMGDTL  185

Query  353  NGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALG  174
            +GK+ +DI+ E +++E+ L+ L     S+E    AM+DLG++RA+ +G PNTYVFTK +G
Sbjct  186  HGKNKVDINTEMQLVEQRLKQLVEQGCSEEETKHAMRDLGLKRAKHFGLPNTYVFTKVMG  245

Query  173  EMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            EM LG ++E++P+V+IRP +IT T+ +PFPGW+EG++T+D++ + YGKG L CFL D
Sbjct  246  EMFLGHYRENMPIVVIRPAMITSTFSDPFPGWIEGVKTVDTVIVSYGKGMLKCFLID  302



>ref|XP_006347258.1| PREDICTED: fatty acyl-CoA reductase 3-like [Solanum tuberosum]
Length=506

 Score =   342 bits (878),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/295 (55%), Positives = 218/295 (74%), Gaps = 4/295 (1%)
 Frame = -3

Query  875  QFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKEI  696
            +F++  TIL+TGA GFLAK+ +EKILRVQ NV+KLYLL+RA +  +A +RF  E++  E+
Sbjct  21   EFMEGKTILITGATGFLAKLVMEKILRVQSNVRKLYLLIRAPNNNSAKERFTREVMMSEL  80

Query  695  FQILKEKCGN----SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKF  528
            F + +EK G+    S++ EKV  ++GD+SYENLG+K+S L   M  E+D ++N AA T F
Sbjct  81   FNVAREKIGSENLKSLMKEKVFAISGDISYENLGIKNSELREEMHKEIDIIINSAAVTNF  140

Query  527  DERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNG  348
             ERYD+A+ VN +G  +VL FAK C KL++LLHVSTAYV G   G++ E P+ MGE L+ 
Sbjct  141  YERYDIAMNVNVVGAMNVLKFAKSCIKLKMLLHVSTAYVCGKAIGILPEKPFDMGETLSE  200

Query  347  KSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGEM  168
             + LDID E+ V+   L++L   NA+ + +T AMK+LG+QRAR++GWPN Y FTKA+GEM
Sbjct  201  NTYLDIDVERGVIANKLKELETLNATPKEVTIAMKELGMQRARLHGWPNIYSFTKAMGEM  260

Query  167  VLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            +LG  KE+  VVIIRPTIIT TYKEPFPGW+EG+RT+DS  + YGKG L  + GD
Sbjct  261  ILGHLKENSQVVIIRPTIITSTYKEPFPGWIEGVRTVDSFIVAYGKGVLKFYYGD  315



>ref|XP_010070015.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Eucalyptus grandis]
Length=493

 Score =   342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 226/304 (74%), Gaps = 8/304 (3%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL   ++FL+N TILVTGA GFLAKIF+EKILR+QPNVKK++LL+RA D ++A +R + 
Sbjct  1    MEL-DIVRFLENKTILVTGATGFLAKIFVEKILRIQPNVKKMFLLIRATDKQSATRRLHE  59

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            E++ K++F +L+EK     NS++ EK+T V GDVS ENLGV +  L ++M  E+D +VN 
Sbjct  60   ELLQKKLFHVLREKWAENFNSIV-EKLTPVPGDVSCENLGVHNFDLRSQMWREIDIIVNS  118

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATTKFDERYD+AL VN+ G KHV  FA +C  +++LLH+STAYV G   G+I E  + M
Sbjct  119  AATTKFDERYDIALAVNSFGAKHVAEFAVRCANIKMLLHISTAYVCGNMTGIIREKTFNM  178

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE LNG   LD++EEK ++EE + +L   NAS+  IT A+K+LG+QRAR++GWPNTY  T
Sbjct  179  GETLNGSGVLDMNEEKLLVEELMMELREMNASEREITIALKNLGLQRARLHGWPNTYTLT  238

Query  185  KALGEMVLGEF-KEDLPVVIIRPTIITGTYKEPFPGWVE--GIRTIDSLGLGYGKGKLTC  15
            KA+GEM+L     ++ P+  IRPT+IT TY+EPF GW+E    RTIDS+ + YG+G+L  
Sbjct  239  KAMGEMILWHHCNQNTPLAFIRPTVITSTYREPFAGWMEDSSFRTIDSIAINYGRGRLKF  298

Query  14   FLGD  3
            FLG+
Sbjct  299  FLGN  302



>ref|XP_010041357.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Eucalyptus grandis]
Length=402

 Score =   338 bits (866),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/298 (55%), Positives = 221/298 (74%), Gaps = 7/298 (2%)
 Frame = -3

Query  878  LQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKE  699
            +QFL+N TILVTGA GFLAKIF+EKILR+QPNVKK+Y+L+RA D +AA+QR + E+I K+
Sbjct  6    VQFLENKTILVTGATGFLAKIFVEKILRIQPNVKKIYVLIRAMDKQAAIQRLHEELIEKK  65

Query  698  IFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKF  528
            +F  L+E+     NS++ EK++ + GDVS ENLGV D  L   M  E+D +V+ AATTKF
Sbjct  66   LFDNLREEWAENFNSIV-EKLSPIPGDVSCENLGVHDFDLRLEMWREIDIIVSSAATTKF  124

Query  527  DERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNG  348
            DERYD+AL VN  G KHV  FA +C  +++LLH+STAYV G   G+I E  + MGE LNG
Sbjct  125  DERYDIALAVNVFGAKHVAEFAVRCVNIKMLLHISTAYVWGNMTGIIREKTFSMGETLNG  184

Query  347  KSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGE-  171
               LD++EEK ++EE + +L   NAS+   T A+K+LG+QRAR++GWPNTY  TKA+GE 
Sbjct  185  SRKLDVNEEKLLVEELMNELREKNASERESTIALKNLGLQRARLHGWPNTYTLTKAMGEM  244

Query  170  MVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGI--RTIDSLGLGYGKGKLTCFLGD  3
            MV    K+++ + ++RPTIIT TY+EPF GW+EG   RT+DS+ + YG+G+L  FLG+
Sbjct  245  MVQHHLKQNIQLAVMRPTIITSTYREPFAGWIEGFPPRTMDSIAILYGRGRLKYFLGN  302



>gb|KCW58994.1| hypothetical protein EUGRSUZ_H01618 [Eucalyptus grandis]
Length=493

 Score =   341 bits (874),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/298 (55%), Positives = 225/298 (76%), Gaps = 7/298 (2%)
 Frame = -3

Query  878  LQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKE  699
            +QFL+N TILVTGA GFLAKIF+EKILR+QPN+KK+Y+L+RA D +AA+QR + E+I K+
Sbjct  6    VQFLENKTILVTGATGFLAKIFVEKILRIQPNIKKIYVLIRATDKQAAIQRLHEELIEKK  65

Query  698  IFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKF  528
            +F  L+E+     NS++ EK++ + GDVS ENLGV D  L   M  E+D +V+ AATTKF
Sbjct  66   LFDNLREEWAENFNSIV-EKLSPIPGDVSCENLGVHDFDLRLEMWREIDIIVSSAATTKF  124

Query  527  DERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNG  348
            DERYD+AL VN  G KHV  FA +C  +++LLH+STAYVSG   G+I E  + MGE LNG
Sbjct  125  DERYDIALAVNVFGAKHVAEFAVRCVNVKMLLHISTAYVSGSMTGIIREKTFSMGETLNG  184

Query  347  KSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGE-  171
               LD++EEK ++EE + +L   NAS+   T A+K+LG+QRAR++GWPNTY+ TKA+GE 
Sbjct  185  SRKLDVNEEKLLVEELMNELQEKNASERESTIALKNLGLQRARLHGWPNTYILTKAMGEM  244

Query  170  MVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEG--IRTIDSLGLGYGKGKLTCFLGD  3
            MV    K+++ +V++RPTIIT TY+EPF GW+EG  +RT+DS+ + YG+G+L  FLG+
Sbjct  245  MVQHHLKQNIQLVVMRPTIITSTYQEPFAGWIEGFPLRTMDSIAILYGRGRLKYFLGN  302



>ref|XP_009364295.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Pyrus 
x bretschneideri]
Length=493

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/302 (58%), Positives = 222/302 (74%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            MEL S L +  N TILVTGA GFL  +F+EKILRVQP+VKK+YLL+RA DT AA  R + 
Sbjct  1    MELKSILGYFRNKTILVTGATGFLGMVFVEKILRVQPDVKKIYLLIRATDTMAATDRMHK  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EII KE+F +LKE+ G   +S I+ KV  + GDV  E+LGVK+  L   M SE++ ++N 
Sbjct  61   EIIEKELFSVLKEEWGTEFDSFIANKVVAIPGDVVSEDLGVKEFKLREEMCSEIEIILNS  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            A TT FDERYD+AL VNT G +HVL+ AKKC KL ILLHVSTAYV G KEGLI E    M
Sbjct  121  AGTTNFDERYDIALSVNTFGVQHVLSMAKKCLKLEILLHVSTAYVCGRKEGLILEDSSCM  180

Query  365  GEALNGKSGLDIDE-EKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
             E +   +  D    EK ++EE L++L  +NA++E I + MKD GI+R++ YGWPNTYVF
Sbjct  181  DEMVKETAKFDFKALEKNLVEEKLKELEAENATEEVIRTTMKDFGIERSKSYGWPNTYVF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GE+V+ + K++LPV+I+RPT++T TYKEPFPGWV+G RTIDS+  GY KGKLTC L
Sbjct  241  TKAMGEIVIEQSKDNLPVLILRPTVVTSTYKEPFPGWVQGFRTIDSVIAGYCKGKLTCLL  300

Query  8    GD  3
             D
Sbjct  301  FD  302



>ref|XP_009419426.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Musa acuminata 
subsp. malaccensis]
Length=490

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/301 (56%), Positives = 229/301 (76%), Gaps = 3/301 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            ME    ++F  N +ILVTG+ GFLAKIF+EK+LRVQP VKKL+LL+RA D  +A +R  T
Sbjct  1    MESIRIVKFFKNKSILVTGSTGFLAKIFVEKVLRVQPEVKKLFLLVRAGDAASANRRVQT  60

Query  716  EIIGKEIFQILKEKCGN---SVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+ K++F++LK+K G+   S ++ K+  +AGD+  E+LG+ DS L   +  EV+ VVN+
Sbjct  61   EILEKDLFKVLKDKHGDGFHSFVASKLVPLAGDIVQEDLGIHDSDLRRNLWKEVEVVVNV  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKM  366
            AATT FDERYDVALG+N +G KH+L FAK+C +L++LLHVSTAYV+G++ GLI E  + M
Sbjct  121  AATTNFDERYDVALGINVLGAKHILEFAKRCVRLQMLLHVSTAYVAGVQSGLILEKKFLM  180

Query  365  GEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFT  186
            GE L G S LDI+ E  + ++  RDL  ++A++E+   AMK+LGI RA+++GWPNTYVFT
Sbjct  181  GETLTGDSYLDIEAELSLADKKKRDLRAEDATEEAEKLAMKELGINRAKLFGWPNTYVFT  240

Query  185  KALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLG  6
            KA+GEM+LG  + DLP+VI+RPTIIT    +P PGWVEG RTIDS+ +GY KGK+TCF G
Sbjct  241  KAMGEMLLGHSRGDLPMVILRPTIITSVQSDPLPGWVEGTRTIDSVLIGYAKGKITCFFG  300

Query  5    D  3
            D
Sbjct  301  D  301



>gb|KCW58570.1| hypothetical protein EUGRSUZ_H01227 [Eucalyptus grandis]
Length=402

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/298 (54%), Positives = 222/298 (74%), Gaps = 7/298 (2%)
 Frame = -3

Query  878  LQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKE  699
            +QFL+N TILVTGA GFL KIF+EK+L++QPNVKK+Y+L+RA D +AA QR + E+I K+
Sbjct  6    VQFLENKTILVTGATGFLVKIFVEKLLQIQPNVKKMYVLIRAMDKQAAKQRLHEELIQKK  65

Query  698  IFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKF  528
            +F IL+E+     NS++ EK++ + GDVS ENL V D  L + M  E+D +V+ AATTKF
Sbjct  66   LFDILREEWAENFNSIV-EKLSPIPGDVSCENLRVHDFDLRSEMWREIDIIVSSAATTKF  124

Query  527  DERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNG  348
            DERYD+AL VNT G KHV  FA +C  +++LLH+STAYV G   G+I E  + MGE  NG
Sbjct  125  DERYDIALAVNTFGAKHVAEFAVRCVNIKMLLHISTAYVCGDMTGIIQEKAFSMGETPNG  184

Query  347  KSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGEM  168
               LD++EEK ++EE + +L   NAS+  IT A+K+LG+QRAR++GWPNTY  TKA+GEM
Sbjct  185  SRKLDVNEEKLLVEELMNELQERNASEREITIALKNLGLQRARLHGWPNTYTLTKAMGEM  244

Query  167  VL-GEFKEDLPVVIIRPTIITGTYKEPFPGWVEGI--RTIDSLGLGYGKGKLTCFLGD  3
            ++    K+++ + I+RPTIIT TY+EPF GW+EG   RT+DS+ + YG+G+L  FLG+
Sbjct  245  IVQHHLKQNIQLAIMRPTIITSTYREPFAGWIEGFPPRTMDSIAILYGRGRLKYFLGN  302



>ref|XP_006851509.1| hypothetical protein AMTR_s00040p00158690 [Amborella trichopoda]
 gb|ERN13090.1| hypothetical protein AMTR_s00040p00158690 [Amborella trichopoda]
Length=487

 Score =   338 bits (867),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/302 (55%), Positives = 220/302 (73%), Gaps = 4/302 (1%)
 Frame = -3

Query  896  MELGSALQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNT  717
            M L   ++ L + +IL+TG+ GFLAKI +EK+LR QP VKKL+LL+RA+D  +A  R + 
Sbjct  1    MGLDDIIRSLQHKSILITGSTGFLAKILVEKVLRTQPEVKKLFLLIRASDLNSARYRLHN  60

Query  716  EIIGKEIFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNL  546
            EI+ KE+F++L+EK G   +S + EK+  V GDV +E+LG+ D  L   +  E D ++N+
Sbjct  61   EILKKELFKVLREKHGSGFDSFVREKIFPVVGDVGHESLGIADLELRKTLWREADIIINV  120

Query  545  AATTKFDERYDVALGVNTMGPKHVLNFAKKCP-KLRILLHVSTAYVSGIKEGLIAESPYK  369
            AATT FDERYDVAL VNT+G KHVL FAK+C  +L +LLHVSTAYVSG K GLI E P K
Sbjct  121  AATTSFDERYDVALEVNTLGAKHVLEFAKQCGGRLEVLLHVSTAYVSGNKSGLIMEKPIK  180

Query  368  MGEALNGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVF  189
            +GE L   S LDID E +++E  L     + A +++   AMK LG++RAR+YGWPNTY F
Sbjct  181  LGETLIPYSHLDIDFELKLVEIELEKARNEGADEKTQRLAMKKLGLKRARLYGWPNTYTF  240

Query  188  TKALGEMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFL  9
            TKA+GEM++G  + DLPVVI+RP+II  T+ +PFPGW+EG RTIDSL + +GKGKL CFL
Sbjct  241  TKAMGEMMMGHLRGDLPVVIMRPSIIESTFSDPFPGWMEGARTIDSLIVNFGKGKLKCFL  300

Query  8    GD  3
             D
Sbjct  301  AD  302



>gb|KCW44418.1| hypothetical protein EUGRSUZ_L02093, partial [Eucalyptus grandis]
Length=438

 Score =   337 bits (863),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 163/298 (55%), Positives = 221/298 (74%), Gaps = 7/298 (2%)
 Frame = -3

Query  878  LQFLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKE  699
            +QFL+N TILVTGA GFLAKIF+EKILR+QPNVKK+Y+L+RA D +AA+QR + E+I K+
Sbjct  4    VQFLENKTILVTGATGFLAKIFVEKILRIQPNVKKIYVLIRAMDKQAAIQRLHEELIEKK  63

Query  698  IFQILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKF  528
            +F  L+E+     NS++ EK++ + GDVS ENLGV D  L   M  E+D +V+ AATTKF
Sbjct  64   LFDNLREEWAENFNSIV-EKLSPIPGDVSCENLGVHDFDLRLEMWREIDIIVSSAATTKF  122

Query  527  DERYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSGIKEGLIAESPYKMGEALNG  348
            DERYD+AL VN  G KHV  FA +C  +++LLH+STAYV G   G+I E  + MGE LNG
Sbjct  123  DERYDIALAVNVFGAKHVAEFAVRCVNIKMLLHISTAYVWGNMTGIIREKTFSMGETLNG  182

Query  347  KSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALGE-  171
               LD++EEK ++EE + +L   NAS+   T A+K+LG+QRAR++GWPNTY  TKA+GE 
Sbjct  183  SRKLDVNEEKLLVEELMNELREKNASERESTIALKNLGLQRARLHGWPNTYTLTKAMGEM  242

Query  170  MVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGI--RTIDSLGLGYGKGKLTCFLGD  3
            MV    K+++ + ++RPTIIT TY+EPF GW+EG   RT+DS+ + YG+G+L  FLG+
Sbjct  243  MVQHHLKQNIQLAVMRPTIITSTYREPFAGWIEGFPPRTMDSIAILYGRGRLKYFLGN  300



>gb|AES88411.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=494

 Score =   338 bits (866),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/297 (54%), Positives = 219/297 (74%), Gaps = 7/297 (2%)
 Frame = -3

Query  872  FLDNTTILVTGAAGFLAKIFLEKILRVQPNVKKLYLLLRAADTEAALQRFNTEIIGKEIF  693
            FL   TILVTGAAGFLAK+F+EKILR+QP ++KLYLLLRA++T+ A  R   E+   ++F
Sbjct  6    FLKGKTILVTGAAGFLAKVFVEKILRIQPEIQKLYLLLRASNTDLAENRLRNEVFEIDLF  65

Query  692  QILKEKCG---NSVISEKVTVVAGDVSYENLGVKDSHLLTRMLSEVDAVVNLAATTKFDE  522
            ++L+ K G   +S IS+KV  +AGDV+ ENLG+KD  L   +  E+D +V+ AA+TKFDE
Sbjct  66   RVLRAKWGENFSSFISKKVVAIAGDVAIENLGIKDEKLKREIFEEIDLLVHFAASTKFDE  125

Query  521  RYDVALGVNTMGPKHVLNFAKKCPKLRILLHVSTAYVSG-IKEG---LIAESPYKMGEAL  354
            R+D+ + VNT G  H LN AK C +++  +H+STAYV G  K+G   ++ E+P++MGE+L
Sbjct  126  RFDILMAVNTQGALHALNVAKNCKRIKAFVHISTAYVCGDAKDGDSIILRENPFEMGESL  185

Query  353  NGKSGLDIDEEKRVMEEALRDLTRDNASQESITSAMKDLGIQRARMYGWPNTYVFTKALG  174
             G S LDI EE  ++E  L +L   N  + +IT AMKD G++RA +YGWPNTY FTKA+G
Sbjct  186  KGTSKLDIHEEMNLLERKLAELQAMNVDENTITCAMKDYGMERANLYGWPNTYTFTKAMG  245

Query  173  EMVLGEFKEDLPVVIIRPTIITGTYKEPFPGWVEGIRTIDSLGLGYGKGKLTCFLGD  3
            EM+L   K+++P++IIRPT+IT T K+PFPGW+EG+RTIDSL   YG GK+ CFLG+
Sbjct  246  EMLLVHHKDNVPLIIIRPTMITSTNKDPFPGWIEGLRTIDSLIYAYGHGKVKCFLGN  302



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2096606554367