BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17072_g1_i2 len=897 path=[1379:0-412 406:413-480 152:481-896]

Length=897
                                                                      Score     E

emb|CDP04689.1|  unnamed protein product                                184   9e-54   
ref|XP_002280638.1|  PREDICTED: uncharacterized protein LOC100248...    178   1e-51   Vitis vinifera
ref|XP_010539940.1|  PREDICTED: uncharacterized protein LOC104813856    177   3e-51   
ref|XP_009625685.1|  PREDICTED: uncharacterized protein LOC104116517    177   5e-51   
ref|XP_010270394.1|  PREDICTED: uncharacterized protein LOC104606742    176   6e-51   
ref|XP_011096949.1|  PREDICTED: uncharacterized protein LOC105175992    177   6e-51   
ref|XP_008244416.1|  PREDICTED: uncharacterized protein LOC103342560    176   6e-51   
ref|XP_006858398.1|  hypothetical protein AMTR_s00071p00027790          176   8e-51   
ref|XP_007206056.1|  hypothetical protein PRUPE_ppa012640mg             176   9e-51   
ref|XP_009785400.1|  PREDICTED: uncharacterized protein LOC104233672    176   1e-50   
ref|XP_006432220.1|  hypothetical protein CICLE_v10002727mg             176   1e-50   
ref|XP_006350961.1|  PREDICTED: uncharacterized protein LOC102606098    175   2e-50   
ref|XP_004288117.1|  PREDICTED: uncharacterized protein LOC101295944    175   2e-50   
ref|XP_004148658.1|  PREDICTED: uncharacterized protein LOC101204156    175   2e-50   
ref|XP_002310516.1|  hypothetical protein POPTR_0007s04100g             175   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_009374204.1|  PREDICTED: uncharacterized protein LOC103963...    175   3e-50   
ref|XP_004249910.1|  PREDICTED: uncharacterized protein LOC101250...    175   3e-50   
ref|XP_008441053.1|  PREDICTED: uncharacterized protein LOC103485281    174   5e-50   
ref|XP_010094739.1|  hypothetical protein L484_019949                   173   1e-49   
emb|CDX73121.1|  BnaC06g35690D                                          172   2e-49   
ref|XP_010027659.1|  PREDICTED: uncharacterized protein LOC104418122    173   2e-49   
ref|XP_009106143.1|  PREDICTED: uncharacterized protein LOC103831946    172   2e-49   
ref|XP_010428483.1|  PREDICTED: uncharacterized protein LOC104713126    172   2e-49   
ref|NP_001237675.1|  uncharacterized protein LOC100500669               172   3e-49   
emb|CDY45401.1|  BnaA07g31810D                                          172   3e-49   
ref|XP_007048390.1|  NAD(P)H:plastoquinone dehydrogenase complex ...    172   5e-49   
ref|XP_006390375.1|  hypothetical protein EUTSA_v10019178mg             171   6e-49   
gb|ACY01921.1|  hypothetical protein                                    171   6e-49   
ref|XP_010680197.1|  PREDICTED: uncharacterized protein LOC104895398    171   6e-49   
ref|XP_002888997.1|  hypothetical protein ARALYDRAFT_476624             171   6e-49   
ref|XP_008371399.1|  PREDICTED: uncharacterized protein LOC103434...    171   6e-49   
ref|XP_007137726.1|  hypothetical protein PHAVU_009G150600g             171   7e-49   
ref|XP_010471583.1|  PREDICTED: uncharacterized protein LOC104751356    171   8e-49   
ref|XP_003602617.1|  NAD(P)H-quinone oxidoreductase subunit             171   8e-49   
ref|XP_010416346.1|  PREDICTED: uncharacterized protein LOC104702218    171   8e-49   
gb|KFK41927.1|  hypothetical protein AALP_AA2G189900                    171   9e-49   
ref|XP_009392547.1|  PREDICTED: uncharacterized protein LOC103978...    171   1e-48   
gb|ACJ85995.1|  unknown                                                 171   1e-48   Medicago truncatula
ref|XP_004502939.1|  PREDICTED: uncharacterized protein LOC101514807    170   2e-48   
ref|XP_003565117.1|  PREDICTED: uncharacterized protein LOC100820990    169   4e-48   
ref|XP_006302858.1|  hypothetical protein CARUB_v10020988mg             170   4e-48   
ref|NP_001045462.1|  Os01g0959900                                       169   7e-48   Oryza sativa Japonica Group [Japonica rice]
gb|KHG18335.1|  NAD (P)H-quinone oxidoreductase subunit O               169   9e-48   
gb|EEE56043.1|  hypothetical protein OsJ_04839                          169   1e-47   Oryza sativa Japonica Group [Japonica rice]
ref|NP_565093.1|  NAD(P)H:plastoquinone dehydrogenase complex sub...    168   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AFW83906.1|  hypothetical protein ZEAMMB73_217588                    167   1e-47   
gb|KDP43684.1|  hypothetical protein JCGZ_24142                         167   2e-47   
ref|XP_002456968.1|  hypothetical protein SORBIDRAFT_03g046510          167   2e-47   Sorghum bicolor [broomcorn]
ref|XP_004971333.1|  PREDICTED: uncharacterized protein LOC101767228    167   2e-47   
ref|XP_010312492.1|  PREDICTED: uncharacterized protein LOC101250...    167   2e-47   
ref|XP_010912612.1|  PREDICTED: uncharacterized protein LOC105038...    167   4e-47   
gb|AFK37298.1|  unknown                                                 166   7e-47   
ref|XP_006646707.1|  PREDICTED: uncharacterized protein LOC102716472    162   2e-46   
emb|CDM86745.1|  unnamed protein product                                165   2e-46   
gb|EYU18036.1|  hypothetical protein MIMGU_mgv1a016493mg                163   2e-46   
dbj|BAK01265.1|  predicted protein                                      164   4e-46   
ref|XP_006646708.1|  PREDICTED: uncharacterized protein LOC102716754    162   4e-46   
gb|EYU24312.1|  hypothetical protein MIMGU_mgv1a0153392mg               161   6e-46   
ref|XP_008343329.1|  PREDICTED: uncharacterized protein LOC103406089    158   7e-45   
ref|XP_008657857.1|  PREDICTED: uncharacterized protein LOC103637441    160   9e-45   
emb|CAN67062.1|  hypothetical protein VITISV_017539                     160   3e-44   Vitis vinifera
ref|XP_006390379.1|  hypothetical protein EUTSA_v10019178mg             160   3e-44   
gb|KHN09611.1|  NAD(P)H-quinone oxidoreductase subunit O                159   2e-43   
gb|EMT23695.1|  hypothetical protein F775_08346                         155   2e-43   
ref|XP_008371331.1|  PREDICTED: uncharacterized protein LOC103434...    157   4e-43   
ref|XP_002517265.1|  conserved hypothetical protein                     155   1e-42   Ricinus communis
ref|XP_006390376.1|  hypothetical protein EUTSA_v10019178mg             148   6e-40   
emb|CCI55383.1|  NDH subunit NdhO                                       147   2e-39   
ref|XP_002984034.1|  hypothetical protein SELMODRAFT_49258              140   4e-38   
ref|XP_001777972.1|  predicted protein                                  143   9e-38   
ref|XP_009374205.1|  PREDICTED: uncharacterized protein LOC103963...    138   2e-36   
ref|XP_002960102.1|  hypothetical protein SELMODRAFT_437242             149   2e-36   
ref|XP_008371548.1|  PREDICTED: uncharacterized protein LOC103434...    135   2e-35   
ref|XP_010912613.1|  PREDICTED: uncharacterized protein LOC105038...    132   5e-34   
gb|EMS54216.1|  hypothetical protein TRIUR3_24045                       131   7e-34   
ref|XP_006390377.1|  hypothetical protein EUTSA_v10019178mg             126   1e-31   
ref|XP_010649372.1|  PREDICTED: uncharacterized protein LOC100248...    125   2e-31   
ref|XP_006464987.1|  PREDICTED: uncharacterized protein LOC102608...    125   6e-31   
ref|XP_003521975.1|  PREDICTED: uncharacterized protein LOC100802383    120   3e-30   
ref|XP_008371473.1|  PREDICTED: uncharacterized protein LOC103434...    121   1e-29   
ref|XP_009392546.1|  PREDICTED: uncharacterized protein LOC103978...  94.0    6e-23   
ref|XP_007048391.1|  NAD(P)H:plastoquinone dehydrogenase complex ...  99.8    4e-22   
ref|XP_003602618.1|  NAD(P)H-quinone oxidoreductase subunit           95.5    2e-20   
gb|AES72869.2|  cyanobacterial and plant NDH-1 subunit O              95.5    3e-20   
ref|XP_008795230.1|  PREDICTED: uncharacterized protein LOC103711038  46.2    2e-09   
ref|WP_023174818.1|  hypothetical protein                             48.5    4e-04   
ref|WP_011143533.1|  NAD(P)H-quinone oxidoreductase subunit O         47.8    6e-04   



>emb|CDP04689.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   184 bits (466),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  673  VKAEESSQPPQTPQNVaaaetkpeaaASSDAppppppkpkkPVYSMKKGQIVRVDKEKYL  494
            VKAE+S++P    +       +    + S +   PPPKPKKPVYSMKKGQIVRVDKEKYL
Sbjct  33   VKAEKSAEPASDQKLTETKTQEVSTNSQSASSTSPPPKPKKPVYSMKKGQIVRVDKEKYL  92

Query  493  NSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWVGVPTAPAWLPTEILIK  314
            NSINYLSVGHPPYYKGL+YIYEDRGEVLDIRIFETGEYALIGWVG+PTAPAWLPT++LIK
Sbjct  93   NSINYLSVGHPPYYKGLDYIYEDRGEVLDIRIFETGEYALIGWVGIPTAPAWLPTDMLIK  152

Query  313  SDKLNYERI  287
            SDKL+YER+
Sbjct  153  SDKLDYERM  161



>ref|XP_002280638.1| PREDICTED: uncharacterized protein LOC100248924 isoform X1 [Vitis 
vinifera]
 emb|CBI37537.3| unnamed protein product [Vitis vinifera]
Length=158

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGEYALI 
Sbjct  72   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEYALIA  131

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKSDKLNYER+
Sbjct  132  WVGIPTAPAWLPTDMLIKSDKLNYERM  158



>ref|XP_010539940.1| PREDICTED: uncharacterized protein LOC104813856 [Tarenaya hassleriana]
Length=156

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 87/87 (100%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLDIRIFETGEYAL+G
Sbjct  70   VYSMKKGQIVRVDKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDIRIFETGEYALVG  129

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KLNYER+
Sbjct  130  WVGIPTAPAWLPTDMLIKSEKLNYERL  156



>ref|XP_009625685.1| PREDICTED: uncharacterized protein LOC104116517 [Nicotiana tomentosiformis]
Length=157

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSV HPPYYKGL+YIYEDRGEVLD+RIFETGEYALIG
Sbjct  71   VYSMKKGQIVRVDKEKYLNSINYLSVDHPPYYKGLDYIYEDRGEVLDLRIFETGEYALIG  130

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            W+G+PTAPAWLPTE+LIKSDKL+YERI
Sbjct  131  WIGIPTAPAWLPTEMLIKSDKLDYERI  157



>ref|XP_010270394.1| PREDICTED: uncharacterized protein LOC104606742 [Nelumbo nucifera]
Length=158

 Score =   176 bits (447),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYL+S+NYLSVGHPPYYKGL+YIYEDRGEVLDIRIFETGEYALI 
Sbjct  72   VYSMKKGQIVRVDKEKYLSSVNYLSVGHPPYYKGLDYIYEDRGEVLDIRIFETGEYALIA  131

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKSDKLNYERI
Sbjct  132  WVGIPTAPAWLPTDMLIKSDKLNYERI  158



>ref|XP_011096949.1| PREDICTED: uncharacterized protein LOC105175992 [Sesamum indicum]
Length=159

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGEYALI 
Sbjct  73   VYSMKKGQIVRVDKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEYALIA  132

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKSDKL+YERI
Sbjct  133  WVGIPTAPAWLPTDMLIKSDKLDYERI  159



>ref|XP_008244416.1| PREDICTED: uncharacterized protein LOC103342560 [Prunus mume]
Length=160

 Score =   176 bits (447),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+KEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGEYAL+ 
Sbjct  74   VYSMKKGQIVRVEKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEYALVA  133

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVGVPTAPAWLPTE+LIKS+KLNYER+
Sbjct  134  WVGVPTAPAWLPTEMLIKSEKLNYERL  160



>ref|XP_006858398.1| hypothetical protein AMTR_s00071p00027790 [Amborella trichopoda]
 gb|ERN19865.1| hypothetical protein AMTR_s00071p00027790 [Amborella trichopoda]
Length=164

 Score =   176 bits (447),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = -3

Query  544  YSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGW  365
            YSMKKGQIVRVDKEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLDIRIFETGEYALI W
Sbjct  79   YSMKKGQIVRVDKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDIRIFETGEYALIAW  138

Query  364  VGVPTAPAWLPTEILIKSDKLNYERI  287
            VG+PTAPAWLPTE+LIKSD LNYER 
Sbjct  139  VGIPTAPAWLPTEMLIKSDNLNYERF  164



>ref|XP_007206056.1| hypothetical protein PRUPE_ppa012640mg [Prunus persica]
 gb|EMJ07255.1| hypothetical protein PRUPE_ppa012640mg [Prunus persica]
Length=160

 Score =   176 bits (446),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+KEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGEYAL+ 
Sbjct  74   VYSMKKGQIVRVEKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEYALVA  133

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVGVPTAPAWLPTE+LIKS+KLNYER+
Sbjct  134  WVGVPTAPAWLPTEMLIKSEKLNYERL  160



>ref|XP_009785400.1| PREDICTED: uncharacterized protein LOC104233672 [Nicotiana sylvestris]
Length=157

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSV HPPYYKGL+YIYEDRGEVLD+RIFETGEYALIG
Sbjct  71   VYSMKKGQIVRVDKEKYLNSINYLSVDHPPYYKGLDYIYEDRGEVLDLRIFETGEYALIG  130

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            W+G+PTAPAWLPTE+LIKSDKL+YERI
Sbjct  131  WIGIPTAPAWLPTEMLIKSDKLDYERI  157



>ref|XP_006432220.1| hypothetical protein CICLE_v10002727mg [Citrus clementina]
 ref|XP_006464988.1| PREDICTED: uncharacterized protein LOC102608658 isoform X2 [Citrus 
sinensis]
 gb|ESR45460.1| hypothetical protein CICLE_v10002727mg [Citrus clementina]
 gb|KDO50301.1| hypothetical protein CISIN_1g031252mg [Citrus sinensis]
Length=163

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGE+AL+ 
Sbjct  77   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEHALVA  136

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKSDKL+YER+
Sbjct  137  WVGIPTAPAWLPTDMLIKSDKLDYERL  163



>ref|XP_006350961.1| PREDICTED: uncharacterized protein LOC102606098 [Solanum tuberosum]
Length=160

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+KEKYLNSINYLSV HPPYYKGL+YIYEDRGEVLDIRIFETGEYALIG
Sbjct  74   VYSMKKGQIVRVEKEKYLNSINYLSVDHPPYYKGLDYIYEDRGEVLDIRIFETGEYALIG  133

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            W+G+PTAPAWLPTE+LIKSDKL+YERI
Sbjct  134  WIGIPTAPAWLPTEMLIKSDKLDYERI  160



>ref|XP_004288117.1| PREDICTED: uncharacterized protein LOC101295944 [Fragaria vesca 
subsp. vesca]
Length=159

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGEYALI 
Sbjct  73   VYSMKKGQIVRVDKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEYALIA  132

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVGVPTAPAWLPTE+LIKS+KL+YER+
Sbjct  133  WVGVPTAPAWLPTEMLIKSEKLDYERL  159



>ref|XP_004148658.1| PREDICTED: uncharacterized protein LOC101204156 [Cucumis sativus]
 gb|KGN48349.1| hypothetical protein Csa_6G483310 [Cucumis sativus]
Length=160

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNS+NYLSVGHPPY+KGL+YIYEDRGEVLD+RIFETGEYALI 
Sbjct  74   VYSMKKGQIVRVDKEKYLNSVNYLSVGHPPYFKGLDYIYEDRGEVLDLRIFETGEYALIA  133

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPTE+LIKS+KLNYER+
Sbjct  134  WVGIPTAPAWLPTEMLIKSEKLNYERL  160



>ref|XP_002310516.1| hypothetical protein POPTR_0007s04100g [Populus trichocarpa]
 ref|XP_011022948.1| PREDICTED: uncharacterized protein LOC105124576 [Populus euphratica]
 gb|ABK96516.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE90966.1| hypothetical protein POPTR_0007s04100g [Populus trichocarpa]
Length=157

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            +YSMKKGQIVRVDKEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGEYAL+ 
Sbjct  71   IYSMKKGQIVRVDKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEYALVS  130

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVGVPTAPAWLPT++LIKS+KLNYER+
Sbjct  131  WVGVPTAPAWLPTDMLIKSEKLNYERL  157



>ref|XP_009374204.1| PREDICTED: uncharacterized protein LOC103963151 isoform X1 [Pyrus 
x bretschneideri]
Length=163

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  673  VKAEESSQPPQTPQNVaaaetkpeaaASSDAppppppkpkkPVYSMKKGQIVRVDKEKYL  494
            +KA ++++P     N   A +   A  S+      PP  KKPVYSMKKGQIVRV+K+KYL
Sbjct  35   IKAVKATEPEANNNNTEKASSSSNAQPSTATAASKPPPKKKPVYSMKKGQIVRVEKDKYL  94

Query  493  NSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWVGVPTAPAWLPTEILIK  314
            NS+NYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGEYAL+ WVGVPTAPAWLPT++LI+
Sbjct  95   NSVNYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEYALVAWVGVPTAPAWLPTDMLIR  154

Query  313  SDKLNYERI  287
            SDKL+YER+
Sbjct  155  SDKLDYERL  163



>ref|XP_004249910.1| PREDICTED: uncharacterized protein LOC101250560 isoform X2 [Solanum 
lycopersicum]
Length=160

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+KEKYLNSINYLSV HPPYYKGL+YIYEDRGEVLDIRIFETGEYALIG
Sbjct  74   VYSMKKGQIVRVEKEKYLNSINYLSVDHPPYYKGLDYIYEDRGEVLDIRIFETGEYALIG  133

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            W+G+PTAPAWLPTE+LIKSDKL+YERI
Sbjct  134  WIGIPTAPAWLPTEMLIKSDKLDYERI  160



>ref|XP_008441053.1| PREDICTED: uncharacterized protein LOC103485281 [Cucumis melo]
Length=160

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNS+NYLSVGHPPY+KGL+YIYEDRGEVLD+RIFETGEYALI 
Sbjct  74   VYSMKKGQIVRVDKEKYLNSVNYLSVGHPPYFKGLDYIYEDRGEVLDLRIFETGEYALIA  133

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPTE+LIKS+KLNYER+
Sbjct  134  WVGIPTAPAWLPTEMLIKSEKLNYERL  160



>ref|XP_010094739.1| hypothetical protein L484_019949 [Morus notabilis]
 gb|EXB56904.1| hypothetical protein L484_019949 [Morus notabilis]
Length=164

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGE+AL+ 
Sbjct  78   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEHALVA  137

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL+YER+
Sbjct  138  WVGIPTAPAWLPTDMLIKSEKLDYERL  164



>emb|CDX73121.1| BnaC06g35690D [Brassica napus]
Length=158

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIR+FETGEYAL+G
Sbjct  72   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRVFETGEYALVG  131

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL YER+
Sbjct  132  WVGIPTAPAWLPTDMLIKSEKLVYERL  158



>ref|XP_010027659.1| PREDICTED: uncharacterized protein LOC104418122 [Eucalyptus grandis]
 gb|KCW54225.1| hypothetical protein EUGRSUZ_I00205 [Eucalyptus grandis]
Length=169

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYL+S+NYLSVGHPPYYKGL+YIYEDRGEVLDIRIFETGEYALI 
Sbjct  83   VYSMKKGQIVRVDKEKYLDSVNYLSVGHPPYYKGLDYIYEDRGEVLDIRIFETGEYALIA  142

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL+YER+
Sbjct  143  WVGIPTAPAWLPTDMLIKSEKLDYERL  169



>ref|XP_009106143.1| PREDICTED: uncharacterized protein LOC103831946 [Brassica rapa]
Length=156

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIR+FETGEYAL+G
Sbjct  70   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRVFETGEYALVG  129

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL YER+
Sbjct  130  WVGIPTAPAWLPTDMLIKSEKLVYERL  156



>ref|XP_010428483.1| PREDICTED: uncharacterized protein LOC104713126 [Camelina sativa]
Length=159

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLD+R+FETGEYAL+G
Sbjct  73   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDLRVFETGEYALVG  132

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPTE+LIKS+KL YER+
Sbjct  133  WVGIPTAPAWLPTEMLIKSEKLVYERM  159



>ref|NP_001237675.1| uncharacterized protein LOC100500669 [Glycine max]
 gb|ACU15810.1| unknown [Glycine max]
Length=154

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYS+KKGQIVRVDKEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGEYALI 
Sbjct  68   VYSLKKGQIVRVDKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDMRIFETGEYALIA  127

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVGVPTAPAWLPT++LIKS+KLNYER+
Sbjct  128  WVGVPTAPAWLPTDMLIKSEKLNYERL  154



>emb|CDY45401.1| BnaA07g31810D [Brassica napus]
Length=156

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIR+FETGEYAL+G
Sbjct  70   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRVFETGEYALVG  129

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL YER+
Sbjct  130  WVGIPTAPAWLPTDMLIKSEKLVYERL  156



>ref|XP_007048390.1| NAD(P)H:plastoquinone dehydrogenase complex subunit O isoform 
1 [Theobroma cacao]
 gb|EOX92547.1| NAD(P)H:plastoquinone dehydrogenase complex subunit O isoform 
1 [Theobroma cacao]
Length=165

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLD+R FETGEYAL+ 
Sbjct  79   VYSMKKGQIVRVDKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDLRNFETGEYALVA  138

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL+YER+
Sbjct  139  WVGIPTAPAWLPTDMLIKSEKLDYERL  165



>ref|XP_006390375.1| hypothetical protein EUTSA_v10019178mg [Eutrema salsugineum]
 ref|XP_006390378.1| hypothetical protein EUTSA_v10019178mg [Eutrema salsugineum]
 gb|ESQ27661.1| hypothetical protein EUTSA_v10019178mg [Eutrema salsugineum]
 gb|ESQ27664.1| hypothetical protein EUTSA_v10019178mg [Eutrema salsugineum]
Length=160

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+KEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIR+FETGEYAL+G
Sbjct  74   VYSMKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRVFETGEYALVG  133

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL YER+
Sbjct  134  WVGIPTAPAWLPTDMLIKSEKLVYERL  160



>gb|ACY01921.1| hypothetical protein [Beta vulgaris]
Length=152

 Score =   171 bits (433),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+KEKYLNSINYLSVGHPPYYKGL+YIYEDRGE+LDIR FETGEYAL+ 
Sbjct  66   VYSMKKGQIVRVEKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEILDIRFFETGEYALVS  125

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PT+PAWLPT++LIKSDKL+YER+
Sbjct  126  WVGIPTSPAWLPTDMLIKSDKLDYERM  152



>ref|XP_010680197.1| PREDICTED: uncharacterized protein LOC104895398 [Beta vulgaris 
subsp. vulgaris]
Length=152

 Score =   171 bits (433),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+KEKYLNSINYLSVGHPPYYKGL+YIYEDRGE+LDIR FETGEYAL+ 
Sbjct  66   VYSMKKGQIVRVEKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEILDIRFFETGEYALVS  125

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PT+PAWLPT++LIKSDKL+YER+
Sbjct  126  WVGIPTSPAWLPTDMLIKSDKLDYERM  152



>ref|XP_002888997.1| hypothetical protein ARALYDRAFT_476624 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65256.1| hypothetical protein ARALYDRAFT_476624 [Arabidopsis lyrata subsp. 
lyrata]
Length=158

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLD+R+FETGEYAL+G
Sbjct  72   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDLRVFETGEYALVG  131

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL YER+
Sbjct  132  WVGIPTAPAWLPTDMLIKSEKLVYERM  158



>ref|XP_008371399.1| PREDICTED: uncharacterized protein LOC103434722 isoform X2 [Malus 
domestica]
Length=161

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+K+KYLNS+NYLSVGHPPYYKGL+YIYEDRGE+LD+RIFETGEYAL+ 
Sbjct  75   VYSMKKGQIVRVEKDKYLNSVNYLSVGHPPYYKGLDYIYEDRGEILDLRIFETGEYALVA  134

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVGVPTAPAWLPT++LI+SDKL+YER+
Sbjct  135  WVGVPTAPAWLPTDMLIRSDKLDYERL  161



>ref|XP_007137726.1| hypothetical protein PHAVU_009G150600g [Phaseolus vulgaris]
 gb|ESW09720.1| hypothetical protein PHAVU_009G150600g [Phaseolus vulgaris]
Length=153

 Score =   171 bits (433),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYS+KKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGEYALI 
Sbjct  67   VYSLKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDMRIFETGEYALIA  126

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVGVPTAPAWLPT +LIKS+KL+YER+
Sbjct  127  WVGVPTAPAWLPTYMLIKSEKLDYERL  153



>ref|XP_010471583.1| PREDICTED: uncharacterized protein LOC104751356 [Camelina sativa]
Length=159

 Score =   171 bits (433),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLD+R+FETGEYAL+G
Sbjct  73   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDLRVFETGEYALVG  132

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL YER+
Sbjct  133  WVGIPTAPAWLPTDMLIKSEKLVYERM  159



>ref|XP_003602617.1| NAD(P)H-quinone oxidoreductase subunit [Medicago truncatula]
 gb|AES72868.1| cyanobacterial and plant NDH-1 subunit O [Medicago truncatula]
Length=159

 Score =   171 bits (433),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGE+AL+ 
Sbjct  73   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDMRIFETGEHALVA  132

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVGVPTAPAWLPT +LIKS+KLNYER+
Sbjct  133  WVGVPTAPAWLPTYMLIKSEKLNYERL  159



>ref|XP_010416346.1| PREDICTED: uncharacterized protein LOC104702218 [Camelina sativa]
Length=158

 Score =   171 bits (433),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLD+R+FETGEYAL+G
Sbjct  72   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDLRVFETGEYALVG  131

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL YER+
Sbjct  132  WVGIPTAPAWLPTDMLIKSEKLVYERM  158



>gb|KFK41927.1| hypothetical protein AALP_AA2G189900 [Arabis alpina]
Length=156

 Score =   171 bits (432),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+KEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIR+FETGEYAL+G
Sbjct  70   VYSMKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRVFETGEYALVG  129

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL YER+
Sbjct  130  WVGIPTAPAWLPTDMLIKSEKLVYERL  156



>ref|XP_009392547.1| PREDICTED: uncharacterized protein LOC103978477 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=160

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEVL++RIFETGE+AL+ 
Sbjct  74   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLELRIFETGEHALVA  133

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL+YER+
Sbjct  134  WVGIPTAPAWLPTDMLIKSEKLDYERM  160



>gb|ACJ85995.1| unknown [Medicago truncatula]
 gb|AFK48676.1| unknown [Medicago truncatula]
Length=167

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGE+AL+ 
Sbjct  81   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDMRIFETGEHALVA  140

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVGVPTAPAWLPT +LIKS+KLNYER+
Sbjct  141  WVGVPTAPAWLPTYMLIKSEKLNYERL  167



>ref|XP_004502939.1| PREDICTED: uncharacterized protein LOC101514807 [Cicer arietinum]
Length=161

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGE+AL+ 
Sbjct  75   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDMRIFETGEHALVA  134

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVGVPTAPAWLPT +LIKS+KLNYER+
Sbjct  135  WVGVPTAPAWLPTYMLIKSEKLNYERL  161



>ref|XP_003565117.1| PREDICTED: uncharacterized protein LOC100820990 [Brachypodium 
distachyon]
Length=159

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+KEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIR+FETGEYALI 
Sbjct  73   VYSMKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRVFETGEYALIA  132

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PT PAWLPT +LIKSDKL+YER+
Sbjct  133  WVGIPTPPAWLPTYMLIKSDKLDYERM  159



>ref|XP_006302858.1| hypothetical protein CARUB_v10020988mg, partial [Capsella rubella]
 gb|EOA35756.1| hypothetical protein CARUB_v10020988mg, partial [Capsella rubella]
Length=191

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLD+R+FETGEYAL+G
Sbjct  105  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDLRVFETGEYALVG  164

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL YER+
Sbjct  165  WVGIPTAPAWLPTDMLIKSEKLVYERM  191



>ref|NP_001045462.1| Os01g0959900 [Oryza sativa Japonica Group]
 dbj|BAD87122.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF07376.1| Os01g0959900 [Oryza sativa Japonica Group]
 gb|EAY77312.1| hypothetical protein OsI_05288 [Oryza sativa Indica Group]
 dbj|BAG86675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=164

 Score =   169 bits (427),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP++KGL+YIYEDRGEVLDIRIFETGEYALI 
Sbjct  78   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFFKGLDYIYEDRGEVLDIRIFETGEYALIA  137

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PT PAWLPT +LIKSDKL+YERI
Sbjct  138  WVGIPTPPAWLPTYMLIKSDKLDYERI  164



>gb|KHG18335.1| NAD (P)H-quinone oxidoreductase subunit O [Gossypium arboreum]
Length=171

 Score =   169 bits (427),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDK+KYLNSINYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGE+AL+ 
Sbjct  85   VYSMKKGQIVRVDKDKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDVRIFETGEHALVA  144

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIKS+KL YER+
Sbjct  145  WVGIPTAPAWLPTDMLIKSEKLQYERL  171



>gb|EEE56043.1| hypothetical protein OsJ_04839 [Oryza sativa Japonica Group]
Length=184

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP++KGL+YIYEDRGEVLDIRIFETGEYALI 
Sbjct  98   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFFKGLDYIYEDRGEVLDIRIFETGEYALIA  157

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PT PAWLPT +LIKSDKL+YERI
Sbjct  158  WVGIPTPPAWLPTYMLIKSDKLDYERI  184



>ref|NP_565093.1| NAD(P)H:plastoquinone dehydrogenase complex subunit O [Arabidopsis 
thaliana]
 gb|AAD55288.1|AC008263_19 ESTs gb|AA042183 and gb|R86825 come from this gene [Arabidopsis 
thaliana]
 gb|AAG51918.1|AC013258_12 unknown protein; 72347-73255 [Arabidopsis thaliana]
 gb|AAK06871.1|AF344320_1 unknown protein [Arabidopsis thaliana]
 gb|AAK95275.1|AF410289_1 At1g74880/F9E10_27 [Arabidopsis thaliana]
 gb|AAN28747.1| At1g74880/F9E10_27 [Arabidopsis thaliana]
 gb|AEE35643.1| NAD(P)H:plastoquinone dehydrogenase complex subunit O [Arabidopsis 
thaliana]
Length=158

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+KEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLD+R+FETGEYAL+G
Sbjct  72   VYSMKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDLRVFETGEYALVG  131

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIK +KL YER+
Sbjct  132  WVGIPTAPAWLPTDMLIKCEKLVYERM  158



>gb|AFW83906.1| hypothetical protein ZEAMMB73_217588 [Zea mays]
Length=150

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIY+DRGEVLDIR FETGEYALI 
Sbjct  64   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYQDRGEVLDIRNFETGEYALIA  123

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PT PAWLPT +LIKSDKL+YERI
Sbjct  124  WVGIPTPPAWLPTYMLIKSDKLDYERI  150



>gb|KDP43684.1| hypothetical protein JCGZ_24142 [Jatropha curcas]
Length=157

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDK+KYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLD+R+FETGE+AL+ 
Sbjct  71   VYSMKKGQIVRVDKDKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDLRMFETGEHALVA  130

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT++LIK++KL+YER+
Sbjct  131  WVGIPTAPAWLPTDMLIKAEKLDYERL  157



>ref|XP_002456968.1| hypothetical protein SORBIDRAFT_03g046510 [Sorghum bicolor]
 gb|EES02088.1| hypothetical protein SORBIDRAFT_03g046510 [Sorghum bicolor]
Length=157

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIR FETGEYALI 
Sbjct  71   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRNFETGEYALIA  130

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PT PAWLPT +LIKSDKL+YERI
Sbjct  131  WVGIPTPPAWLPTYMLIKSDKLDYERI  157



>ref|XP_004971333.1| PREDICTED: uncharacterized protein LOC101767228 [Setaria italica]
Length=166

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDI+IFETGEYALI 
Sbjct  80   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIKIFETGEYALIA  139

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PT PAWLPT +LIKSDKL+YERI
Sbjct  140  WVGIPTPPAWLPTYMLIKSDKLDYERI  166



>ref|XP_010312492.1| PREDICTED: uncharacterized protein LOC101250560 isoform X1 [Solanum 
lycopersicum]
Length=167

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = -3

Query  541  SMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWV  362
            ++KKGQIVRV+KEKYLNSINYLSV HPPYYKGL+YIYEDRGEVLDIRIFETGEYALIGW+
Sbjct  83   AVKKGQIVRVEKEKYLNSINYLSVDHPPYYKGLDYIYEDRGEVLDIRIFETGEYALIGWI  142

Query  361  GVPTAPAWLPTEILIKSDKLNYERI  287
            G+PTAPAWLPTE+LIKSDKL+YERI
Sbjct  143  GIPTAPAWLPTEMLIKSDKLDYERI  167



>ref|XP_010912612.1| PREDICTED: uncharacterized protein LOC105038492 isoform X1 [Elaeis 
guineensis]
Length=162

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = -3

Query  544  YSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGW  365
            YSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLD+RIFETGE+AL+ W
Sbjct  77   YSMKKGQIVRVDKEKYLNSINYLSVGHPPHYKGLDYIYEDRGEVLDLRIFETGEHALVAW  136

Query  364  VGVPTAPAWLPTEILIKSDKLNYERI  287
            VG+PT PAWLPT +LIKS+KLNYERI
Sbjct  137  VGIPTPPAWLPTNMLIKSEKLNYERI  162



>gb|AFK37298.1| unknown [Lotus japonicus]
Length=159

 Score =   166 bits (420),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYL SINYLSVGHPPYYKGL+YIYEDRGEVLD+R+F+TGE+ALI 
Sbjct  73   VYSMKKGQIVRVDKEKYLTSINYLSVGHPPYYKGLDYIYEDRGEVLDMRVFDTGEHALIA  132

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVG+PTAPAWLPT +LIKS+KL+YERI
Sbjct  133  WVGIPTAPAWLPTYMLIKSEKLDYERI  159



>ref|XP_006646707.1| PREDICTED: uncharacterized protein LOC102716472 [Oryza brachyantha]
Length=89

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  538  MKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWVG  359
            MKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIRIFETGEYALI WVG
Sbjct  6    MKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRIFETGEYALIAWVG  65

Query  358  VPTAPAWLPTEILIKSDKLNYERI  287
            +PT PAWLPT +LIKSDKL+YERI
Sbjct  66   IPTPPAWLPTYMLIKSDKLDYERI  89



>emb|CDM86745.1| unnamed protein product [Triticum aestivum]
Length=155

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIF-ETGEYALI  371
            VYSMKKGQIVRV+KEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIRIF ETGEYALI
Sbjct  68   VYSMKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRIFEETGEYALI  127

Query  370  GWVGVPTAPAWLPTEILIKSDKLNYERI  287
             WVG+PT PAWLPT +LIKSDKL+YERI
Sbjct  128  AWVGIPTPPAWLPTYMLIKSDKLDYERI  155



>gb|EYU18036.1| hypothetical protein MIMGU_mgv1a016493mg [Erythranthe guttata]
Length=119

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  538  MKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWVG  359
            +KKGQIVRV+KEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLD+R+FETGEYALI WVG
Sbjct  36   VKKGQIVRVEKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDLRVFETGEYALIAWVG  95

Query  358  VPTAPAWLPTEILIKSDKLNYERI  287
            +PTAPAWLPT++LIKSDKL+YERI
Sbjct  96   IPTAPAWLPTDMLIKSDKLDYERI  119



>dbj|BAK01265.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIF-ETGEYALI  371
            VYSMKKGQIVRV+KEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLD+RIF ETGEYALI
Sbjct  68   VYSMKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDVRIFEETGEYALI  127

Query  370  GWVGVPTAPAWLPTEILIKSDKLNYERI  287
             WVG+PT PAWLPT +LIKSDKL+YERI
Sbjct  128  AWVGIPTPPAWLPTYMLIKSDKLDYERI  155



>ref|XP_006646708.1| PREDICTED: uncharacterized protein LOC102716754, partial [Oryza 
brachyantha]
Length=85

 Score =   162 bits (409),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  541  SMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWV  362
            S+KKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIRIFETGEYALI WV
Sbjct  1    SVKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRIFETGEYALIAWV  60

Query  361  GVPTAPAWLPTEILIKSDKLNYERI  287
            G+PT PAWLPT +LIKSDKL+YERI
Sbjct  61   GIPTPPAWLPTYMLIKSDKLDYERI  85



>gb|EYU24312.1| hypothetical protein MIMGU_mgv1a0153392mg, partial [Erythranthe 
guttata]
Length=83

 Score =   161 bits (407),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = -3

Query  535  KKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWVGV  356
            KKGQIVRV+KEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLD+R+FETGEYALI WVG+
Sbjct  1    KKGQIVRVEKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDLRVFETGEYALIAWVGI  60

Query  355  PTAPAWLPTEILIKSDKLNYERI  287
            PTAPAWLPT++LIKSDKL+YERI
Sbjct  61   PTAPAWLPTDMLIKSDKLDYERI  83



>ref|XP_008343329.1| PREDICTED: uncharacterized protein LOC103406089, partial [Malus 
domestica]
Length=83

 Score =   158 bits (400),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = -3

Query  535  KKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWVGV  356
            KKGQIVRV+K+KYLNS+NYLSVGHPPYYKGL+YIYEDRGE+LD+RIFETGEYAL+ WVGV
Sbjct  1    KKGQIVRVEKDKYLNSVNYLSVGHPPYYKGLDYIYEDRGEILDLRIFETGEYALVAWVGV  60

Query  355  PTAPAWLPTEILIKSDKLNYERI  287
            PTAPAWLPT++LI+SDKL+YER+
Sbjct  61   PTAPAWLPTDMLIRSDKLDYERL  83



>ref|XP_008657857.1| PREDICTED: uncharacterized protein LOC103637441 [Zea mays]
Length=159

 Score =   160 bits (406),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 83/96 (86%), Gaps = 9/96 (9%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYAL--  374
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIY+DRGEVLDIR FETGEYAL  
Sbjct  64   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYQDRGEVLDIRNFETGEYALTN  123

Query  373  -------IGWVGVPTAPAWLPTEILIKSDKLNYERI  287
                   I WVG+PT PAWLPT +LIKSDKL+YERI
Sbjct  124  ARVHAFQIAWVGIPTPPAWLPTYMLIKSDKLDYERI  159



>emb|CAN67062.1| hypothetical protein VITISV_017539 [Vitis vinifera]
Length=199

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGEYALI 
Sbjct  72   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEYALIA  131

Query  367  WVGVPTAPAWLPTEILIK  314
            WVG+PTAPAWLPT++LIK
Sbjct  132  WVGIPTAPAWLPTDMLIK  149



>ref|XP_006390379.1| hypothetical protein EUTSA_v10019178mg [Eutrema salsugineum]
 gb|ESQ27665.1| hypothetical protein EUTSA_v10019178mg [Eutrema salsugineum]
Length=193

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+KEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIR+FETGEYAL+G
Sbjct  74   VYSMKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRVFETGEYALVG  133

Query  367  WVGVPTAPAWLPTEILIK  314
            WVG+PTAPAWLPT++LIK
Sbjct  134  WVGIPTAPAWLPTDMLIK  151



>gb|KHN09611.1| NAD(P)H-quinone oxidoreductase subunit O [Glycine soja]
Length=233

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYS+KKGQIVRVDKEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGEYALI 
Sbjct  68   VYSLKKGQIVRVDKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDMRIFETGEYALIA  127

Query  367  WVGVPTAPAWLPTEILIKSDK  305
            WVGVPTAPAWLPT++LIKS++
Sbjct  128  WVGVPTAPAWLPTDMLIKSEE  148



>gb|EMT23695.1| hypothetical protein F775_08346 [Aegilops tauschii]
Length=122

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 1/85 (1%)
 Frame = -3

Query  538  MKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIF-ETGEYALIGWV  362
            +KKGQIVRV+KEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIRIF ETGEYALI WV
Sbjct  38   VKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRIFEETGEYALIAWV  97

Query  361  GVPTAPAWLPTEILIKSDKLNYERI  287
            G+PT PAWLPT +LIKSDKL+YERI
Sbjct  98   GIPTPPAWLPTYMLIKSDKLDYERI  122



>ref|XP_008371331.1| PREDICTED: uncharacterized protein LOC103434722 isoform X1 [Malus 
domestica]
Length=167

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+K+KYLNS+NYLSVGHPPYYKGL+YIYEDRGE+LD+RIFETGEYAL+ 
Sbjct  75   VYSMKKGQIVRVEKDKYLNSVNYLSVGHPPYYKGLDYIYEDRGEILDLRIFETGEYALVA  134

Query  367  WVGVPTAPAWLPTEILIK  314
            WVGVPTAPAWLPT++LI+
Sbjct  135  WVGVPTAPAWLPTDMLIR  152



>ref|XP_002517265.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45165.1| conserved hypothetical protein [Ricinus communis]
Length=164

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIV+VDK+KYLNS+NYLSVGHPPYYKGL+YIYEDRGEVLD+++FETGE+ALI 
Sbjct  78   VYSMKKGQIVKVDKDKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVLDLKMFETGEHALIA  137

Query  367  WVGVPTAPAWLPTEILIK  314
            WVGVPTAPAWLPT++LIK
Sbjct  138  WVGVPTAPAWLPTDMLIK  155



>ref|XP_006390376.1| hypothetical protein EUTSA_v10019178mg [Eutrema salsugineum]
 gb|ESQ27662.1| hypothetical protein EUTSA_v10019178mg [Eutrema salsugineum]
Length=151

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = -3

Query  520  VRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWVGVPTAPA  341
            V   KEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIR+FETGEYAL+GWVG+PTAPA
Sbjct  74   VYSKKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRVFETGEYALVGWVGIPTAPA  133

Query  340  WLPTEILIKSDKLNYERI  287
            WLPT++LIKS+KL YER+
Sbjct  134  WLPTDMLIKSEKLVYERL  151



>emb|CCI55383.1| NDH subunit NdhO [Marchantia polymorpha]
Length=167

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            V++MKKGQIVRVDKEKYL+S+ Y +V HP ++KGL+YIYEDRGEVLDIR+FE GEYALI 
Sbjct  81   VFTMKKGQIVRVDKEKYLDSVEYYAVAHPKFFKGLDYIYEDRGEVLDIRMFEAGEYALIS  140

Query  367  WVGVPTAPAWLPTEILIKSDKLNYER  290
            W G+ T+PAWLPT +LIKSDKL Y R
Sbjct  141  WAGISTSPAWLPTSMLIKSDKLTYRR  166



>ref|XP_002984034.1| hypothetical protein SELMODRAFT_49258, partial [Selaginella moellendorffii]
 gb|EFJ15046.1| hypothetical protein SELMODRAFT_49258, partial [Selaginella moellendorffii]
Length=75

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  538  MKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWVG  359
            +KKGQIVRVDKEKYLNSINYLSVGHP YYKGL+YIYEDRGE+LDIR FETGEYALI W G
Sbjct  1    VKKGQIVRVDKEKYLNSINYLSVGHPTYYKGLDYIYEDRGEILDIRQFETGEYALIAWAG  60

Query  358  VPTAPAWLPTEILIK  314
            +PT+PAWLPT++LIK
Sbjct  61   IPTSPAWLPTDMLIK  75



>ref|XP_001777972.1| predicted protein [Physcomitrella patens]
 gb|EDQ57185.1| predicted protein [Physcomitrella patens]
Length=176

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  541  SMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWV  362
            ++KKGQIVRVDKEKYLNS+ YLSVGHPPY+ GL+YIYEDRGE+L+ R F+ GEYALI W 
Sbjct  92   TLKKGQIVRVDKEKYLNSVEYLSVGHPPYFTGLDYIYEDRGEILNTRFFDHGEYALISWA  151

Query  361  GVPTAPAWLPTEILIKSDKLNYER  290
            G+PT PAWLPT +LI +D+L+Y+R
Sbjct  152  GIPTNPAWLPTYMLIPADRLSYKR  175



>ref|XP_009374205.1| PREDICTED: uncharacterized protein LOC103963151 isoform X2 [Pyrus 
x bretschneideri]
Length=149

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 91/129 (71%), Gaps = 14/129 (11%)
 Frame = -3

Query  673  VKAEESSQPPQTPQNVaaaetkpeaaASSDAppppppkpkkPVYSMKKGQIVRVDKEKYL  494
            +KA ++++P     N   A +   A  S+      PP  KKPVYSMKKGQIVRV+K+KYL
Sbjct  35   IKAVKATEPEANNNNTEKASSSSNAQPSTATAASKPPPKKKPVYSMKKGQIVRVEKDKYL  94

Query  493  NSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWVGVPTAPAWLPTEILIK  314
            NS+NYLSVGHPPYYKGL+YIYEDRGEV               WVGVPTAPAWLPT++LI+
Sbjct  95   NSVNYLSVGHPPYYKGLDYIYEDRGEV--------------AWVGVPTAPAWLPTDMLIR  140

Query  313  SDKLNYERI  287
            SDKL+YER+
Sbjct  141  SDKLDYERL  149



>ref|XP_002960102.1| hypothetical protein SELMODRAFT_437242 [Selaginella moellendorffii]
 gb|EFJ37641.1| hypothetical protein SELMODRAFT_437242 [Selaginella moellendorffii]
Length=929

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = -3

Query  538  MKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWVG  359
            MKKGQIVRVDKEKYLNSINYLSVGHP YYKGL+YIYEDRGE+LDIR FETGEYALI W G
Sbjct  846  MKKGQIVRVDKEKYLNSINYLSVGHPTYYKGLDYIYEDRGEILDIRQFETGEYALIAWAG  905

Query  358  VPTAPAWLPTEILIKSDKL  302
            +PT+PAWLPT++LIK  +L
Sbjct  906  IPTSPAWLPTDMLIKFSQL  924



>ref|XP_008371548.1| PREDICTED: uncharacterized protein LOC103434722 isoform X4 [Malus 
domestica]
Length=147

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 14/87 (16%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+K+KYLNS+NYLSVGHPPYYKGL+YIYEDRGEV               
Sbjct  75   VYSMKKGQIVRVEKDKYLNSVNYLSVGHPPYYKGLDYIYEDRGEV--------------A  120

Query  367  WVGVPTAPAWLPTEILIKSDKLNYERI  287
            WVGVPTAPAWLPT++LI+SDKL+YER+
Sbjct  121  WVGVPTAPAWLPTDMLIRSDKLDYERL  147



>ref|XP_010912613.1| PREDICTED: uncharacterized protein LOC105038492 isoform X2 [Elaeis 
guineensis]
Length=148

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 69/86 (80%), Gaps = 14/86 (16%)
 Frame = -3

Query  544  YSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGW  365
            YSMKKGQIVRVDKEKYLNSINYLSVGHPP+YKGL+YIYEDRGEV               W
Sbjct  77   YSMKKGQIVRVDKEKYLNSINYLSVGHPPHYKGLDYIYEDRGEV--------------AW  122

Query  364  VGVPTAPAWLPTEILIKSDKLNYERI  287
            VG+PT PAWLPT +LIKS+KLNYERI
Sbjct  123  VGIPTPPAWLPTNMLIKSEKLNYERI  148



>gb|EMS54216.1| hypothetical protein TRIUR3_24045 [Triticum urartu]
Length=144

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 77/97 (79%), Gaps = 12/97 (12%)
 Frame = -3

Query  541  SMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVL---DIRIFE--TGEYA  377
            +MKKGQIVRV+KEKYLNSINYLSVGHPP+YKGL+YIYEDRGE +   D R++   T  ++
Sbjct  48   TMKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEAINFADPRLYNISTAGFS  107

Query  376  L-------IGWVGVPTAPAWLPTEILIKSDKLNYERI  287
            L       I WVG+PT PAWLPT +LIKSDKL+YERI
Sbjct  108  LLIAKLSSIAWVGIPTPPAWLPTYMLIKSDKLDYERI  144



>ref|XP_006390377.1| hypothetical protein EUTSA_v10019178mg [Eutrema salsugineum]
 gb|ESQ27663.1| hypothetical protein EUTSA_v10019178mg [Eutrema salsugineum]
Length=159

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 7/86 (8%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYAL-I  371
            VYSMKKGQIVRV+KEKYLNSINYLSVGHPP+YKGL+YIYEDRGEVLDIR+FETGEYAL +
Sbjct  74   VYSMKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDIRVFETGEYALNL  133

Query  370  GWVGVPTAPAWLPTEILIKSDKLNYE  293
            GW+G      W P    + +++  ++
Sbjct  134  GWMG------WYPYRTSLATNRYAHQ  153



>ref|XP_010649372.1| PREDICTED: uncharacterized protein LOC100248924 isoform X2 [Vitis 
vinifera]
Length=147

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGEYAL+ 
Sbjct  72   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEYALVS  131



>ref|XP_006464987.1| PREDICTED: uncharacterized protein LOC102608658 isoform X1 [Citrus 
sinensis]
Length=170

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEVLD+RIFETGE+AL+ 
Sbjct  77   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEHALVS  136



>ref|XP_003521975.1| PREDICTED: uncharacterized protein LOC100802383 [Glycine max]
Length=73

 Score =   120 bits (300),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 1/66 (2%)
 Frame = -3

Query  481  YLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYAL-IGWVGVPTAPAWLPTEILIKSDK  305
            + S+GHPPYY GL+YIYED GEVLD+RIFETGEYAL IGWVGVPTAPAWLPT++LIKS+K
Sbjct  8    HFSIGHPPYYNGLDYIYEDHGEVLDMRIFETGEYALIIGWVGVPTAPAWLPTDMLIKSEK  67

Query  304  LNYERI  287
            LNYER+
Sbjct  68   LNYERL  73



>ref|XP_008371473.1| PREDICTED: uncharacterized protein LOC103434722 isoform X3 [Malus 
domestica]
Length=153

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 63/78 (81%), Gaps = 14/78 (18%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIG  368
            VYSMKKGQIVRV+K+KYLNS+NYLSVGHPPYYKGL+YIYEDRGEV               
Sbjct  75   VYSMKKGQIVRVEKDKYLNSVNYLSVGHPPYYKGLDYIYEDRGEV--------------A  120

Query  367  WVGVPTAPAWLPTEILIK  314
            WVGVPTAPAWLPT++LI+
Sbjct  121  WVGVPTAPAWLPTDMLIR  138



>ref|XP_009392546.1| PREDICTED: uncharacterized protein LOC103978477 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=202

 Score = 94.0 bits (232),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRG  419
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRG
Sbjct  74   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRG  116


 Score = 41.6 bits (96),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -2

Query  419  RGAGHSDIRDRGICTYWMGWSTNCTGLASNRDSH*VGQAQLREDL  285
            RG G  + RD G C+  +G  + CT +A+NR ++ VG+ +LRED+
Sbjct  115  RGLGTPNFRDWGTCSCCLGRDSYCTCMATNRHAYQVGETRLREDV  159



>ref|XP_007048391.1| NAD(P)H:plastoquinone dehydrogenase complex subunit O isoform 
2 [Theobroma cacao]
 gb|EOX92548.1| NAD(P)H:plastoquinone dehydrogenase complex subunit O isoform 
2 [Theobroma cacao]
Length=125

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVL  410
            VYSMKKGQIVRVDKEKYLNS+NYLSVGHPPYYKGL+YIYEDRGEVL
Sbjct  79   VYSMKKGQIVRVDKEKYLNSVNYLSVGHPPYYKGLDYIYEDRGEVL  124



>ref|XP_003602618.1| NAD(P)H-quinone oxidoreductase subunit [Medicago truncatula]
Length=145

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEV  413
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEV
Sbjct  73   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEV  117



>gb|AES72869.2| cyanobacterial and plant NDH-1 subunit O [Medicago truncatula]
Length=153

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -3

Query  547  VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEV  413
            VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGL+YIYEDRGEV
Sbjct  81   VYSMKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEV  125



>ref|XP_008795230.1| PREDICTED: uncharacterized protein LOC103711038 [Phoenix dactylifera]
Length=199

 Score = 46.2 bits (108),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  544  YSMKKGQIVRVDKEKYLNSINYLSV  470
            YSMKKGQIVRVDKEKYLNSI  L++
Sbjct  77   YSMKKGQIVRVDKEKYLNSIYLLAI  101


 Score = 44.3 bits (103),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -1

Query  480  ICLLGIHLTTKAWNTYMKIVARCWTFGYSRQGNMHLLDGLEYQLHRLG  337
            I LL IHLT K W TYMK V R WT+G  + G+M LL GL YQ H+ G
Sbjct  96   IYLLAIHLTIKGWTTYMKTVVRSWTYGSLKLGSMLLLLGLGYQPHQHG  143



>ref|WP_023174818.1| hypothetical protein [Gloeobacter kilaueensis]
 ref|YP_008713239.1| hypothetical protein GKIL_3286 [Gloeobacter kilaueensis JS1]
 gb|AGY59532.1| hypothetical protein GKIL_3286 [Gloeobacter kilaueensis JS1]
Length=78

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 12/77 (16%)
 Frame = -3

Query  538  MKKGQIVRVDKEKYLNSINYLSVGH--PPYYKGLEYIYEDRGEVLDIRIFETGEYALIGW  365
            +KKG +VR  +EK  NSI  L+     PPY      ++E  GEVLD+R    G+YA I +
Sbjct  3    IKKGVLVRAVREKLDNSIEALASDPLWPPY------LFETDGEVLDLR----GDYAFIKF  52

Query  364  VGVPTAPAWLPTEILIK  314
              VPT P WL  + L++
Sbjct  53   GAVPTPPIWLRLDQLVE  69



>ref|WP_011143533.1| NAD(P)H-quinone oxidoreductase subunit O [Gloeobacter violaceus]
 ref|NP_926490.1| hypothetical protein gsl3544 [Gloeobacter violaceus PCC 7421]
 sp|Q7NFI1.1|NDHO_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit O; AltName: 
Full=NAD(P)H dehydrogenase I subunit O; AltName: Full=NDH-1 
subunit O; AltName: Full=NDH-O [Gloeobacter violaceus PCC 
7421]
 dbj|BAC91485.1| gsl3544 [Gloeobacter violaceus PCC 7421]
Length=78

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 8/76 (11%)
 Frame = -3

Query  538  MKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLEYIYEDRGEVLDIRIFETGEYALIGWVG  359
            +KKG +VR  ++K  NS+  L+       +   Y++E  GEVLD+R    G+YALI +  
Sbjct  3    IKKGSLVRAVRDKLDNSLEALAND----TRWPSYLFETDGEVLDMR----GDYALIKFGA  54

Query  358  VPTAPAWLPTEILIKS  311
            VPT P WL  + L +S
Sbjct  55   VPTPPVWLRQDQLAES  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1838885864684