BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17054_g1_i1 len=3131 path=[3109:0-2003 5113:2004-2046
5156:2047-3130]

Length=3131
                                                                      Score     E

emb|CDO98935.1|  unnamed protein product                               1287   0.0     
ref|XP_009793959.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1284   0.0     
sp|O78328.1|DXS_CAPAN  RecName: Full=Probable 1-deoxy-D-xylulose-...   1283   0.0     Capsicum annuum
gb|AIX87515.1|  1-deoxy-D-xylulose 5-phosphate-synthase 1              1281   0.0     
gb|AIX87491.1|  1-deoxy-D-xylulose 5-phosphate-synthase 1              1281   0.0     
gb|ACF60511.1|  1-D-deoxyxylulose 5-phosphate synthase                 1280   0.0     Nicotiana tabacum [American tobacco]
ref|XP_009615219.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1279   0.0     
emb|CBA12009.1|  1-deoxy-D-xylulose-5-phosphate synthase               1276   0.0     Nicotiana tabacum [American tobacco]
ref|XP_002277919.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1275   0.0     Vitis vinifera
gb|AGL40532.1|  deoxyxylulose 5-phosphate synthase 1                   1274   0.0     
gb|AFI98878.1|  chloroplast 1-deoxy-D-xylulose-5-phosphate synthase    1273   0.0     
ref|XP_006489186.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1272   0.0     
ref|XP_006419702.1|  hypothetical protein CICLE_v10004432mg            1271   0.0     
emb|CAZ66648.1|  1-deoxy-D-xylulose 5-phosphate synthase 1 precursor   1271   0.0     Solanum lycopersicum
ref|XP_011090872.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1268   0.0     
gb|KDO74968.1|  hypothetical protein CISIN_1g004923mg                  1267   0.0     
ref|NP_001234672.1|  1-D-deoxyxylulose 5-phosphate synthase            1266   0.0     
ref|XP_002516843.1|  1-deoxyxylulose-5-phosphate synthase, putative    1265   0.0     Ricinus communis
ref|XP_010024490.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1265   0.0     
gb|ACF21004.1|  1-deoxy-D-xylulose 5-phosphate synthase                1264   0.0     Salvia miltiorrhiza [Chinese salvia]
ref|NP_001275130.1|  1-D-deoxyxylulose 5-phosphate synthase            1263   0.0     
gb|AEM42997.1|  1-deoxyxylulose-5-phosphate synthase                   1261   0.0     
ref|XP_008458506.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1261   0.0     
gb|AGQ04153.1|  deoxyxylulose synthase                                 1259   0.0     
ref|XP_004144970.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1257   0.0     
ref|XP_007035432.1|  Deoxyxylulose-5-phosphate synthase isoform 1      1255   0.0     
gb|AHL17583.1|  1-deoxy-D-xylulose 5-phosphate synthase                1253   0.0     
gb|AAS94123.1|  putative 1-deoxy-D-xylulose 5-phosphate synthase       1253   0.0     Hevea brasiliensis [jebe]
dbj|BAF98288.1|  1-deoxy-D-xylulose 5-phosphate synthase               1252   0.0     Hevea brasiliensis [jebe]
ref|XP_007035433.1|  Deoxyxylulose-5-phosphate synthase isoform 2      1250   0.0     
gb|ACD70396.1|  putative chloroplast 1-deoxy-D-xylulose 5-phospha...   1246   0.0     Populus trichocarpa [western balsam poplar]
gb|AIW04571.1|  1-deoxy-D-xylulose 5-phosphate synthase                1242   0.0     
gb|ABN13970.1|  1-deoxy-D-xylulose 5-phosphate synthase                1238   0.0     Gossypium barbadense [Egyptian cotton]
ref|XP_010279602.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1238   0.0     
ref|XP_010908815.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1237   0.0     
ref|XP_010666332.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1235   0.0     
ref|XP_006378082.1|  hypothetical protein POPTR_0010s01910g            1235   0.0     
ref|XP_008390764.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1234   0.0     
gb|KHG17090.1|  putative 1-deoxy-D-xylulose-5-phosphate synthase,...   1234   0.0     
ref|XP_009393107.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1233   0.0     
ref|XP_011014224.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1232   0.0     
gb|AAQ84169.1|  1-deoxy-D-xylulose 5-phosphate synthase                1232   0.0     Pueraria montana var. lobata [kudzu]
ref|XP_011034246.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1228   0.0     
gb|AFU93068.1|  chloroplast 1-deoxy-D-xylulose-5-phosphate synthase    1228   0.0     
ref|NP_001290502.1|  probable 1-deoxy-D-xylulose-5-phosphate synt...   1228   0.0     
ref|XP_003609567.1|  1-deoxy-D-xylulose 5-phosphate synthase           1225   0.0     
ref|XP_004508322.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1225   0.0     
ref|XP_010548901.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...   1224   0.0     
emb|CAD22530.1|  1-deoxy-D-xylulose 5-phosphate synthase 1             1224   0.0     Medicago truncatula
ref|XP_003550129.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1224   0.0     
ref|XP_008223088.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1222   0.0     
gb|EYU43871.1|  hypothetical protein MIMGU_mgv1a002143mg               1221   0.0     
ref|XP_004296782.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1221   0.0     
ref|XP_010938853.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1221   0.0     
gb|KHN03015.1|  Putative 1-deoxy-D-xylulose-5-phosphate synthase,...   1221   0.0     
ref|XP_010938852.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1219   0.0     
ref|XP_009369084.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1217   0.0     
ref|NP_001236070.1|  1-deoxy-D-xylulose 5-phosphate synthase 1         1217   0.0     
ref|XP_008340868.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1214   0.0     
ref|XP_007225144.1|  hypothetical protein PRUPE_ppa002446mg            1214   0.0     
ref|XP_003541651.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1214   0.0     
gb|KHN37526.1|  Putative 1-deoxy-D-xylulose-5-phosphate synthase,...   1213   0.0     
dbj|BAF75640.1|  1-deoxy-D-xylulose-5-phosphate synthase               1212   0.0     Croton stellatopilosus
gb|AFU75321.1|  1-deoxy-D-xylulose-5-phosphate synthase 1              1212   0.0     
ref|XP_007154212.1|  hypothetical protein PHAVU_003G099600g            1212   0.0     
ref|XP_008795130.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1211   0.0     
ref|XP_002870230.1|  hypothetical protein ARALYDRAFT_493326            1211   0.0     
gb|ACG27905.1|  1-deoxy-D-xylulose-5-phosphate synthase                1211   0.0     Zea mays [maize]
ref|XP_010244640.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1210   0.0     
gb|AAD56390.2|AF182286_1  1-deoxy-D-xylulose-5-phosphate synthase      1210   0.0     Artemisia annua [sweet Annie]
ref|XP_006283213.1|  hypothetical protein CARUB_v10004244mg            1210   0.0     
ref|XP_009419852.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1209   0.0     
ref|XP_010105036.1|  putative 1-deoxy-D-xylulose-5-phosphate synt...   1209   0.0     
ref|XP_004962111.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...   1209   0.0     
gb|AFW77975.1|  1-deoxy-D-xylulose 5-phosphate synthase 1              1209   0.0     
gb|ABP88134.1|  1-deoxy-D-xylulose 5-phosphate synthase                1209   0.0     Zea mays [maize]
gb|ACR02668.1|  chloroplast 1-deoxy-D-xylulose-5-phosphate synthase    1208   0.0     Wurfbainia villosa [sha ren]
ref|NP_193291.1|  1-deoxy-D-xylulose-5-phosphate synthase              1208   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434528.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...   1207   0.0     
ref|NP_001157805.1|  deoxy xylulose synthase 1                         1207   0.0     Zea mays [maize]
ref|XP_010434951.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...   1206   0.0     
ref|XP_009352186.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1206   0.0     
ref|XP_010440286.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...   1206   0.0     
ref|XP_009146913.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...   1206   0.0     
gb|AAC49368.1|  DEF                                                    1203   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CAA74713.1|  transketolase                                         1202   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288863.1|  1-deoxy-D-xylulose-5-phosphate synthase, chl...   1202   0.0     
ref|XP_002441088.1|  hypothetical protein SORBIDRAFT_09g020140         1201   0.0     Sorghum bicolor [broomcorn]
ref|XP_006414485.1|  hypothetical protein EUTSA_v10024542mg            1200   0.0     
gb|AEK69518.1|  chloroplast 1-deoxy-D-xylulose-5-phosphate syntha...   1199   0.0     
ref|XP_010524522.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...   1198   0.0     
ref|XP_008777286.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1197   0.0     
gb|EEC79215.1|  hypothetical protein OsI_19939                         1196   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_003568467.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...   1195   0.0     
ref|NP_001055524.1|  Os05g0408900                                      1195   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KFK39457.1|  hypothetical protein AALP_AA3G247300                   1194   0.0     
ref|XP_006654395.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...   1193   0.0     
emb|CDY64791.1|  BnaA01g35430D                                         1191   0.0     
gb|AAP14353.1|  1-deoxy-D-xylulose-5-phosphate synthase                1191   0.0     Andrographis paniculata
ref|XP_006855370.1|  hypothetical protein AMTR_s00057p00123940         1189   0.0     
dbj|BAJ94232.1|  predicted protein                                     1187   0.0     
emb|CDY09752.1|  BnaC07g33090D                                         1184   0.0     
ref|XP_010551048.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...   1184   0.0     
gb|EMT18567.1|  Putative 1-deoxy-D-xylulose-5-phosphate synthase,...   1184   0.0     
gb|KDO74969.1|  hypothetical protein CISIN_1g004923mg                  1173   0.0     
ref|XP_002312717.1|  1-deoxy-D-xylulose 5-phosphate synthase fami...   1170   0.0     Populus trichocarpa [western balsam poplar]
gb|AHJ57306.1|  chloroplast 1-deoxy-D-xylulose-5-phosphate synthase    1167   0.0     
gb|ABS50518.1|  1-deoxy-D-xylulose 5-phosphate synthase type I         1163   0.0     Picea abies
ref|XP_010938854.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1162   0.0     
ref|XP_007147849.1|  hypothetical protein PHAVU_006G159900g            1159   0.0     
gb|AAS89341.1|  1-deoxy-D-xylulose-5-phosphate synthase                1152   0.0     Ginkgo biloba [ginkgo]
gb|ACC54557.1|  putative 1-D-deoxyxylulose 5-phosphate synthase t...   1152   0.0     Pinus densiflora [Japanese red pine]
gb|AEZ55865.1|  chloroplast 1-deoxy-D-xylulose 5-phosphate syntha...   1147   0.0     
emb|CDY48893.1|  BnaA03g36320D                                         1144   0.0     
ref|XP_009135754.1|  PREDICTED: LOW QUALITY PROTEIN: 1-deoxy-D-xy...   1142   0.0     
ref|XP_010244642.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1139   0.0     
gb|KFK39452.1|  hypothetical protein AALP_AA3G246700                   1138   0.0     
gb|AEZ55688.1|  putative 1-deoxy-D-xylulose 5-phosphate synthase of    1138   0.0     
gb|KEH32266.1|  1-deoxy-D-xylulose-5-phosphate synthase                1136   0.0     
emb|CDY32433.1|  BnaC03g42170D                                         1133   0.0     
ref|XP_001756357.1|  1-deoxyxylulose 5-phosphate synthase              1131   0.0     
gb|ACJ67021.1|  1-deoxy-D-xylulose 5-phosphate synthase type I         1127   0.0     Pinus taeda
ref|XP_010510254.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...   1124   0.0     
ref|XP_006299897.1|  hypothetical protein CARUB_v10016105mg            1122   0.0     
ref|XP_003609568.1|  1-deoxy-D-xylulose 5-phosphate synthase           1122   0.0     
ref|XP_001754004.1|  predicted protein                                 1120   0.0     
ref|XP_010466391.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...   1118   0.0     
ref|XP_002989268.1|  hypothetical protein SELMODRAFT_427859            1114   0.0     
ref|XP_001760423.1|  predicted protein                                 1114   0.0     
emb|CDY52177.1|  BnaC01g22400D                                         1113   0.0     
emb|CDX90583.1|  BnaA03g41980D                                         1113   0.0     
ref|XP_002984677.1|  hypothetical protein SELMODRAFT_268893            1108   0.0     
ref|XP_001771607.1|  predicted protein                                 1107   0.0     
ref|XP_003594033.1|  1-deoxy-D-xylulose 5-phosphate synthase           1106   0.0     
ref|XP_002978764.1|  hypothetical protein SELMODRAFT_268187            1104   0.0     
gb|EPS59801.1|  hypothetical protein M569_15004                        1104   0.0     
pir||D71420  hypothetical protein - Arabidopsis thaliana               1103   0.0  
ref|XP_004486296.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1086   0.0     
gb|KFK39451.1|  hypothetical protein AALP_AA3G246700                   1078   0.0     
gb|AAB88295.1|  CLA1 transketolase-like protein                        1075   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_002965644.1|  1-deoxy-D-xylulose-5-phosphate synthase           1066   0.0     
gb|AAL32062.1|AF443590_1  deoxy-D-xylulose-5-phosphate synthase        1057   0.0     Morinda citrifolia [awl tree]
gb|KDO74970.1|  hypothetical protein CISIN_1g004923mg                  1047   0.0     
gb|ACJ67020.1|  1-deoxy-D-xylulose 5-phosphate synthase type II        1045   0.0     Pinus taeda
ref|XP_006378083.1|  hypothetical protein POPTR_0010s01910g            1043   0.0     
ref|XP_010933574.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1035   0.0     
emb|CDP02935.1|  unnamed protein product                               1035   0.0     
gb|ABS50520.1|  1-deoxy-D-xylulose 5-phosphate synthase type II        1033   0.0     Picea abies
gb|AAS89342.1|  1-deoxy-D-xylulose-5-phosphate synthase                1030   0.0     Taxus x media [hybrid yew]
ref|XP_002533688.1|  1-deoxyxylulose-5-phosphate synthase, putative    1026   0.0     Ricinus communis
gb|AID55339.1|  1-deoxy-D-xylulose-5-phosphate synthase                1026   0.0     
gb|AIY22671.1|  1-seoxy-D-xylulose 5-phosphate synthase 1              1023   0.0     
ref|XP_008236345.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1023   0.0     
gb|ABK35283.1|  deoxyxylulose-5-phosphate synthase                     1023   0.0     Adonis aestivalis var. palaestina
gb|ACN39837.1|  unknown                                                1023   0.0     Picea sitchensis
gb|ABF18929.1|  putative 1-deoxy-D-xylulose 5-phosphate synthase       1023   0.0     Hevea brasiliensis [jebe]
ref|XP_008236351.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1023   0.0     
ref|XP_002532384.1|  1-deoxyxylulose-5-phosphate synthase, putative    1023   0.0     Ricinus communis
gb|ACC54554.1|  putative 1-D-deoxyxylulose 5-phosphate synthase t...   1023   0.0     Pinus densiflora [Japanese red pine]
gb|ABS50519.1|  1-deoxy-D-xylulose 5-phosphate synthase type II        1022   0.0     Picea abies
ref|XP_008810947.1|  PREDICTED: LOW QUALITY PROTEIN: probable 1-d...   1021   0.0     
ref|XP_007156461.1|  hypothetical protein PHAVU_003G287900g            1021   0.0     
gb|AAR95699.1|  putative 1-D-deoxyxylulose 5-phosphate synthase        1020   0.0     Ginkgo biloba [ginkgo]
gb|EEC81653.1|  hypothetical protein OsI_25196                         1019   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_006406262.1|  hypothetical protein EUTSA_v10020205mg            1019   0.0     
ref|NP_001059086.1|  Os07g0190000                                      1019   0.0     Oryza sativa Japonica Group [Japonica rice]
dbj|BAF98289.1|  1-deoxy-D-xylulose 5-phosphate synthase               1018   0.0     Hevea brasiliensis [jebe]
gb|KDP29794.1|  hypothetical protein JCGZ_18729                        1018   0.0     
ref|XP_007156460.1|  hypothetical protein PHAVU_003G287800g            1018   0.0     
ref|XP_004289517.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1018   0.0     
ref|XP_008450188.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1017   0.0     
ref|XP_009364805.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1016   0.0     
ref|XP_009364804.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1016   0.0     
ref|XP_006466336.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1016   0.0     
ref|XP_008338474.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1015   0.0     
gb|KDO60529.1|  hypothetical protein CISIN_1g003948mg                  1014   0.0     
gb|ABI35993.1|  1-deoxy-D-xylulose 5-phosphate synthase 2              1014   0.0     Catharanthus roseus [chatas]
ref|XP_006426247.1|  hypothetical protein CICLE_v10024949mg            1014   0.0     
ref|XP_008338473.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1014   0.0     
ref|XP_002266925.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1013   0.0     Vitis vinifera
ref|XP_008392765.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1013   0.0     
gb|AHB79076.1|  1-deoxy-D-xylulose-5-phosphate synthase                1013   0.0     
gb|KDP43804.1|  hypothetical protein JCGZ_23012                        1013   0.0     
ref|XP_003533424.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1013   0.0     
ref|XP_009364235.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1012   0.0     
gb|AHI62962.1|  1-deoxy-D-xylulose-5-phosphate synthase                1012   0.0     
ref|XP_011099963.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1011   0.0     
gb|AFU93069.1|  chloroplast 1-deoxy-D-xylulose-5-phosphate synthase    1011   0.0     
ref|XP_008351725.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1010   0.0     
ref|XP_006381844.1|  hypothetical protein POPTR_0006s18750g            1010   0.0     
ref|XP_004134268.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1010   0.0     
ref|XP_002459484.1|  hypothetical protein SORBIDRAFT_02g005380         1008   0.0     Sorghum bicolor [broomcorn]
gb|AJB84617.1|  1-deoxy-D-xylulose-5-phosphate synthase                1008   0.0     
ref|XP_009590491.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1008   0.0     
ref|XP_009402142.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1008   0.0     
gb|ACI43010.1|  1-deoxy-D-xylulose 5-phosphate synthase                1008   0.0     Stevia rebaudiana
emb|CAA09804.2|  1-deoxyxylulose 5-phosphate synthase                  1008   0.0     Catharanthus roseus [chatas]
ref|XP_004955719.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1008   0.0     
ref|XP_010113452.1|  putative 1-deoxy-D-xylulose-5-phosphate synt...   1007   0.0     
gb|ACF84835.1|  unknown                                                1006   0.0     Zea mays [maize]
ref|XP_003530592.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1006   0.0     
dbj|BAJ98888.1|  predicted protein                                     1006   0.0     
ref|XP_011012653.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1005   0.0     
gb|KHN24127.1|  Putative 1-deoxy-D-xylulose-5-phosphate synthase,...   1005   0.0     
dbj|BAE79547.1|  1-deoxyxylulose 5-phosphate synthase                  1005   0.0     Chrysanthemum x morifolium [florist's chrysanthemum]
emb|CAD22155.2|  1-deoxy-D-xylulose 5-phosphate synthase               1005   0.0     Stevia rebaudiana
gb|AIX87516.1|  1-deoxy-D-xylulose 5-phosphate-synthase 2              1004   0.0     
gb|AID51428.1|  1-deoxy-D-xylulose 5-phosphate synthase                1004   0.0     
ref|XP_003530591.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1004   0.0     
ref|XP_006380580.1|  hypothetical protein POPTR_0007s09490g            1003   0.0     
ref|XP_006353153.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1003   0.0     
ref|XP_009400868.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1002   0.0     
gb|EYU30922.1|  hypothetical protein MIMGU_mgv1a002082mg               1002   0.0     
ref|XP_003557443.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1002   0.0     
gb|AHF22384.1|  1-deoxy-D-xylulose-5-phosphate synthase                1002   0.0     
ref|XP_007014110.1|  1-deoxy-D-xylulose-5-phosphate synthase           1001   0.0     
gb|AIZ68637.1|  1-deoxy-D-xylulose-5-phosphate synthase precursor      1001   0.0     
emb|CDP01586.1|  unnamed protein product                               1001   0.0     
ref|XP_011011178.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...   1000   0.0     
ref|XP_002271585.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    998   0.0     Vitis vinifera
ref|XP_004250162.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    998   0.0     
gb|AEZ55686.1|  putative 1-deoxy-D-xylulose 5-phosphate synthase of     998   0.0     
gb|AAT97962.1|  putative 1-deoxy-D-xylulose 5-phosphate synthase 2      998   0.0     Solanum habrochaites
ref|XP_003552082.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    998   0.0     
gb|AIX87492.1|  1-deoxy-D-xylulose 5-phosphate-synthase 2               997   0.0     
gb|KHG25453.1|  putative 1-deoxy-D-xylulose-5-phosphate synthase,...    997   0.0     
emb|CAZ66649.1|  1-deoxy-D-xylulose 5-phosphate synthase 2 precursor    997   0.0     Solanum lycopersicum
ref|XP_006602444.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    997   0.0     
ref|XP_007047749.1|  UDP-glucose pyrophosphorylase 3 isoform 1          997   0.0     
ref|XP_010027965.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    995   0.0     
gb|EPS72779.1|  1-deoxyxylulose 5-phosphate synthase                    995   0.0     
emb|CAC08458.1|  1-D-desoxyxylulose 5-phosphate synthase (DXS)          994   0.0     Narcissus pseudonarcissus
ref|XP_007208040.1|  hypothetical protein PRUPE_ppa002778mg             993   0.0     
gb|AGQ04154.1|  1-deoxy-D-xylulose 5-phosphate synthase                 993   0.0     
ref|XP_009768276.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    991   0.0     
gb|AAW28999.1|  1-deoxy-D-xylulose-5-phosphate synthase                 991   0.0     Antirrhinum majus [garden snapdragon]
gb|EMS59126.1|  putative 1-deoxy-D-xylulose-5-phosphate synthase,...    991   0.0     
gb|AAC33513.1|  1-deoxyxylulose-5-phosphate synthase                    991   0.0     Mentha x piperita
gb|AFM78321.1|  1-D-deoxyxylulose 5-phosphate synthase 2                991   0.0     
ref|XP_004509707.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    991   0.0     
ref|XP_011069878.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    990   0.0     
emb|CAD22531.1|  1-deoxy-D-xylulose 5-phosphate synthase 2              990   0.0     Medicago truncatula
ref|XP_004173040.1|  PREDICTED: LOW QUALITY PROTEIN: probable 1-d...    990   0.0     
emb|CAN89181.1|  1-Deoxy-D-xylulose 5-phosphate synthase 2 precursor    989   0.0     Medicago truncatula
ref|XP_008652152.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    988   0.0     
gb|ABP88135.1|  1-deoxy-D-xylulose 5-phosphate synthase                 987   0.0     Zea mays [maize]
ref|XP_006852893.1|  hypothetical protein AMTR_s00033p00220630          986   0.0     
emb|CBI17763.3|  unnamed protein product                                986   0.0     
ref|XP_010656800.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    986   0.0     
gb|AAG10432.1|  1-deoxy-D-xylulose-5-phosphate synthase                 984   0.0     Tagetes erecta [big marigold]
gb|KHG14116.1|  putative 1-deoxy-D-xylulose-5-phosphate synthase,...    982   0.0     
emb|CAN71054.1|  hypothetical protein VITISV_003721                     982   0.0     Vitis vinifera
ref|XP_004146353.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    979   0.0     
gb|KHG09883.1|  putative 1-deoxy-D-xylulose-5-phosphate synthase,...    978   0.0     
gb|EYU42445.1|  hypothetical protein MIMGU_mgv1a002040mg                978   0.0     
gb|KHG09884.1|  putative 1-deoxy-D-xylulose-5-phosphate synthase,...    978   0.0     
gb|KDO74971.1|  hypothetical protein CISIN_1g004923mg                   978   0.0     
ref|XP_008453643.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    977   0.0     
gb|KHG29081.1|  putative 1-deoxy-D-xylulose-5-phosphate synthase,...    974   0.0     
gb|KHG29080.1|  putative 1-deoxy-D-xylulose-5-phosphate synthase,...    973   0.0     
ref|XP_003550669.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    973   0.0     
ref|XP_003628891.1|  1-Deoxy-D-xylulose 5-phosphate synthase            973   0.0     
gb|ACQ66107.1|  1-deoxy-D-xylulose 5-phosphate synthase 2               973   0.0     Salvia miltiorrhiza [Chinese salvia]
gb|AIY22670.1|  1-deoxy-D-xylulose 5-phosphate synthase 2               971   0.0     
ref|XP_009397035.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    970   0.0     
gb|ADD82535.1|  1-deoxyxylulose-5-phosphate synthase                    969   0.0     Narcissus tazetta subsp. chinensis
gb|KHN45781.1|  Putative 1-deoxy-D-xylulose-5-phosphate synthase,...    969   0.0     
emb|CBI17808.3|  unnamed protein product                                969   0.0     
ref|XP_007047752.1|  1-deoxy-D-xylulose-5-phosphate synthase            969   0.0     
ref|XP_002270336.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    968   0.0     Vitis vinifera
ref|XP_004161053.1|  PREDICTED: LOW QUALITY PROTEIN: probable 1-d...    966   0.0     
ref|XP_010102986.1|  putative 1-deoxy-D-xylulose-5-phosphate synt...    966   0.0     
gb|EPS64831.1|  1-deoxyxylulose-5-phosphate synthase                    961   0.0     
ref|XP_010680483.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    952   0.0     
ref|XP_006378080.1|  hypothetical protein POPTR_0010s01910g             952   0.0     
ref|XP_007154799.1|  hypothetical protein PHAVU_003G148900g             951   0.0     
ref|XP_006426248.1|  hypothetical protein CICLE_v10024949mg             949   0.0     
gb|AEK69519.1|  1-deoxy-D-xylulose-5-phosphate synthase 2               949   0.0     
gb|KDO60530.1|  hypothetical protein CISIN_1g003948mg                   948   0.0     
emb|CAN83878.1|  hypothetical protein VITISV_003880                     948   0.0     
gb|KHN17565.1|  Putative 1-deoxy-D-xylulose-5-phosphate synthase,...    944   0.0     
emb|CAA07554.1|  1-deoxy-D-xylulose-5-phosphate synthase                940   0.0     
ref|XP_001702062.1|  1-deoxy-D-xylulose 5-phosphate synthase            940   0.0     
ref|XP_006378084.1|  hypothetical protein POPTR_0010s01910g             938   0.0     
ref|XP_007509340.1|  1-deoxy-D-xylulose-5-phosphate (DXP) synthas...    938   0.0     
ref|XP_002507311.1|  predicted protein                                  937   0.0     
ref|XP_010510263.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...    933   0.0     
gb|AEZ53173.1|  1-deoxy-D-xylulose 5-phosphate synthase                 933   0.0     
ref|XP_001416190.1|  1-deoxy-D-xylulose-5-phosphate synthase plas...    930   0.0     
ref|XP_003074992.1|  Dxs 1-deoxy-D-xylulose-5-phosphate synthase ...    928   0.0     
ref|XP_005843866.1|  hypothetical protein CHLNCDRAFT_59788              927   0.0     
ref|XP_003056386.1|  predicted protein                                  926   0.0     
ref|XP_007047750.1|  UDP-glucose pyrophosphorylase 3 isoform 2          922   0.0     
ref|XP_002956962.1|  hypothetical protein VOLCADRAFT_107482             920   0.0     
ref|XP_010510271.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...    919   0.0     
ref|XP_005646913.1|  1-deoxy-D-xylulose 5-phosphate synthase            899   0.0     
gb|ACT21080.1|  1-deoxy-D-xylulose 5-phosphate synthase                 895   0.0     
gb|ACB55417.1|  1-deoxy-D-xylulose 5-phosphate synthase                 885   0.0     
gb|KFM24758.1|  1-deoxy-D-xylulose-5-phosphate synthase 1, chloro...    873   0.0     
gb|AAP14354.2|  1-deoxy-D-xylulose-5-phosphate synthase                 863   0.0     
ref|XP_009397033.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    861   0.0     
gb|AAX49359.1|  1-deoxy-D-xylulose 5-phosphate synthase 1               851   0.0     
gb|KGN65420.1|  hypothetical protein Csa_1G420340                       847   0.0     
ref|XP_006378081.1|  hypothetical protein POPTR_0010s01910g             832   0.0     
ref|XP_008450191.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    838   0.0     
gb|AFP65821.1|  1-deoxy-D-xylulose 5-phosphate synthase                 830   0.0     
gb|KDO60531.1|  hypothetical protein CISIN_1g003948mg                   816   0.0     
gb|KDP33630.1|  hypothetical protein JCGZ_07201                         815   0.0     
gb|AEZ35187.1|  1-deoxy-D-xylulose 5-phosphate synthase-III             810   0.0     
ref|XP_007137053.1|  hypothetical protein PHAVU_009G095900g             809   0.0     
ref|XP_007013804.1|  1-deoxy-D-xylulose 5-phosphate synthase 3 is...    806   0.0     
ref|XP_002514364.1|  1-deoxyxylulose-5-phosphate synthase, putative     805   0.0     
ref|XP_003603440.1|  hypothetical protein MTR_3g107740                  805   0.0     
ref|XP_010102815.1|  putative 1-deoxy-D-xylulose-5-phosphate synt...    804   0.0     
ref|XP_002282428.2|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    803   0.0     
ref|XP_004501298.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    802   0.0     
gb|ACN38875.1|  chloroplast 1-deoxy-D-xylulose 5-phosphate synthase     791   0.0     
ref|XP_007013806.1|  1-deoxy-D-xylulose 5-phosphate synthase 3 is...    801   0.0     
ref|XP_006450503.1|  hypothetical protein CICLE_v10007595mg             801   0.0     
ref|XP_003523698.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    801   0.0     
ref|XP_006483309.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    801   0.0     
ref|XP_002308644.2|  hypothetical protein POPTR_0006s26580g             801   0.0     
ref|XP_010254309.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    801   0.0     
ref|XP_010914935.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    800   0.0     
ref|XP_010914934.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    801   0.0     
ref|XP_003527796.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    800   0.0     
ref|XP_011019757.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    800   0.0     
ref|XP_007225201.1|  hypothetical protein PRUPE_ppa002074mg             799   0.0     
ref|XP_007047751.1|  Deoxyxylulose-5-phosphate synthase isoform 3       791   0.0     
ref|XP_006483308.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    799   0.0     
ref|XP_010048248.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    798   0.0     
ref|XP_009334784.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    796   0.0     
ref|XP_006578165.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    795   0.0     
ref|XP_006854919.1|  hypothetical protein AMTR_s00052p00100800          791   0.0     
ref|XP_008394029.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    792   0.0     
ref|XP_008445153.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    792   0.0     
ref|XP_008378349.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    792   0.0     
ref|XP_004138739.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...    792   0.0     
ref|XP_003628889.1|  1-Deoxy-D-xylulose 5-phosphate synthase            783   0.0     
ref|WP_007680449.1|  1-deoxy-D-xylulose-5-phosphate synthase            788   0.0     
ref|XP_008792105.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    788   0.0     
ref|XP_009399764.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    788   0.0     
ref|XP_008347722.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    788   0.0     
ref|XP_002459488.1|  hypothetical protein SORBIDRAFT_02g005410          777   0.0     
ref|XP_008219892.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    785   0.0     
ref|WP_028097263.1|  1-deoxy-D-xylulose-5-phosphate synthase            781   0.0     
ref|XP_010254310.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    780   0.0     
gb|ACI45959.1|  putative plastid 1-deoxy-D-xylulose 5-phosphate s...    781   0.0     
emb|CEG08544.1|  1-deoxy-D-xylulose-5-phosphate synthase                776   0.0     
gb|KHN07102.1|  Putative 1-deoxy-D-xylulose-5-phosphate synthase,...    776   0.0     
ref|XP_010519937.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate sy...    779   0.0     
ref|WP_008944119.1|  1-deoxy-D-xylulose-5-phosphate synthase            776   0.0     
ref|WP_035676876.1|  1-deoxy-D-xylulose-5-phosphate synthase            775   0.0     
gb|AEZ35186.1|  1-deoxy-D-xylulose 5-phosphate synthase-II              780   0.0     
ref|WP_008388968.1|  1-deoxy-D-xylulose-5-phosphate synthase            775   0.0     
ref|WP_014198455.1|  1-deoxy-D-xylulose-5-phosphate synthase            774   0.0     
ref|WP_002716364.1|  1-deoxy-D-xylulose-5-phosphate synthase            774   0.0     
gb|EZQ05775.1|  1-deoxy-D-xylulose-5-phosphate synthase                 774   0.0     
ref|WP_012109654.1|  1-deoxy-D-xylulose-5-phosphate synthase            774   0.0     
gb|KHG14929.1|  putative 1-deoxy-D-xylulose-5-phosphate synthase,...    776   0.0     
ref|WP_009338948.1|  1-deoxy-D-xylulose-5-phosphate synthase            773   0.0     
gb|AFW77974.1|  hypothetical protein ZEAMMB73_720473                    765   0.0     
ref|WP_037017986.1|  1-deoxy-D-xylulose-5-phosphate synthase            773   0.0     
ref|WP_012563803.1|  1-deoxy-D-xylulose-5-phosphate synthase            772   0.0     
ref|WP_024573915.1|  MULTISPECIES: 1-deoxy-D-xylulose-5-phosphate...    771   0.0     
ref|WP_012565793.1|  1-deoxy-D-xylulose-5-phosphate synthase            771   0.0     
ref|WP_029007586.1|  1-deoxy-D-xylulose-5-phosphate synthase            770   0.0     
gb|AAL16232.1|AF428463_1  AT4g15560/dl3821w                             762   0.0     
ref|XP_004964516.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    773   0.0     
ref|WP_019461445.1|  MULTISPECIES: 1-deoxy-D-xylulose-5-phosphate...    769   0.0     
gb|AFU75320.1|  1-deoxy-D-xylulose-5-phosphate synthase 3               772   0.0     
ref|WP_027279648.1|  1-deoxy-D-xylulose-5-phosphate synthase            768   0.0     
ref|XP_002437810.1|  hypothetical protein SORBIDRAFT_10g002960          771   0.0     
ref|WP_009735796.1|  1-deoxy-D-xylulose-5-phosphate synthase            767   0.0     
ref|XP_008658908.1|  PREDICTED: uncharacterized protein LOC100384...    770   0.0     
ref|WP_002711128.1|  1-deoxy-D-xylulose-5-phosphate synthase            766   0.0     
gb|ADN22972.1|  1-deoxy-D-xylulose 5-phosphate synthase                 769   0.0     
ref|WP_006019765.1|  1-deoxy-D-xylulose-5-phosphate synthase            766   0.0     
ref|WP_024920585.1|  MULTISPECIES: 1-deoxy-D-xylulose-5-phosphate...    765   0.0     
ref|WP_009465625.1|  1-deoxy-D-xylulose-5-phosphate synthase            765   0.0     
ref|WP_038361177.1|  1-deoxy-D-xylulose-5-phosphate synthase            764   0.0     
gb|AEZ35185.1|  1-deoxy-D-xylulose 5-phosphate synthase-I               770   0.0     
ref|XP_004291479.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    767   0.0     
ref|WP_014197626.1|  1-deoxy-D-xylulose-5-phosphate synthase            764   0.0     
ref|WP_028464447.1|  1-deoxy-D-xylulose-5-phosphate synthase            764   0.0     
dbj|GAK46123.1|  1-deoxy-D-xylulose-5-phosphate synthase                763   0.0     
ref|XP_006655777.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    766   0.0     
ref|XP_005716785.1|  1-deoxyxylulose-5-phosphate synthase               765   0.0     
ref|WP_008595359.1|  1-deoxy-D-xylulose-5-phosphate synthase            761   0.0     
gb|AAV59446.1|  putative 1-deoxy-D-xylulose 5-phosphate synthase        771   0.0     
ref|WP_027283271.1|  1-deoxy-D-xylulose-5-phosphate synthase            761   0.0     
ref|WP_024079520.1|  1-deoxyxylulose-5-phosphate synthase, thiami...    761   0.0     
ref|WP_014131670.1|  1-deoxy-D-xylulose-5-phosphate synthase            761   0.0     
ref|WP_035458783.1|  1-deoxy-D-xylulose-5-phosphate synthase            760   0.0     
gb|AHN97608.1|  1-deoxy-D-xylulose-5-phosphate synthase                 759   0.0     
ref|WP_019401461.1|  1-deoxy-D-xylulose-5-phosphate synthase            758   0.0     
ref|WP_009764791.1|  1-deoxy-D-xylulose-5-phosphate synthase            758   0.0     
ref|WP_007004946.1|  1-deoxy-D-xylulose-5-phosphate synthase            758   0.0     
ref|WP_027578941.1|  1-deoxy-D-xylulose-5-phosphate synthase            758   0.0     
emb|CAM77691.1|  Deoxyxylulose-5-phosphate synthase                     758   0.0     
ref|WP_009451365.1|  1-deoxy-D-xylulose-5-phosphate synthase            758   0.0     
ref|WP_024580659.1|  1-deoxy-D-xylulose-5-phosphate synthase            757   0.0     
ref|WP_012564030.1|  1-deoxy-D-xylulose-5-phosphate synthase            756   0.0     
ref|XP_008394030.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    756   0.0     
ref|WP_029014579.1|  1-deoxy-D-xylulose-5-phosphate synthase            756   0.0     
ref|WP_038386483.1|  1-deoxy-D-xylulose-5-phosphate synthase            756   0.0     
gb|KFC73370.1|  1-deoxy-D-xylulose-5-phosphate synthase                 755   0.0     
ref|WP_028879494.1|  1-deoxy-D-xylulose-5-phosphate synthase            756   0.0     
ref|WP_028334495.1|  1-deoxy-D-xylulose-5-phosphate synthase            755   0.0     
ref|WP_037453422.1|  1-deoxy-D-xylulose-5-phosphate synthase            755   0.0     
ref|WP_024926693.1|  MULTISPECIES: 1-deoxy-D-xylulose-5-phosphate...    755   0.0     
ref|WP_027279421.1|  1-deoxy-D-xylulose-5-phosphate synthase            755   0.0     
ref|WP_028339501.1|  1-deoxy-D-xylulose-5-phosphate synthase            755   0.0     
ref|WP_013500896.1|  1-deoxy-D-xylulose-5-phosphate synthase            754   0.0     
ref|WP_018270362.1|  1-deoxy-D-xylulose-5-phosphate synthase            754   0.0     
ref|WP_014744484.1|  1-deoxy-D-xylulose-5-phosphate synthase            754   0.0     
ref|WP_031346457.1|  1-deoxy-D-xylulose-5-phosphate synthase            754   0.0     
ref|WP_027570994.1|  1-deoxy-D-xylulose-5-phosphate synthase            754   0.0     
ref|XP_010670708.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    756   0.0     
ref|WP_006466199.1|  1-deoxy-D-xylulose-5-phosphate synthase            753   0.0     
ref|XP_004245186.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    756   0.0     
ref|WP_011156487.1|  1-deoxy-D-xylulose-5-phosphate synthase            753   0.0     
ref|WP_029925569.1|  1-deoxy-D-xylulose-5-phosphate synthase            753   0.0     
ref|WP_012090818.1|  1-deoxy-D-xylulose-5-phosphate synthase            753   0.0     
emb|CDP04804.1|  unnamed protein product                                755   0.0     
ref|WP_018426800.1|  1-deoxy-D-xylulose-5-phosphate synthase            752   0.0     
ref|WP_011471617.1|  1-deoxy-D-xylulose-5-phosphate synthase            753   0.0     
ref|WP_034844213.1|  1-deoxy-D-xylulose-5-phosphate synthase            752   0.0     
ref|WP_036038029.1|  1-deoxy-D-xylulose-5-phosphate synthase            752   0.0     
ref|WP_028168304.1|  1-deoxy-D-xylulose-5-phosphate synthase            752   0.0     
ref|WP_002716530.1|  1-deoxy-D-xylulose-5-phosphate synthase            752   0.0     
ref|WP_010658366.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_027537704.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_037547809.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_006072240.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_027301401.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_024848205.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_027053432.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_036004129.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_036481984.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_018182613.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_035726300.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_011504683.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_036585960.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
dbj|BAQ16538.1|  1-deoxy-D-xylulose 5-phosphate synthase                751   0.0     
ref|WP_029081383.1|  1-deoxy-D-xylulose-5-phosphate synthase            750   0.0     
gb|KFK25404.1|  hypothetical protein AALP_AA8G110000                    753   0.0     
ref|WP_027034218.1|  1-deoxy-D-xylulose-5-phosphate synthase            750   0.0     
ref|WP_011580078.1|  1-deoxy-D-xylulose-5-phosphate synthase            751   0.0     
ref|WP_021076753.1|  1-deoxy-D-xylulose-5-phosphate synthase            750   0.0     
gb|AIK43407.1|  1-deoxy-D-xylulose-5-phosphate synthase                 750   0.0     
ref|XP_006399639.1|  hypothetical protein EUTSA_v10012843mg             752   0.0     
ref|WP_027554314.1|  1-deoxy-D-xylulose-5-phosphate synthase            750   0.0     
ref|WP_013896671.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_038465575.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_019169824.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_011925232.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_006611440.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_013169196.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_028793893.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_007421331.1|  MULTISPECIES: 1-deoxy-D-xylulose-5-phosphate...    749   0.0     
ref|WP_035711089.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_027058196.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_024340268.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
gb|KGJ68138.1|  putative 1-deoxy-D-xylulose 5-phosphate synthase        749   0.0     
ref|WP_027558316.1|  MULTISPECIES: 1-deoxy-D-xylulose-5-phosphate...    749   0.0     
ref|WP_026868734.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_026202775.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_035982778.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_012042672.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_028144212.1|  MULTISPECIES: 1-deoxy-D-xylulose-5-phosphate...    749   0.0     
dbj|GAJ33662.1|  1-deoxy-D-xylulose 5-phosphate synthase                749   0.0     
ref|XP_006364283.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    751   0.0     
ref|WP_009027909.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|WP_028175335.1|  MULTISPECIES: 1-deoxy-D-xylulose-5-phosphate...    749   0.0     
ref|WP_027035953.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
emb|CEG08836.1|  1-deoxy-D-xylulose-5-phosphate synthase                748   0.0     
ref|WP_007435961.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|WP_027526543.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|WP_032929362.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|WP_029063846.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|WP_023778680.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|WP_007090872.1|  MULTISPECIES: 1-deoxy-D-xylulose-5-phosphate...    748   0.0     
ref|WP_011085437.1|  1-deoxy-D-xylulose-5-phosphate synthase            749   0.0     
ref|WP_025034658.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|WP_013640404.1|  MULTISPECIES: 1-deoxy-D-xylulose-5-phosphate...    748   0.0     
ref|WP_027022955.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|WP_029640175.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|WP_023808621.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|WP_015318805.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|XP_009621371.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...    750   0.0     
ref|WP_027529017.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|WP_009340448.1|  1-deoxy-D-xylulose-5-phosphate synthase            747   0.0     
ref|WP_012977223.1|  1-deoxy-D-xylulose-5-phosphate synthase            747   0.0     
ref|WP_023759116.1|  1-deoxy-D-xylulose-5-phosphate synthase            747   0.0     
ref|WP_036053774.1|  1-deoxy-D-xylulose-5-phosphate synthase            748   0.0     
ref|WP_031336448.1|  1-deoxy-D-xylulose-5-phosphate synthase            747   0.0     
ref|WP_010914877.1|  1-deoxy-D-xylulose-5-phosphate synthase            747   0.0     
ref|WP_028148183.1|  1-deoxy-D-xylulose-5-phosphate synthase            747   0.0     
ref|WP_036348780.1|  1-deoxy-D-xylulose-5-phosphate synthase            747   0.0     



>emb|CDO98935.1| unnamed protein product [Coffea canephora]
Length=717

 Score =  1287 bits (3331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/719 (88%), Positives = 673/719 (94%), Gaps = 2/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL T A P +LS  V SD  K     S W +G+D HLHFQ   +Q+   K+SSGV+ASL
Sbjct  1     MALSTFAFPANLSGAVVSDSIKRSLLYSSWLYGTDQHLHFQSMNNQVT--KKSSGVRASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             +++ EYYSQRPPTPLLDTINYPIHMKNLS KEL QLA+ELRSD+IFNVSKTGGHLGSSLG
Sbjct  59    SERGEYYSQRPPTPLLDTINYPIHMKNLSTKELKQLADELRSDIIFNVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR+KMPT+RQT+GL+GFTKRSESEY
Sbjct  119   VVELTVALHYLFNCPQDKILWDVGHQSYPHKILTGRRDKMPTLRQTDGLSGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFG GHSSTTISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGAGHSSTTISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGP+HEL
Sbjct  239   VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPVHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARG+ISGSGSTLFEELG YYIGPVDGHNIDDLV+IL+EVKSTKTTGPVLIHVV
Sbjct  299   AAKVDEYARGLISGSGSTLFEELGFYYIGPVDGHNIDDLVTILKEVKSTKTTGPVLIHVV  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAEKAADKYHGV KFDPATGKQFK SAKTQSYTTYFAEALIAEAE DKDIVA
Sbjct  359   TEKGRGYPYAEKAADKYHGVVKFDPATGKQFKTSAKTQSYTTYFAEALIAEAEVDKDIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTG+N+F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  419   IHAAMGGGTGMNIFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDR GLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV
Sbjct  479   QVVHDVDLQKLPVRFAMDRGGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LP GNKG PLEVG+GRIL+EGERVAL+GYGTAVQSC
Sbjct  539   ATAAAIDDRPSCFRYPRGNGIGVELPLGNKGIPLEVGKGRILIEGERVALLGYGTAVQSC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA L+E  GLR+TVADARFCKPLDH+LIRSLA SHEV+ITVEEGSIGGFGSHVAQFMA
Sbjct  599   LAAATLVEAHGLRLTVADARFCKPLDHSLIRSLANSHEVLITVEEGSIGGFGSHVAQFMA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             L+GLLDG LKWRPLVLPDRYIDHG+PADQ+ EAGLTPSHIAATVFNILG+ REALEIM+
Sbjct  659   LNGLLDGKLKWRPLVLPDRYIDHGSPADQVEEAGLTPSHIAATVFNILGQKREALEIMS  717



>ref|XP_009793959.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Nicotiana sylvestris]
Length=717

 Score =  1284 bits (3322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/719 (89%), Positives = 679/719 (94%), Gaps = 2/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  A+PG L+R V SD  K  P  S+ FHG+DL   FQ K +Q+  KKRS GVQASL
Sbjct  1     MALCNYAVPGILNRTVASDYSKQSPLFSELFHGTDLQYQFQHKLTQV--KKRSRGVQASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             +++ EYY+QRPPTPLLDTINYPIHMKNLSVKEL QLA ELRSD IFNVSKTGGHLGSSLG
Sbjct  59    SERGEYYAQRPPTPLLDTINYPIHMKNLSVKELKQLAEELRSDTIFNVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFN PQD+ILWDVGHQSYPHKILTGRR KM T+RQT+GLAGFTKRSESEY
Sbjct  119   VVELTVALHYVFNTPQDRILWDVGHQSYPHKILTGRRGKMSTLRQTDGLAGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKG+ NNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGTGHSSTTISAGLGMAVGRDLKGKNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDN+QVSLPTATLDGP PPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  239   VILNDNRQVSLPTATLDGPAPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL+SIL+EV+STKTTGPVLIHV+
Sbjct  299   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLISILKEVRSTKTTGPVLIHVI  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDPATGKQFK SAKTQSYTTYFAEALIAEAEADKDIVA
Sbjct  359   TEKGRGYPYAERAADKYHGVAKFDPATGKQFKVSAKTQSYTTYFAEALIAEAEADKDIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYD
Sbjct  419   IHAAMGGGTGMNLFHRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDE ELFHMV
Sbjct  479   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDETELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LP GNKGTPLEVG+GRIL+EGERVAL+GYG+AVQ+C
Sbjct  539   ATAAAIDDRPSCFRYPRGNGIGVELPVGNKGTPLEVGKGRILVEGERVALLGYGSAVQNC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AAA+LETRGL+VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMA
Sbjct  599   LAAAAVLETRGLQVTVADARFCKPLDGALIRSLAKSHEVLITVEEGSIGGFGSHVAQFMA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG LKWRP+VLPDRYIDHG+PADQLAEAGLTPSHIAATVFNILG+ REALE+MT
Sbjct  659   LDGLLDGKLKWRPIVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNILGQTREALEVMT  717



>sp|O78328.1|DXS_CAPAN RecName: Full=Probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic; Short=1-deoxyxylulose-5-phosphate synthase; 
Short=DXP synthase; Short=DXPS; AltName: Full=CapTKT2; Flags: 
Precursor [Capsicum annuum]
 emb|CAA75778.1| transketolase 2 [Capsicum annuum]
Length=719

 Score =  1283 bits (3319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/721 (88%), Positives = 680/721 (94%), Gaps = 4/721 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVG--SDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQA  2303
             MALC  A PG L+R V   SD  KP P  S+W HG+DL   F QK +Q+  KKRS  VQA
Sbjct  1     MALCAYAFPGILNRTVAVASDASKPTPLFSEWIHGTDLQFQFHQKLTQV--KKRSRTVQA  58

Query  2302  SLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSS  2123
             SL++  EYY+QRPPTP++DTINYPIHMKNLS+KEL QLA+ELRSD IFNVSKTGGHLGSS
Sbjct  59    SLSESGEYYTQRPPTPIVDTINYPIHMKNLSLKELKQLADELRSDTIFNVSKTGGHLGSS  118

Query  2122  LGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSES  1943
             LGVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRREKM T+RQTNGLAGFTKRSES
Sbjct  119   LGVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRREKMSTLRQTNGLAGFTKRSES  178

Query  1942  EYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSD  1763
             EYDCFGTGHSSTTISAGLGMAVGRDLKGR NNVIAVIGDGAMTAGQAYEAMNNAGYLDSD
Sbjct  179   EYDCFGTGHSSTTISAGLGMAVGRDLKGRNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSD  238

Query  1762  MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  1583
             MIVILNDN+QVSLPTATLDGP+PPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH
Sbjct  239   MIVILNDNRQVSLPTATLDGPVPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  298

Query  1582  ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIH  1403
             ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL+SIL+EV+STKTTGPVLIH
Sbjct  299   ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLISILKEVRSTKTTGPVLIH  358

Query  1402  VVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDI  1223
             VVTEKGRGYPYAE+AADKYHGV KFDPATGKQFK SAKTQSYTTYFAEALIAEAEADKDI
Sbjct  359   VVTEKGRGYPYAERAADKYHGVAKFDPATGKQFKGSAKTQSYTTYFAEALIAEAEADKDI  418

Query  1222  VAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRA  1043
             VAIHAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRA
Sbjct  419   VAIHAAMGGGTGMNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRA  478

Query  1042  YDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  863
             YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH
Sbjct  479   YDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  538

Query  862   MVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQ  683
             +VATAAAIDDRPSC RYPRGNG+GV LP GNKG PLEVG+GRIL+EGERVAL+GYG+AVQ
Sbjct  539   IVATAAAIDDRPSCFRYPRGNGIGVELPAGNKGIPLEVGKGRILVEGERVALLGYGSAVQ  598

Query  682   SCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQF  503
             +CL+AA++LE+RGL+VTVADARFCKPLD ALIRSLAKSHEV++TVE+GSIGGFGSHV QF
Sbjct  599   NCLAAASVLESRGLQVTVADARFCKPLDRALIRSLAKSHEVLVTVEKGSIGGFGSHVVQF  658

Query  502   MALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             MALDGLLDG LKWRP+VLPDRYIDHG+PADQLAEAGLTPSHIAATVFNILG+ REALE+M
Sbjct  659   MALDGLLDGKLKWRPIVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNILGQTREALEVM  718

Query  322   T  320
             T
Sbjct  719   T  719



>gb|AIX87515.1| 1-deoxy-D-xylulose 5-phosphate-synthase 1 [Lycium ruthenicum]
Length=717

 Score =  1281 bits (3316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/719 (89%), Positives = 678/719 (94%), Gaps = 2/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  A PG L+R V SDL K  PF S+WF+G+DL   FQ K +Q+  KKRS  VQASL
Sbjct  1     MALCAYAFPGILNRTVVSDLSKQSPFLSEWFNGTDLQFQFQHKLTQV--KKRSRVVQASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EYY+Q+P TP+LDTINYPIHMKNLS+KEL QLA+ELRSD IFNVSKTGGHLGSSLG
Sbjct  59    SESGEYYTQKPATPILDTINYPIHMKNLSLKELKQLADELRSDTIFNVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRREKM T+RQTNGLAGFTKRSESEY
Sbjct  119   VVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRREKMSTLRQTNGLAGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKGR NNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGTGHSSTTISAGLGMAVGRDLKGRNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDN+QVSLPTATLDGP+ PVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  239   VILNDNRQVSLPTATLDGPVAPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGH+IDDL+SIL+EV+STKTTGPVLIHVV
Sbjct  299   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHSIDDLISILKEVRSTKTTGPVLIHVV  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDPATG QFKASAKTQSYTTYFAEALIAEAEADKDIV 
Sbjct  359   TEKGRGYPYAERAADKYHGVAKFDPATGMQFKASAKTQSYTTYFAEALIAEAEADKDIVG  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACE LKPFCAIYSSFMQRAYD
Sbjct  419   IHAAMGGGTGMNLFLRRFPTRCFDVGIAEQHAVTFAAGLACESLKPFCAIYSSFMQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV
Sbjct  479   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LP GNKGTPLEVG+GRIL+EGERVAL+GYG+AVQSC
Sbjct  539   ATAAAIDDRPSCFRYPRGNGIGVELPVGNKGTPLEVGKGRILVEGERVALLGYGSAVQSC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AAA+LE+RGL+VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGFGSHV QFMA
Sbjct  599   LAAAAVLESRGLQVTVADARFCKPLDRALIRSLAKSHEVLITVEEGSIGGFGSHVVQFMA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG LKWRP+VLPDRYIDHG+PADQLAEAGLTPS IAATVFNILG+ REALEIMT
Sbjct  659   LDGLLDGKLKWRPIVLPDRYIDHGSPADQLAEAGLTPSSIAATVFNILGQTREALEIMT  717



>gb|AIX87491.1| 1-deoxy-D-xylulose 5-phosphate-synthase 1 [Lycium barbarum]
Length=717

 Score =  1281 bits (3316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/719 (89%), Positives = 680/719 (95%), Gaps = 2/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  A PG L+R V SDL K  PF S+WF+G+DL   FQ K +Q+  KKRS  VQASL
Sbjct  1     MALCAYAFPGILNRTVVSDLSKQSPFLSEWFNGTDLQFQFQHKLTQV--KKRSRVVQASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EYY+QRPPTP+LDTINYPIHMKNLS+KEL QLA+E+RSD IFNVSK GGHLGSSLG
Sbjct  59    SESGEYYTQRPPTPILDTINYPIHMKNLSLKELKQLADEVRSDTIFNVSKAGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRREKM T+RQTNGLAGFTKRSESEY
Sbjct  119   VVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRREKMSTLRQTNGLAGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKGR +NVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGTGHSSTTISAGLGMAVGRDLKGRNSNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDN+QVSLPTATLDGP+ PVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  239   VILNDNRQVSLPTATLDGPVAPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGH+IDDL+SIL+EV+STKTTGPVLIHVV
Sbjct  299   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHSIDDLISILKEVRSTKTTGPVLIHVV  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA
Sbjct  359   TEKGRGYPYAERAADKYHGVAKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  419   IHAAMGGGTGMNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPV FAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV
Sbjct  479   QVVHDVDLQKLPVGFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LP GNKGTPLEVG+GRIL+EGERVAL+GYG+AVQSC
Sbjct  539   ATAAAIDDRPSCFRYPRGNGIGVELPVGNKGTPLEVGKGRILVEGERVALLGYGSAVQSC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AAA+LE+RGL+VTVADARFCKPLD ALI+SLAKSHEV+ITVEEGSIGGFGSHV QFMA
Sbjct  599   LAAAAVLESRGLQVTVADARFCKPLDRALIKSLAKSHEVLITVEEGSIGGFGSHVVQFMA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG LKWRP+VLPDRYIDHG+PADQLAEAGLTPS IAATVFNILG+ REALEIMT
Sbjct  659   LDGLLDGKLKWRPIVLPDRYIDHGSPADQLAEAGLTPSSIAATVFNILGQTREALEIMT  717



>gb|ACF60511.1| 1-D-deoxyxylulose 5-phosphate synthase [Nicotiana tabacum]
Length=717

 Score =  1280 bits (3313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/719 (89%), Positives = 678/719 (94%), Gaps = 2/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  A+PG L+R V SD  K  P  S+ FHG+DL   FQ K +Q+  KKRS GVQASL
Sbjct  1     MALCAYAVPGILNRTVASDYSKQSPLFSELFHGTDLQYQFQHKLTQV--KKRSRGVQASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             +++ EYY+QRPPTPLLDTINYPIHMKNLSVKEL QLA ELRSD IFNVSKTGGHLGSSLG
Sbjct  59    SERGEYYAQRPPTPLLDTINYPIHMKNLSVKELKQLAEELRSDTIFNVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFN PQD+ILWDVGHQSYPHKILTGRR KM T+RQT+GLAGFTKRSES Y
Sbjct  119   VVELTVALHYVFNTPQDRILWDVGHQSYPHKILTGRRGKMSTLRQTDGLAGFTKRSESVY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKG+ NNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGTGHSSTTISAGLGMAVGRDLKGKNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDN+QVSLPTATLDGP PPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  239   VILNDNRQVSLPTATLDGPAPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL+SIL+EV+STKTTGPVLIHV+
Sbjct  299   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLISILKEVRSTKTTGPVLIHVI  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDPATGKQFK SAKTQSYTTYFAEALIAEAEADKDIVA
Sbjct  359   TEKGRGYPYAERAADKYHGVAKFDPATGKQFKVSAKTQSYTTYFAEALIAEAEADKDIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYD
Sbjct  419   IHAAMGGGTGMNLFHRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDE ELFHMV
Sbjct  479   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDETELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LP GNKGTPLEVG+GRIL+EGERVAL+GYG+AVQ+C
Sbjct  539   ATAAAIDDRPSCFRYPRGNGIGVELPVGNKGTPLEVGKGRILVEGERVALLGYGSAVQNC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AAA+LETRGL+VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMA
Sbjct  599   LAAAAVLETRGLQVTVADARFCKPLDGALIRSLAKSHEVLITVEEGSIGGFGSHVAQFMA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG LKWRP+VLPDRYIDHG+PADQLAEAGLTPSHIAATVFNILG+ REALE+MT
Sbjct  659   LDGLLDGKLKWRPIVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNILGQTREALEVMT  717



>ref|XP_009615219.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Nicotiana tomentosiformis]
Length=717

 Score =  1279 bits (3309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/719 (89%), Positives = 678/719 (94%), Gaps = 2/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC+ A PG L+R V SD  K  P  S+WFHG+DL  HFQ K +Q+  KKRS GVQASL
Sbjct  1     MALCSYAFPGILNRTVASDSLKQSPLFSEWFHGTDLQFHFQHKLTQV--KKRSRGVQASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             +++ EYY+QRPPTPLLDTINYPIHMK LSVKEL QLA ELRS+ +FNVSKTGGHLGSSLG
Sbjct  59    SERGEYYAQRPPTPLLDTINYPIHMKILSVKELKQLAEELRSETVFNVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFN PQD+ILWDVGHQSYPHKILTGRR KM T+RQT+GLAGFTKRSESEY
Sbjct  119   VVELTVALHYVFNTPQDRILWDVGHQSYPHKILTGRRGKMSTLRQTDGLAGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKG+ NNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGTGHSSTTISAGLGMAVGRDLKGKNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDN+QVSLPTATLDGP PPVGALS ALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  239   VILNDNRQVSLPTATLDGPAPPVGALSRALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL+SIL+EV+STKTTGPVLIHV+
Sbjct  299   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLISILKEVRSTKTTGPVLIHVI  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDPATGKQFK SAKTQSYTTYFAEALIAEAEADKDIVA
Sbjct  359   TEKGRGYPYAERAADKYHGVAKFDPATGKQFKVSAKTQSYTTYFAEALIAEAEADKDIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTG+N+F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYD
Sbjct  419   IHAAMGGGTGMNIFHRRFPNRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDE ELFHMV
Sbjct  479   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDETELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LP GNKGTPLEVG+GRIL+EGERVAL+GYG+AVQ+C
Sbjct  539   ATAAAIDDRPSCFRYPRGNGIGVELPVGNKGTPLEVGKGRILVEGERVALLGYGSAVQNC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AAA+L TRGL+VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMA
Sbjct  599   LAAAAVLVTRGLQVTVADARFCKPLDGALIRSLAKSHEVLITVEEGSIGGFGSHVAQFMA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG LKWRP+VLPDRYIDHG+PADQLAEAGLTPSHIAATVFNILG+ REALE+MT
Sbjct  659   LDGLLDGKLKWRPIVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNILGQTREALEVMT  717



>emb|CBA12009.1| 1-deoxy-D-xylulose-5-phosphate synthase [Nicotiana tabacum]
Length=717

 Score =  1276 bits (3303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/719 (89%), Positives = 677/719 (94%), Gaps = 2/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  A+PG L+R V SD  K  P  S+ FHG+DL   FQ K +++  KKRS GVQASL
Sbjct  1     MALCNYAVPGILNRTVASDYSKQSPLFSELFHGTDLQYQFQHKLTRV--KKRSRGVQASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++K EYY+QRPPTPLLDTINYPIHMKNLSVKEL QLA ELRSD IFNVSKTGGHLGSSLG
Sbjct  59    SEKGEYYAQRPPTPLLDTINYPIHMKNLSVKELKQLAEELRSDTIFNVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFN PQD+ILWDVGHQSYPHKILTGRR KM T+RQT+GLAGFTKRSESEY
Sbjct  119   VVELTVALHYVFNTPQDRILWDVGHQSYPHKILTGRRGKMSTLRQTDGLAGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKG+ NNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGTGHSSTTISAGLGMAVGRDLKGKNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDN+QVSLPTATLDGP PPVGALS ALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  239   VILNDNRQVSLPTATLDGPAPPVGALSRALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL+SIL+EV+STKTTGPVLIHV+
Sbjct  299   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLISILKEVRSTKTTGPVLIHVI  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDPATGKQFK SAKTQSYTTYFAEALIAEAEADKDIVA
Sbjct  359   TEKGRGYPYAERAADKYHGVAKFDPATGKQFKVSAKTQSYTTYFAEALIAEAEADKDIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTG+N+F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYD
Sbjct  419   IHAAMGGGTGMNIFHRRFPNRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDE ELFHMV
Sbjct  479   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDETELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LP GNKGTPLEVG+GRIL+EGERVAL+GYG+AVQ+C
Sbjct  539   ATAAAIDDRPSCFRYPRGNGIGVELPVGNKGTPLEVGKGRILVEGERVALLGYGSAVQNC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AAA+L TRGL+VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMA
Sbjct  599   LAAAAVLVTRGLQVTVADARFCKPLDGALIRSLAKSHEVLITVEEGSIGGFGSHVAQFMA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG LKWRP+VLPDRYIDHG+PADQLAEAGLTPSHIAATVFNILG+ REALE+MT
Sbjct  659   LDGLLDGKLKWRPIVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNILGQTREALEVMT  717



>ref|XP_002277919.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Vitis vinifera]
 emb|CBI26134.3| unnamed protein product [Vitis vinifera]
Length=716

 Score =  1275 bits (3300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/718 (88%), Positives = 671/718 (93%), Gaps = 3/718 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALCT + P   S+   S+ Q+  P  S  F G DL    QQ+      +KR +GV ASL
Sbjct  1     MALCTLSFPAHFSQAAASNPQRLTPQCSHLFLGVDLQCQSQQRSKA---RKRPNGVCASL  57

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             +D++EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDV+FNVSKTGGHLGSSLG
Sbjct  58    SDREEYHSQRPPTPLLDTINYPIHMKNLSVKELKQLADELRSDVVFNVSKTGGHLGSSLG  117

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR++M T+RQT+GLAGFTKRSESEY
Sbjct  118   VVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDQMHTMRQTDGLAGFTKRSESEY  177

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKG+ NNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  178   DCFGTGHSSTTISAGLGMAVGRDLKGKNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  237

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  238   VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  297

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLV+IL+EVKSTKTTGPVLIHVV
Sbjct  298   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVAILKEVKSTKTTGPVLIHVV  357

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAEKAADKYHGVTKFDPATGKQFK+SA TQSYTTYFAEALIAEAE DKDIVA
Sbjct  358   TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKSSAPTQSYTTYFAEALIAEAEVDKDIVA  417

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSFMQRAYD
Sbjct  418   IHAAMGGGTGLNLFHRRFPTRCFDVGIAEQHAVTFAAGLACEGIKPFCAIYSSFMQRAYD  477

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPV+FAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAP+DEAELFHMV
Sbjct  478   QVVHDVDLQKLPVKFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPADEAELFHMV  537

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNGVGV LPPGNKG P+EVGRGRIL+EGERVAL+GYGTAVQSC
Sbjct  538   ATAAAIDDRPSCFRYPRGNGVGVELPPGNKGIPIEVGRGRILIEGERVALLGYGTAVQSC  597

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L A++LLE  GLR+TVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHVAQF+A
Sbjct  598   LVASSLLEQHGLRITVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVAQFLA  657

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             L+GLLDG  KW P+VLPDRYIDHGAPADQLA AGLTPSHIAATVFNILG+ REALEIM
Sbjct  658   LNGLLDGTTKWSPMVLPDRYIDHGAPADQLAMAGLTPSHIAATVFNILGQTREALEIM  715



>gb|AGL40532.1| deoxyxylulose 5-phosphate synthase 1 [Catharanthus roseus]
Length=719

 Score =  1274 bits (3298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/719 (87%), Positives = 674/719 (94%), Gaps = 0/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  A PG L++ V S+      F S W +GSDL   FQ K  Q+  ++ ++GV+ASL
Sbjct  1     MALCAFAFPGSLNKAVASESLNNSLFCSNWLYGSDLLSPFQSKNHQVITRRPNNGVRASL  60

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY+SQRPPTPLLD+INYP+HMKNLS KEL QLA+E+RSD+IFNVSKTGGHLGSSLG
Sbjct  61    SEMGEYFSQRPPTPLLDSINYPVHMKNLSNKELKQLADEVRSDIIFNVSKTGGHLGSSLG  120

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFN PQD+ILWDVGHQSYPHKILTGRR+KMPT+RQTNGL+GFTKRSESEY
Sbjct  121   VVELTVALHYVFNCPQDRILWDVGHQSYPHKILTGRRDKMPTLRQTNGLSGFTKRSESEY  180

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFG GHSSTTISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  181   DCFGAGHSSTTISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  240

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGP PPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGP+HEL
Sbjct  241   VILNDNKQVSLPTATLDGPAPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPVHEL  300

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELG YYIGPVDGHNIDDLV+IL+EVKSTKTTGPVLIHVV
Sbjct  301   AAKVDEYARGMISGSGSTLFEELGFYYIGPVDGHNIDDLVAILKEVKSTKTTGPVLIHVV  360

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDP+TGKQFK+S+ TQSYTTYFAEALI+EAEADKDIVA
Sbjct  361   TEKGRGYPYAERAADKYHGVVKFDPSTGKQFKSSSNTQSYTTYFAEALISEAEADKDIVA  420

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTG+NLF RRFP RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  421   IHAAMGGGTGMNLFLRRFPRRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  480

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTH G+FDVTFMACLPNMVVMAPSDE+ELFHMV
Sbjct  481   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHSGSFDVTFMACLPNMVVMAPSDESELFHMV  540

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSCLRYPRGNGVGV LPPGNKG PLEVG+GRIL+EGERVAL+GYG AVQ+C
Sbjct  541   ATAAAIDDRPSCLRYPRGNGVGVQLPPGNKGLPLEVGKGRILIEGERVALLGYGAAVQNC  600

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AAAL+E+ GLRVTVADARFCKPLDH LIRSLAKSH+V+ITVEEGSIGGF SHVAQFM+
Sbjct  601   LAAAALVESHGLRVTVADARFCKPLDHELIRSLAKSHDVLITVEEGSIGGFSSHVAQFMS  660

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDGNLKWRPLVLPDRYIDHG+PADQ+AEAGLTPSHIAATVFNILG+ REALE+M+
Sbjct  661   LDGLLDGNLKWRPLVLPDRYIDHGSPADQMAEAGLTPSHIAATVFNILGQTREALEVMS  719



>gb|AFI98878.1| chloroplast 1-deoxy-D-xylulose-5-phosphate synthase [Withania 
somnifera]
 gb|AFI98880.1| chloroplast 1-deoxy-D-xylulose-5-phosphate synthase [Withania 
somnifera]
Length=717

 Score =  1273 bits (3293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/719 (89%), Positives = 674/719 (94%), Gaps = 2/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  A PG L R   SD  K     S+WFHG+DL   FQ K +Q+  KKRS  VQASL
Sbjct  1     MALCAYAFPGFLIRTAVSDSPKQSSLFSEWFHGTDLQFQFQHKFTQV--KKRSRVVQASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EYY+QRPPTP+LDTINYPIHMKNLS+KEL QLA ELRSD IFNVSKTGGHLGSSLG
Sbjct  59    SETGEYYTQRPPTPILDTINYPIHMKNLSLKELKQLAEELRSDTIFNVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRREKM T+RQTNGLAGFTKRSESEY
Sbjct  119   VVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRREKMSTLRQTNGLAGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKGR NNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGTGHSSTTISAGLGMAVGRDLKGRNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDN+QVSLPTATLDGP+PPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  239   VILNDNRQVSLPTATLDGPVPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL+SIL+EVKSTKTTGPVLIHVV
Sbjct  299   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLISILKEVKSTKTTGPVLIHVV  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDPATGKQFK  AKTQSYTTYFAEALIAEAEA+KDIVA
Sbjct  359   TEKGRGYPYAERAADKYHGVAKFDPATGKQFKGIAKTQSYTTYFAEALIAEAEANKDIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTG+NLF  RFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  419   IHAAMGGGTGMNLFLGRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV
Sbjct  479   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LP GN+GTPLEVG+GRIL+EGERVAL+GYG+AVQ+C
Sbjct  539   ATAAAIDDRPSCFRYPRGNGIGVELPAGNRGTPLEVGKGRILVEGERVALLGYGSAVQNC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+A+A+LE+  L+VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMA
Sbjct  599   LAASAVLESHCLQVTVADARFCKPLDRALIRSLAKSHEVLITVEEGSIGGFGSHVAQFMA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG LKWRP+VLPDRYIDHG+PADQLAEAGLTPSHIAATVFNILG+ REALE+MT
Sbjct  659   LDGLLDGKLKWRPIVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNILGQTREALEVMT  717



>ref|XP_006489186.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006489187.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic-like isoform X2 [Citrus sinensis]
Length=723

 Score =  1272 bits (3292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/721 (87%), Positives = 678/721 (94%), Gaps = 3/721 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQK--PSQINYKKRSSGVQA  2303
             MAL   + P  +S+   SD  K  P +S +F G+ L  HF QK    QI  KKR +GV A
Sbjct  1     MALSAFSFPTYVSKATNSDPHKSSPVTSHFF-GAALFSHFSQKLDNHQIQLKKRPNGVCA  59

Query  2302  SLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSS  2123
             SL+++ EY+SQRPPTPLLDTINYPIHMKNLS++EL QLA+ELR+DVIFNVSKTGGHLGSS
Sbjct  60    SLSERGEYHSQRPPTPLLDTINYPIHMKNLSIRELKQLADELRADVIFNVSKTGGHLGSS  119

Query  2122  LGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSES  1943
             LGV+ELTVALHYVFNAP+D+ILWDVGHQ+YPHKILTGRR+KM T+RQT+GL+GFTKRSES
Sbjct  120   LGVIELTVALHYVFNAPKDRILWDVGHQTYPHKILTGRRDKMHTMRQTDGLSGFTKRSES  179

Query  1942  EYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSD  1763
             EYDCFGTGHSST+ISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSD
Sbjct  180   EYDCFGTGHSSTSISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSD  239

Query  1762  MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  1583
             MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH
Sbjct  240   MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  299

Query  1582  ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIH  1403
             ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLV+IL+EVK+TKTTGPVLIH
Sbjct  300   ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNVDDLVAILEEVKNTKTTGPVLIH  359

Query  1402  VVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDI  1223
             VVTEKGRGYPYAEKAADKYHGV KFDPATGKQFK+SA+TQSYTTYFAEALIAEAE DKD+
Sbjct  360   VVTEKGRGYPYAEKAADKYHGVAKFDPATGKQFKSSARTQSYTTYFAEALIAEAEVDKDV  419

Query  1222  VAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRA  1043
             VAIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRA
Sbjct  420   VAIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRA  479

Query  1042  YDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  863
             YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMAPSDEAELFH
Sbjct  480   YDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMAPSDEAELFH  539

Query  862   MVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQ  683
             MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG PLEVG+GRIL+EGERVAL+GYGTAVQ
Sbjct  540   MVATAAAIDDRPSCFRYPRGNGIGVELPPGNKGIPLEVGKGRILIEGERVALLGYGTAVQ  599

Query  682   SCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQF  503
             SCL+A+ALLE+ GLR+TVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHV QF
Sbjct  600   SCLAASALLESNGLRLTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVVQF  659

Query  502   MALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             +A DGLLDG +KWRPLVLPDRYIDHG+PADQLA+AGLTPSHIAATVFNILG+ REALEIM
Sbjct  660   LAQDGLLDGTVKWRPLVLPDRYIDHGSPADQLAQAGLTPSHIAATVFNILGQTREALEIM  719

Query  322   T  320
             +
Sbjct  720   S  720



>ref|XP_006419702.1| hypothetical protein CICLE_v10004432mg [Citrus clementina]
 gb|ESR32942.1| hypothetical protein CICLE_v10004432mg [Citrus clementina]
Length=723

 Score =  1271 bits (3289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/721 (87%), Positives = 678/721 (94%), Gaps = 3/721 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQK--PSQINYKKRSSGVQA  2303
             MAL   + P  +S+   SD  K  P +S +F G+ L  HF QK    QI  KKR +GV A
Sbjct  1     MALSAFSFPTYVSKATNSDPHKSSPVTSHFF-GAALFSHFSQKLDNHQIQLKKRPNGVCA  59

Query  2302  SLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSS  2123
             SL+++ EY+SQRPPTPLLDTINYPIHMKNLS++EL QLA+ELR+DVIFNVSKTGGHLGSS
Sbjct  60    SLSERGEYHSQRPPTPLLDTINYPIHMKNLSIRELKQLADELRADVIFNVSKTGGHLGSS  119

Query  2122  LGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSES  1943
             LGV+ELTVALHYVFNAP+D+ILWDVGHQ+YPHKILTGRR+KM T+RQT+GL+GFTKRSES
Sbjct  120   LGVIELTVALHYVFNAPKDRILWDVGHQTYPHKILTGRRDKMHTMRQTDGLSGFTKRSES  179

Query  1942  EYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSD  1763
             EYDCFGTGHSST+ISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSD
Sbjct  180   EYDCFGTGHSSTSISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSD  239

Query  1762  MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  1583
             MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH
Sbjct  240   MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  299

Query  1582  ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIH  1403
             ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLV+IL+EVK+TKTTGPVLIH
Sbjct  300   ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNVDDLVAILEEVKNTKTTGPVLIH  359

Query  1402  VVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDI  1223
             VVTEKGRGYPYAEKAADKYHGV KFD ATGKQFK+SA+TQSYTTYFAEALIAEAE DKD+
Sbjct  360   VVTEKGRGYPYAEKAADKYHGVAKFDLATGKQFKSSARTQSYTTYFAEALIAEAEVDKDV  419

Query  1222  VAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRA  1043
             VAIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRA
Sbjct  420   VAIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRA  479

Query  1042  YDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  863
             YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMAPSDEAELFH
Sbjct  480   YDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMAPSDEAELFH  539

Query  862   MVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQ  683
             MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG PLEVG+GRIL+EGERVAL+GYGTAVQ
Sbjct  540   MVATAAAIDDRPSCFRYPRGNGIGVELPPGNKGIPLEVGKGRILIEGERVALLGYGTAVQ  599

Query  682   SCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQF  503
             SCL+A+ALLE+ GLR+TVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHV QF
Sbjct  600   SCLAASALLESNGLRLTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVVQF  659

Query  502   MALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             +ALDGLLDG +KWRPLVLPDRYIDHG+PADQLA+AGLTPSHIAATVFNILG+ REALEIM
Sbjct  660   LALDGLLDGTVKWRPLVLPDRYIDHGSPADQLAQAGLTPSHIAATVFNILGQTREALEIM  719

Query  322   T  320
             +
Sbjct  720   S  720



>emb|CAZ66648.1| 1-deoxy-D-xylulose 5-phosphate synthase 1 precursor [Solanum 
lycopersicum]
Length=719

 Score =  1271 bits (3288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/720 (88%), Positives = 675/720 (94%), Gaps = 2/720 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRL-VGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MALC  A PG L+R  V SD  K  P  S W HG+DL   FQ KP+    KKRS  VQAS
Sbjct  1     MALCAYAFPGILNRTGVVSDSSKATPLFSGWIHGTDLQFLFQHKPTH-EVKKRSRVVQAS  59

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L++  EYY+QRPPTP+LDT+NYPIHMKNLS+KEL QLA+ELRSD IFNVSKTGGHLGSSL
Sbjct  60    LSESGEYYTQRPPTPILDTVNYPIHMKNLSLKELKQLADELRSDTIFNVSKTGGHLGSSL  119

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM T+RQT+GLAGFTKRSESE
Sbjct  120   GVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMSTLRQTDGLAGFTKRSESE  179

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFGTGHSSTTISAGLGMAVGRDLKGR NNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  180   YDCFGTGHSSTTISAGLGMAVGRDLKGRNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  239

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDN+QVSLPTATLDGP+ PVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE
Sbjct  240   IVILNDNRQVSLPTATLDGPVAPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  299

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL++IL+EV+STKTTGPVLIHV
Sbjct  300   LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLIAILKEVRSTKTTGPVLIHV  359

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAE+AADKYHGV KFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV
Sbjct  360   VTEKGRGYPYAERAADKYHGVAKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  419

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSFMQRAY
Sbjct  420   AIHAAMGGGTGMNLFHRRFPTRCFDVGIAEQHAVTFAAGLACEGIKPFCAIYSSFMQRAY  479

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAELFHM
Sbjct  480   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELFHM  539

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNG+GV LP GNKG PLEVG+GRIL+EGERVAL+GYG+AVQ+
Sbjct  540   VATAAAIDDRPSCFRYPRGNGIGVELPAGNKGIPLEVGKGRILIEGERVALLGYGSAVQN  599

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL AA +LE+RGL+VTVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHV QFM
Sbjct  600   CLDAAIVLESRGLQVTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVVQFM  659

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDG LKWRP+VLPDRYIDHG+P DQLAEAGLTPSHIAATVFNILG+ REALE+MT
Sbjct  660   ALDGLLDGKLKWRPIVLPDRYIDHGSPVDQLAEAGLTPSHIAATVFNILGQTREALEVMT  719



>ref|XP_011090872.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Sesamum indicum]
Length=718

 Score =  1268 bits (3281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/720 (88%), Positives = 680/720 (94%), Gaps = 3/720 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSR-LVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MALCT A+PG+LS  +VG+D +K     SQW  GSDL  H   K +QI  +KRS+GV AS
Sbjct  1     MALCTFAVPGNLSSGVVGADAKKQTSLGSQWLRGSDLQPHSFSKNNQI--RKRSTGVCAS  58

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L ++ EY+SQ+PPTPLLDTINYPIHMKNLS KEL QLA+ELRSDVIFNVSKTGGHLGSSL
Sbjct  59    LTERGEYFSQKPPTPLLDTINYPIHMKNLSTKELKQLADELRSDVIFNVSKTGGHLGSSL  118

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GV+ELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM T+RQT+GL+GFTKRSES+
Sbjct  119   GVIELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMATLRQTDGLSGFTKRSESD  178

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFG GHSSTTISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  179   YDCFGAGHSSTTISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  238

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE
Sbjct  239   IVILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  298

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL +IL+EVKSTKTTGPVLIHV
Sbjct  299   LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLTAILKEVKSTKTTGPVLIHV  358

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFK++A TQSYTTYFAEALIAEAEADKDIV
Sbjct  359   VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKSNAPTQSYTTYFAEALIAEAEADKDIV  418

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSFMQRAY
Sbjct  419   AIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGIKPFCAIYSSFMQRAY  478

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM
Sbjct  479   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  538

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNG+G+ LPPGNKG PLE+G+GRIL EGERVAL+GYGTAVQS
Sbjct  539   VATAAAIDDRPSCFRYPRGNGIGMELPPGNKGIPLEIGKGRILKEGERVALLGYGTAVQS  598

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+AAAL+E  GLR+TVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGFGSHVA FM
Sbjct  599   CLAAAALVEPHGLRLTVADARFCKPLDQALIRSLAKSHEVLITVEEGSIGGFGSHVAHFM  658

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDG LKWRPLVLPDRYIDHG+PADQL +AGL+PSHIAATVFNILG+AREAL+IM+
Sbjct  659   ALDGLLDGKLKWRPLVLPDRYIDHGSPADQLMQAGLSPSHIAATVFNILGQAREALQIMS  718



>gb|KDO74968.1| hypothetical protein CISIN_1g004923mg [Citrus sinensis]
Length=723

 Score =  1267 bits (3279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/721 (87%), Positives = 676/721 (94%), Gaps = 3/721 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQK--PSQINYKKRSSGVQA  2303
             MAL   + P  +S+   S   K  P +S +F G+ L  HF  K    QI  KKR +GV A
Sbjct  1     MALSAFSFPTYVSKATNSGPHKSSPVTSHFF-GAALFSHFSHKLDNHQIQLKKRPNGVCA  59

Query  2302  SLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSS  2123
             SL+++ EY+SQRPPTPLLDTINYPIHMKNLS++EL QLA+ELR+DVIFNVSKTGGHLGSS
Sbjct  60    SLSERGEYHSQRPPTPLLDTINYPIHMKNLSIRELKQLADELRADVIFNVSKTGGHLGSS  119

Query  2122  LGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSES  1943
             LGV+ELTVALHYVFNAP+D+ILWDVGHQ+YPHKILTGRR+KM T+RQT+GL+GFTKRSES
Sbjct  120   LGVIELTVALHYVFNAPKDRILWDVGHQTYPHKILTGRRDKMHTMRQTDGLSGFTKRSES  179

Query  1942  EYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSD  1763
             EYDCFGTGHSST+ISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSD
Sbjct  180   EYDCFGTGHSSTSISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSD  239

Query  1762  MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  1583
             MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH
Sbjct  240   MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  299

Query  1582  ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIH  1403
             ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLV+IL+EVK+TKTTGPVLIH
Sbjct  300   ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNVDDLVAILEEVKNTKTTGPVLIH  359

Query  1402  VVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDI  1223
             VVTEKGRGYPYAEKAADKYHGV KFDPATGKQFK+SA+TQSYTTYFAEALIAEAE DKD+
Sbjct  360   VVTEKGRGYPYAEKAADKYHGVAKFDPATGKQFKSSARTQSYTTYFAEALIAEAEVDKDV  419

Query  1222  VAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRA  1043
             VAIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRA
Sbjct  420   VAIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRA  479

Query  1042  YDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  863
             YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMAPSDEAELFH
Sbjct  480   YDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMAPSDEAELFH  539

Query  862   MVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQ  683
             MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG PLEVG+GRIL+EGERVAL+GYGTAVQ
Sbjct  540   MVATAAAIDDRPSCFRYPRGNGIGVELPPGNKGIPLEVGKGRILIEGERVALLGYGTAVQ  599

Query  682   SCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQF  503
             SCL+A+ALLE+ GLR+TVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHV QF
Sbjct  600   SCLAASALLESNGLRLTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVVQF  659

Query  502   MALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             +A DGLLDG +KWRPLVLPDRYIDHG+PADQLA+AGLTPSHIAATVFNILG+ REALEIM
Sbjct  660   LAQDGLLDGTVKWRPLVLPDRYIDHGSPADQLAQAGLTPSHIAATVFNILGQTREALEIM  719

Query  322   T  320
             +
Sbjct  720   S  720



>ref|NP_001234672.1| 1-D-deoxyxylulose 5-phosphate synthase [Solanum lycopersicum]
 gb|AAD38941.1|AF143812_1 1-D-deoxyxylulose 5-phosphate synthase [Solanum lycopersicum]
Length=719

 Score =  1266 bits (3276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/720 (88%), Positives = 674/720 (94%), Gaps = 2/720 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRL-VGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MALC  A PG L+R  V SD  K  P  S W HG+DL   FQ K +    KKRS  VQAS
Sbjct  1     MALCAYAFPGILNRTGVVSDSSKATPLFSGWIHGTDLQFLFQHKLTH-EVKKRSRVVQAS  59

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L++  EYY+QRPPTP+LDT+NYPIHMKNLS+KEL QLA+ELRSD IFNVSKTGGHLGSSL
Sbjct  60    LSESGEYYTQRPPTPILDTVNYPIHMKNLSLKELKQLADELRSDTIFNVSKTGGHLGSSL  119

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM T+RQT+GLAGFTKRSESE
Sbjct  120   GVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMSTLRQTDGLAGFTKRSESE  179

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFGTGHSSTTISAGLGMAVGRDLKGR NNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  180   YDCFGTGHSSTTISAGLGMAVGRDLKGRNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  239

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDN+QVSLPTATLDGP+ PVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE
Sbjct  240   IVILNDNRQVSLPTATLDGPVAPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  299

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL++IL+EV+STKTTGPVLIHV
Sbjct  300   LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLIAILKEVRSTKTTGPVLIHV  359

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAE+AADKYHGV KFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV
Sbjct  360   VTEKGRGYPYAERAADKYHGVAKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  419

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSFMQRAY
Sbjct  420   AIHAAMGGGTGMNLFHRRFPTRCFDVGIAEQHAVTFAAGLACEGIKPFCAIYSSFMQRAY  479

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAELFHM
Sbjct  480   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELFHM  539

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNG+GV LP GNKG PLEVG+GRIL+EGERVAL+GYG+AVQ+
Sbjct  540   VATAAAIDDRPSCFRYPRGNGIGVELPAGNKGIPLEVGKGRILIEGERVALLGYGSAVQN  599

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL AA +LE+RGL+VTVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHV QFM
Sbjct  600   CLDAAIVLESRGLQVTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVVQFM  659

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDG LKWRP+VLPDRYIDHG+P DQLAEAGLTPSHIAATVFNILG+ REALE+MT
Sbjct  660   ALDGLLDGKLKWRPIVLPDRYIDHGSPVDQLAEAGLTPSHIAATVFNILGQTREALEVMT  719



>ref|XP_002516843.1| 1-deoxyxylulose-5-phosphate synthase, putative [Ricinus communis]
 gb|EEF45457.1| 1-deoxyxylulose-5-phosphate synthase, putative [Ricinus communis]
Length=720

 Score =  1265 bits (3274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/721 (87%), Positives = 671/721 (93%), Gaps = 4/721 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLV--GSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQA  2303
             MALC  + P   +++    SDLQK    SS +   +DL     QK +Q   KKR +GV A
Sbjct  1     MALCAFSFPAHANKVTTASSDLQKSNYVSSNFLLKTDLLGQSMQKFNQ--GKKRPAGVCA  58

Query  2302  SLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSS  2123
             SL++  EY+SQRPPTPLLDTINYPIHMKNLS+KEL QL++ELRSDVIFNVS TGGHLGSS
Sbjct  59    SLSETGEYHSQRPPTPLLDTINYPIHMKNLSIKELKQLSDELRSDVIFNVSITGGHLGSS  118

Query  2122  LGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSES  1943
             LGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRR+KM T+RQTNGL+GFTKRSES
Sbjct  119   LGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRRDKMQTMRQTNGLSGFTKRSES  178

Query  1942  EYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSD  1763
             EYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSD
Sbjct  179   EYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSD  238

Query  1762  MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  1583
             MIVILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSN+PLRELREVAKGVTK+IGGPMH
Sbjct  239   MIVILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNKPLRELREVAKGVTKRIGGPMH  298

Query  1582  ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIH  1403
             ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLV+IL+EVKSTKTTGPVLIH
Sbjct  299   ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNVDDLVAILKEVKSTKTTGPVLIH  358

Query  1402  VVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDI  1223
             VVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFK SA TQSYTTYFAEALIAEAE DKD+
Sbjct  359   VVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKGSASTQSYTTYFAEALIAEAEVDKDV  418

Query  1222  VAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRA  1043
             VAIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRA
Sbjct  419   VAIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRA  478

Query  1042  YDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  863
             YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH
Sbjct  479   YDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  538

Query  862   MVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQ  683
             MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG PLEVG+GRIL+EGERVAL+GYG+AVQ
Sbjct  539   MVATAAAIDDRPSCFRYPRGNGIGVQLPPGNKGIPLEVGKGRILIEGERVALLGYGSAVQ  598

Query  682   SCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQF  503
             SCL+AA+L+ET  LR+TVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHVA F
Sbjct  599   SCLAAASLMETYDLRITVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVAHF  658

Query  502   MALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             +ALDGLLDG LKWRP++LPDRYIDHG+PADQL EAGLTPSHIAAT+FNILG  REAL+IM
Sbjct  659   LALDGLLDGKLKWRPVILPDRYIDHGSPADQLVEAGLTPSHIAATIFNILGNKREALQIM  718

Query  322   T  320
             +
Sbjct  719   S  719



>ref|XP_010024490.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Eucalyptus grandis]
 gb|KCW60931.1| hypothetical protein EUGRSUZ_H03664 [Eucalyptus grandis]
Length=719

 Score =  1265 bits (3273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/719 (88%), Positives = 674/719 (94%), Gaps = 0/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  + P  ++R   SD Q+    SS +  GSDL +  Q   +Q+  +KR  GV ASL
Sbjct  1     MALCAFSFPAHINRATASDAQRNASLSSHFVGGSDLLVQSQHSLAQVQVRKRPGGVYASL  60

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EYYS+RPPTPLLDT+NYP+HMKNL++KEL QLA+ELRSDVIFNVSKTGGHLGSSLG
Sbjct  61    SESGEYYSKRPPTPLLDTVNYPLHMKNLAIKELKQLADELRSDVIFNVSKTGGHLGSSLG  120

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM TIRQTNGLAGFTKRSESEY
Sbjct  121   VVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMQTIRQTNGLAGFTKRSESEY  180

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  181   DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  240

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  241   VILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  300

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSIL+EVKSTKTTGPVLIHVV
Sbjct  301   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILKEVKSTKTTGPVLIHVV  360

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAEKAADKYHGV KFDPATGKQFK+S  TQSYTTYFAEALIAEAEADKDIVA
Sbjct  361   TEKGRGYPYAEKAADKYHGVVKFDPATGKQFKSSPATQSYTTYFAEALIAEAEADKDIVA  420

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSF+QRAYD
Sbjct  421   IHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGIKPFCAIYSSFLQRAYD  480

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAP+DEAELFHMV
Sbjct  481   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPADEAELFHMV  540

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNGVGV LPPGNKGTPLE+G+GRIL+EGERVAL+GYGT VQ C
Sbjct  541   ATAAAIDDRPSCFRYPRGNGVGVPLPPGNKGTPLEIGKGRILLEGERVALLGYGTVVQGC  600

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AAAL+ET G ++TVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHVAQF+A
Sbjct  601   LAAAALIETHGFKITVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVAQFLA  660

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG +KWRPLVLPDRYIDHG+PADQ+A+AGLTP+HIAATVFN++GK REALEIMT
Sbjct  661   LDGLLDGTVKWRPLVLPDRYIDHGSPADQIAQAGLTPAHIAATVFNVVGKTREALEIMT  719



>gb|ACF21004.1| 1-deoxy-D-xylulose 5-phosphate synthase [Salvia miltiorrhiza]
Length=714

 Score =  1264 bits (3271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/719 (87%), Positives = 672/719 (93%), Gaps = 5/719 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  A  G L   V +D QK   F SQW HG+DL  H   K SQI  +K S+G+ A+L
Sbjct  1     MALCPFAFSGSL---VAADAQKHTNFCSQWLHGADLPFHPFCKNSQI--RKSSTGICATL  55

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             +++ EY+SQ+PPTPLLDTINYPIHMKNLS KEL QLA+ELRSDVIFNVSKTGGHLGSSLG
Sbjct  56    SERGEYFSQKPPTPLLDTINYPIHMKNLSTKELQQLADELRSDVIFNVSKTGGHLGSSLG  115

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             V+ELTVALHYVFNAPQD+ILWDVGHQ+YPHKILTGRR++MP++RQT GL+GFTKRSES+Y
Sbjct  116   VIELTVALHYVFNAPQDRILWDVGHQAYPHKILTGRRDRMPSLRQTGGLSGFTKRSESDY  175

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFG GHSSTTISAGLGMAVGRDLKGRK+NV+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  176   DCFGAGHSSTTISAGLGMAVGRDLKGRKDNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  235

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTA LDGP  PVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  236   VILNDNKQVSLPTANLDGPTAPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  295

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARG+ISGSGSTLFEELGLYYIGPVDGHN+DDL +I +EVKSTKTTGPVLIHVV
Sbjct  296   AAKVDEYARGLISGSGSTLFEELGLYYIGPVDGHNLDDLTAIHREVKSTKTTGPVLIHVV  355

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAEKAADKYHGVTKFDPATGKQFK+SA TQ YTTYFAEALIAEAE DKDIVA
Sbjct  356   TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKSSAPTQPYTTYFAEALIAEAEVDKDIVA  415

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSF+QR YD
Sbjct  416   IHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGIKPFCAIYSSFLQRGYD  475

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELF+MV
Sbjct  476   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFNMV  535

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LPPGNKG PLE+G+GRIL+EGERVAL+GYG+AVQSC
Sbjct  536   ATAAAIDDRPSCFRYPRGNGIGVELPPGNKGKPLEIGKGRILIEGERVALLGYGSAVQSC  595

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AAAL+ETRGL++TVADARFC PLDHALIRSLAKSHEV+ITVEEGSIGGFGSHVA FMA
Sbjct  596   LAAAALVETRGLQLTVADARFCMPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVAHFMA  655

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDGNLKWRPLVLPDRYIDHGAP DQL EAGLTPSHIAATVFNILGKAREALEIM+
Sbjct  656   LDGLLDGNLKWRPLVLPDRYIDHGAPVDQLMEAGLTPSHIAATVFNILGKAREALEIMS  714



>ref|NP_001275130.1| 1-D-deoxyxylulose 5-phosphate synthase [Solanum tuberosum]
 gb|ADK73609.1| 1-D-deoxyxylulose 5-phosphate synthase [Solanum tuberosum]
Length=719

 Score =  1263 bits (3269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/720 (88%), Positives = 674/720 (94%), Gaps = 2/720 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRL-VGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MALC  A PG L+R  V SD  K  P  S+W HG+DL   FQ K +    KKRS  VQAS
Sbjct  1     MALCAYAFPGILNRTAVVSDSSKTAPLFSEWIHGTDLQFLFQHKLTH-EVKKRSRVVQAS  59

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L++  EYY+QRPPTP+LDT+NYPIHMKNLS+KEL QLA+ELRSD IFNVSKTGGHLGSSL
Sbjct  60    LSESGEYYTQRPPTPILDTVNYPIHMKNLSLKELKQLADELRSDTIFNVSKTGGHLGSSL  119

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM T+RQT+GLAGFTKRSESE
Sbjct  120   GVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMSTLRQTDGLAGFTKRSESE  179

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFGTGHSSTTISAGLGMAVGRDLKGR NNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  180   YDCFGTGHSSTTISAGLGMAVGRDLKGRNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  239

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDN+QVSLPTATLDGP+ PVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE
Sbjct  240   IVILNDNRQVSLPTATLDGPVAPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  299

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL++IL+EV+STKTTGPVLIHV
Sbjct  300   LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLIAILKEVRSTKTTGPVLIHV  359

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAE+AADKYHGV KFDPATGKQFKA+AKTQSYTTYFAEALIAEAEADKDIV
Sbjct  360   VTEKGRGYPYAERAADKYHGVAKFDPATGKQFKANAKTQSYTTYFAEALIAEAEADKDIV  419

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTG+NLF RRFP+RCFDVGIAEQ  VTFAAGLACEG+KPFCAIYSSFMQRAY
Sbjct  420   AIHAAMGGGTGMNLFHRRFPTRCFDVGIAEQRAVTFAAGLACEGIKPFCAIYSSFMQRAY  479

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAELFHM
Sbjct  480   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELFHM  539

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNG+GV LP GNKG PLEVG+GRIL+EGERVAL+GYG+AVQ+
Sbjct  540   VATAAAIDDRPSCFRYPRGNGIGVELPAGNKGIPLEVGKGRILIEGERVALLGYGSAVQN  599

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL AA +LE+RG++VTVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHV QFM
Sbjct  600   CLDAAIVLESRGIQVTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVVQFM  659

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDG LKWRP+VLPDRYIDHG+P DQLAEAGLTPSHIAATVFNILG+ REALE+MT
Sbjct  660   ALDGLLDGKLKWRPIVLPDRYIDHGSPVDQLAEAGLTPSHIAATVFNILGQTREALEVMT  719



>gb|AEM42997.1| 1-deoxyxylulose-5-phosphate synthase [Siraitia grosvenorii]
Length=719

 Score =  1261 bits (3264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/719 (86%), Positives = 668/719 (93%), Gaps = 0/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALCT   P  +SR+   + +     SS++  G+DL   FQ+K +Q    KR  G+ ASL
Sbjct  1     MALCTLTFPAHVSRVAAKEHEGSSAVSSRFLWGTDLLFRFQKKLNQRQVSKRPGGIYASL  60

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY SQRPPTPLLDTINYPIHMKNLS+KEL QLA+E+RSDVIFNVSKTGGHLGSSLG
Sbjct  61    SETGEYPSQRPPTPLLDTINYPIHMKNLSIKELYQLADEVRSDVIFNVSKTGGHLGSSLG  120

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM TIRQTNGL+GFTKRSESE+
Sbjct  121   VVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMSTIRQTNGLSGFTKRSESEF  180

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFG GHSSTTISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  181   DCFGAGHSSTTISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  240

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGP+PPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  241   VILNDNKQVSLPTATLDGPVPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  300

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLVSIL+EVKST TTGPVLIHVV
Sbjct  301   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNMDDLVSILKEVKSTNTTGPVLIHVV  360

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGVTKFDPATGKQ K+   TQSYTTYFAEAL+AEAE DKDI+A
Sbjct  361   TEKGRGYPYAERAADKYHGVTKFDPATGKQQKSKGATQSYTTYFAEALVAEAEVDKDIIA  420

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSFMQRAYD
Sbjct  421   IHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLASEGLKPFCAIYSSFMQRAYD  480

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMAPSDEA LF+MV
Sbjct  481   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMAPSDEAGLFNMV  540

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LPPGNKG P+EVG+GRIL+EGERVAL+GYGTAVQ+C
Sbjct  541   ATAAAIDDRPSCFRYPRGNGIGVELPPGNKGVPVEVGKGRILLEGERVALLGYGTAVQNC  600

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA+L+E  GLR+TVAD RFCKPLD ALIRSLAKSHE++ITVEEGSIGGFGSHV QF+A
Sbjct  601   LTAASLVERHGLRITVADGRFCKPLDRALIRSLAKSHEILITVEEGSIGGFGSHVIQFLA  660

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDGNL+WRPLVLPDRYIDHG+PADQLAEAGLTPSHIAATVFN+LG+ REALEIM+
Sbjct  661   LDGLLDGNLRWRPLVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNMLGQTREALEIMS  719



>ref|XP_008458506.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Cucumis melo]
Length=718

 Score =  1261 bits (3263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/724 (87%), Positives = 673/724 (93%), Gaps = 11/724 (2%)
 Frame = -2

Query  2476  MALCTCALPGDLSRL-----VGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSG  2312
             MALC    P  +SR+      GS +      SS++  G+DL   FQ++ +Q+  KKR  G
Sbjct  1     MALCMLTFPAHVSRVGLKEHDGSSVA----VSSRFLWGTDLVFRFQKRVNQV--KKRPGG  54

Query  2311  VQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHL  2132
             + ASL++  EY SQRPPTPLLDTINYPIHMKNLSVKEL QLA+E+RSDVIFNVSKTGGHL
Sbjct  55    ICASLSETGEYPSQRPPTPLLDTINYPIHMKNLSVKELYQLADEVRSDVIFNVSKTGGHL  114

Query  2131  GSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKR  1952
             GSSLGVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM TIRQTNGL+GFTKR
Sbjct  115   GSSLGVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMSTIRQTNGLSGFTKR  174

Query  1951  SESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYL  1772
             SESE+DCFG GHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYL
Sbjct  175   SESEFDCFGAGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYL  234

Query  1771  DSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG  1592
             DSDMIVILNDNKQVSLPTATLDGP+PPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG
Sbjct  235   DSDMIVILNDNKQVSLPTATLDGPVPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG  294

Query  1591  PMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPV  1412
             PMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLVSIL+EVKSTKTTGPV
Sbjct  295   PMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNVDDLVSILKEVKSTKTTGPV  354

Query  1411  LIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEAD  1232
             LIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQ K+ A TQSYTTYFAEALIAEAE D
Sbjct  355   LIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQQKSKAPTQSYTTYFAEALIAEAERD  414

Query  1231  KDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFM  1052
             KDI+AIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFM
Sbjct  415   KDIIAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFM  474

Query  1051  QRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAE  872
             QRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMAPSDEAE
Sbjct  475   QRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMAPSDEAE  534

Query  871   LFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGT  692
             LF+MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG P+EVG+GRIL+EGERVAL+GYGT
Sbjct  535   LFNMVATAAAIDDRPSCFRYPRGNGIGVELPPGNKGIPIEVGKGRILLEGERVALLGYGT  594

Query  691   AVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHV  512
             AVQ+CL+AA+++E  GLR+TVAD RFCKPLD ALIRSLAKSHE++ITVEEGSIGGFGSHV
Sbjct  595   AVQNCLAAASMVERHGLRITVADGRFCKPLDRALIRSLAKSHEILITVEEGSIGGFGSHV  654

Query  511   AQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
              QF+ALDGLLDG LKWRPLVLPDRYIDHG+PADQLAEAGLTPSHIAATVFN+LG+ REAL
Sbjct  655   IQFLALDGLLDGTLKWRPLVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNMLGQTREAL  714

Query  331   EIMT  320
             EIMT
Sbjct  715   EIMT  718



>gb|AGQ04153.1| deoxyxylulose synthase [Lavandula angustifolia]
Length=718

 Score =  1259 bits (3258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/720 (87%), Positives = 669/720 (93%), Gaps = 3/720 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSR-LVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MALC  A  G+LS+ LV +D QK   F SQW HG+DL LH   K +QI  +K SS + A+
Sbjct  1     MALCPFAFSGNLSKGLVAADAQKHTNFCSQWLHGADLPLHHFCKNNQI--RKSSSAICAT  58

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L +  EY+SQRPPTPLLDTINYPIHMKNLS KEL QLA+ELRSDVIFNVSKTGGHLGSSL
Sbjct  59    LTESGEYFSQRPPTPLLDTINYPIHMKNLSTKELKQLADELRSDVIFNVSKTGGHLGSSL  118

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GV+ELTVALHYVFNAPQD+ILWDVGHQ+YPHKILTGRRE MP++RQT G++GFTKRSES+
Sbjct  119   GVIELTVALHYVFNAPQDRILWDVGHQAYPHKILTGRREMMPSLRQTGGISGFTKRSESD  178

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFG GHSSTTISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  179   YDCFGAGHSSTTISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  238

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTA LDGP  PVGALSSALSRLQSNRPLRELREVAKGV KQIGGPMHE
Sbjct  239   IVILNDNKQVSLPTANLDGPTSPVGALSSALSRLQSNRPLRELREVAKGVAKQIGGPMHE  298

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARG+ISGSGSTLFEELGLYYIGPVDGHNIDDL +IL+EVKSTKTTGPVLIHV
Sbjct  299   LAAKVDEYARGLISGSGSTLFEELGLYYIGPVDGHNIDDLTAILREVKSTKTTGPVLIHV  358

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFK+SA TQSYTTYFAEALIAEAE D D+V
Sbjct  359   VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKSSAPTQSYTTYFAEALIAEAEVDNDVV  418

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSF+QR Y
Sbjct  419   AIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGIKPFCAIYSSFLQRGY  478

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPV+FA+DRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM
Sbjct  479   DQVVHDVDLQKLPVKFAIDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  538

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNG+GV LPPGNKG PLE+G+GRIL+EGERVAL+GYG+AVQS
Sbjct  539   VATAAAIDDRPSCFRYPRGNGIGVDLPPGNKGKPLEIGKGRILIEGERVALLGYGSAVQS  598

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+AAAL+E+ GLR+TVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHVA FM
Sbjct  599   CLAAAALVESNGLRLTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVAHFM  658

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDG LKWRPLVLPD+YIDHGAPADQ  EAGL+ SHIAATVFNILG AR+AL IM+
Sbjct  659   ALDGLLDGKLKWRPLVLPDKYIDHGAPADQTMEAGLSSSHIAATVFNILGNARDALLIMS  718



>ref|XP_004144970.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004153837.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004163093.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic-like [Cucumis sativus]
 gb|KGN46181.1| hypothetical protein Csa_6G067390 [Cucumis sativus]
Length=718

 Score =  1257 bits (3252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/724 (87%), Positives = 672/724 (93%), Gaps = 11/724 (2%)
 Frame = -2

Query  2476  MALCTCALPGDLSRL-----VGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSG  2312
             MALC    P  +SR+      GS +      SS++  G+DL   FQ++ +Q+  KKR  G
Sbjct  1     MALCMLTFPAHVSRVGLKEHDGSSVA----VSSRFLWGTDLVFRFQKRVNQV--KKRPGG  54

Query  2311  VQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHL  2132
             + ASL++  EY SQRPPTPLLDTINYPIHMKNLSVKEL QLA+E+RSDVIFNVSKTGGHL
Sbjct  55    ICASLSETGEYPSQRPPTPLLDTINYPIHMKNLSVKELYQLADEVRSDVIFNVSKTGGHL  114

Query  2131  GSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKR  1952
             GSSLGVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM TIRQTNGL+GFTKR
Sbjct  115   GSSLGVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMSTIRQTNGLSGFTKR  174

Query  1951  SESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYL  1772
             SESE+D FG GHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYL
Sbjct  175   SESEFDSFGAGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYL  234

Query  1771  DSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG  1592
             DSDMIVILNDNKQVSLPTATLDGP+PPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG
Sbjct  235   DSDMIVILNDNKQVSLPTATLDGPVPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG  294

Query  1591  PMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPV  1412
             PMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLVSIL+EVKSTKTTGPV
Sbjct  295   PMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNVDDLVSILKEVKSTKTTGPV  354

Query  1411  LIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEAD  1232
             LIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQ KA A TQSYTTYFAEALIAEAE D
Sbjct  355   LIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQQKAKAPTQSYTTYFAEALIAEAERD  414

Query  1231  KDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFM  1052
             KDI+AIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFM
Sbjct  415   KDIIAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFM  474

Query  1051  QRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAE  872
             QRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMAPSDE E
Sbjct  475   QRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMAPSDETE  534

Query  871   LFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGT  692
             LF+MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG P+EVG+GRIL+EGERVAL+GYGT
Sbjct  535   LFNMVATAAAIDDRPSCFRYPRGNGIGVELPPGNKGIPIEVGKGRILLEGERVALLGYGT  594

Query  691   AVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHV  512
             AVQ+CL+AA+++E  GLR+TVAD RFCKPLD ALIRSLAKSHE++ITVEEGSIGGFGSHV
Sbjct  595   AVQNCLAAASMVERHGLRITVADGRFCKPLDRALIRSLAKSHEILITVEEGSIGGFGSHV  654

Query  511   AQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
              QF+ALDGLLDG+LKWRPLVLPDRYIDHG+PADQLAEAGLTPSHIAATVFN+LG+ REAL
Sbjct  655   IQFLALDGLLDGSLKWRPLVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNMLGQTREAL  714

Query  331   EIMT  320
             EIMT
Sbjct  715   EIMT  718



>ref|XP_007035432.1| Deoxyxylulose-5-phosphate synthase isoform 1 [Theobroma cacao]
 gb|EOY06358.1| Deoxyxylulose-5-phosphate synthase isoform 1 [Theobroma cacao]
Length=722

 Score =  1255 bits (3247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/721 (87%), Positives = 671/721 (93%), Gaps = 0/721 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  + P  ++R   SD QK   F+S    G+DL      K +Q+  +KR  GV ASL
Sbjct  1     MALCAFSFPAHINRAAASDPQKSTSFASHLLGGTDLLFQPLHKLNQVQVRKRPGGVCASL  60

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             +++ EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDVIFNVSKTGGHLGSSLG
Sbjct  61    SERAEYHSQRPPTPLLDTINYPIHMKNLSVKELKQLADELRSDVIFNVSKTGGHLGSSLG  120

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAP+DKILWDVGHQSYPHKILTGRR+KM T+RQTNGLAGFTKRSESEY
Sbjct  121   VVELTVALHYVFNAPKDKILWDVGHQSYPHKILTGRRDKMYTMRQTNGLAGFTKRSESEY  180

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKG +NNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  181   DCFGTGHSSTTISAGLGMAVGRDLKGERNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  240

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  241   VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  300

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSIL+EVKSTKTTGPVLIHVV
Sbjct  301   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILKEVKSTKTTGPVLIHVV  360

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFD ATGKQFK S+ TQSYTTYFAEALIAEAEADK+IVA
Sbjct  361   TEKGRGYPYAERAADKYHGVVKFDLATGKQFKGSSATQSYTTYFAEALIAEAEADKNIVA  420

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLF RRFP RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  421   IHAAMGGGTGLNLFLRRFPERCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  480

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV
Sbjct  481   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  540

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV +PPGNKG PLE+G+GR+L+EGERVAL+GYG+AVQSC
Sbjct  541   ATAAAIDDRPSCFRYPRGNGLGVQVPPGNKGVPLEIGKGRVLIEGERVALLGYGSAVQSC  600

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L AA+LL + GLR+TVADARFCKPLDH LIR LAKSHEV+ITVEEGSIGGFGSHVAQF+A
Sbjct  601   LGAASLLASHGLRLTVADARFCKPLDHTLIRKLAKSHEVLITVEEGSIGGFGSHVAQFLA  660

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT*  317
             LDGLLDG +KWRPLVLPDRYIDHG+PADQLAEAGLTPSHIAATVFN+LG+ REALEIM+ 
Sbjct  661   LDGLLDGTVKWRPLVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNVLGQKREALEIMSS  720

Query  316   R  314
             R
Sbjct  721   R  721



>gb|AHL17583.1| 1-deoxy-D-xylulose 5-phosphate synthase [Jatropha curcas]
 gb|KDP40044.1| hypothetical protein JCGZ_02042 [Jatropha curcas]
Length=720

 Score =  1253 bits (3243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/722 (87%), Positives = 664/722 (92%), Gaps = 6/722 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINY---KKRSSGVQ  2306
             MAL   ++P   +R   SDLQK       +   +DL     Q P +IN    KK+S GV 
Sbjct  1     MALSAFSVPAHANRAACSDLQKYSYVYPHFLWRTDL---LGQSPHRINQAKGKKKSGGVS  57

Query  2305  ASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGS  2126
             ASL+++ EY+SQRP TPLLDTINYPIHMKNLS+KEL QLA+ELRSDVIFNVS+TGGHLGS
Sbjct  58    ASLSERGEYHSQRPATPLLDTINYPIHMKNLSIKELKQLADELRSDVIFNVSRTGGHLGS  117

Query  2125  SLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSE  1946
             SLGVVELTVALHYVFN PQDKILWDVGHQSYPHKILTGRR+KM T+RQTNGL+GFTKRSE
Sbjct  118   SLGVVELTVALHYVFNTPQDKILWDVGHQSYPHKILTGRRDKMHTMRQTNGLSGFTKRSE  177

Query  1945  SEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDS  1766
             SEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDS
Sbjct  178   SEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDS  237

Query  1765  DMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM  1586
             DMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM
Sbjct  238   DMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM  297

Query  1585  HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLI  1406
             HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLV IL+EVKSTKT GPVLI
Sbjct  298   HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVDILKEVKSTKTIGPVLI  357

Query  1405  HVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKD  1226
             HVVTEKGRGYPYAEKAADKYHGV KFDPATGKQFK+S  TQSYTTYFAEALIAEAE DKD
Sbjct  358   HVVTEKGRGYPYAEKAADKYHGVAKFDPATGKQFKSSGATQSYTTYFAEALIAEAEVDKD  417

Query  1225  IVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQR  1046
             IVAIHAAMGGGTGLNLF RRFPSRCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQR
Sbjct  418   IVAIHAAMGGGTGLNLFLRRFPSRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQR  477

Query  1045  AYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELF  866
             AYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELF
Sbjct  478   AYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELF  537

Query  865   HMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAV  686
             +MVATAAAIDDRPSC RYPRGNGVGV LPPGNKG PLEVG+GRIL+EGERVAL+GYGTAV
Sbjct  538   NMVATAAAIDDRPSCFRYPRGNGVGVQLPPGNKGIPLEVGKGRILIEGERVALLGYGTAV  597

Query  685   QSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQ  506
             QSCL+AA+LLE  GLR+TVADARFCKPLD ALIRSLA SHEV+ITVEEGSIGGFGSHVA 
Sbjct  598   QSCLAAASLLEPHGLRLTVADARFCKPLDQALIRSLANSHEVLITVEEGSIGGFGSHVAH  657

Query  505   FMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             F+AL+GLLDG LKWRPLVLPDRY+DHG+PADQL EAGLTPSHIAATV NILG  REAL+I
Sbjct  658   FLALNGLLDGKLKWRPLVLPDRYVDHGSPADQLIEAGLTPSHIAATVLNILGNKREALQI  717

Query  325   MT  320
             M+
Sbjct  718   MS  719



>gb|AAS94123.1| putative 1-deoxy-D-xylulose 5-phosphate synthase [Hevea brasiliensis]
Length=720

 Score =  1253 bits (3242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/719 (87%), Positives = 662/719 (92%), Gaps = 0/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL  C+ P  ++R   SDLQK    SS +    +       + +Q   K+R   V ASL
Sbjct  1     MALSACSFPAHVNRNTISDLQKYSYVSSHFLSRKNPLAQSLHRLNQAKSKRRPERVCASL  60

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++++EY+SQRPPTPLLDTINYPIHMKNLS+KEL QLA+ELRSDVIFNVS TGGHLGSSLG
Sbjct  61    SEREEYHSQRPPTPLLDTINYPIHMKNLSIKELKQLADELRSDVIFNVSGTGGHLGSSLG  120

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRR+KM TIRQTNGL+GFTKRSESEY
Sbjct  121   VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRRDKMHTIRQTNGLSGFTKRSESEY  180

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  181   DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  240

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTK+IGG MHEL
Sbjct  241   VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKRIGGSMHEL  300

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL++IL+EVK TKTTGPVLIHVV
Sbjct  301   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLIAILKEVKGTKTTGPVLIHVV  360

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAEKAADKYHGVTKFDPATGKQFK SA TQSYTTYFAEALIAEAE DKDIVA
Sbjct  361   TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKGSAITQSYTTYFAEALIAEAEVDKDIVA  420

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  421   IHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  480

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV
Sbjct  481   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  540

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNGVGV LPPGNKG PLEVG+GRIL+EGERVAL+GYGTAVQSC
Sbjct  541   ATAAAIDDRPSCFRYPRGNGVGVQLPPGNKGIPLEVGKGRILIEGERVALLGYGTAVQSC  600

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA+L+E  GL +TVADARFCKPLDH LIRSLAK HEV+ITVEEGSIGGFGSHVA F+A
Sbjct  601   LAAASLVEPHGLLITVADARFCKPLDHTLIRSLAKPHEVLITVEEGSIGGFGSHVAHFLA  660

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG LKWRPLVLPDRYIDHG+P+ QL EAGLTPSH+AATV NILG  REAL+IM+
Sbjct  661   LDGLLDGKLKWRPLVLPDRYIDHGSPSVQLIEAGLTPSHVAATVLNILGNKREALQIMS  719



>dbj|BAF98288.1| 1-deoxy-D-xylulose 5-phosphate synthase [Hevea brasiliensis]
Length=720

 Score =  1252 bits (3239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/719 (87%), Positives = 663/719 (92%), Gaps = 0/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL  C+ P  + +   SDLQK     S+    +DL      + +Q   KK   G+ ASL
Sbjct  1     MALSACSFPAHVDKATISDLQKYGYVPSRSLWRTDLLAQSLGRLNQAKSKKGPGGICASL  60

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             +++ EY+SQRPPTPLLDT NYPIHMKNLS+KEL QLA+ELRSDVIFNVS+TGGHLGSSLG
Sbjct  61    SERGEYHSQRPPTPLLDTTNYPIHMKNLSIKELKQLADELRSDVIFNVSRTGGHLGSSLG  120

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVF+AP+DKILWDVGHQSYPHKILTGRREKM TIRQTNGL+GFTKRSESEY
Sbjct  121   VVELTVALHYVFSAPRDKILWDVGHQSYPHKILTGRREKMYTIRQTNGLSGFTKRSESEY  180

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKG+KNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  181   DCFGTGHSSTTISAGLGMAVGRDLKGKKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  240

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE 
Sbjct  241   VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEW  300

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL++IL+EVKSTKTTGPVLIHVV
Sbjct  301   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLIAILKEVKSTKTTGPVLIHVV  360

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAEKAADKYHGVTKFDPATGKQFK SA TQSYTTYFAEALIAEAE DKDIVA
Sbjct  361   TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKGSAITQSYTTYFAEALIAEAEVDKDIVA  420

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  421   IHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  480

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV
Sbjct  481   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  540

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNGVGV LPPGNKG PLEVG+GRIL+EGERVAL+GYGTAVQSC
Sbjct  541   ATAAAIDDRPSCFRYPRGNGVGVQLPPGNKGIPLEVGKGRILIEGERVALLGYGTAVQSC  600

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA+L+E  GL +TVADARFCKPLDH LIRSLAKSHEV+ITVEEGSIGGFGSHVA F+A
Sbjct  601   LAAASLVEPHGLLITVADARFCKPLDHTLIRSLAKSHEVLITVEEGSIGGFGSHVAHFLA  660

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG LKWRPLVLPDRYIDHG+P+ QL EAGLTPSH+AATV NILG  REAL+IM+
Sbjct  661   LDGLLDGKLKWRPLVLPDRYIDHGSPSVQLIEAGLTPSHVAATVLNILGNKREALQIMS  719



>ref|XP_007035433.1| Deoxyxylulose-5-phosphate synthase isoform 2 [Theobroma cacao]
 gb|EOY06359.1| Deoxyxylulose-5-phosphate synthase isoform 2 [Theobroma cacao]
Length=720

 Score =  1250 bits (3235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/721 (87%), Positives = 671/721 (93%), Gaps = 2/721 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  + P  ++R   SD QK   F+S    G+DL      K +Q+  +KR  GV ASL
Sbjct  1     MALCAFSFPAHINRAAASDPQKSTSFASHLLGGTDLLFQPLHKLNQV--RKRPGGVCASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             +++ EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDVIFNVSKTGGHLGSSLG
Sbjct  59    SERAEYHSQRPPTPLLDTINYPIHMKNLSVKELKQLADELRSDVIFNVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAP+DKILWDVGHQSYPHKILTGRR+KM T+RQTNGLAGFTKRSESEY
Sbjct  119   VVELTVALHYVFNAPKDKILWDVGHQSYPHKILTGRRDKMYTMRQTNGLAGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKG +NNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGTGHSSTTISAGLGMAVGRDLKGERNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  239   VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSIL+EVKSTKTTGPVLIHVV
Sbjct  299   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILKEVKSTKTTGPVLIHVV  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFD ATGKQFK S+ TQSYTTYFAEALIAEAEADK+IVA
Sbjct  359   TEKGRGYPYAERAADKYHGVVKFDLATGKQFKGSSATQSYTTYFAEALIAEAEADKNIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLF RRFP RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  419   IHAAMGGGTGLNLFLRRFPERCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV
Sbjct  479   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV +PPGNKG PLE+G+GR+L+EGERVAL+GYG+AVQSC
Sbjct  539   ATAAAIDDRPSCFRYPRGNGLGVQVPPGNKGVPLEIGKGRVLIEGERVALLGYGSAVQSC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L AA+LL + GLR+TVADARFCKPLDH LIR LAKSHEV+ITVEEGSIGGFGSHVAQF+A
Sbjct  599   LGAASLLASHGLRLTVADARFCKPLDHTLIRKLAKSHEVLITVEEGSIGGFGSHVAQFLA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT*  317
             LDGLLDG +KWRPLVLPDRYIDHG+PADQLAEAGLTPSHIAATVFN+LG+ REALEIM+ 
Sbjct  659   LDGLLDGTVKWRPLVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNVLGQKREALEIMSS  718

Query  316   R  314
             R
Sbjct  719   R  719



>gb|ACD70396.1| putative chloroplast 1-deoxy-D-xylulose 5-phosphate synthase 
[Populus trichocarpa]
Length=685

 Score =  1246 bits (3224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 614/677 (91%), Positives = 650/677 (96%), Gaps = 0/677 (0%)
 Frame = -2

Query  2350  KPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRS  2171
             K +QI+ KKR++G+ ASL+++ EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRS
Sbjct  8     KINQIHVKKRANGICASLSERGEYHSQRPPTPLLDTINYPIHMKNLSVKELKQLADELRS  67

Query  2170  DVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPT  1991
             DVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRR+KM T
Sbjct  68    DVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRRDKMHT  127

Query  1990  IRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTA  1811
             IRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKG  N V+AVIGDGAMTA
Sbjct  128   IRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGGTNKVVAVIGDGAMTA  187

Query  1810  GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLREL  1631
             GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSNRPLREL
Sbjct  188   GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNRPLREL  247

Query  1630  REVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSI  1451
             REVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL++I
Sbjct  248   REVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLIAI  307

Query  1450  LQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTT  1271
             L+EVKSTKTTGPVLIHVVTEKGRGYP+AE+AADKYHGV KFDPATGKQFKAS  TQSYTT
Sbjct  308   LKEVKSTKTTGPVLIHVVTEKGRGYPFAERAADKYHGVAKFDPATGKQFKASPSTQSYTT  367

Query  1270  YFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACE  1091
             YFAEAL AEAE DKDIVAIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACE
Sbjct  368   YFAEALTAEAEVDKDIVAIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACE  427

Query  1090  GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACL  911
             GLKPFCAIYSSF+QRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACL
Sbjct  428   GLKPFCAIYSSFLQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACL  487

Query  910   PNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRIL  731
             PNMVVMAPSDEAELFHMVATA AIDDRPSC RYPRGNGVGV LPPGNKG PLEVG+GR+L
Sbjct  488   PNMVVMAPSDEAELFHMVATATAIDDRPSCFRYPRGNGVGVQLPPGNKGVPLEVGKGRML  547

Query  730   MEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMIT  551
             +EGERVAL+GYGTAVQSCL+AA+LLE  G+R+TVADARFCKPLDHALIRSLAKSHE++IT
Sbjct  548   IEGERVALLGYGTAVQSCLAAASLLERHGIRLTVADARFCKPLDHALIRSLAKSHEILIT  607

Query  550   VEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAA  371
             VEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDHG+PADQL EAGLTPSHIAA
Sbjct  608   VEEGSIGGFGSHVVQFLALDGLLDGKLKWRPVVLPDRYIDHGSPADQLVEAGLTPSHIAA  667

Query  370   TVFNILGKAREALEIMT  320
             TVF+ILG+ REALEIM+
Sbjct  668   TVFSILGQRREALEIMS  684



>gb|AIW04571.1| 1-deoxy-D-xylulose 5-phosphate synthase [Gossypium hirsutum]
Length=720

 Score =  1242 bits (3213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/721 (87%), Positives = 668/721 (93%), Gaps = 2/721 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  + P  ++    SD QK  PF+S +  GSDL L   +K +Q+  KKR  GV ASL
Sbjct  1     MALCASSFPAIINWGAASDPQKSTPFASHFLGGSDLVLQPLKKLNQV--KKRPGGVYASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY+SQRP TPLLDTINYPIHMKNLSVKEL QL+ ELRSDVIFNVSKTGGHLGSSLG
Sbjct  59    SEGAEYHSQRPATPLLDTINYPIHMKNLSVKELKQLSEELRSDVIFNVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAP+DKILWDVGHQSYPHKILTGRR KM T+RQTNGLAGFTKRSESEY
Sbjct  119   VVELTVALHYVFNAPRDKILWDVGHQSYPHKILTGRRHKMHTMRQTNGLAGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKG +N+V+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGTGHSSTTISAGLGMAVGRDLKGERNHVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTA LDGP PPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  239   VILNDNKQVSLPTANLDGPTPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSIL+EVK+TKTTGPVLIHVV
Sbjct  299   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILKEVKTTKTTGPVLIHVV  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDPATGKQFK ++ TQSYTTYFAEALIAEAEADK+IVA
Sbjct  359   TEKGRGYPYAERAADKYHGVVKFDPATGKQFKGNSATQSYTTYFAEALIAEAEADKNIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLF RRFP RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  419   IHAAMGGGTGLNLFLRRFPQRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV
Sbjct  479   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LPPG KG PLEVG+GR+L+EGERVAL+GYG+AVQSC
Sbjct  539   ATAAAIDDRPSCFRYPRGNGIGVQLPPGKKGVPLEVGKGRVLIEGERVALLGYGSAVQSC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA+LLE+ GLR+TVADARFCKPLDHALIR LAKSHEV+ITVEEGSIGGFGSHVAQF+A
Sbjct  599   LAAASLLESHGLRLTVADARFCKPLDHALIRKLAKSHEVLITVEEGSIGGFGSHVAQFLA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT*  317
             LDGLLDG +KWRPLVLPDRYIDHG+P DQLAEAGLTPSHIAATVFN+L + REA E+M+ 
Sbjct  659   LDGLLDGKVKWRPLVLPDRYIDHGSPVDQLAEAGLTPSHIAATVFNVLEQKREAFEVMSS  718

Query  316   R  314
             R
Sbjct  719   R  719



>gb|ABN13970.1| 1-deoxy-D-xylulose 5-phosphate synthase [Gossypium barbadense]
Length=720

 Score =  1238 bits (3204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/721 (87%), Positives = 668/721 (93%), Gaps = 2/721 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  + P  ++    SD QK  PF+S +  GSDL L   +K +Q+  KKR  G  ASL
Sbjct  1     MALCASSFPAIINWGAASDPQKSTPFASHFLGGSDLVLQPLKKLNQV--KKRPGGAYASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY+SQRP TPLLDTINY IHMKNLSVKEL QL+ ELRSDV+FNVSKTGGHLGSSLG
Sbjct  59    SEGAEYHSQRPATPLLDTINYLIHMKNLSVKELKQLSEELRSDVVFNVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAP+DKILWDVGHQSYPHKILTGRR KM T+RQTNGLAGFTKRSESEY
Sbjct  119   VVELTVALHYVFNAPRDKILWDVGHQSYPHKILTGRRHKMHTMRQTNGLAGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKG +N+V+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGTGHSSTTISAGLGMAVGRDLKGERNHVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  239   VILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSIL+EVK+TKTTGPVLIHVV
Sbjct  299   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILKEVKTTKTTGPVLIHVV  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDPATGKQFK ++ TQSYTTYFAEALIAEAEADK+IVA
Sbjct  359   TEKGRGYPYAERAADKYHGVVKFDPATGKQFKGNSATQSYTTYFAEALIAEAEADKNIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLF RRFP RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  419   IHAAMGGGTGLNLFLRRFPQRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV
Sbjct  479   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LPPG KG PLEVG+GR+L+EGERVAL+GYG+AVQSC
Sbjct  539   ATAAAIDDRPSCFRYPRGNGIGVQLPPGKKGVPLEVGKGRVLIEGERVALLGYGSAVQSC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA+LLE+ GLR+TVADARFCKPLDHALIR LAKSHEV+ITVEEGSIGGFGSHVAQF+A
Sbjct  599   LAAASLLESHGLRLTVADARFCKPLDHALIRKLAKSHEVLITVEEGSIGGFGSHVAQFLA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT*  317
             LDGLLDG +KWRPLVLPDRYIDHG+P DQLAEAGLTPSHIAATVFN+L + REALE+M+ 
Sbjct  659   LDGLLDGKVKWRPLVLPDRYIDHGSPVDQLAEAGLTPSHIAATVFNVLEQKREALEVMSS  718

Query  316   R  314
             R
Sbjct  719   R  719



>ref|XP_010279602.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Nelumbo nucifera]
Length=718

 Score =  1238 bits (3203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/720 (86%), Positives = 672/720 (93%), Gaps = 3/720 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGS-DLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MAL + + P  L R V S D  KP   SS  F G+DL   FQQ+   I  ++RS GV AS
Sbjct  1     MALSSFSFPCHLPREVASSDSLKPSLLSSHPFRGADLPHQFQQR--HIQVRRRSGGVSAS  58

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L+++ EYYSQRPPTPLLDTINYPIHMKNLS+KEL QL++ELRSD+IFNVSKTGGHLGSSL
Sbjct  59    LSERAEYYSQRPPTPLLDTINYPIHMKNLSIKELKQLSDELRSDIIFNVSKTGGHLGSSL  118

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHYVFN PQDKILWDVGHQSYPHKILTGRR+KMPT+RQTNGL+GFTKRSES+
Sbjct  119   GVVELTVALHYVFNCPQDKILWDVGHQSYPHKILTGRRDKMPTLRQTNGLSGFTKRSESD  178

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFGTGHSST+ISA LGMAVGRDLKGRKN+V+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  179   YDCFGTGHSSTSISAALGMAVGRDLKGRKNHVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  238

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTATLDGPIPPVGALSSALS+LQS+RPLRELREVAKGVTKQIGGPMHE
Sbjct  239   IVILNDNKQVSLPTATLDGPIPPVGALSSALSKLQSSRPLRELREVAKGVTKQIGGPMHE  298

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSIL+EVKST TTGPVLIHV
Sbjct  299   LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILKEVKSTHTTGPVLIHV  358

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAE+AADKYHGVTKFDPATGKQFK+S  TQSYTTYFAEAL AEAEADKDIV
Sbjct  359   VTEKGRGYPYAERAADKYHGVTKFDPATGKQFKSSVPTQSYTTYFAEALTAEAEADKDIV  418

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGL CEGLKPFCAIYSSF+QRAY
Sbjct  419   AIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLTCEGLKPFCAIYSSFLQRAY  478

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQV+HDVDLQKLPVRFA+DRAGLVG+DGPTH G+FDVT+MACLPNMVVMAPSDEAELFHM
Sbjct  479   DQVIHDVDLQKLPVRFALDRAGLVGADGPTHSGSFDVTYMACLPNMVVMAPSDEAELFHM  538

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAI+DRPSC RYPRGNG+GV LPPGNKG PLEVG+GRIL+EGERVAL+GYGTAVQ 
Sbjct  539   VATAAAINDRPSCFRYPRGNGIGVQLPPGNKGIPLEVGKGRILIEGERVALLGYGTAVQG  598

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+A +L+E  GLR+TVADARFCKPLD +LIRSLAKSH+V+ITVEEGSIGGFGSHVAQF+
Sbjct  599   CLAAVSLVERHGLRLTVADARFCKPLDRSLIRSLAKSHDVLITVEEGSIGGFGSHVAQFL  658

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDG +KWRPLVLPDRYIDHG+PADQ+AEAG+TPSHIAATVFNILG+ REALEIM+
Sbjct  659   ALDGLLDGTVKWRPLVLPDRYIDHGSPADQMAEAGMTPSHIAATVFNILGQKREALEIMS  718



>ref|XP_010908815.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Elaeis guineensis]
Length=717

 Score =  1237 bits (3201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/719 (86%), Positives = 661/719 (92%), Gaps = 2/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL T   P        SD QK  P SS    G+DL  H Q   + +  +KR+  + ASL
Sbjct  1     MALSTFFFPSHFLGTKASDPQKSSPLSSHRLGGADLQSH-QHHNTLLKPRKRTC-ICASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY+SQ+PPTPLLDTINYPIHMKNLSVKEL QLA+ELRSD+IFNVSKTGGHLGS LG
Sbjct  59    SEHGEYHSQKPPTPLLDTINYPIHMKNLSVKELKQLADELRSDIIFNVSKTGGHLGSGLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VV+LTVA+HYVFNAP+DKILWDVGHQSYPHKILTGRR+KMPT+RQTNGL+GFTKRSESEY
Sbjct  119   VVDLTVAIHYVFNAPEDKILWDVGHQSYPHKILTGRRDKMPTLRQTNGLSGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             D FG GHSST+ISA LGMAVGRDLKGR NNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DSFGAGHSSTSISAALGMAVGRDLKGRNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTA LDGPIPPVGALSSALSRLQS+RPLRELREVAKGVTKQIGG MH+L
Sbjct  239   VILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSSRPLRELREVAKGVTKQIGGSMHKL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMI GSGST FEELGLYYIGPVDGHN+DDLV+IL+EVKSTK TGPVLIHVV
Sbjct  299   AAKVDEYARGMIGGSGSTFFEELGLYYIGPVDGHNMDDLVTILKEVKSTKATGPVLIHVV  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGVTKFDPATGKQ KASAKTQSYT YFAEALIAEAE DKDIVA
Sbjct  359   TEKGRGYPYAERAADKYHGVTKFDPATGKQLKASAKTQSYTNYFAEALIAEAEVDKDIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLN F RRFP+RCFDVGIAEQH VTFAAGL CEGLKPFCAIYSSF+QRAYD
Sbjct  419   IHAAMGGGTGLNYFLRRFPTRCFDVGIAEQHAVTFAAGLVCEGLKPFCAIYSSFLQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QV+HDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVT+MACLPNMVVMAPSDEAELFHMV
Sbjct  479   QVIHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTYMACLPNMVVMAPSDEAELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNGVGV LPPGNKG PLEVG+GRIL+EGERVAL+GYGTAVQSC
Sbjct  539   ATAAAIDDRPSCFRYPRGNGVGVPLPPGNKGVPLEVGKGRILIEGERVALLGYGTAVQSC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA+L+E  GL++TVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMA
Sbjct  599   LAAASLVERHGLKITVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVAQFMA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG +KWRPLVLPDRYIDHG+PADQLAEAGLTPSH+AATVFN+LG+AREALEIM+
Sbjct  659   LDGLLDGKIKWRPLVLPDRYIDHGSPADQLAEAGLTPSHVAATVFNMLGQAREALEIMS  717



>ref|XP_010666332.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=708

 Score =  1235 bits (3196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/719 (85%), Positives = 666/719 (93%), Gaps = 11/719 (2%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             M  C+C+LP   S     DL +P     Q+   ++L    + + +Q+  K+R  GV+ASL
Sbjct  1     MGFCSCSLPAHFS----PDLLRP-----QFTWRNNLQNLPKHRFNQV--KRRPYGVRASL  49

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
              +  EY+S+RPPTPLLDTINYPIHMKNLSVKEL QLA+E+RSDVIFNVSKTGGHLGSSLG
Sbjct  50    VENGEYHSERPPTPLLDTINYPIHMKNLSVKELKQLADEVRSDVIFNVSKTGGHLGSSLG  109

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM T+RQTNGL+GFTKR ESEY
Sbjct  110   VVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMRTLRQTNGLSGFTKRGESEY  169

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFG GHSS +ISAGLGMAVGRDLKGR+NNV+AVIGDGAMTAGQA+EAMNNAGYLDSDMI
Sbjct  170   DCFGAGHSSNSISAGLGMAVGRDLKGRQNNVVAVIGDGAMTAGQAFEAMNNAGYLDSDMI  229

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTAT+DGPIPPVGALSSALSRLQSN+PLRELREVAKGVTKQIGGPM++L
Sbjct  230   VILNDNKQVSLPTATVDGPIPPVGALSSALSRLQSNKPLRELREVAKGVTKQIGGPMYQL  289

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLVSIL+EVKSTKTTGPVLIHVV
Sbjct  290   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNVDDLVSILKEVKSTKTTGPVLIHVV  349

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+A DKYHGVTKFDPATGKQFK  + TQSYTTYFAEALIAEAE DKDIVA
Sbjct  350   TEKGRGYPYAERAPDKYHGVTKFDPATGKQFKGQSTTQSYTTYFAEALIAEAEVDKDIVA  409

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  410   IHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  469

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQK+PVRFAMDRAGLVGSDGPTH G+FDVTFMACLPNM+VMAPSDEAELFHM+
Sbjct  470   QVVHDVDLQKIPVRFAMDRAGLVGSDGPTHSGSFDVTFMACLPNMIVMAPSDEAELFHMI  529

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNGVG+ LPPGNKG PLE+G+GRIL EGERVA++GYG AVQ+C
Sbjct  530   ATAAAIDDRPSCFRYPRGNGVGMELPPGNKGIPLEIGKGRILKEGERVAVLGYGAAVQNC  589

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AAAL+E+RGL +TVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMA
Sbjct  590   LAAAALVESRGLHLTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVAQFMA  649

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG +KWRPLVLPDRYI+HGAPADQ+AEAGLT SHIAATVFNILG+ REALE+M+
Sbjct  650   LDGLLDGKVKWRPLVLPDRYIEHGAPADQMAEAGLTASHIAATVFNILGQTREALELMS  708



>ref|XP_006378082.1| hypothetical protein POPTR_0010s01910g [Populus trichocarpa]
 gb|ERP55879.1| hypothetical protein POPTR_0010s01910g [Populus trichocarpa]
Length=721

 Score =  1235 bits (3196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/722 (87%), Positives = 671/722 (93%), Gaps = 5/722 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFS---SQWFHGSDLHLHFQQKPSQINYKKRSSGVQ  2306
             MAL   + P  ++ +  + L+ P+ FS   S +   +DL      K +QI+ KKR++G+ 
Sbjct  1     MALSAFSFPAHVNSV--TSLEHPQKFSLLSSHFLWRTDLLSQSLDKINQIHVKKRANGIC  58

Query  2305  ASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGS  2126
             ASL+++ EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDVIFNVSKTGGHLGS
Sbjct  59    ASLSERGEYHSQRPPTPLLDTINYPIHMKNLSVKELKQLADELRSDVIFNVSKTGGHLGS  118

Query  2125  SLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSE  1946
             SLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRR+KM TIRQTNGLAGFTKRSE
Sbjct  119   SLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRRDKMHTIRQTNGLAGFTKRSE  178

Query  1945  SEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDS  1766
             SEYDCFGTGHSSTTISAGLGMAVGRDLKG  N V+AVIGDGAMTAGQAYEAMNNAGYLDS
Sbjct  179   SEYDCFGTGHSSTTISAGLGMAVGRDLKGGTNKVVAVIGDGAMTAGQAYEAMNNAGYLDS  238

Query  1765  DMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM  1586
             DMIVILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM
Sbjct  239   DMIVILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM  298

Query  1585  HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLI  1406
             HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL++IL+EVKSTKTTGPVLI
Sbjct  299   HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLIAILKEVKSTKTTGPVLI  358

Query  1405  HVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKD  1226
             HVVTEKGRGYP+AE+AADKYHGV KFDPATGKQFKAS  TQSYTTYFAEAL AEAEADKD
Sbjct  359   HVVTEKGRGYPFAERAADKYHGVAKFDPATGKQFKASPSTQSYTTYFAEALTAEAEADKD  418

Query  1225  IVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQR  1046
             IVAIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QR
Sbjct  419   IVAIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQR  478

Query  1045  AYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELF  866
             AYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELF
Sbjct  479   AYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELF  538

Query  865   HMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAV  686
             HMVATA AIDDRPSC RYPRGNGVGV LPPGNKG PLEVG+GR+L+EGERVAL+GYGTAV
Sbjct  539   HMVATATAIDDRPSCFRYPRGNGVGVQLPPGNKGVPLEVGKGRMLIEGERVALLGYGTAV  598

Query  685   QSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQ  506
             QSCL+AA+L+E  G+R+TVADARFCKPLDHALIRSLAKSHE++ITVEEGSIGGFGSHV Q
Sbjct  599   QSCLAAASLVERHGIRLTVADARFCKPLDHALIRSLAKSHEILITVEEGSIGGFGSHVVQ  658

Query  505   FMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             F+ALDGLLDG LKWRP+VLPDRYIDHG+PADQL EAGLTPSHIAATVF+ILG+ REALEI
Sbjct  659   FLALDGLLDGKLKWRPVVLPDRYIDHGSPADQLVEAGLTPSHIAATVFSILGQRREALEI  718

Query  325   MT  320
             M+
Sbjct  719   MS  720



>ref|XP_008390764.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Malus domestica]
Length=714

 Score =  1234 bits (3194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/720 (87%), Positives = 673/720 (93%), Gaps = 7/720 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGS-DLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MALCT + P D+SR   S D QK     S +  G+ L    QQK +Q+  +KR SG+ AS
Sbjct  1     MALCTFSFPADISRSAASADAQK-----SLFSVGTSLPCPSQQKLNQV-VRKRPSGICAS  54

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L++++EYYSQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDVIFNVSKTGGHLGSSL
Sbjct  55    LSEREEYYSQRPPTPLLDTINYPIHMKNLSVKELKQLADELRSDVIFNVSKTGGHLGSSL  114

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVA+HYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM T+RQTNGLAGFTKRSESE
Sbjct  115   GVVELTVAVHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMHTMRQTNGLAGFTKRSESE  174

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFGTGHSSTTISAGLGMAVGRDL+G  N+V+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  175   YDCFGTGHSSTTISAGLGMAVGRDLRGGNNHVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  234

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             I+ILNDNKQVSLPTA+LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG +H 
Sbjct  235   IIILNDNKQVSLPTASLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGSVHN  294

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISGSGS+LFEELGLYYIGPVDGHNIDDL+SIL+EVK TKTTGPVLIH+
Sbjct  295   LAAKVDEYARGMISGSGSSLFEELGLYYIGPVDGHNIDDLISILKEVKITKTTGPVLIHL  354

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAEKAADKYHGV KFDPATGKQFKASA TQSYTTYFAEALIAEAEADKDIV
Sbjct  355   VTEKGRGYPYAEKAADKYHGVAKFDPATGKQFKASASTQSYTTYFAEALIAEAEADKDIV  414

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAY
Sbjct  415   AIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAY  474

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTH G+FDVTFMACLPNMVVMAPSDEAELFHM
Sbjct  475   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHSGSFDVTFMACLPNMVVMAPSDEAELFHM  534

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNGVGV LP GNKGTPLEVGRGRIL+EGERVAL+GYG AVQS
Sbjct  535   VATAAAIDDRPSCFRYPRGNGVGVELPLGNKGTPLEVGRGRILIEGERVALLGYGAAVQS  594

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+A++L+E+RGLR+TVADARFCKPLD ALIRSL KSHE++ITVEEGSIGGFGSHVA F+
Sbjct  595   CLAASSLVESRGLRLTVADARFCKPLDRALIRSLVKSHEILITVEEGSIGGFGSHVAHFL  654

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDG LKWRP+VLPDRYIDHG+P DQLAEAGLTPSHIAATVFN+LG++REALEI++
Sbjct  655   ALDGLLDGKLKWRPIVLPDRYIDHGSPVDQLAEAGLTPSHIAATVFNMLGQSREALEIVS  714



>gb|KHG17090.1| putative 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Gossypium arboreum]
Length=734

 Score =  1234 bits (3192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/735 (85%), Positives = 669/735 (91%), Gaps = 16/735 (2%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALC  + P  ++    SD QK  PF+S +  GSDL L   +K +Q+  KKR  G  ASL
Sbjct  1     MALCASSFPAIINWGAASDPQKSTPFASHFLGGSDLVLQPLKKLNQV--KKRPGGAYASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY+SQRP TPLLDTINYPIHMKNLSVKEL QL+ ELRSDV+FNVSKTGGHLGSSLG
Sbjct  59    SEGAEYHSQRPATPLLDTINYPIHMKNLSVKELKQLSEELRSDVVFNVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAP+DKILWDVGHQSYPHKILTGRR KM T+RQTNGLAGFTKRSESEY
Sbjct  119   VVELTVALHYVFNAPRDKILWDVGHQSYPHKILTGRRHKMHTMRQTNGLAGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKG +N+V+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGTGHSSTTISAGLGMAVGRDLKGERNHVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL
Sbjct  239   VILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSIL+EVK+TKTTGPVLIHVV
Sbjct  299   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILKEVKTTKTTGPVLIHVV  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDPATGKQFK ++ TQSYTTYFAEALIAEAEADK+IVA
Sbjct  359   TEKGRGYPYAERAADKYHGVVKFDPATGKQFKGNSATQSYTTYFAEALIAEAEADKNIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLF RRFP RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  419   IHAAMGGGTGLNLFLRRFPQRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  478

Query  1036  Q--------------VVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMV  899
             Q              VVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMV
Sbjct  479   QASYQSYLGFSFLRIVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMV  538

Query  898   VMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGE  719
             VMAPSDEAELFHMVATAAAIDDRPSC RYPRGNG+GV LPPG KG PLEVG+GR+L+EGE
Sbjct  539   VMAPSDEAELFHMVATAAAIDDRPSCFRYPRGNGIGVQLPPGKKGVPLEVGKGRVLIEGE  598

Query  718   RVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEG  539
             RVAL+GYG+AVQSCL+AA+LLE+ GLR+TVADARFCKPLDHALIR LAKSHEV+ITVEEG
Sbjct  599   RVALLGYGSAVQSCLAAASLLESHGLRLTVADARFCKPLDHALIRKLAKSHEVLITVEEG  658

Query  538   SIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFN  359
             SIGGFGSHVAQF+ALDGLLDG +KWRPLVLPDRYIDHG+P DQLAEAGLTPSHIAATVFN
Sbjct  659   SIGGFGSHVAQFLALDGLLDGKVKWRPLVLPDRYIDHGSPVDQLAEAGLTPSHIAATVFN  718

Query  358   ILGKAREALEIMT*R  314
             +L + REALE+M+ R
Sbjct  719   VLEQKREALEVMSSR  733



>ref|XP_009393107.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=718

 Score =  1233 bits (3190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/720 (85%), Positives = 666/720 (93%), Gaps = 3/720 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPF-SSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MA  T      L  L+ SDLQK  P   +Q F G+DL  H + +   +  ++RS  V AS
Sbjct  1     MAASTLPFSCHLPALLSSDLQKASPLLPTQLFAGTDLP-HHRHRHGFLTPRRRSC-VCAS  58

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L+   EY+SQRPPTPLLDT+NYPIHMKNLSVKEL QLA+ELRSDVIF+VSKTGGHLGSSL
Sbjct  59    LSGTGEYFSQRPPTPLLDTVNYPIHMKNLSVKELKQLADELRSDVIFHVSKTGGHLGSSL  118

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRR+KMPT+R+TNGL+GFTKRSES+
Sbjct  119   GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRRDKMPTLRRTNGLSGFTKRSESD  178

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YD FGTGHSST+ISA LGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  179   YDSFGTGHSSTSISAALGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  238

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTA+LDGPIPPVGALSSALSRLQS+RPLRELREVAKGVTKQIGG MH+
Sbjct  239   IVILNDNKQVSLPTASLDGPIPPVGALSSALSRLQSSRPLRELREVAKGVTKQIGGSMHQ  298

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             +AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSIL+EVK TKTTGPVLIHV
Sbjct  299   IAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILKEVKDTKTTGPVLIHV  358

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAE+AADKYHGVTKFDPATGKQ K+ ++TQSYT YFAEALIAEAE DKDIV
Sbjct  359   VTEKGRGYPYAERAADKYHGVTKFDPATGKQLKSISQTQSYTNYFAEALIAEAEVDKDIV  418

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLN F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAY
Sbjct  419   AIHAAMGGGTGLNYFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAY  478

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQV+HDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPNM+VMAPSDEAELFHM
Sbjct  479   DQVIHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMIVMAPSDEAELFHM  538

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAI+DRPSC RYPRGNG+GV LP GNKG PLE+G+GRIL+EGERVAL+GYGTAVQS
Sbjct  539   VATAAAINDRPSCFRYPRGNGIGVPLPQGNKGVPLEIGKGRILIEGERVALLGYGTAVQS  598

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             C++AA+LLE RGLRVTVADARFCKPLDHALIR+L+KSH+V+ITVEEGSIGGFGSHVAQFM
Sbjct  599   CVAAASLLEQRGLRVTVADARFCKPLDHALIRNLSKSHQVLITVEEGSIGGFGSHVAQFM  658

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             AL+GLLDG +KWRPLVLPDRYI+HG+P DQLAEAGLTPSH+AATV NILG+ REALEIM+
Sbjct  659   ALNGLLDGTIKWRPLVLPDRYIEHGSPNDQLAEAGLTPSHVAATVLNILGQTREALEIMS  718



>ref|XP_011014224.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Populus euphratica]
Length=721

 Score =  1232 bits (3188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/720 (87%), Positives = 667/720 (93%), Gaps = 1/720 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDL-QKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MAL   + P   + ++  +  QK    SS +   +DL      K +QI+ KKR++G+ AS
Sbjct  1     MALYAFSFPAHANSVISLEHHQKFSLLSSHFLWRTDLLSQSLDKINQIHVKKRANGICAS  60

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L+++ EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDVIFNVSKTGGHLGSSL
Sbjct  61    LSERGEYHSQRPPTPLLDTINYPIHMKNLSVKELKQLADELRSDVIFNVSKTGGHLGSSL  120

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRR+KM TIRQTNGLAGFTKRSESE
Sbjct  121   GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRRDKMHTIRQTNGLAGFTKRSESE  180

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFGTGHSSTTISAGLGMAVGRDLKG  N V+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  181   YDCFGTGHSSTTISAGLGMAVGRDLKGGTNKVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  240

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE
Sbjct  241   IVILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  300

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMI GSGSTLFEELGLYYIGPVDGHNIDDL++IL+EVKSTKTTGPVLIHV
Sbjct  301   LAAKVDEYARGMIGGSGSTLFEELGLYYIGPVDGHNIDDLIAILKEVKSTKTTGPVLIHV  360

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYP+AE+AADKYHGV KFDPATGKQFKAS  TQSYTTYFAEAL AEAEADKDIV
Sbjct  361   VTEKGRGYPFAERAADKYHGVAKFDPATGKQFKASPSTQSYTTYFAEALTAEAEADKDIV  420

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAY
Sbjct  421   AIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAY  480

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM
Sbjct  481   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  540

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATA AIDDRPSC RYPRGNGVGV LPPGNKG PLEVG+GR+L+EGERVAL+GYGTAVQS
Sbjct  541   VATATAIDDRPSCFRYPRGNGVGVQLPPGNKGVPLEVGKGRMLIEGERVALLGYGTAVQS  600

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+AA+L+E  G+R+TVADARFCKPLDHALIRSLAKSHE++ITVEEGSIGGFGSHV QF+
Sbjct  601   CLAAASLVERHGIRLTVADARFCKPLDHALIRSLAKSHEILITVEEGSIGGFGSHVVQFL  660

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDG LKWRP+VLPDRYIDHG+PADQL EAGLTPSHIAATVFNILG+ REALEIM+
Sbjct  661   ALDGLLDGKLKWRPVVLPDRYIDHGSPADQLVEAGLTPSHIAATVFNILGQRREALEIMS  720



>gb|AAQ84169.1| 1-deoxy-D-xylulose 5-phosphate synthase [Pueraria montana var. 
lobata]
Length=717

 Score =  1232 bits (3187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/716 (87%), Positives = 665/716 (93%), Gaps = 4/716 (1%)
 Frame = -2

Query  2461  CALPGDLSRLVGSDLQK--PRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLADK  2288
             CAL    + +  SD ++  P P  SQW  G D     Q        KKRSSGV  SL+++
Sbjct  4     CALSSYPAFVTPSDPRRSLPLPSHSQW--GLDFLAQSQHTHRLNQMKKRSSGVCTSLSER  61

Query  2287  DEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVE  2108
              EYYSQRPPTPLLDTINYPIHMKNLS KEL QLA+ELRSDVIF+VS+TGGHLGSSLGVVE
Sbjct  62    GEYYSQRPPTPLLDTINYPIHMKNLSTKELKQLADELRSDVIFSVSRTGGHLGSSLGVVE  121

Query  2107  LTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCF  1928
             LTVALHYVFN PQDKILWDVGHQSYPHKILTGRR+KM T+RQTNGL+GFTKRSESEYDCF
Sbjct  122   LTVALHYVFNTPQDKILWDVGHQSYPHKILTGRRDKMHTMRQTNGLSGFTKRSESEYDCF  181

Query  1927  GTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVIL  1748
             GTGHSSTTISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEA+NNAGYLDSDMIVIL
Sbjct  182   GTGHSSTTISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEALNNAGYLDSDMIVIL  241

Query  1747  NDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAK  1568
             NDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTK+IGGPMHELAAK
Sbjct  242   NDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKRIGGPMHELAAK  301

Query  1567  VDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEK  1388
             VDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLV+IL EVKSTKTTGPVLIHV+TEK
Sbjct  302   VDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVAILNEVKSTKTTGPVLIHVITEK  361

Query  1387  GRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHA  1208
             GRGYPYAEKAADKYHGVTKFDP TGKQFK+ A TQSYTTYFAEALIAEAEADKDIVAIHA
Sbjct  362   GRGYPYAEKAADKYHGVTKFDPPTGKQFKSKATTQSYTTYFAEALIAEAEADKDIVAIHA  421

Query  1207  AMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVV  1028
             AMGGGTG+N+F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYDQVV
Sbjct  422   AMGGGTGMNIFHRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYDQVV  481

Query  1027  HDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATA  848
             HDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMAPSDEAELFHMVATA
Sbjct  482   HDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMAPSDEAELFHMVATA  541

Query  847   AAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSA  668
             AAI+DRPSC RYPRGNG+GV LP GNKGTPLE+G+GRIL+EGERVAL+GYG+AVQ+CL+A
Sbjct  542   AAINDRPSCFRYPRGNGIGVQLPTGNKGTPLEIGKGRILIEGERVALLGYGSAVQNCLAA  601

Query  667   AALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDG  488
             A+L+E  GLR+TVADARFCKPLD +LIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMALDG
Sbjct  602   ASLVERHGLRLTVADARFCKPLDRSLIRSLAKSHEVLITVEEGSIGGFGSHVAQFMALDG  661

Query  487   LLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LLDG LKWRP+VLPDRYIDHG+PADQL+ AGLTPSHIAATVFNILG+ REALE+M+
Sbjct  662   LLDGKLKWRPIVLPDRYIDHGSPADQLSLAGLTPSHIAATVFNILGQTREALEVMS  717



>ref|XP_011034246.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Populus euphratica]
Length=721

 Score =  1228 bits (3176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/720 (87%), Positives = 667/720 (93%), Gaps = 1/720 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWF-HGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MAL   +LP  ++ +   D  +   FSS  F   +DL     +K +Q++ KKR +GV AS
Sbjct  1     MALSAFSLPAHVNSVTSLDHLQNYSFSSSHFLWRTDLLCQSFKKINQVHVKKRPNGVCAS  60

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L++  E+ SQRPPTPLLDT+NYPIHMKNLS+KEL QLA ELRSDVIFNVSKTGGHLGSSL
Sbjct  61    LSESGEFPSQRPPTPLLDTVNYPIHMKNLSIKELKQLAEELRSDVIFNVSKTGGHLGSSL  120

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHYVFN+PQDKILWDVGHQ+YPHKILTGRR+KM TIRQTNGLAGFTKRSESE
Sbjct  121   GVVELTVALHYVFNSPQDKILWDVGHQAYPHKILTGRRDKMHTIRQTNGLAGFTKRSESE  180

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFGTGHSSTTISAGLGMAVGRDLKG  N V+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  181   YDCFGTGHSSTTISAGLGMAVGRDLKGGTNKVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  240

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE
Sbjct  241   IVILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  300

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL++IL+EVKSTKTTGPVLIHV
Sbjct  301   LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLIAILKEVKSTKTTGPVLIHV  360

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAE+AADKYHGV KFDPATGKQFKASA TQSYTTYFAEALIAEAEADKD+V
Sbjct  361   VTEKGRGYPYAERAADKYHGVNKFDPATGKQFKASASTQSYTTYFAEALIAEAEADKDVV  420

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEG KPFCAIYSSF+QRAY
Sbjct  421   AIHAAMGGGTGLNLFHRRFPTRCFDVGIAEQHAVTFAAGLACEGHKPFCAIYSSFLQRAY  480

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM
Sbjct  481   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  540

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNGVGV LPPGNKG PLEVG+GRIL+EGERVAL+GYGTAVQS
Sbjct  541   VATAAAIDDRPSCFRYPRGNGVGVRLPPGNKGIPLEVGKGRILIEGERVALLGYGTAVQS  600

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+AA+L+E  G+ +TVADARFCKPLD+ALIRSLAKSHEV+ITVEEGSIGGFGSHVA F+
Sbjct  601   CLAAASLVERHGIHLTVADARFCKPLDNALIRSLAKSHEVLITVEEGSIGGFGSHVAHFL  660

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDG LKWRP+VLPDRYIDHG+PADQL EAGLTPSHIAATVFNILG+ R+ALEIM+
Sbjct  661   ALDGLLDGQLKWRPIVLPDRYIDHGSPADQLVEAGLTPSHIAATVFNILGQRRDALEIMS  720



>gb|AFU93068.1| chloroplast 1-deoxy-D-xylulose-5-phosphate synthase [Eucommia 
ulmoides]
Length=712

 Score =  1228 bits (3176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/721 (87%), Positives = 673/721 (93%), Gaps = 11/721 (2%)
 Frame = -2

Query  2476  MALCT-CALPGDLSR-LVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQA  2303
             MALCT  + PG  +R +V SDLQK   F S+   G D+H    QK +Q+  KKRS GV A
Sbjct  1     MALCTYSSFPGHFNRAVVASDLQKQFGFCSK---GKDVH----QKHTQL--KKRSIGVWA  51

Query  2302  SLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSS  2123
             SL++  EY+S+RPPTPLLDTINYPIHMKNLS+KEL QLA E+RSDVIFNVSKTGGHLGSS
Sbjct  52    SLSETGEYHSKRPPTPLLDTINYPIHMKNLSIKELKQLAEEVRSDVIFNVSKTGGHLGSS  111

Query  2122  LGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSES  1943
             LGVVELTVALHYVFNAP+D+ILWDVGHQSYPHKILTGRR+KM TIRQTNGLAGFTKRSES
Sbjct  112   LGVVELTVALHYVFNAPKDRILWDVGHQSYPHKILTGRRDKMHTIRQTNGLAGFTKRSES  171

Query  1942  EYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSD  1763
             EYDCFGTGHSSTTISAGLGMAVGRDLK RKNNV++VIGDGAMTAGQAYEAMNNAGYLDSD
Sbjct  172   EYDCFGTGHSSTTISAGLGMAVGRDLKRRKNNVVSVIGDGAMTAGQAYEAMNNAGYLDSD  231

Query  1762  MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  1583
             MIVILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIG PMH
Sbjct  232   MIVILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGWPMH  291

Query  1582  ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIH  1403
             +LA+KVDEYARG+ISGSGSTLFEELGLYYIGPVDGH+IDDLV+IL+EVKST+TTGPVLIH
Sbjct  292   DLASKVDEYARGLISGSGSTLFEELGLYYIGPVDGHSIDDLVAILKEVKSTRTTGPVLIH  351

Query  1402  VVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDI  1223
             VVTEKGRGYPYAEKAADKYHGV KFDPATG+QFKAS KTQS+TTYFAEALIAEAEADKD+
Sbjct  352   VVTEKGRGYPYAEKAADKYHGVVKFDPATGQQFKASVKTQSFTTYFAEALIAEAEADKDV  411

Query  1222  VAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRA  1043
             VAIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRA
Sbjct  412   VAIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRA  471

Query  1042  YDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  863
             YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH
Sbjct  472   YDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  531

Query  862   MVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQ  683
             MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG PLEVG+GRIL+EGERVAL+GYGTAV+
Sbjct  532   MVATAAAIDDRPSCFRYPRGNGIGVDLPPGNKGVPLEVGKGRILIEGERVALLGYGTAVR  591

Query  682   SCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQF  503
             SCL+AA++++ RGL +TV DARFCKPLD +LIRSLAKSHE +ITVEEGSIGGFGSHVA F
Sbjct  592   SCLAAASIVKPRGLNLTVVDARFCKPLDCSLIRSLAKSHEFLITVEEGSIGGFGSHVAHF  651

Query  502   MALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             +ALDGLLDGNLKWRPLVLPDRYIDHG+PADQL EAGLTPSHIAATVFNILGK R ALEIM
Sbjct  652   LALDGLLDGNLKWRPLVLPDRYIDHGSPADQLTEAGLTPSHIAATVFNILGKTRGALEIM  711

Query  322   T  320
             +
Sbjct  712   S  712



>ref|NP_001290502.1| probable 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Elaeis guineensis]
 gb|AAS99588.1| chloroplast 1-deoxy-D-xylulose-5-phosphate synthase [Elaeis guineensis]
Length=707

 Score =  1228 bits (3176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/719 (85%), Positives = 656/719 (91%), Gaps = 12/719 (2%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL T + P           Q P      W  G+DLH H Q +   +  +KR   V ASL
Sbjct  1     MALSTFSFPS----------QMPSLLCPHWLGGADLHSH-QHQYRLLKTRKRPC-VCASL  48

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY+SQRPPTPLLDTINYPIHMKNLS+KEL QL +ELRSD+IF+VSKTGGHLGSSLG
Sbjct  49    SEHGEYHSQRPPTPLLDTINYPIHMKNLSIKELKQLGDELRSDIIFHVSKTGGHLGSSLG  108

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALH+VFNAPQDKILWDVGHQSYPHKILTGRR+KMPT+RQTNGL+GFTKRSESEY
Sbjct  109   VVELTVALHHVFNAPQDKILWDVGHQSYPHKILTGRRDKMPTLRQTNGLSGFTKRSESEY  168

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             D FG GHSST+ISA LGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  169   DSFGAGHSSTSISAALGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  228

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTA LDGPIPPVGALSSALSRLQS+RPLRELREVAKGVTKQIGG MH+L
Sbjct  229   VILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSSRPLRELREVAKGVTKQIGGSMHKL  288

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLV+IL+EVKSTKTTGPV IHVV
Sbjct  289   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNMDDLVTILKEVKSTKTTGPVFIHVV  348

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDP+TGKQFK+ +KTQSYT YFAEALI+EAE DKDIVA
Sbjct  349   TEKGRGYPYAERAADKYHGVAKFDPSTGKQFKSRSKTQSYTNYFAEALISEAEVDKDIVA  408

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLN F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYD
Sbjct  409   IHAAMGGGTGLNYFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYD  468

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVT+MACLPNMVVM PSDEAELFHMV
Sbjct  469   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTYMACLPNMVVMTPSDEAELFHMV  528

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNGVGV LP GNKG PLEVG+GRIL+EGERVAL+GYG AVQ C
Sbjct  529   ATAAAIDDRPSCFRYPRGNGVGVPLPAGNKGVPLEVGKGRILIEGERVALLGYGAAVQGC  588

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA+LLE   L+VTVADARFCKPLDHALIRSLA+SHE++ITVEEGSIGGFGSHVAQFMA
Sbjct  589   LAAASLLEEHSLKVTVADARFCKPLDHALIRSLARSHELLITVEEGSIGGFGSHVAQFMA  648

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG LKWRPLVLPDRYIDHG+PADQLAEAGLTPSH+AATVFN+LG+AREALEIM+
Sbjct  649   LDGLLDGKLKWRPLVLPDRYIDHGSPADQLAEAGLTPSHVAATVFNMLGQAREALEIMS  707



>ref|XP_003609567.1| 1-deoxy-D-xylulose 5-phosphate synthase [Medicago truncatula]
 gb|AES91764.1| 1-deoxy-D-xylulose-5-phosphate synthase [Medicago truncatula]
Length=717

 Score =  1225 bits (3170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/720 (84%), Positives = 658/720 (91%), Gaps = 4/720 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGV-QAS  2300
             M LC+ A P   S +   D ++  P  S     S   LHF     Q N  K+  GV  AS
Sbjct  1     MDLCSLACP---SFVTPCDPRRTLPLPSSSSSHSQWGLHFFSHSQQHNKLKKKFGVVHAS  57

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L++  EYYSQRPPTPLLDTINYPIHMKNLS KEL QLA+ELRSDVIF+VS+TGGHLGSSL
Sbjct  58    LSEMGEYYSQRPPTPLLDTINYPIHMKNLSTKELKQLADELRSDVIFSVSRTGGHLGSSL  117

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELT+ALHYVFN PQDKILWDVGHQSYPHKILTGRR+KM T+RQTNGL+GFTKRSESE
Sbjct  118   GVVELTIALHYVFNTPQDKILWDVGHQSYPHKILTGRRDKMHTMRQTNGLSGFTKRSESE  177

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YD FGTGHSSTTISAGLGMAVGRDLKGRKN+V+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  178   YDSFGTGHSSTTISAGLGMAVGRDLKGRKNDVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  237

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSN+PLRELREVAKGVTK+IGGPMHE
Sbjct  238   IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNKPLRELREVAKGVTKRIGGPMHE  297

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDDLV+IL+EVK+T +TGPVLIHV
Sbjct  298   LAAKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDLVAILKEVKTTNSTGPVLIHV  357

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             +TEKGRGYPYAEKAADKYHGV KFDP TGKQFK +AKTQSYTTYFAEALIAEA+ADKDI+
Sbjct  358   ITEKGRGYPYAEKAADKYHGVAKFDPPTGKQFKVAAKTQSYTTYFAEALIAEAKADKDII  417

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTG+N+F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAY
Sbjct  418   AIHAAMGGGTGMNIFHRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAY  477

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTH G+FDVTFMACLPNMVVMAPSDEAEL HM
Sbjct  478   DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHSGSFDVTFMACLPNMVVMAPSDEAELCHM  537

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNG+GV LP   KG PLE+G+GRIL+EGERVAL+GYG+AVQ+
Sbjct  538   VATAAAIDDRPSCFRYPRGNGIGVELPTEYKGIPLEIGKGRILIEGERVALLGYGSAVQN  597

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+AA+L+E  GLR+TVADARFCKPLD +LIRSLAKSHEV+ITVEEGSIGGFGSHVAQFM
Sbjct  598   CLAAASLVEQHGLRLTVADARFCKPLDRSLIRSLAKSHEVLITVEEGSIGGFGSHVAQFM  657

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDGNLKWRP+VLPDRYIDHG+PADQL  AGLTPSHIAATVFNILG+ REALE+M+
Sbjct  658   ALDGLLDGNLKWRPVVLPDRYIDHGSPADQLCMAGLTPSHIAATVFNILGQTREALEVMS  717



>ref|XP_004508322.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic-like [Cicer arietinum]
Length=720

 Score =  1225 bits (3169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/724 (84%), Positives = 659/724 (91%), Gaps = 9/724 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQK--PRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSG---  2312
             M LC    P  ++ +  S+ Q   P P  SQW  G  L  H   + +Q+  KK+S G   
Sbjct  1     MDLCAFTCPAFMNTIAPSNPQTTLPLPSHSQW--GLHLLPHSHHRLNQL--KKKSGGGVY  56

Query  2311  VQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHL  2132
               ASL++K EYYSQRPPTPLLDTINYPIHMKNLS KEL QLA ELRSDVIF+VS+TGGHL
Sbjct  57    AYASLSEKGEYYSQRPPTPLLDTINYPIHMKNLSTKELKQLAEELRSDVIFSVSRTGGHL  116

Query  2131  GSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKR  1952
             GSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRR+KM T+RQTNGL+GFTKR
Sbjct  117   GSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRRDKMHTMRQTNGLSGFTKR  176

Query  1951  SESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYL  1772
             +ESE+DCFGTGHSSTTISAGLGMAVGRDLKGRKN+V+AVIGDGAMTAGQAYEAMNNAGYL
Sbjct  177   AESEFDCFGTGHSSTTISAGLGMAVGRDLKGRKNDVVAVIGDGAMTAGQAYEAMNNAGYL  236

Query  1771  DSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG  1592
             DSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSR+QSNRPLRELREVAKG+TK+IGG
Sbjct  237   DSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRVQSNRPLRELREVAKGLTKRIGG  296

Query  1591  PMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPV  1412
             PMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSIL+EVKSTK+TGPV
Sbjct  297   PMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILKEVKSTKSTGPV  356

Query  1411  LIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEAD  1232
             LIHV+TEKGRGYPYAEKAADKYHGVTKFDP TGKQFKA+A T SYTTYFAEALIAEA+ D
Sbjct  357   LIHVITEKGRGYPYAEKAADKYHGVTKFDPPTGKQFKANAATLSYTTYFAEALIAEAKVD  416

Query  1231  KDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFM  1052
             KDIVAIHAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSF+
Sbjct  417   KDIVAIHAAMGGGTGMNLFHRRFPTRCFDVGIAEQHAVTFAAGLACEGVKPFCAIYSSFL  476

Query  1051  QRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAE  872
             QRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCG+FDVTFMACLPNMVVMAPSDEAE
Sbjct  477   QRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGSFDVTFMACLPNMVVMAPSDEAE  536

Query  871   LFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGT  692
             L HMVATAAAIDDRPSC RYPRGNG+GV LP   KG PLE+G+GRIL+EGE      YGT
Sbjct  537   LCHMVATAAAIDDRPSCFRYPRGNGIGVELPTEYKGIPLEIGKGRILIEGEXXXXXXYGT  596

Query  691   AVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHV  512
             AVQ+CL+AA+L+E  GLR+TVADARFCKPLD +LIRSLAKSHEV+ITVEEGSIGGFGSHV
Sbjct  597   AVQNCLAAASLVELHGLRLTVADARFCKPLDRSLIRSLAKSHEVLITVEEGSIGGFGSHV  656

Query  511   AQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             AQFMALDGLLDGNLKWRP+VLPDRYI+HG+PADQL  AGLTPSHIAATVFNILG+ REAL
Sbjct  657   AQFMALDGLLDGNLKWRPVVLPDRYIEHGSPADQLCMAGLTPSHIAATVFNILGQTREAL  716

Query  331   EIMT  320
             E+M+
Sbjct  717   EVMS  720



>ref|XP_010548901.1| PREDICTED: 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Tarenaya hassleriana]
Length=716

 Score =  1224 bits (3168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/716 (85%), Positives = 653/716 (91%), Gaps = 2/716 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSR-LVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MAL   A P  +SR    +D  K  P SS     +D         + ++ K++  GV AS
Sbjct  1     MALSAFAFPSYISRGTTPTDSYKSAPLSSSSSLSTDFP-SVSSGKTTVHSKRKPGGVYAS  59

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             LA+K EYY+ RPPTPLLDTINYPIHMKNLSVKEL QL++ELRSDVIFNVSKTGGHLGSSL
Sbjct  60    LAEKGEYYANRPPTPLLDTINYPIHMKNLSVKELKQLSDELRSDVIFNVSKTGGHLGSSL  119

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHYVFN+PQD+ILWDVGHQSYPHKILTGRR KM T+RQTNGL+GFTKR+ESE
Sbjct  120   GVVELTVALHYVFNSPQDRILWDVGHQSYPHKILTGRRGKMNTLRQTNGLSGFTKRAESE  179

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFG GHSSTTISAGLGMAVGRDLKGR NNV+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  180   YDCFGAGHSSTTISAGLGMAVGRDLKGRNNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  239

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTATLDGP PPVGALSSALS+LQSNRPLRELREVAKGVTKQIGGPMHE
Sbjct  240   IVILNDNKQVSLPTATLDGPAPPVGALSSALSKLQSNRPLRELREVAKGVTKQIGGPMHE  299

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISGSG+TLFEELGLYYIGPVDGHNIDDLV+IL EVKST+TTGPVLIHV
Sbjct  300   LAAKVDEYARGMISGSGATLFEELGLYYIGPVDGHNIDDLVAILNEVKSTRTTGPVLIHV  359

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAE+A DKYHGV KFDPATGKQFK SAKTQSYTTYFAEALI+EAEADKD+V
Sbjct  360   VTEKGRGYPYAERATDKYHGVVKFDPATGKQFKTSAKTQSYTTYFAEALISEAEADKDVV  419

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSF+QRAY
Sbjct  420   AIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGVKPFCAIYSSFLQRAY  479

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM
Sbjct  480   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  539

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNG+GV LP GNKG PLE+GRGRILMEGERVAL+GYG+AVQS
Sbjct  540   VATAAAIDDRPSCFRYPRGNGIGVPLPLGNKGVPLEIGRGRILMEGERVALLGYGSAVQS  599

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             C++AAA+L+ R + VTVADARFCKPLD  LIR LAKSHEV+ITVEEGSIGGFGSHV QF+
Sbjct  600   CVAAAAMLKDRDVNVTVADARFCKPLDRDLIRKLAKSHEVLITVEEGSIGGFGSHVVQFL  659

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             ALDGLLDG LKW P+VLPDRYIDHG+P+DQLAEAGLTPSHIAATV N+LG  REAL
Sbjct  660   ALDGLLDGKLKWTPMVLPDRYIDHGSPSDQLAEAGLTPSHIAATVMNLLGSPREAL  715



>emb|CAD22530.1| 1-deoxy-D-xylulose 5-phosphate synthase 1 [Medicago truncatula]
Length=717

 Score =  1224 bits (3167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/720 (84%), Positives = 658/720 (91%), Gaps = 4/720 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGV-QAS  2300
             M LC+ A P   S +   D ++  P  S     S   LHF     Q N  K+  GV  AS
Sbjct  1     MDLCSLACP---SFVTPCDPRRTLPLPSSSSSHSQWGLHFFSHSQQHNKLKKKFGVVHAS  57

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L++  EYYSQRPPTPLLDTINYPIHMKNLS KEL QLA+ELRSDVIF+VS+TGGHLGSSL
Sbjct  58    LSEMGEYYSQRPPTPLLDTINYPIHMKNLSTKELKQLADELRSDVIFSVSRTGGHLGSSL  117

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELT+ALHYVFN PQDKILWDVGHQSYPHKILTGRR+KM T+RQTNGL+GFTKRSESE
Sbjct  118   GVVELTIALHYVFNTPQDKILWDVGHQSYPHKILTGRRDKMHTMRQTNGLSGFTKRSESE  177

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YD FGTGHSSTTISAGLGMAVGRDLKGRKN+V+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  178   YDSFGTGHSSTTISAGLGMAVGRDLKGRKNDVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  237

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSN+PLRELREVAKGVTK+IGGPMHE
Sbjct  238   IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNKPLRELREVAKGVTKRIGGPMHE  297

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDDLV+IL+EVK+T +TGPVLIHV
Sbjct  298   LAAKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDLVAILKEVKTTNSTGPVLIHV  357

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             +TEKGRGYPYA+KAADKYHGV KFDP TGKQFK +AKTQSYTTYFAEALIAEA+ADKDI+
Sbjct  358   ITEKGRGYPYAQKAADKYHGVAKFDPPTGKQFKVAAKTQSYTTYFAEALIAEAKADKDII  417

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTG+N+F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAY
Sbjct  418   AIHAAMGGGTGMNIFHRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAY  477

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTH G+FDVTFMACLPNMVVMAPSDEAEL HM
Sbjct  478   DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHSGSFDVTFMACLPNMVVMAPSDEAELCHM  537

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNG+GV LP   KG PLE+G+GRIL+EGERVAL+GYG+AVQ+
Sbjct  538   VATAAAIDDRPSCFRYPRGNGIGVELPTEYKGIPLEIGKGRILIEGERVALLGYGSAVQN  597

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+AA+L+E  GLR+TVADARFCKPLD +LIRSLAKSHEV+ITVEEGSIGGFGSHVAQFM
Sbjct  598   CLAAASLVEQHGLRLTVADARFCKPLDRSLIRSLAKSHEVLITVEEGSIGGFGSHVAQFM  657

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDGNLKWRP+VLPDRYIDHG+PADQL  AGLTPSHIAATVFNILG+ REALE+M+
Sbjct  658   ALDGLLDGNLKWRPVVLPDRYIDHGSPADQLCMAGLTPSHIAATVFNILGQTREALEVMS  717



>ref|XP_003550129.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic-like [Glycine max]
 gb|KHN03402.1| Putative 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Glycine soja]
Length=712

 Score =  1224 bits (3166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/709 (87%), Positives = 662/709 (93%), Gaps = 9/709 (1%)
 Frame = -2

Query  2437  RLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQIN-YKKRSSGVQASLADKD--EYYSQR  2267
             R VG     PR    QW       LHF     ++N  KKRSSGV ASL++++  EYYSQR
Sbjct  10    RTVGVTPSDPRKSLPQW------GLHFLSYTHRLNQIKKRSSGVYASLSERERGEYYSQR  63

Query  2266  PPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHY  2087
             PPTPLLDT+NYPIHMKNLS  EL QLA+ELRSDVIF+VS+TGGHLGSSLGVVELTVALHY
Sbjct  64    PPTPLLDTVNYPIHMKNLSTNELKQLADELRSDVIFSVSRTGGHLGSSLGVVELTVALHY  123

Query  2086  VFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSST  1907
             VFNAPQDKILWDVGHQSYPHKILTGRR+KM T+RQTNGL+GFTKRSESE+DCFGTGHSST
Sbjct  124   VFNAPQDKILWDVGHQSYPHKILTGRRDKMHTMRQTNGLSGFTKRSESEFDCFGTGHSST  183

Query  1906  TISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVS  1727
             TISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVS
Sbjct  184   TISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVS  243

Query  1726  LPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARG  1547
             LPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTK+IGGPMHELAAKVDEYARG
Sbjct  244   LPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKRIGGPMHELAAKVDEYARG  303

Query  1546  MISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYA  1367
             MISGSGS+LFEELGLYYIGPVDGHNI+DLV+IL EVKST TTGPVLIHV+TEKGRGYPYA
Sbjct  304   MISGSGSSLFEELGLYYIGPVDGHNINDLVAILNEVKSTNTTGPVLIHVITEKGRGYPYA  363

Query  1366  EKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTG  1187
             EKAADKYHGVTKFDP TGKQFK+ A T+SYTTYFAEALIAEAEADKD+VAIHAAMGGGTG
Sbjct  364   EKAADKYHGVTKFDPPTGKQFKSKATTRSYTTYFAEALIAEAEADKDVVAIHAAMGGGTG  423

Query  1186  LNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQK  1007
             +NLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQK
Sbjct  424   MNLFHRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQK  483

Query  1006  LPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRP  827
             LPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMAPSDEAELFHMVATAAAI+DRP
Sbjct  484   LPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMAPSDEAELFHMVATAAAINDRP  543

Query  826   SCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETR  647
             SC RYPRGNG+GV LP GNKGTPLE+G+GRIL+EGERVAL+GYG+AVQ+CL+AA+L+E  
Sbjct  544   SCFRYPRGNGIGVQLPTGNKGTPLEIGKGRILIEGERVALLGYGSAVQNCLAAASLVEHH  603

Query  646   GLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLK  467
             GLRVTVADARFCKPLD +LIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMALDGL+DG LK
Sbjct  604   GLRVTVADARFCKPLDRSLIRSLAKSHEVLITVEEGSIGGFGSHVAQFMALDGLIDGKLK  663

Query  466   WRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             WRP+VLPDRYIDHG+PADQL+ AGLTPSHIAATVFNILG+ REALE+M+
Sbjct  664   WRPIVLPDRYIDHGSPADQLSLAGLTPSHIAATVFNILGQTREALEVMS  712



>ref|XP_008223088.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Prunus mume]
Length=720

 Score =  1222 bits (3162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/721 (85%), Positives = 658/721 (91%), Gaps = 3/721 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVG-SDLQKPRPF-SSQWFHGSDLHLHFQQKPSQINYKKRSSGVQA  2303
             MALCT + P  ++R    SD QK      S +  G+ L    Q K +Q+  +KR +G+ A
Sbjct  1     MALCTFSFPAHINRPTAHSDAQKSTSLLYSHFSWGTVLPCQSQHKLNQV-MRKRPAGICA  59

Query  2302  SLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSS  2123
             SL++  EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDVIFNVSKTGGHLGSS
Sbjct  60    SLSESGEYHSQRPPTPLLDTINYPIHMKNLSVKELKQLADELRSDVIFNVSKTGGHLGSS  119

Query  2122  LGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSES  1943
             LGVVELTVALHYVFN PQD+ILWDVGHQSYPHKILTGRR+KM T+RQTNGLAGFTKRSES
Sbjct  120   LGVVELTVALHYVFNTPQDRILWDVGHQSYPHKILTGRRDKMHTMRQTNGLAGFTKRSES  179

Query  1942  EYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSD  1763
             EYDCFGTGHSSTTISAGLGMAVGRDLKG  N+V+AVIGDGAMTAGQAYEAMNNAGYLDSD
Sbjct  180   EYDCFGTGHSSTTISAGLGMAVGRDLKGGNNHVVAVIGDGAMTAGQAYEAMNNAGYLDSD  239

Query  1762  MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  1583
             MI+ILNDNKQVSLPTA+LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGP+H
Sbjct  240   MIIILNDNKQVSLPTASLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPVH  299

Query  1582  ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIH  1403
              LAAKVDEYARGMISG+GS+LFEELGLYYIGPVDGHNIDDL++IL+EVKSTKTTGPVLIH
Sbjct  300   NLAAKVDEYARGMISGTGSSLFEELGLYYIGPVDGHNIDDLIAILKEVKSTKTTGPVLIH  359

Query  1402  VVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDI  1223
             ++TEKGRGYPYAEKAADKYHGV KFDPATGKQFKAS  TQSYTTYFAEALIAEAE DKDI
Sbjct  360   LITEKGRGYPYAEKAADKYHGVAKFDPATGKQFKASVSTQSYTTYFAEALIAEAEVDKDI  419

Query  1222  VAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRA  1043
             VAIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRA
Sbjct  420   VAIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRA  479

Query  1042  YDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  863
             YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMAP DEAELFH
Sbjct  480   YDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMAPCDEAELFH  539

Query  862   MVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQ  683
             MVATAAAIDDRPSC RYPRGNGVGV LP GNKGTPLEV    +     RVAL+GYG AVQ
Sbjct  540   MVATAAAIDDRPSCFRYPRGNGVGVQLPTGNKGTPLEVTFNSLYFYISRVALLGYGAAVQ  599

Query  682   SCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQF  503
             SCL+A++L+E+ GLR+TVADARFCKPLD ALIRSLAKSHE +ITVEEGSIGGFGSHVAQF
Sbjct  600   SCLAASSLVESHGLRLTVADARFCKPLDRALIRSLAKSHEFLITVEEGSIGGFGSHVAQF  659

Query  502   MALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             +ALDGLLDG LKWRPLVLPDRYIDHG+PADQL EAGLTPSHIAATVFN+LG+ REAL+IM
Sbjct  660   LALDGLLDGKLKWRPLVLPDRYIDHGSPADQLVEAGLTPSHIAATVFNVLGQTREALKIM  719

Query  322   T  320
             +
Sbjct  720   S  720



>gb|EYU43871.1| hypothetical protein MIMGU_mgv1a002143mg [Erythranthe guttata]
Length=709

 Score =  1221 bits (3159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 614/720 (85%), Positives = 663/720 (92%), Gaps = 12/720 (2%)
 Frame = -2

Query  2476  MALCTCALPGDLSR-LVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MALC     G LS+ L G+           W +GS L  H   K +    +K S+GV AS
Sbjct  1     MALCAFPFTGSLSKGLTGT----------HWLNGSGLQPHPCCKKNH-QVRKSSNGVYAS  49

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L+++ EY+SQ+PPTPLLDTINYPIHMKNLS KEL QLA+ELRSDVIFNVSKTGGHLGSSL
Sbjct  50    LSERGEYFSQKPPTPLLDTINYPIHMKNLSTKELKQLADELRSDVIFNVSKTGGHLGSSL  109

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GV+ELTVALH+VFN PQD+ILWDVGHQSYPHKI++GRR+KMPT+RQTNGL+GFTKRSES+
Sbjct  110   GVIELTVALHFVFNTPQDRILWDVGHQSYPHKIVSGRRDKMPTLRQTNGLSGFTKRSESD  169

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFGTGHSSTTISAGLGMAVGRDLKG+ NNV+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  170   YDCFGTGHSSTTISAGLGMAVGRDLKGKSNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  229

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTA LDGP  PVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE
Sbjct  230   IVILNDNKQVSLPTANLDGPTAPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  289

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARG+ISGSGST FEELGLYYIGPVDGHN+DDL +IL EVKSTKTTGPVLIHV
Sbjct  290   LAAKVDEYARGLISGSGSTFFEELGLYYIGPVDGHNLDDLTAILNEVKSTKTTGPVLIHV  349

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             +TEKGRGYPYAEKAADKYHGVTKFDPATGKQFK+SA TQSYTTYFAEALIAEAEADKDIV
Sbjct  350   ITEKGRGYPYAEKAADKYHGVTKFDPATGKQFKSSAPTQSYTTYFAEALIAEAEADKDIV  409

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSF+QRAY
Sbjct  410   AIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGIKPFCAIYSSFLQRAY  469

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAELFHM
Sbjct  470   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELFHM  529

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC R+PRGNGVG+ LP GNKG P+E+G+GR+L+EGERVAL+GYGTAVQS
Sbjct  530   VATAAAIDDRPSCFRFPRGNGVGIELPKGNKGIPIEIGKGRVLIEGERVALLGYGTAVQS  589

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             C++AAALLE  G+R+TVADARFCKPLDH LIRSLAKSH+V+ITVEEGSIGGFGSHVAQFM
Sbjct  590   CMAAAALLEPHGIRLTVADARFCKPLDHDLIRSLAKSHQVLITVEEGSIGGFGSHVAQFM  649

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDGNLKWRPLVLPDRYIDHG+P DQ  EAGLTPSHIAATV NILGKAREALEIM+
Sbjct  650   ALDGLLDGNLKWRPLVLPDRYIDHGSPIDQQMEAGLTPSHIAATVCNILGKAREALEIMS  709



>ref|XP_004296782.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=709

 Score =  1221 bits (3159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/700 (87%), Positives = 658/700 (94%), Gaps = 2/700 (0%)
 Frame = -2

Query  2416  QKP-RPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTI  2240
             QKP   FSS +  G  L    QQK      KKR++G+ ASL++  EY+SQRPPTPLLDTI
Sbjct  11    QKPTSKFSSHFSFGPALPCPQQQKLFN-QVKKRTTGICASLSESGEYHSQRPPTPLLDTI  69

Query  2239  NYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKI  2060
             NYPIHMKNLSVKEL QLA+ELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKI
Sbjct  70    NYPIHMKNLSVKELKQLADELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKI  129

Query  2059  LWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMA  1880
             LWDVGHQSYPHKILTGRR+KM T+RQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMA
Sbjct  130   LWDVGHQSYPHKILTGRRDKMQTMRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMA  189

Query  1879  VGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP  1700
             VGRDLKG+ N+V+AVIGDGAMTAGQAYEAMNNAGYLDSDMI+ILNDNKQVSLPTA LDGP
Sbjct  190   VGRDLKGKNNHVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIIILNDNKQVSLPTANLDGP  249

Query  1699  IPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTL  1520
             IPPVGALSSALS+LQSNRPLRELREVAKGVTKQIGG +HELAAKVDEYARGMISGSGSTL
Sbjct  250   IPPVGALSSALSKLQSNRPLRELREVAKGVTKQIGGSVHELAAKVDEYARGMISGSGSTL  309

Query  1519  FEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHG  1340
             FEELGLYYIGPVDGHN+DDL++ILQEVK+T+TTGPVLIH++TEKGRGYPYAEKAADKYHG
Sbjct  310   FEELGLYYIGPVDGHNVDDLIAILQEVKTTQTTGPVLIHLITEKGRGYPYAEKAADKYHG  369

Query  1339  VTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFP  1160
             V KFDPATGKQFKA+A TQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTG+NLF RRFP
Sbjct  370   VAKFDPATGKQFKAAASTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGMNLFLRRFP  429

Query  1159  SRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDR  980
             +RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYDQVVHDVDLQKLPVRFAMDR
Sbjct  430   TRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVVHDVDLQKLPVRFAMDR  489

Query  979   AGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgn  800
             AGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC RYPRGN
Sbjct  490   AGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRYPRGN  549

Query  799   gvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADA  620
             G+GV LP GNKGTPLE+G+GRIL+EGERVAL+GYG+AVQ+CL+AA L+E  GL +TVADA
Sbjct  550   GIGVELPAGNKGTPLEIGKGRILIEGERVALLGYGSAVQTCLAAATLVEPLGLSLTVADA  609

Query  619   RFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDR  440
             RFCKPLDHALIR LAKSHE +ITVEEGSIGGFGSHV QF+ALDGLLDGNLKWRPLVLPDR
Sbjct  610   RFCKPLDHALIRKLAKSHEFLITVEEGSIGGFGSHVVQFLALDGLLDGNLKWRPLVLPDR  669

Query  439   YIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             YIDHGAPADQLA+AGLTPSHIAATV N+LG+ REAL++M+
Sbjct  670   YIDHGAPADQLADAGLTPSHIAATVLNMLGQTREALQVMS  709



>ref|XP_010938853.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic isoform X2 [Elaeis guineensis]
Length=696

 Score =  1221 bits (3158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/697 (86%), Positives = 648/697 (93%), Gaps = 2/697 (0%)
 Frame = -2

Query  2410  PRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYP  2231
             P      W  G+DLH H Q +   +  +KR   V ASL++  EY+SQRPPTPLLDTINYP
Sbjct  2     PSLLCPHWLGGADLHSH-QHQYRLLKTRKRPC-VCASLSEHGEYHSQRPPTPLLDTINYP  59

Query  2230  IHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWD  2051
             IHMKNLS+KEL QL +ELRSD+IF+VSKTGGHLGSSLGVVELTVALH+VFNAPQDKILWD
Sbjct  60    IHMKNLSIKELKQLGDELRSDIIFHVSKTGGHLGSSLGVVELTVALHHVFNAPQDKILWD  119

Query  2050  VGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGR  1871
             VGHQSYPHKILTGRR+KMPT+RQTNGL+GFTKRSESEYD FG GHSST+ISA LGMAVGR
Sbjct  120   VGHQSYPHKILTGRRDKMPTLRQTNGLSGFTKRSESEYDSFGAGHSSTSISAALGMAVGR  179

Query  1870  DLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPP  1691
             DLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTA LDGPIPP
Sbjct  180   DLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTANLDGPIPP  239

Query  1690  VGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEE  1511
             VGALSSALSRLQS+RPLRELREVAKGVTKQIGG MH+LAAKVDEYARGMISGSGSTLFEE
Sbjct  240   VGALSSALSRLQSSRPLRELREVAKGVTKQIGGSMHKLAAKVDEYARGMISGSGSTLFEE  299

Query  1510  LGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTK  1331
             LGLYYIGPVDGHN+DDLV+IL+EVKSTKTTGPV IHVVTEKGRGYPYAE+AADKYHGV K
Sbjct  300   LGLYYIGPVDGHNMDDLVTILKEVKSTKTTGPVFIHVVTEKGRGYPYAERAADKYHGVAK  359

Query  1330  FDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRC  1151
             FDP+TGKQFK+S KTQSYT YFAEALI+EAE DKDIVAIHAAMGGGTGLN F RRFP+RC
Sbjct  360   FDPSTGKQFKSSTKTQSYTNYFAEALISEAEVDKDIVAIHAAMGGGTGLNYFLRRFPTRC  419

Query  1150  FDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGL  971
             FDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYDQV+HDVDLQKLPVRFAMDRAGL
Sbjct  420   FDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVIHDVDLQKLPVRFAMDRAGL  479

Query  970   VGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvg  791
             VG+DGPTHCG+FDVT+MACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC RYPRGNGVG
Sbjct  480   VGADGPTHCGSFDVTYMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRYPRGNGVG  539

Query  790   vvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFC  611
             V LP GNKG PLEVG+GRIL+EGERVAL+GYG AVQ CL+AA+LLE   L+VTVADARFC
Sbjct  540   VPLPAGNKGVPLEVGKGRILIEGERVALLGYGAAVQGCLAAASLLEEHSLKVTVADARFC  599

Query  610   KPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYID  431
             KPLDHALIRSLA+SHE++ITVEEGSIGGFGSHVAQFM+LDGLLDG  KWRP+VLPDRYID
Sbjct  600   KPLDHALIRSLARSHELLITVEEGSIGGFGSHVAQFMSLDGLLDGTTKWRPVVLPDRYID  659

Query  430   HGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             HG+PADQL+EAGLTPSHIAATVFNILG+ REALEIM+
Sbjct  660   HGSPADQLSEAGLTPSHIAATVFNILGQTREALEIMS  696



>gb|KHN03015.1| Putative 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Glycine soja]
Length=708

 Score =  1221 bits (3158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/698 (87%), Positives = 657/698 (94%), Gaps = 7/698 (1%)
 Frame = -2

Query  2410  PRPFSSQWFHGSDLHLHFQQKPSQIN-YKKRSSGVQASLADKDEYYSQRPPTPLLDTINY  2234
             P P  SQW       LHF     +++  KKR  GV ASL++  EYYS RPPTPLLDT+NY
Sbjct  17    PLPSHSQW------GLHFLAHAHRLHQMKKRPCGVYASLSESGEYYSHRPPTPLLDTVNY  70

Query  2233  PIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILW  2054
             PIHMKNLS KEL QLA+ELRSDVIF+VS+TGGHLGSSLGVVELTVALHYVFNAPQDKILW
Sbjct  71    PIHMKNLSTKELKQLADELRSDVIFSVSRTGGHLGSSLGVVELTVALHYVFNAPQDKILW  130

Query  2053  DVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVG  1874
             DVGHQSYPHKILTGRR++M T+RQTNGL+GFTKRSESE+DCFGTGHSSTTISAGLGMAVG
Sbjct  131   DVGHQSYPHKILTGRRDQMHTMRQTNGLSGFTKRSESEFDCFGTGHSSTTISAGLGMAVG  190

Query  1873  RDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIP  1694
             RDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIP
Sbjct  191   RDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIP  250

Query  1693  PVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFE  1514
             PVGALSSALSRLQSNRPLRELREVAKGVTK+IGGPMHELAAKVDEYARGMISGSGS+LFE
Sbjct  251   PVGALSSALSRLQSNRPLRELREVAKGVTKRIGGPMHELAAKVDEYARGMISGSGSSLFE  310

Query  1513  ELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVT  1334
             ELGLYYIGPVDGHNIDDLV+IL EVKSTKTTGPVLIHV+TEKGRGYPYAEKAADKYHGVT
Sbjct  311   ELGLYYIGPVDGHNIDDLVAILNEVKSTKTTGPVLIHVITEKGRGYPYAEKAADKYHGVT  370

Query  1333  KFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSR  1154
             KFDP TGKQFK+ A TQSYTTYFAEALIAEAEADKD+VAIHAAMGGGTG+NLF RRFP+R
Sbjct  371   KFDPPTGKQFKSKATTQSYTTYFAEALIAEAEADKDVVAIHAAMGGGTGMNLFHRRFPTR  430

Query  1153  CFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAG  974
             CFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAG
Sbjct  431   CFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAG  490

Query  973   LVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngv  794
             LVG+DGPTHCG+FDVTFMACLPNMVVMAPSDEA+LFHMVATAAAI+DRPSC RYPRGNG+
Sbjct  491   LVGADGPTHCGSFDVTFMACLPNMVVMAPSDEADLFHMVATAAAINDRPSCFRYPRGNGI  550

Query  793   gvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARF  614
             GV LP GNKGTPLE+G+GRIL+EGERVAL+GYG+AVQ+CL+AA+L+E  GLR+TVADARF
Sbjct  551   GVQLPTGNKGTPLEIGKGRILIEGERVALLGYGSAVQNCLAAASLVECHGLRLTVADARF  610

Query  613   CKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYI  434
             CKPLD +LIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMALDGLLDG LKWRP+VLPDRYI
Sbjct  611   CKPLDRSLIRSLAKSHEVLITVEEGSIGGFGSHVAQFMALDGLLDGKLKWRPIVLPDRYI  670

Query  433   DHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             DHG+PADQL+ AGLTPSHIAATVFN+LG+ REALE+M+
Sbjct  671   DHGSPADQLSLAGLTPSHIAATVFNVLGQTREALEVMS  708



>ref|XP_010938852.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic isoform X1 [Elaeis guineensis]
Length=722

 Score =  1219 bits (3154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/697 (86%), Positives = 648/697 (93%), Gaps = 2/697 (0%)
 Frame = -2

Query  2410  PRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYP  2231
             P      W  G+DLH H Q +   +  +KR   V ASL++  EY+SQRPPTPLLDTINYP
Sbjct  28    PSLLCPHWLGGADLHSH-QHQYRLLKTRKRPC-VCASLSEHGEYHSQRPPTPLLDTINYP  85

Query  2230  IHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWD  2051
             IHMKNLS+KEL QL +ELRSD+IF+VSKTGGHLGSSLGVVELTVALH+VFNAPQDKILWD
Sbjct  86    IHMKNLSIKELKQLGDELRSDIIFHVSKTGGHLGSSLGVVELTVALHHVFNAPQDKILWD  145

Query  2050  VGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGR  1871
             VGHQSYPHKILTGRR+KMPT+RQTNGL+GFTKRSESEYD FG GHSST+ISA LGMAVGR
Sbjct  146   VGHQSYPHKILTGRRDKMPTLRQTNGLSGFTKRSESEYDSFGAGHSSTSISAALGMAVGR  205

Query  1870  DLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPP  1691
             DLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTA LDGPIPP
Sbjct  206   DLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTANLDGPIPP  265

Query  1690  VGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEE  1511
             VGALSSALSRLQS+RPLRELREVAKGVTKQIGG MH+LAAKVDEYARGMISGSGSTLFEE
Sbjct  266   VGALSSALSRLQSSRPLRELREVAKGVTKQIGGSMHKLAAKVDEYARGMISGSGSTLFEE  325

Query  1510  LGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTK  1331
             LGLYYIGPVDGHN+DDLV+IL+EVKSTKTTGPV IHVVTEKGRGYPYAE+AADKYHGV K
Sbjct  326   LGLYYIGPVDGHNMDDLVTILKEVKSTKTTGPVFIHVVTEKGRGYPYAERAADKYHGVAK  385

Query  1330  FDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRC  1151
             FDP+TGKQFK+S KTQSYT YFAEALI+EAE DKDIVAIHAAMGGGTGLN F RRFP+RC
Sbjct  386   FDPSTGKQFKSSTKTQSYTNYFAEALISEAEVDKDIVAIHAAMGGGTGLNYFLRRFPTRC  445

Query  1150  FDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGL  971
             FDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYDQV+HDVDLQKLPVRFAMDRAGL
Sbjct  446   FDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVIHDVDLQKLPVRFAMDRAGL  505

Query  970   VGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvg  791
             VG+DGPTHCG+FDVT+MACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC RYPRGNGVG
Sbjct  506   VGADGPTHCGSFDVTYMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRYPRGNGVG  565

Query  790   vvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFC  611
             V LP GNKG PLEVG+GRIL+EGERVAL+GYG AVQ CL+AA+LLE   L+VTVADARFC
Sbjct  566   VPLPAGNKGVPLEVGKGRILIEGERVALLGYGAAVQGCLAAASLLEEHSLKVTVADARFC  625

Query  610   KPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYID  431
             KPLDHALIRSLA+SHE++ITVEEGSIGGFGSHVAQFM+LDGLLDG  KWRP+VLPDRYID
Sbjct  626   KPLDHALIRSLARSHELLITVEEGSIGGFGSHVAQFMSLDGLLDGTTKWRPVVLPDRYID  685

Query  430   HGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             HG+PADQL+EAGLTPSHIAATVFNILG+ REALEIM+
Sbjct  686   HGSPADQLSEAGLTPSHIAATVFNILGQTREALEIMS  722



>ref|XP_009369084.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
Length=714

 Score =  1217 bits (3150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/720 (86%), Positives = 666/720 (93%), Gaps = 7/720 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGS-DLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MALC  + P  +S+   S D QK     S +  G+ L    QQK +Q+  +KR SG+ AS
Sbjct  1     MALCAFSFPAHISKPAASADAQK-----SHFSVGAPLPCPSQQKLNQV-MRKRPSGICAS  54

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L+++ EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDVIFNVSKTGGHLGSSL
Sbjct  55    LSERGEYHSQRPPTPLLDTINYPIHMKNLSVKELQQLADELRSDVIFNVSKTGGHLGSSL  114

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM T+RQTNGLAGFTKRSESE
Sbjct  115   GVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMHTMRQTNGLAGFTKRSESE  174

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFGTGHSSTTISAGLGMAVGRDLKG  N+V+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  175   YDCFGTGHSSTTISAGLGMAVGRDLKGGNNHVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  234

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             I+ILNDNKQVSLPTA+LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGP+H 
Sbjct  235   IIILNDNKQVSLPTASLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPVHN  294

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISG+GS+LFEELGLYYIGPVDGHN+DDL+SIL EVK TKTTGPVLIH+
Sbjct  295   LAAKVDEYARGMISGTGSSLFEELGLYYIGPVDGHNLDDLISILNEVKITKTTGPVLIHL  354

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             +TEKGRGYPYAE AADKYHGV KFDPATGKQFKASA TQSYTTYFAEALIAEAEADKDIV
Sbjct  355   ITEKGRGYPYAENAADKYHGVAKFDPATGKQFKASASTQSYTTYFAEALIAEAEADKDIV  414

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAY
Sbjct  415   AIHAAMGGGTGMNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAY  474

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTH G+FDVTFMACLPNMVVMAPSDEAELF M
Sbjct  475   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHSGSFDVTFMACLPNMVVMAPSDEAELFDM  534

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNGVGV LP  NKGTPLEVG+GRIL+EGERVAL+GYG AVQS
Sbjct  535   VATAAAIDDRPSCFRYPRGNGVGVELPLWNKGTPLEVGKGRILIEGERVALLGYGAAVQS  594

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+A++L+E+ GLR+TVADARFCKPLD ALIRSLAKSHE +ITVEEGSIGGFGSHVA F+
Sbjct  595   CLAASSLVESHGLRLTVADARFCKPLDRALIRSLAKSHEFLITVEEGSIGGFGSHVAHFL  654

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDG LKWRP+VLPDRYIDHG+PADQLAEAGLTPSHIAATVFN+LG+ REALEIM+
Sbjct  655   ALDGLLDGKLKWRPIVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNMLGQTREALEIMS  714



>ref|NP_001236070.1| 1-deoxy-D-xylulose 5-phosphate synthase 1 [Glycine max]
 gb|ACO72582.1| 1-deoxy-D-xylulose 5-phosphate synthase 1 [Glycine max]
Length=708

 Score =  1217 bits (3150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/698 (87%), Positives = 656/698 (94%), Gaps = 7/698 (1%)
 Frame = -2

Query  2410  PRPFSSQWFHGSDLHLHFQQKPSQIN-YKKRSSGVQASLADKDEYYSQRPPTPLLDTINY  2234
             P P  SQW       LHF     +++  KKR  GV ASL++  EYYS RPPTPLLDT+NY
Sbjct  17    PLPSHSQW------GLHFLAHAHRLHQMKKRPCGVYASLSESGEYYSHRPPTPLLDTVNY  70

Query  2233  PIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILW  2054
             PIHMKNLS KEL QLA+ELRSDVIF+VS+TGGHLGSSLGVVELTVALHYVFNAPQDKILW
Sbjct  71    PIHMKNLSAKELKQLADELRSDVIFSVSRTGGHLGSSLGVVELTVALHYVFNAPQDKILW  130

Query  2053  DVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVG  1874
             DVGHQSYPHKILTGRR++M T+RQTNGL+GFTKRSESE+DCFGTGHSSTTISAGLGMAVG
Sbjct  131   DVGHQSYPHKILTGRRDQMHTMRQTNGLSGFTKRSESEFDCFGTGHSSTTISAGLGMAVG  190

Query  1873  RDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIP  1694
             RDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIP
Sbjct  191   RDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIP  250

Query  1693  PVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFE  1514
             PVGALSSALSRLQSNRPLRELREVAKGVTK+IGGPMHELAAKVDEYARGMISGSGS+LFE
Sbjct  251   PVGALSSALSRLQSNRPLRELREVAKGVTKRIGGPMHELAAKVDEYARGMISGSGSSLFE  310

Query  1513  ELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVT  1334
             ELGLYYIGPVDGHNIDDLV+IL EVKSTKTTGPVLIHV+TEKGRGYPYAEKAADKYHGVT
Sbjct  311   ELGLYYIGPVDGHNIDDLVAILNEVKSTKTTGPVLIHVITEKGRGYPYAEKAADKYHGVT  370

Query  1333  KFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSR  1154
             KFDP TGKQFK+ A TQSYTTYFAEALIAEAEADKD+VAIHAAMGGGTG+NLF RRFP+R
Sbjct  371   KFDPPTGKQFKSKATTQSYTTYFAEALIAEAEADKDVVAIHAAMGGGTGMNLFHRRFPTR  430

Query  1153  CFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAG  974
             CFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAG
Sbjct  431   CFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAG  490

Query  973   LVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngv  794
             LVG+DGPTHCG+FDVTFMACLPNMVVMAPSDEA+LFHMVATAAAI+DRPSC RYPRGNG+
Sbjct  491   LVGADGPTHCGSFDVTFMACLPNMVVMAPSDEADLFHMVATAAAINDRPSCFRYPRGNGI  550

Query  793   gvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARF  614
             GV LP GNKGTPLE+G+GRIL+EGERVAL+GYG+AVQ+CL+AA+L+E  GLR+TVADARF
Sbjct  551   GVQLPTGNKGTPLEIGKGRILIEGERVALLGYGSAVQNCLAAASLVECHGLRLTVADARF  610

Query  613   CKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYI  434
             CKPLD +LIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMALDGLLDG LKWRP+VLPDRYI
Sbjct  611   CKPLDRSLIRSLAKSHEVLITVEEGSIGGFGSHVAQFMALDGLLDGKLKWRPIVLPDRYI  670

Query  433   DHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             DHG+PADQL+ AGLTPSHIAATVFN+L + REALE+M+
Sbjct  671   DHGSPADQLSLAGLTPSHIAATVFNVLRQTREALEVMS  708



>ref|XP_008340868.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Malus domestica]
Length=714

 Score =  1214 bits (3142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/720 (86%), Positives = 668/720 (93%), Gaps = 7/720 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGS-DLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MALC  + P  +S+   S D QK     S +  G+ L    QQK +Q+  +K  SG+ AS
Sbjct  1     MALCAFSFPAHISKPAASADAQK-----SHFSVGTPLPCPSQQKLNQV-MRKXPSGICAS  54

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L+++ EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDVIFNVSKTGGHLGSSL
Sbjct  55    LSERGEYHSQRPPTPLLDTINYPIHMKNLSVKELQQLADELRSDVIFNVSKTGGHLGSSL  114

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM T+RQTNGLAGFTKRSESE
Sbjct  115   GVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMHTMRQTNGLAGFTKRSESE  174

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFGTGHSSTTISAGLGMAVGRDLKG  N+V+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  175   YDCFGTGHSSTTISAGLGMAVGRDLKGGXNHVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  234

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             I+ILNDNKQVSLPTA+LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGP+H 
Sbjct  235   IIILNDNKQVSLPTASLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPVHN  294

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISG+GS+LFEELGLYYIGPVDGHN+DDL+SIL+EVK TKTTGPVLIH+
Sbjct  295   LAAKVDEYARGMISGTGSSLFEELGLYYIGPVDGHNLDDLISILKEVKITKTTGPVLIHL  354

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             +TEKGRGYPYAEKAADKYHGV KFDPATGKQFK+SA TQSYTTYFAEALIAEAEADKDIV
Sbjct  355   ITEKGRGYPYAEKAADKYHGVAKFDPATGKQFKSSASTQSYTTYFAEALIAEAEADKDIV  414

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAY
Sbjct  415   AIHAAMGGGTGMNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAY  474

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTH G+FDVTFMACLPNMVVMAPSDEAELF M
Sbjct  475   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHSGSFDVTFMACLPNMVVMAPSDEAELFDM  534

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNGVGV LP GNKGTPLEVG+GRIL+EGERVAL+GYG AVQS
Sbjct  535   VATAAAIDDRPSCFRYPRGNGVGVELPLGNKGTPLEVGKGRILIEGERVALLGYGAAVQS  594

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+A++L+E+ GL +TVADARFCKPLD ALIRSLA+SHE +ITVEEGSIGGFGSHVA F+
Sbjct  595   CLAASSLVESHGLXLTVADARFCKPLDRALIRSLARSHEFLITVEEGSIGGFGSHVAHFL  654

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDG LKWRP+VLPDRYIDHG+PADQLAEAGLTPSHIAATVFN+LG+AREALEIM+
Sbjct  655   ALDGLLDGKLKWRPIVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNMLGQAREALEIMS  714



>ref|XP_007225144.1| hypothetical protein PRUPE_ppa002446mg [Prunus persica]
 gb|EMJ26343.1| hypothetical protein PRUPE_ppa002446mg [Prunus persica]
Length=671

 Score =  1214 bits (3140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/670 (90%), Positives = 647/670 (97%), Gaps = 0/670 (0%)
 Frame = -2

Query  2329  KKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVS  2150
             +KR +G+ ASL++  EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDVIFNVS
Sbjct  2     RKRPAGICASLSESGEYHSQRPPTPLLDTINYPIHMKNLSVKELKQLADELRSDVIFNVS  61

Query  2149  KTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGL  1970
             KTGGHLGSSLGVVELTVALHYVFNAP+D+ILWDVGHQSYPHKILTGRR+KM T+RQTNGL
Sbjct  62    KTGGHLGSSLGVVELTVALHYVFNAPRDRILWDVGHQSYPHKILTGRRDKMHTMRQTNGL  121

Query  1969  AGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAM  1790
             AGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKG  N+V+AVIGDGAMTAGQAYEAM
Sbjct  122   AGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGGNNHVVAVIGDGAMTAGQAYEAM  181

Query  1789  NNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGV  1610
             NNAGYLDSDMI+ILNDNKQVSLPTA+LDGPIPPVGALSSALSRLQSNRPLRELREVAKGV
Sbjct  182   NNAGYLDSDMIIILNDNKQVSLPTASLDGPIPPVGALSSALSRLQSNRPLRELREVAKGV  241

Query  1609  TKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKST  1430
             TKQIGGP+H LAAKVDEYARGMISG+GS+LFEELGLYYIGPVDGHN+DDL+SIL+EVKST
Sbjct  242   TKQIGGPVHNLAAKVDEYARGMISGTGSSLFEELGLYYIGPVDGHNLDDLISILKEVKST  301

Query  1429  KTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALI  1250
             KTTGPVLIH++TEKGRGYPYAEKAADKYHGV KFDPATGKQFKASA TQSYTTYFAEALI
Sbjct  302   KTTGPVLIHLITEKGRGYPYAEKAADKYHGVAKFDPATGKQFKASASTQSYTTYFAEALI  361

Query  1249  AEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCA  1070
             AEAEADKDIVAIHAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCA
Sbjct  362   AEAEADKDIVAIHAAMGGGTGMNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCA  421

Query  1069  IYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMA  890
             IYSSF+QRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMA
Sbjct  422   IYSSFLQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMA  481

Query  889   PSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVA  710
             PSDEAELFHMVATAAAIDDRPSC RYPRGNGVGV LP GNKGTPLEVG+GRIL+EGERVA
Sbjct  482   PSDEAELFHMVATAAAIDDRPSCFRYPRGNGVGVQLPTGNKGTPLEVGKGRILIEGERVA  541

Query  709   LVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIG  530
             L+GYG AVQSCL+A++L+E+ GLR+TVADARFCKPLD ALIRSLAKSHE +ITVEEGSIG
Sbjct  542   LLGYGAAVQSCLAASSLVESHGLRLTVADARFCKPLDRALIRSLAKSHEFLITVEEGSIG  601

Query  529   GFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILG  350
             GFGSHVAQF+ALDGLLDG LKWRPLVLPDRYIDHG+PADQL EAGLTPSHIAATVFN+LG
Sbjct  602   GFGSHVAQFLALDGLLDGKLKWRPLVLPDRYIDHGSPADQLVEAGLTPSHIAATVFNVLG  661

Query  349   KAREALEIMT  320
             + REAL+IM+
Sbjct  662   QTREALKIMS  671



>ref|XP_003541651.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic-like [Glycine max]
Length=721

 Score =  1214 bits (3140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/697 (87%), Positives = 654/697 (94%), Gaps = 2/697 (0%)
 Frame = -2

Query  2410  PRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYP  2231
             P P SS    G+DL    Q+K +Q+  K+R  GV ASL++  EYYSQ+PPTPLLDTINYP
Sbjct  27    PLPLSSHSHWGADLLTQSQRKLNQV--KRRPHGVCASLSEMGEYYSQKPPTPLLDTINYP  84

Query  2230  IHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWD  2051
             IHMKNL+ K+L QLA+ELRSDVIF+VS+TGGHLGSSLGVVELT+ALHYVFNAP+DKILWD
Sbjct  85    IHMKNLATKKLKQLADELRSDVIFHVSRTGGHLGSSLGVVELTIALHYVFNAPKDKILWD  144

Query  2050  VGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGR  1871
             VGHQSYPHKILTGRR+KM T+RQT+GLAGFTKRSES+YDCFGTGHSSTTISAGLGMAVGR
Sbjct  145   VGHQSYPHKILTGRRDKMHTMRQTDGLAGFTKRSESDYDCFGTGHSSTTISAGLGMAVGR  204

Query  1870  DLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPP  1691
             DLKG KNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTA LDGPIPP
Sbjct  205   DLKGDKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTANLDGPIPP  264

Query  1690  VGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEE  1511
             VGALSSALS+LQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEE
Sbjct  265   VGALSSALSKLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEE  324

Query  1510  LGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTK  1331
             LGLYYIGPVDGHNIDDLVSIL EVKSTKTTGPVL+HVVTEKG GYPYAE+AADKYHGVTK
Sbjct  325   LGLYYIGPVDGHNIDDLVSILNEVKSTKTTGPVLLHVVTEKGHGYPYAERAADKYHGVTK  384

Query  1330  FDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRC  1151
             FDPATGKQFK++A TQSYTTYFAEALIAEAEADKDIV IHAAMGGGTG+NLF RRFP+RC
Sbjct  385   FDPATGKQFKSNAATQSYTTYFAEALIAEAEADKDIVGIHAAMGGGTGMNLFLRRFPTRC  444

Query  1150  FDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGL  971
             FDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGL
Sbjct  445   FDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGL  504

Query  970   VGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvg  791
             VG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC RYPRGNG+G
Sbjct  505   VGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRYPRGNGIG  564

Query  790   vvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFC  611
             V LP GNKG PLE+G+GRIL+EGERVAL+GYG+AVQSCL+AA+LLE  GLR TVADARFC
Sbjct  565   VELPLGNKGIPLEIGKGRILIEGERVALLGYGSAVQSCLAAASLLEHHGLRATVADARFC  624

Query  610   KPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYID  431
             KPLD +LIRSLA+SHEV+ITVEEGSIGGFGSHV QFMALDGLLDG LKWRP+VLPD YID
Sbjct  625   KPLDRSLIRSLAQSHEVLITVEEGSIGGFGSHVVQFMALDGLLDGKLKWRPIVLPDCYID  684

Query  430   HGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             HG+P DQL+ AGLTPSHIAATVFN+LG+ REALE+MT
Sbjct  685   HGSPVDQLSAAGLTPSHIAATVFNLLGQTREALEVMT  721



>gb|KHN37526.1| Putative 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Glycine soja]
Length=721

 Score =  1213 bits (3138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/697 (87%), Positives = 654/697 (94%), Gaps = 2/697 (0%)
 Frame = -2

Query  2410  PRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYP  2231
             P P SS    G+DL    Q+K +Q+  K+R  GV ASL++  EYYSQ+PPTPLLDTINYP
Sbjct  27    PLPLSSHSHWGADLLTQSQRKLNQV--KRRPHGVCASLSEMGEYYSQKPPTPLLDTINYP  84

Query  2230  IHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWD  2051
             IHMKNL+ K+L QLA+ELRSDVIF+VS+TGGHLGSSLGVVELTVALHYVFNAP+DKILWD
Sbjct  85    IHMKNLATKKLKQLADELRSDVIFHVSRTGGHLGSSLGVVELTVALHYVFNAPKDKILWD  144

Query  2050  VGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGR  1871
             VGHQSYPHKILTGRR+KM T+RQT+GLAGFTKRSES+YDCFGTGHSSTTISAGLGMAVGR
Sbjct  145   VGHQSYPHKILTGRRDKMHTMRQTDGLAGFTKRSESDYDCFGTGHSSTTISAGLGMAVGR  204

Query  1870  DLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPP  1691
             DLKG KNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTA LDGPIPP
Sbjct  205   DLKGDKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTANLDGPIPP  264

Query  1690  VGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEE  1511
             VGALSSALS+LQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEE
Sbjct  265   VGALSSALSKLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEE  324

Query  1510  LGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTK  1331
             LGLYYIGPVDGHNIDDLVSIL EVKSTKTTGPVL+HVVTEKG GYPYAE+AADKYHGVTK
Sbjct  325   LGLYYIGPVDGHNIDDLVSILNEVKSTKTTGPVLLHVVTEKGHGYPYAERAADKYHGVTK  384

Query  1330  FDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRC  1151
             FDPATGKQFK++A TQSYTTYFAEALIAEAEADKDIV IHAAMGGGTG+NLF RRFP+RC
Sbjct  385   FDPATGKQFKSNAATQSYTTYFAEALIAEAEADKDIVGIHAAMGGGTGMNLFLRRFPTRC  444

Query  1150  FDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGL  971
             FDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGL
Sbjct  445   FDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGL  504

Query  970   VGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvg  791
             VG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC RYPRGNG+G
Sbjct  505   VGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRYPRGNGIG  564

Query  790   vvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFC  611
             V LP GNKG PLE+G+GRIL+EGERVAL+GYG+AVQSCL+A++LLE  GLR TVADARFC
Sbjct  565   VELPLGNKGIPLEIGKGRILIEGERVALLGYGSAVQSCLAASSLLEHHGLRATVADARFC  624

Query  610   KPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYID  431
             KPLD +LIRSLA+SHEV+ITVEEGSIGGFGSHV QFMALDGLLDG LKWRP+VLPD YID
Sbjct  625   KPLDRSLIRSLAQSHEVLITVEEGSIGGFGSHVVQFMALDGLLDGKLKWRPIVLPDCYID  684

Query  430   HGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             HG+P DQL+ AGLTPSHIAATVFN+LG+ REALE+MT
Sbjct  685   HGSPVDQLSAAGLTPSHIAATVFNLLGQTREALEVMT  721



>dbj|BAF75640.1| 1-deoxy-D-xylulose-5-phosphate synthase [Croton stellatopilosus]
Length=720

 Score =  1212 bits (3137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/719 (84%), Positives = 652/719 (91%), Gaps = 0/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL   + P   +    SDLQK    S  +   +DL      + +Q   KKR  GV ASL
Sbjct  1     MALSAFSFPAHANWDACSDLQKYTSVSPHFPWRTDLLGQSLLRINQAKGKKRPGGVSASL  60

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY+S RP TPLLDTIN+PIHMKNLS+KEL QLA ELRSDVIFNVSKTGGHLGSSLG
Sbjct  61    SESAEYHSNRPATPLLDTINFPIHMKNLSIKELKQLAEELRSDVIFNVSKTGGHLGSSLG  120

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR++M TIRQTNGL+GFTKR+ESE+
Sbjct  121   VVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRDRMRTIRQTNGLSGFTKRAESEH  180

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLK RKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  181   DCFGTGHSSTTISAGLGMAVGRDLKERKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  240

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELRE+AKGVTKQIGG MHEL
Sbjct  241   VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREIAKGVTKQIGGQMHEL  300

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMIS SGS+LFEELGLYYIGPVDGHNI+DLV IL+EVKSTK+TGPVLIHVV
Sbjct  301   AAKVDEYARGMISASGSSLFEELGLYYIGPVDGHNIEDLVDILKEVKSTKSTGPVLIHVV  360

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGVTKFDPATGKQFK+   TQSYTTYFAEALIAEAE DKDIVA
Sbjct  361   TEKGRGYPYAERAADKYHGVTKFDPATGKQFKSGGSTQSYTTYFAEALIAEAEVDKDIVA  420

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLF RRFP++CFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  421   IHAAMGGGTGLNLFHRRFPNKCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  480

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGL+G+DGPTHCGAFDVTFMAC PNMVVMAPS+EAELF+MV
Sbjct  481   QVVHDVDLQKLPVRFAMDRAGLIGADGPTHCGAFDVTFMACPPNMVVMAPSNEAELFNMV  540

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LPPGNKG P EVG+GRIL+EGERVAL+GYG AVQ+C
Sbjct  541   ATAAAIDDRPSCFRYPRGNGIGVPLPPGNKGIPXEVGKGRILIEGERVALLGYGAAVQNC  600

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA+L+ET GLRVTVADARFCKPLD +LIRSLAKSHEV+ITVEEGSIGGFGSHVA FMA
Sbjct  601   LAAASLVETPGLRVTVADARFCKPLDQSLIRSLAKSHEVLITVEEGSIGGFGSHVAHFMA  660

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             L+GLLDG LKWRPLV PDRYI+ G+PADQL EAGLTPS IAAT+FNILG  REAL+IM+
Sbjct  661   LNGLLDGXLKWRPLVXPDRYIEXGSPADQLIEAGLTPSXIAATIFNILGNKREALQIMS  719



>gb|AFU75321.1| 1-deoxy-D-xylulose-5-phosphate synthase 1 [Aquilaria sinensis]
Length=717

 Score =  1212 bits (3136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/690 (87%), Positives = 645/690 (93%), Gaps = 4/690 (1%)
 Frame = -2

Query  2380  GSDL---HLHFQQKPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLS  2210
             GSDL    LH   K +Q    + S    ASL+ + EY+SQR PTPLLDTINYPIHMKNLS
Sbjct  29    GSDLIFQSLH-NLKLNQAKVGRWSGEACASLSGRAEYHSQRQPTPLLDTINYPIHMKNLS  87

Query  2209  VKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYP  2030
             +KEL QLA ELRSDVIFNVS+TGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYP
Sbjct  88    IKELKQLAEELRSDVIFNVSETGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYP  147

Query  2029  HKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKN  1850
             HKILTGRR++M T+RQTNGL+GFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKG++N
Sbjct  148   HKILTGRRDRMHTMRQTNGLSGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGKRN  207

Query  1849  NVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSA  1670
             NV+AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSA
Sbjct  208   NVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPAPPVGALSSA  267

Query  1669  LSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIG  1490
             LSRLQSNRPLRELREVAKGVTKQ+ GPMHELAAKVDEYARGMISGSGSTLFEELGLYYIG
Sbjct  268   LSRLQSNRPLRELREVAKGVTKQLPGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIG  327

Query  1489  PVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGK  1310
             PVDGHN+DDLV+IL+EVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGV KFDPATGK
Sbjct  328   PVDGHNVDDLVAILKEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVVKFDPATGK  387

Query  1309  QFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAE  1130
             Q K SAKTQSYTTYFAEALIAEAE D+DIVAIHAAMGGGTGLN F  RFP+RCFDVGIAE
Sbjct  388   QLKPSAKTQSYTTYFAEALIAEAEVDQDIVAIHAAMGGGTGLNHFLHRFPARCFDVGIAE  447

Query  1129  QHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPT  950
             QH VTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPT
Sbjct  448   QHAVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPT  507

Query  949   HCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgn  770
             HCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAI+DRPSC RYPRGNG+GV LPPGN
Sbjct  508   HCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAINDRPSCFRYPRGNGLGVQLPPGN  567

Query  769   kGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHAL  590
             KGTPLE+G+GRIL+EGER AL+GYGTAVQSC++AA+ +E+ GLR TVADARFCKPLDH L
Sbjct  568   KGTPLEIGKGRILIEGERAALLGYGTAVQSCIAAASSVESHGLRPTVADARFCKPLDHGL  627

Query  589   IRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQ  410
             IR LAKSHEV+ITVEEGS GGFGSHVAQF+ALDGLLDG +KWRPLVLPDRYIDHG+PADQ
Sbjct  628   IRKLAKSHEVLITVEEGSTGGFGSHVAQFLALDGLLDGTVKWRPLVLPDRYIDHGSPADQ  687

Query  409   LAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LA++GLTP+HIAAT+FNILG  REALE+M+
Sbjct  688   LAQSGLTPAHIAATLFNILGHTREALEVMS  717



>ref|XP_007154212.1| hypothetical protein PHAVU_003G099600g [Phaseolus vulgaris]
 gb|ESW26206.1| hypothetical protein PHAVU_003G099600g [Phaseolus vulgaris]
Length=715

 Score =  1212 bits (3135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 601/670 (90%), Positives = 641/670 (96%), Gaps = 0/670 (0%)
 Frame = -2

Query  2329  KKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVS  2150
             KKRSSGV AS+++  EYYSQRPPTPLLDT+NYPIHMKNLS KEL QLA+ELRSDVIF+VS
Sbjct  46    KKRSSGVHASMSESGEYYSQRPPTPLLDTVNYPIHMKNLSTKELKQLADELRSDVIFSVS  105

Query  2149  KTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGL  1970
             +TGGHLGSSLGVVELTVALHYVFNAP+DKILWDVGHQSYPHKILTGRR+ M T+RQTNGL
Sbjct  106   RTGGHLGSSLGVVELTVALHYVFNAPKDKILWDVGHQSYPHKILTGRRDMMHTMRQTNGL  165

Query  1969  AGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAM  1790
             +GFTKRSESEYDCFGTGHSSTTISAGLGMA+GRDLKGR NNVIAVIGDGAMTAGQAYEAM
Sbjct  166   SGFTKRSESEYDCFGTGHSSTTISAGLGMAIGRDLKGRGNNVIAVIGDGAMTAGQAYEAM  225

Query  1789  NNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGV  1610
             NNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGV
Sbjct  226   NNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGV  285

Query  1609  TKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKST  1430
             TK+IGGPMHELAAKVDEYARGMI GSGSTLFEELGLYYIGPVDGHNIDDLV+IL EVKST
Sbjct  286   TKRIGGPMHELAAKVDEYARGMIGGSGSTLFEELGLYYIGPVDGHNIDDLVAILNEVKST  345

Query  1429  KTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALI  1250
             KTTGPVLIHV+TEKGRGYPYAEKAADKYHGVTKFDP TGKQFK  A TQSYTTYFAEALI
Sbjct  346   KTTGPVLIHVITEKGRGYPYAEKAADKYHGVTKFDPPTGKQFKTKAATQSYTTYFAEALI  405

Query  1249  AEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCA  1070
             AEAEADKDIVAIHAAMGGGTG+N+F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCA
Sbjct  406   AEAEADKDIVAIHAAMGGGTGMNIFHRRFPARCFDVGIAEQHAVTFAAGLACEGLKPFCA  465

Query  1069  IYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMA  890
             IYSSF+QRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMA
Sbjct  466   IYSSFLQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMA  525

Query  889   PSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVA  710
             PSDEAELFHMVATAAAI+DRPSC RYPRGNG+G  LP GNKGTPLE+G+GRIL+EGERVA
Sbjct  526   PSDEAELFHMVATAAAINDRPSCFRYPRGNGIGYELPAGNKGTPLEIGKGRILIEGERVA  585

Query  709   LVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIG  530
             L+GYG+AVQ+CL+AA+L+E  GLR+TVADARFCKPLD +LIRSLAKSHEV+ITVEEGSIG
Sbjct  586   LLGYGSAVQNCLAAASLVERHGLRLTVADARFCKPLDCSLIRSLAKSHEVLITVEEGSIG  645

Query  529   GFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILG  350
             GF SHVAQFMALDGLLDG LKWRP+VLPDRYIDHG+PADQL  AGLTPSHIAATVFNILG
Sbjct  646   GFASHVAQFMALDGLLDGKLKWRPIVLPDRYIDHGSPADQLFSAGLTPSHIAATVFNILG  705

Query  349   KAREALEIMT  320
             + REALE+ +
Sbjct  706   QTREALEVTS  715



>ref|XP_008795130.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Phoenix dactylifera]
Length=717

 Score =  1211 bits (3134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/719 (85%), Positives = 663/719 (92%), Gaps = 2/719 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL T   P +      SD +KP P SS    G+ L     Q  ++    ++S+ V ASL
Sbjct  1     MALATFFFPCNFLATAASDPEKPYPLSSHCLGGAALQA--LQHRNRFLKPRKSTCVCASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY+SQRPPTPLLDTINYPIHMKNLS+KEL QL++ELRSD+IF+VSKTGGHLGSSLG
Sbjct  59    SESGEYHSQRPPTPLLDTINYPIHMKNLSIKELKQLSDELRSDIIFHVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVA+HYVFNAP+DKILWDVGHQSYPHKILTGRR+KMPT+RQTNGL+GFTKRSESEY
Sbjct  119   VVELTVAIHYVFNAPEDKILWDVGHQSYPHKILTGRRDKMPTLRQTNGLSGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             D FG GHSST+ISA LGMAVGRDLKGR NNVIAVIGDG+MTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DSFGAGHSSTSISAALGMAVGRDLKGRNNNVIAVIGDGSMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTA LDGPIPPVGALSSALSRLQS+RPLRELREVAKGVTKQIGG M++L
Sbjct  239   VILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSSRPLRELREVAKGVTKQIGGSMYKL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLV+IL+EVKSTK TGPVLIHVV
Sbjct  299   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNMDDLVTILKEVKSTKATGPVLIHVV  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGVTKFDPATGKQFKASAKTQSYT YFAEALIAEAEADKDIVA
Sbjct  359   TEKGRGYPYAERAADKYHGVTKFDPATGKQFKASAKTQSYTNYFAEALIAEAEADKDIVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLN F RRFP+RCFDVGIAEQH VTFAAGL CEGLKPFCAIYSSF+QRAYD
Sbjct  419   IHAAMGGGTGLNYFLRRFPTRCFDVGIAEQHAVTFAAGLVCEGLKPFCAIYSSFLQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QV+HDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVT+MACLPNMVVMAPSDEAELFHMV
Sbjct  479   QVIHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTYMACLPNMVVMAPSDEAELFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAI+DRPSCLRYPRGNGVGV LPPGNKG PL+VG+GRIL+EGERVAL+GYGTAVQSC
Sbjct  539   ATAAAINDRPSCLRYPRGNGVGVPLPPGNKGVPLQVGKGRILIEGERVALLGYGTAVQSC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA L+E  GL+VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMA
Sbjct  599   LAAATLVERHGLKVTVADARFCKPLDQALIRSLAKSHEVLITVEEGSIGGFGSHVAQFMA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             L+GLLDG  KWRPLVLPDRYIDHG+PADQ+AEAGLTPSH+AATVFNILG+ REALEIM+
Sbjct  659   LNGLLDGKTKWRPLVLPDRYIDHGSPADQVAEAGLTPSHVAATVFNILGQTREALEIMS  717



>ref|XP_002870230.1| hypothetical protein ARALYDRAFT_493326 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46489.1| hypothetical protein ARALYDRAFT_493326 [Arabidopsis lyrata subsp. 
lyrata]
Length=717

 Score =  1211 bits (3134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/673 (88%), Positives = 635/673 (94%), Gaps = 0/673 (0%)
 Frame = -2

Query  2350  KPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRS  2171
             +P+  ++  R + V ASLA+K EYY+ RPPTPLLDTINYPIHMKNLSVKEL QL++ELRS
Sbjct  44    RPNNNSHTNRRAKVNASLAEKGEYYANRPPTPLLDTINYPIHMKNLSVKELKQLSDELRS  103

Query  2170  DVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPT  1991
             DVIFNVSKTGGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT
Sbjct  104   DVIFNVSKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPT  163

Query  1990  IRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTA  1811
             +RQTNGL+GFTKR ESE+DCFGTGHSSTTISAGLGMAVGRDLKG+ NNV+AVIGDGAMTA
Sbjct  164   MRQTNGLSGFTKRGESEHDCFGTGHSSTTISAGLGMAVGRDLKGKNNNVVAVIGDGAMTA  223

Query  1810  GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLREL  1631
             GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LREL
Sbjct  224   GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALREL  283

Query  1630  REVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSI  1451
             REVAKG+TKQIGGPMH+LAAKVDEYARGMISG+GS+LFEELGLYYIGPVDGHNIDDLV+I
Sbjct  284   REVAKGMTKQIGGPMHQLAAKVDEYARGMISGTGSSLFEELGLYYIGPVDGHNIDDLVAI  343

Query  1450  LQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTT  1271
             L+EVKST+TTGPVLIHVVTEKGRGYPYAE+A DKYHGV KFDPATGKQFK++ KTQSYTT
Sbjct  344   LKEVKSTRTTGPVLIHVVTEKGRGYPYAERADDKYHGVVKFDPATGKQFKSTNKTQSYTT  403

Query  1270  YFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACE  1091
             YFAEAL+AEAE DKD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACE
Sbjct  404   YFAEALVAEAEVDKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACE  463

Query  1090  GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACL  911
             GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACL
Sbjct  464   GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACL  523

Query  910   PNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRIL  731
             PNM+VMAPSDEA+LF+MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG P+E+G+GRIL
Sbjct  524   PNMIVMAPSDEADLFNMVATAAAIDDRPSCFRYPRGNGIGVALPPGNKGVPVEIGKGRIL  583

Query  730   MEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMIT  551
              EGERVAL+GYG+AVQSCL AA +LE RGL VTVADARFCKPLD ALIRSLAKSHEV+IT
Sbjct  584   KEGERVALLGYGSAVQSCLGAAVMLEERGLNVTVADARFCKPLDRALIRSLAKSHEVLIT  643

Query  550   VEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAA  371
             VEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDHGAPADQLAEAGL PSHIAA
Sbjct  644   VEEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGAPADQLAEAGLMPSHIAA  703

Query  370   TVFNILGKAREAL  332
             T  N++G  REAL
Sbjct  704   TALNLIGAPREAL  716



>gb|ACG27905.1| 1-deoxy-D-xylulose-5-phosphate synthase [Zea mays]
Length=719

 Score =  1211 bits (3132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/722 (84%), Positives = 654/722 (91%), Gaps = 12/722 (2%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLH--FQQKPSQINYKKRSSGVQA  2303
             MAL T ++P     +   D        S +    +LH+H   Q +P  +  ++R + V A
Sbjct  1     MALSTFSVPRGFLGVPAQD--------SHFASAVELHVHKLLQARPINLKPRRRPACVSA  52

Query  2302  SLADKDE--YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLG  2129
             SL+ + E  YYSQRPPTPLLDTINYP+HMKNLSVKEL QLA+ELRSDVIF+VSKTGGHLG
Sbjct  53    SLSSEREAEYYSQRPPTPLLDTINYPVHMKNLSVKELRQLADELRSDVIFHVSKTGGHLG  112

Query  2128  SSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRS  1949
             SSLGVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KMPT+RQTNGLAGFTKR+
Sbjct  113   SSLGVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMPTMRQTNGLAGFTKRA  172

Query  1948  ESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLD  1769
             ESEYD FGTGHSSTTISA LGMAVGRDLKG KNNV+AVIGDGAMTAGQAYEAMNNAGYLD
Sbjct  173   ESEYDSFGTGHSSTTISAALGMAVGRDLKGGKNNVVAVIGDGAMTAGQAYEAMNNAGYLD  232

Query  1768  SDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGP  1589
             SDMIVILNDNKQVSLPTATLDGP+PPVGALSSALS+LQS+RPLRELREVAKGVTKQIGG 
Sbjct  233   SDMIVILNDNKQVSLPTATLDGPVPPVGALSSALSKLQSSRPLRELREVAKGVTKQIGGS  292

Query  1588  MHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVL  1409
             +HELAAKVDEYARGMISG GS+LFEELGLYYIGPVDGHNIDDL++IL +VKSTKTTGPVL
Sbjct  293   VHELAAKVDEYARGMISGPGSSLFEELGLYYIGPVDGHNIDDLITILNDVKSTKTTGPVL  352

Query  1408  IHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADK  1229
             IHVVTEKGRGYPYAE+AADKYHGV KFDPATGKQFK+ AKT SYT YFAEALIAEAE D 
Sbjct  353   IHVVTEKGRGYPYAERAADKYHGVAKFDPATGKQFKSPAKTLSYTNYFAEALIAEAEQDS  412

Query  1228  DIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQ  1049
              IVAIHAAMGGGTGLN F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+Q
Sbjct  413   KIVAIHAAMGGGTGLNYFLRRFPNRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQ  472

Query  1048  RAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAEL  869
             R YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +MACLPNMVVMAPSDEAEL
Sbjct  473   RGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPSDEAEL  532

Query  868   FHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTA  689
              HMVATAAAIDDRPSC RYPRGNGVGV LPP  KGTPLEVG+GRIL+EG+RVAL+GYG+A
Sbjct  533   CHMVATAAAIDDRPSCFRYPRGNGVGVPLPPNYKGTPLEVGKGRILLEGDRVALLGYGSA  592

Query  688   VQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVA  509
             VQ CL+AA+L++  GL+VTVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHVA
Sbjct  593   VQYCLTAASLVQRHGLKVTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVA  652

Query  508   QFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALE  329
             QFMALDGLLDG LKWRPLVLPDRYIDHG+PADQLAEAGLTPSHIAA+VFNILG+ REAL 
Sbjct  653   QFMALDGLLDGKLKWRPLVLPDRYIDHGSPADQLAEAGLTPSHIAASVFNILGQNREALA  712

Query  328   IM  323
             IM
Sbjct  713   IM  714



>ref|XP_010244640.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic isoform X1 [Nelumbo nucifera]
Length=743

 Score =  1210 bits (3130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/718 (84%), Positives = 663/718 (92%), Gaps = 2/718 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGS-DLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MAL + + P  L R V S D  K   FSS  F G+DL   FQ + +++  ++R  GV AS
Sbjct  22    MALSSFSFPFHLPREVASSDSLKSISFSSHLFCGADLPHQFQNRHNKVR-RRRPDGVCAS  80

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L++  EY+SQRPPTPLLDTINYP HMKNLS KEL QLA+ELRSD+IF+VSKTGGHLGS+L
Sbjct  81    LSESGEYHSQRPPTPLLDTINYPNHMKNLSTKELMQLADELRSDIIFSVSKTGGHLGSNL  140

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHYVFN P+DKILWDVGHQSYPHKILTGRR+KMPT+R+TNGL+GFTKRSES+
Sbjct  141   GVVELTVALHYVFNCPEDKILWDVGHQSYPHKILTGRRDKMPTLRRTNGLSGFTKRSESD  200

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFGTGHSST+ISA LGMAVGRDLKGR+N VI+VIGDGAMTAGQAYEAMN+AGYLDSDM
Sbjct  201   YDCFGTGHSSTSISAALGMAVGRDLKGRENCVISVIGDGAMTAGQAYEAMNSAGYLDSDM  260

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDN+QVSLPTATLDGP PPVGALSSALSRLQS+RPLRELREVAKG+TK+IGG MH+
Sbjct  261   IVILNDNRQVSLPTATLDGPAPPVGALSSALSRLQSSRPLRELREVAKGITKKIGGDMHK  320

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGM+SGSGSTLFEELGLYYIGPVDGHNIDDLV+IL EVK+T+TTGPVLIHV
Sbjct  321   LAAKVDEYARGMVSGSGSTLFEELGLYYIGPVDGHNIDDLVAILWEVKNTRTTGPVLIHV  380

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAE+AADKYHGV KFDPATGKQFK+S  TQSYT YFA+ALIAEAEADK IV
Sbjct  381   VTEKGRGYPYAERAADKYHGVVKFDPATGKQFKSSTPTQSYTAYFAQALIAEAEADKYIV  440

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLFQ  FP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAY
Sbjct  441   AIHAAMGGGTGLNLFQHSFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAY  500

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQV+HDVDLQKLPVRFA+DRAGLVG+DGPTH G+FDVTFMACLPNMVVMAPSDEAEL+HM
Sbjct  501   DQVIHDVDLQKLPVRFALDRAGLVGADGPTHSGSFDVTFMACLPNMVVMAPSDEAELYHM  560

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAI+DRPSC RYPRGNG+GV LPPGNKG PLEVG+GR+L+EGERVAL+GYGTAVQS
Sbjct  561   VATAAAINDRPSCFRYPRGNGIGVKLPPGNKGIPLEVGKGRVLIEGERVALLGYGTAVQS  620

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+AA+L+E  GLRVTVADARFCKPLDH+LIRSLAKSHEV+ITVEEGSIGGFGSHVAQFM
Sbjct  621   CLAAASLVEHHGLRVTVADARFCKPLDHSLIRSLAKSHEVLITVEEGSIGGFGSHVAQFM  680

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             AL+GLLDG LKWRPLVLPDRYIDHG+PADQ+AEAGLTPS IAATVF+ILG+ REALEI
Sbjct  681   ALNGLLDGKLKWRPLVLPDRYIDHGSPADQMAEAGLTPSQIAATVFSILGQKREALEI  738



>gb|AAD56390.2|AF182286_1 1-deoxy-D-xylulose-5-phosphate synthase [Artemisia annua]
Length=713

 Score =  1210 bits (3130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 614/721 (85%), Positives = 669/721 (93%), Gaps = 10/721 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLS-RLVGSDLQKPRPFSSQWFHGSDLHLHFQQKP-SQINYKKRSSGVQA  2303
             MAL   A P  ++ R V S+    +P       G+DL+    QKP +QI   KRS+G+++
Sbjct  1     MALSAFAFPTQINHRSVTSN----QPLIQHCLFGTDLN--SSQKPFNQI--VKRSNGIRS  52

Query  2302  SLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSS  2123
             +L+++ EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDVIFNVSKTGGHLGSS
Sbjct  53    TLSERGEYHSQRPPTPLLDTINYPIHMKNLSVKELKQLADELRSDVIFNVSKTGGHLGSS  112

Query  2122  LGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSES  1943
             LGVVELTVALHYVFN PQDKILWDVGHQSYPHKILTGRR++M TIRQTNGLAGFTKRSES
Sbjct  113   LGVVELTVALHYVFNTPQDKILWDVGHQSYPHKILTGRRDQMHTIRQTNGLAGFTKRSES  172

Query  1942  EYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSD  1763
             E+DCFGTGHSSTTISAGLGMAVGRDLKG  N+V+A+IGDGAMTAGQAYEAMNNAGYLDSD
Sbjct  173   EHDCFGTGHSSTTISAGLGMAVGRDLKGGTNDVVAIIGDGAMTAGQAYEAMNNAGYLDSD  232

Query  1762  MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  1583
             MIVILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSNRPLRELREVAK VTKQIGGPMH
Sbjct  233   MIVILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNRPLRELREVAKEVTKQIGGPMH  292

Query  1582  ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIH  1403
             ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGH+IDDLV+IL+EVKSTKTTGPVLIH
Sbjct  293   ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHSIDDLVAILKEVKSTKTTGPVLIH  352

Query  1402  VVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDI  1223
             V+TEKGRGYPYAEKAADKYHGV KFDPATGKQFK+SA TQSYTTYFAEALIAEAEADK I
Sbjct  353   VITEKGRGYPYAEKAADKYHGVGKFDPATGKQFKSSAPTQSYTTYFAEALIAEAEADKKI  412

Query  1222  VAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRA  1043
             V IHAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QR 
Sbjct  413   VGIHAAMGGGTGMNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRG  472

Query  1042  YDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  863
             YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTH G+FDVTFMACLPNMVVMAPSDEAELF+
Sbjct  473   YDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHSGSFDVTFMACLPNMVVMAPSDEAELFN  532

Query  862   MVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQ  683
             MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG PLEVG+GRI++EG+RVAL+GYGTAVQ
Sbjct  533   MVATAAAIDDRPSCFRYPRGNGIGVPLPPGNKGVPLEVGKGRIMLEGQRVALLGYGTAVQ  592

Query  682   SCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQF  503
             SC++AA +++ RGL +TVADARFCKPLDH+LIR+LAK+HEV+ITVEEGSIGGFGSHVA F
Sbjct  593   SCMAAATIVQERGLNITVADARFCKPLDHSLIRALAKTHEVLITVEEGSIGGFGSHVAHF  652

Query  502   MALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             +ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFN+LG+ REALE+M
Sbjct  653   LALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNVLGQTREALEVM  712

Query  322   T  320
             +
Sbjct  713   S  713



>ref|XP_006283213.1| hypothetical protein CARUB_v10004244mg [Capsella rubella]
 gb|EOA16111.1| hypothetical protein CARUB_v10004244mg [Capsella rubella]
Length=718

 Score =  1210 bits (3130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/673 (88%), Positives = 634/673 (94%), Gaps = 0/673 (0%)
 Frame = -2

Query  2350  KPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRS  2171
             +P+  ++  R + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLSVKEL QL++ELRS
Sbjct  45    RPNNNSHSNRKAKVYASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSVKELKQLSDELRS  104

Query  2170  DVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPT  1991
             DVIFNVSKTGGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT
Sbjct  105   DVIFNVSKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPT  164

Query  1990  IRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTA  1811
             +RQTNGL+GFTKR ESE+DCFGTGHSSTTISAGLGMAVGRDLKG  NNV+AVIGDGAMTA
Sbjct  165   MRQTNGLSGFTKRGESEHDCFGTGHSSTTISAGLGMAVGRDLKGLNNNVVAVIGDGAMTA  224

Query  1810  GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLREL  1631
             GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LREL
Sbjct  225   GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALREL  284

Query  1630  REVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSI  1451
             REVAKG+TKQIGGPMH+LAAKVDEYARGMISG+GS+LFEELGLYYIGPVDGHNIDDLV+I
Sbjct  285   REVAKGMTKQIGGPMHQLAAKVDEYARGMISGTGSSLFEELGLYYIGPVDGHNIDDLVAI  344

Query  1450  LQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTT  1271
             L+EVKST+TTGPVLIHVVTEKGRGYPYAE+A DKYHGV KFDPATGKQFK++ KTQSYTT
Sbjct  345   LKEVKSTRTTGPVLIHVVTEKGRGYPYAERADDKYHGVVKFDPATGKQFKSTNKTQSYTT  404

Query  1270  YFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACE  1091
             YFAEAL+AEAE DKD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACE
Sbjct  405   YFAEALVAEAEVDKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACE  464

Query  1090  GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACL  911
             GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACL
Sbjct  465   GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACL  524

Query  910   PNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRIL  731
             PNM+VMAPSDEA+LF+MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG P+E+G+GRIL
Sbjct  525   PNMIVMAPSDEADLFNMVATAAAIDDRPSCFRYPRGNGIGVALPPGNKGVPIEIGKGRIL  584

Query  730   MEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMIT  551
              EGERVAL+GYG+AVQSCL AA +LE RGL VTVADARFCKPLD ALIRSLAKSHEV+IT
Sbjct  585   KEGERVALLGYGSAVQSCLGAAIMLEERGLNVTVADARFCKPLDRALIRSLAKSHEVLIT  644

Query  550   VEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAA  371
             VEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDHGAPADQLAEAGL PSHIAA
Sbjct  645   VEEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGAPADQLAEAGLMPSHIAA  704

Query  370   TVFNILGKAREAL  332
             T  N++G  REAL
Sbjct  705   TALNLIGAPREAL  717



>ref|XP_009419852.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=751

 Score =  1209 bits (3129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/686 (86%), Positives = 646/686 (94%), Gaps = 1/686 (0%)
 Frame = -2

Query  2377  SDLHLHFQQKPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKEL  2198
             +DL  H Q  P+++   K+ + V ASL++  EY+SQRPPTPLLDT+N+PIHMKNLSV+EL
Sbjct  67    TDLQ-HQQPLPTRVLKPKKRACVCASLSETGEYHSQRPPTPLLDTVNFPIHMKNLSVREL  125

Query  2197  NQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKIL  2018
              QLA+ELRSD+IFNVS+TGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKIL
Sbjct  126   KQLADELRSDIIFNVSRTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKIL  185

Query  2017  TGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIA  1838
             TGRR+KM T+RQTNGL+GFTKRSESEYDCFG GHSST+ISA LGMAVGRDLKGRKNNV+A
Sbjct  186   TGRRDKMATMRQTNGLSGFTKRSESEYDCFGAGHSSTSISAALGMAVGRDLKGRKNNVVA  245

Query  1837  VIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRL  1658
             VIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP+PPVGALSSALSRL
Sbjct  246   VIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPVPPVGALSSALSRL  305

Query  1657  QSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDG  1478
             QS++PLRELREVAKGVTKQIGG MHE+AAKVDEYARGMI GSGSTLFEELGLYYIGPVDG
Sbjct  306   QSSKPLRELREVAKGVTKQIGGSMHEIAAKVDEYARGMIGGSGSTLFEELGLYYIGPVDG  365

Query  1477  HNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKA  1298
             HNIDDLV+IL++VKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGV KFDPATGKQFK+
Sbjct  366   HNIDDLVAILKDVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVAKFDPATGKQFKS  425

Query  1297  SAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGV  1118
              +KTQSYT YFAEALIAEAE D+ IVAIHAAMGGGTGLN F R +P+RCFDVGIAEQH V
Sbjct  426   GSKTQSYTNYFAEALIAEAEVDEGIVAIHAAMGGGTGLNYFLRCYPTRCFDVGIAEQHAV  485

Query  1117  TFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGA  938
             TFAAGLACEGLKPFCAIYSSF+QRAYDQV+HDVDLQKLPVRFAMDRAGLVG+DGPTHCG+
Sbjct  486   TFAAGLACEGLKPFCAIYSSFLQRAYDQVIHDVDLQKLPVRFAMDRAGLVGADGPTHCGS  545

Query  937   FDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTP  758
             FDVT+MACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC RYPRGNG+GV LPPGNKG P
Sbjct  546   FDVTYMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRYPRGNGIGVPLPPGNKGIP  605

Query  757   LEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSL  578
             LEVG+GRIL EGERV L+GYGTAVQSCL+AA+LLE RGL++TVADARFCKPLD +LIR+L
Sbjct  606   LEVGKGRILKEGERVTLLGYGTAVQSCLAAASLLEERGLKITVADARFCKPLDRSLIRNL  665

Query  577   AKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEA  398
             A+SHEV++TVEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDHG+P DQLAEA
Sbjct  666   ARSHEVLLTVEEGSIGGFGSHVVQFLALDGLLDGTLKWRPVVLPDRYIDHGSPRDQLAEA  725

Query  397   GLTPSHIAATVFNILGKAREALEIMT  320
             GLTPSHIAATV NILG+ REALEIM+
Sbjct  726   GLTPSHIAATVLNILGQTREALEIMS  751



>ref|XP_010105036.1| putative 1-deoxy-D-xylulose-5-phosphate synthase [Morus notabilis]
 gb|EXC03145.1| putative 1-deoxy-D-xylulose-5-phosphate synthase [Morus notabilis]
Length=762

 Score =  1209 bits (3129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 622/716 (87%), Positives = 669/716 (93%), Gaps = 4/716 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MALCT + PG ++R   SD QK   FSSQ+  G+DL    Q K +Q+  +KR  GV ASL
Sbjct  1     MALCTLSFPGHITR--ASDPQKSASFSSQFSWGTDLLGQSQCKLNQV--RKRPGGVYASL  56

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDVIFNVSKTGGHLGSSLG
Sbjct  57    SEMGEYHSQRPPTPLLDTINYPIHMKNLSVKELKQLADELRSDVIFNVSKTGGHLGSSLG  116

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHY FN PQD+ILWDVGHQSYPHKILTGRR+KM T+RQTNGL+GFTKRSESEY
Sbjct  117   VVELTVALHYAFNTPQDRILWDVGHQSYPHKILTGRRDKMHTMRQTNGLSGFTKRSESEY  176

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLKGRKN+V+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  177   DCFGTGHSSTTISAGLGMAVGRDLKGRKNHVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  236

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             +ILNDNKQVSLPTATLDGP+PPVGALSSAL+RLQSNRPLRELREVAKGVTKQIGG +HEL
Sbjct  237   IILNDNKQVSLPTATLDGPVPPVGALSSALTRLQSNRPLRELREVAKGVTKQIGGSVHEL  296

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLV+IL+EVKSTKTTGPVLIH V
Sbjct  297   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVAILKEVKSTKTTGPVLIHCV  356

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAEKAADKYHGV KFDPATGKQFK+S+ TQSYTTYFAEALIAEAEADKDIVA
Sbjct  357   TEKGRGYPYAEKAADKYHGVAKFDPATGKQFKSSSSTQSYTTYFAEALIAEAEADKDIVA  416

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  417   IHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  476

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             Q +HDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMAPSDEAELFHM+
Sbjct  477   QAIHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMAPSDEAELFHMI  536

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATA+AI+DRPSC RYPRGNGVGV LPPGNKG PLEVG+GRIL+EG+RVAL+GYG AVQSC
Sbjct  537   ATASAINDRPSCFRYPRGNGVGVPLPPGNKGIPLEVGKGRILIEGDRVALLGYGAAVQSC  596

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA L+E  GLR+TVADARFCKPLD ALIRSLAK+HE++ITVEEGSIGGFGSHVAQF+A
Sbjct  597   LAAAHLVEPHGLRLTVADARFCKPLDRALIRSLAKNHEILITVEEGSIGGFGSHVAQFLA  656

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALE  329
             LDGLLDG +KWRPLVLPDRYIDHG+PADQ AEAGLTPSHIAATVFNILG+ REALE
Sbjct  657   LDGLLDGKIKWRPLVLPDRYIDHGSPADQFAEAGLTPSHIAATVFNILGQTREALE  712



>ref|XP_004962111.1| PREDICTED: 1-deoxy-D-xylulose-5-phosphate synthase 1, chloroplastic-like 
[Setaria italica]
Length=717

 Score =  1209 bits (3129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/692 (86%), Positives = 645/692 (93%), Gaps = 1/692 (0%)
 Frame = -2

Query  2395  SQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLADKD-EYYSQRPPTPLLDTINYPIHMK  2219
             S +   ++LH H Q +   I  ++R + V ASL++++ EYYSQRPPTPLLDTINYP+HMK
Sbjct  21    SHFAPAAELHAHKQLQARPIKPRRRPACVSASLSEREAEYYSQRPPTPLLDTINYPVHMK  80

Query  2218  NLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQ  2039
             NLSVKEL QLA+ELRSDVIF+VSKTGGHLGSSLGVVELTVALHYVFNAPQD+ILWDVGHQ
Sbjct  81    NLSVKELRQLADELRSDVIFHVSKTGGHLGSSLGVVELTVALHYVFNAPQDRILWDVGHQ  140

Query  2038  SYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKG  1859
             SYPHKILTGRR+KMPT+RQTNGLAGFTKR+ESEYD FGTGHSSTTISA LGMAVGRDLKG
Sbjct  141   SYPHKILTGRRDKMPTMRQTNGLAGFTKRAESEYDSFGTGHSSTTISAALGMAVGRDLKG  200

Query  1858  RKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGAL  1679
              KN+V+AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP+PPVGAL
Sbjct  201   SKNHVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPVPPVGAL  260

Query  1678  SSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLY  1499
             SSALS+LQS+RPLRELREVAKGVTKQIGG +HELAAKVDEYARGMISG GS+LFEELGLY
Sbjct  261   SSALSKLQSSRPLRELREVAKGVTKQIGGSVHELAAKVDEYARGMISGPGSSLFEELGLY  320

Query  1498  YIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPA  1319
             YIGPVDGHNIDDL++IL +VKSTKTTGPVLIHV+TEKGRGYPYAE+AADKYHGV KFDPA
Sbjct  321   YIGPVDGHNIDDLITILNDVKSTKTTGPVLIHVITEKGRGYPYAERAADKYHGVAKFDPA  380

Query  1318  TGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVG  1139
             TGKQFK+ AKT SYT YFAEALIAEAE D  IVAIHAAMGGGTGLN F RRFP+RCFDVG
Sbjct  381   TGKQFKSPAKTLSYTNYFAEALIAEAEQDSKIVAIHAAMGGGTGLNYFLRRFPNRCFDVG  440

Query  1138  IAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSD  959
             IAEQH VTFAAGLACEGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+D
Sbjct  441   IAEQHAVTFAAGLACEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGAD  500

Query  958   GPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlp  779
             GPTHCGAFDVT+MACLPNMVVMAPSDEAEL HMVATAAAIDDRPSC RYPRGNG+GV LP
Sbjct  501   GPTHCGAFDVTYMACLPNMVVMAPSDEAELCHMVATAAAIDDRPSCFRYPRGNGIGVPLP  560

Query  778   pgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLD  599
             P  KGTPLEVG+GRIL+EG++VAL+GYG+AVQ CL+AA L+E  GL+VTVADARFCKPLD
Sbjct  561   PNYKGTPLEVGKGRILLEGDQVALLGYGSAVQYCLAAATLVERHGLKVTVADARFCKPLD  620

Query  598   HALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAP  419
              ALIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMALDGLLDG LKWRPLVLPDRYIDHG+P
Sbjct  621   QALIRSLAKSHEVLITVEEGSIGGFGSHVAQFMALDGLLDGKLKWRPLVLPDRYIDHGSP  680

Query  418   ADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             ADQLAEAGLTPSHIAATVFN+LG+ REAL IM
Sbjct  681   ADQLAEAGLTPSHIAATVFNVLGQNREALAIM  712



>gb|AFW77975.1| 1-deoxy-D-xylulose 5-phosphate synthase 1 [Zea mays]
Length=719

 Score =  1209 bits (3129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/722 (84%), Positives = 654/722 (91%), Gaps = 12/722 (2%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLH--FQQKPSQINYKKRSSGVQA  2303
             MAL T ++P     +   D        S +    +LH++   Q +P  +  ++R + V A
Sbjct  1     MALSTFSVPRGFLGVPAQD--------SHFASAVELHVNKLLQARPINLKPRRRPACVSA  52

Query  2302  SLADKDE--YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLG  2129
             SL+ + E  YYSQRPPTPLLDTINYP+HMKNLSVKEL QLA+ELRSDVIF+VSKTGGHLG
Sbjct  53    SLSSEREAEYYSQRPPTPLLDTINYPVHMKNLSVKELRQLADELRSDVIFHVSKTGGHLG  112

Query  2128  SSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRS  1949
             SSLGVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KMPT+RQTNGLAGFTKR+
Sbjct  113   SSLGVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMPTMRQTNGLAGFTKRA  172

Query  1948  ESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLD  1769
             ESEYD FGTGHSSTTISA LGMAVGRDLKG KNNV+AVIGDGAMTAGQAYEAMNNAGYLD
Sbjct  173   ESEYDSFGTGHSSTTISAALGMAVGRDLKGGKNNVVAVIGDGAMTAGQAYEAMNNAGYLD  232

Query  1768  SDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGP  1589
             SDMIVILNDNKQVSLPTATLDGP+PPVGALSSALS+LQS+RPLRELREVAKGVTKQIGG 
Sbjct  233   SDMIVILNDNKQVSLPTATLDGPVPPVGALSSALSKLQSSRPLRELREVAKGVTKQIGGS  292

Query  1588  MHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVL  1409
             +HELAAKVDEYARGMISG GS+LFEELGLYYIGPVDGHNIDDL++IL +VKSTKTTGPVL
Sbjct  293   VHELAAKVDEYARGMISGPGSSLFEELGLYYIGPVDGHNIDDLITILNDVKSTKTTGPVL  352

Query  1408  IHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADK  1229
             IHVVTEKGRGYPYAE+AADKYHGV KFDPATGKQFK+ AKT SYT YFAEALIAEAE D 
Sbjct  353   IHVVTEKGRGYPYAERAADKYHGVAKFDPATGKQFKSPAKTLSYTNYFAEALIAEAEQDS  412

Query  1228  DIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQ  1049
              IVAIHAAMGGGTGLN F RRFPSRCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+Q
Sbjct  413   KIVAIHAAMGGGTGLNYFLRRFPSRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQ  472

Query  1048  RAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAEL  869
             R YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +MACLPNMVVMAPSDEAEL
Sbjct  473   RGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPSDEAEL  532

Query  868   FHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTA  689
              HMVATAAAIDDRPSC RYPRGNGVGV LPP  KGTPLEVG+GRIL+EG+RVAL+GYG+A
Sbjct  533   CHMVATAAAIDDRPSCFRYPRGNGVGVPLPPNYKGTPLEVGKGRILLEGDRVALLGYGSA  592

Query  688   VQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVA  509
             VQ CL+AA+L++  GL+VTVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHVA
Sbjct  593   VQYCLTAASLVQRHGLKVTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVA  652

Query  508   QFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALE  329
             QFMALDGLLDG LKWRPLVLPDRYIDHG+PADQLAEAGLTPSHIAA+VFNILG+ REAL 
Sbjct  653   QFMALDGLLDGKLKWRPLVLPDRYIDHGSPADQLAEAGLTPSHIAASVFNILGQNREALA  712

Query  328   IM  323
             IM
Sbjct  713   IM  714



>gb|ABP88134.1| 1-deoxy-D-xylulose 5-phosphate synthase [Zea mays]
Length=719

 Score =  1209 bits (3127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/722 (84%), Positives = 654/722 (91%), Gaps = 12/722 (2%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLH--FQQKPSQINYKKRSSGVQA  2303
             MAL T ++P     +   D        S +    +LH++   Q +P  +  ++R + V A
Sbjct  1     MALSTFSVPRGFLGVPAQD--------SHFASAVELHVNKLLQARPINLKPRRRPACVSA  52

Query  2302  SLADKDE--YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLG  2129
             SL+ + E  YYSQRPPTPLLDTINYP+HMKNLSVKEL QLA+ELRSDVIF+VSKTGGHLG
Sbjct  53    SLSSEREAEYYSQRPPTPLLDTINYPVHMKNLSVKELRQLADELRSDVIFHVSKTGGHLG  112

Query  2128  SSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRS  1949
             SSLGVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KMPT+RQTNGLAGFTKR+
Sbjct  113   SSLGVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMPTMRQTNGLAGFTKRA  172

Query  1948  ESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLD  1769
             ESEYD FGTGHSSTTISA LGMAVGRDLKG KNNV+AVIGDGAMTAGQAYEAMNNAGYLD
Sbjct  173   ESEYDSFGTGHSSTTISAALGMAVGRDLKGGKNNVVAVIGDGAMTAGQAYEAMNNAGYLD  232

Query  1768  SDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGP  1589
             SDMIVILNDNKQVSLPTATLDGP+PPVGALSSALS+LQS+RPLRELREVAKGVTKQIGG 
Sbjct  233   SDMIVILNDNKQVSLPTATLDGPVPPVGALSSALSKLQSSRPLRELREVAKGVTKQIGGS  292

Query  1588  MHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVL  1409
             +HELAAKVDEYARGMISG GS+LFEELGLYYIGPVDGHNIDDL++IL +VKSTKTTGPVL
Sbjct  293   VHELAAKVDEYARGMISGPGSSLFEELGLYYIGPVDGHNIDDLITILNDVKSTKTTGPVL  352

Query  1408  IHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADK  1229
             IHVVTEKGRGYPYAE+AADKYHGV KFDPATGKQFK+ AKT SYT YFAEALIAEAE D 
Sbjct  353   IHVVTEKGRGYPYAERAADKYHGVAKFDPATGKQFKSPAKTLSYTNYFAEALIAEAEQDS  412

Query  1228  DIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQ  1049
              IVAIHAAMGGGTGLN F RRFPSRCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+Q
Sbjct  413   KIVAIHAAMGGGTGLNYFLRRFPSRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQ  472

Query  1048  RAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAEL  869
             R YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +MACLPNMVVMAPSDEAEL
Sbjct  473   RGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPSDEAEL  532

Query  868   FHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTA  689
              HMVATAAAIDDRPSC RYPRGNGVGV LPP  KGTPLEVG+GRIL+EG+RVAL+GYG+A
Sbjct  533   CHMVATAAAIDDRPSCFRYPRGNGVGVPLPPNYKGTPLEVGKGRILLEGDRVALLGYGSA  592

Query  688   VQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVA  509
             VQ CL+AA+L++  GL+VTVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSH+A
Sbjct  593   VQYCLTAASLVQRHGLKVTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHIA  652

Query  508   QFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALE  329
             QFMALDGLLDG LKWRPLVLPDRYIDHG+PADQLAEAGLTPSHIAA+VFNILG+ REAL 
Sbjct  653   QFMALDGLLDGKLKWRPLVLPDRYIDHGSPADQLAEAGLTPSHIAASVFNILGQNREALA  712

Query  328   IM  323
             IM
Sbjct  713   IM  714



>gb|ACR02668.1| chloroplast 1-deoxy-D-xylulose-5-phosphate synthase [Amomum villosum]
Length=715

 Score =  1208 bits (3126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/719 (83%), Positives = 660/719 (92%), Gaps = 4/719 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             M+L T   P  L     S+ QK    SS +   ++LH H Q+    +  KKRSS V ASL
Sbjct  1     MSLSTLPFPCHLFGTAASNHQKSNT-SSPFL--TELH-HRQEHSRSLKSKKRSSCVCASL  56

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY+SQRPPTPLLDTINYPIHMKNLS++EL QL+ ELRSDVIFNVSKTGGHLGSSLG
Sbjct  57    SEIGEYHSQRPPTPLLDTINYPIHMKNLSLRELKQLSEELRSDVIFNVSKTGGHLGSSLG  116

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVF+AP+DKILWDVGHQSYPHKILTGRR+KM T+RQT+GL+GFTKRSES+Y
Sbjct  117   VVELTVALHYVFSAPRDKILWDVGHQSYPHKILTGRRDKMQTLRQTDGLSGFTKRSESDY  176

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             D FG GHSST+ISA LGMAVGRDL GRKNNVIAVIGDG+MTAGQAYEAMNNAGYLDSDMI
Sbjct  177   DAFGAGHSSTSISAALGMAVGRDLMGRKNNVIAVIGDGSMTAGQAYEAMNNAGYLDSDMI  236

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGP+PPVGALSSALSRLQS++PLRELREVAKGVTK+IGG MHE+
Sbjct  237   VILNDNKQVSLPTATLDGPVPPVGALSSALSRLQSSKPLRELREVAKGVTKKIGGSMHEI  296

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLV+IL+EVKSTKTTGPVLIHVV
Sbjct  297   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVTILKEVKSTKTTGPVLIHVV  356

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAEKAADKYHGVTKFDPATGKQFK+S++T+SYT YFA+AL+AEAE DKDIVA
Sbjct  357   TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKSSSQTKSYTNYFADALVAEAEVDKDIVA  416

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLN F R+FP RCFDVGIAEQH VTFAAGL CEGLKPFCAIYSSF+QRAYD
Sbjct  417   IHAAMGGGTGLNYFLRKFPDRCFDVGIAEQHAVTFAAGLTCEGLKPFCAIYSSFLQRAYD  476

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QV+HDVDLQKLPVRFA+DRAGLVG+DGPTH GAFDV +MACLPNMVVMAPSDEAELFHMV
Sbjct  477   QVIHDVDLQKLPVRFALDRAGLVGADGPTHSGAFDVAYMACLPNMVVMAPSDEAELFHMV  536

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNGVGV L PGNKG PLE+G+GRIL+EGERVAL+GYGTAVQSC
Sbjct  537   ATAAAIDDRPSCFRYPRGNGVGVPLLPGNKGVPLEIGKGRILIEGERVALLGYGTAVQSC  596

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA+++E +GL++TVADARFCKPLD +LIRSLAKSHEV+ITVEEGSIGGF SHVAQFMA
Sbjct  597   LAAASMVELQGLKITVADARFCKPLDRSLIRSLAKSHEVLITVEEGSIGGFSSHVAQFMA  656

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG LKWRPLVLPDRYIDHG+P DQLAEAGLTPSHIAA+VFN++G+ REAL++M+
Sbjct  657   LDGLLDGKLKWRPLVLPDRYIDHGSPRDQLAEAGLTPSHIAASVFNVIGQTREALKMMS  715



>ref|NP_193291.1| 1-deoxy-D-xylulose-5-phosphate synthase [Arabidopsis thaliana]
 sp|Q38854.2|DXS_ARATH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic; 
Short=1-deoxyxylulose-5-phosphate synthase; Short=DXP 
synthase; Short=DXPS; AltName: Full=Protein CLOROPLASTOS 
ALTERADOS 1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB45992.1| DEF (CLA1) protein [Arabidopsis thaliana]
 emb|CAB78598.1| DEF (CLA1) protein [Arabidopsis thaliana]
 gb|AAN86173.1| putative DEF (CLA1) protein [Arabidopsis thaliana]
 gb|AEE83625.1| 1-deoxy-D-xylulose-5-phosphate synthase [Arabidopsis thaliana]
 gb|AFM91070.1| 1-deoxy-D-xylulose 5-phosphate synthase [synthetic construct]
Length=717

 Score =  1208 bits (3125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/673 (88%), Positives = 633/673 (94%), Gaps = 0/673 (0%)
 Frame = -2

Query  2350  KPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRS  2171
             KP+  ++  R + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLSVKEL QL++ELRS
Sbjct  44    KPNNNSHSNRRAKVCASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSVKELKQLSDELRS  103

Query  2170  DVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPT  1991
             DVIFNVSKTGGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT
Sbjct  104   DVIFNVSKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPT  163

Query  1990  IRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTA  1811
             +RQTNGL+GFTKR ESE+DCFGTGHSSTTISAGLGMAVGRDLKG+ NNV+AVIGDGAMTA
Sbjct  164   MRQTNGLSGFTKRGESEHDCFGTGHSSTTISAGLGMAVGRDLKGKNNNVVAVIGDGAMTA  223

Query  1810  GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLREL  1631
             GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LREL
Sbjct  224   GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALREL  283

Query  1630  REVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSI  1451
             REVAKG+TKQIGGPMH+LAAKVDEYARGMISG+GS+LFEELGLYYIGPVDGHNIDDLV+I
Sbjct  284   REVAKGMTKQIGGPMHQLAAKVDEYARGMISGTGSSLFEELGLYYIGPVDGHNIDDLVAI  343

Query  1450  LQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTT  1271
             L+EVKST+TTGPVLIHVVTEKGRGYPYAE+A DKYHGV KFDPATG+QFK + KTQSYTT
Sbjct  344   LKEVKSTRTTGPVLIHVVTEKGRGYPYAERADDKYHGVVKFDPATGRQFKTTNKTQSYTT  403

Query  1270  YFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACE  1091
             YFAEAL+AEAE DKD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACE
Sbjct  404   YFAEALVAEAEVDKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACE  463

Query  1090  GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACL  911
             GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACL
Sbjct  464   GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACL  523

Query  910   PNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRIL  731
             PNM+VMAPSDEA+LF+MVATA AIDDRPSC RYPRGNG+GV LPPGNKG P+E+G+GRIL
Sbjct  524   PNMIVMAPSDEADLFNMVATAVAIDDRPSCFRYPRGNGIGVALPPGNKGVPIEIGKGRIL  583

Query  730   MEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMIT  551
              EGERVAL+GYG+AVQSCL AA +LE RGL VTVADARFCKPLD ALIRSLAKSHEV+IT
Sbjct  584   KEGERVALLGYGSAVQSCLGAAVMLEERGLNVTVADARFCKPLDRALIRSLAKSHEVLIT  643

Query  550   VEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAA  371
             VEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDHGAPADQLAEAGL PSHIAA
Sbjct  644   VEEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGAPADQLAEAGLMPSHIAA  703

Query  370   TVFNILGKAREAL  332
             T  N++G  REAL
Sbjct  704   TALNLIGAPREAL  716



>ref|XP_010434528.1| PREDICTED: 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Camelina sativa]
Length=719

 Score =  1207 bits (3122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/664 (89%), Positives = 627/664 (94%), Gaps = 0/664 (0%)
 Frame = -2

Query  2323  RSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKT  2144
             R + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLSVKEL QL++ELRSDVIFNVSKT
Sbjct  55    RKAKVYASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSVKELKQLSDELRSDVIFNVSKT  114

Query  2143  GGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAG  1964
             GGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT+RQTNGL+G
Sbjct  115   GGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPTMRQTNGLSG  174

Query  1963  FTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNN  1784
             FTKR ESE+DCFGTGHSSTTISAGLGMAVGRDLKG  NNV+AVIGDGAMTAGQAYEAMNN
Sbjct  175   FTKRGESEHDCFGTGHSSTTISAGLGMAVGRDLKGNNNNVVAVIGDGAMTAGQAYEAMNN  234

Query  1783  AGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTK  1604
             AGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LRELREVAKGVTK
Sbjct  235   AGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALRELREVAKGVTK  294

Query  1603  QIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKT  1424
             QIGGPMH+LAAKVDEYARGMISG+GS+LFEELGLYYIGPVDGHNIDD+V+IL+EVKS +T
Sbjct  295   QIGGPMHQLAAKVDEYARGMISGTGSSLFEELGLYYIGPVDGHNIDDMVAILKEVKSART  354

Query  1423  TGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAE  1244
             TGPVLIHVVTEKGRGYPYAE+A DKYHGV KFDPATGKQFK + KTQSYTTYFAEAL+AE
Sbjct  355   TGPVLIHVVTEKGRGYPYAERADDKYHGVVKFDPATGKQFKTTNKTQSYTTYFAEALVAE  414

Query  1243  AEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIY  1064
             AE DKD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIY
Sbjct  415   AEVDKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIY  474

Query  1063  SSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPS  884
             SSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNM+VMAPS
Sbjct  475   SSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMIVMAPS  534

Query  883   DEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALV  704
             DEA+LF+MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG P+E+GRGRIL EGERVAL+
Sbjct  535   DEADLFNMVATAAAIDDRPSCFRYPRGNGIGVALPPGNKGVPIEIGRGRILKEGERVALL  594

Query  703   GYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGF  524
             GYG+AVQSCL AA +LE RGL VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGF
Sbjct  595   GYGSAVQSCLGAAIMLEERGLNVTVADARFCKPLDRALIRSLAKSHEVLITVEEGSIGGF  654

Query  523   GSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKA  344
             GSHV QF+ALDGLLDG LKWRP+VLPDRYIDHGAPADQLAEAGL PSHIAAT  N++G  
Sbjct  655   GSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGAPADQLAEAGLMPSHIAATALNLIGAP  714

Query  343   REAL  332
             REAL
Sbjct  715   REAL  718



>ref|NP_001157805.1| deoxy xylulose synthase 1 [Zea mays]
 gb|ACT32136.1| 1-deoxy-D-xylulose 5-phosphate synthase [Zea mays]
Length=719

 Score =  1207 bits (3122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/722 (84%), Positives = 654/722 (91%), Gaps = 12/722 (2%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLH--FQQKPSQINYKKRSSGVQA  2303
             MAL T ++P     +   D        S +    +LH++   Q +P  +  ++R + V A
Sbjct  1     MALSTFSVPRGFLGVPAQD--------SHFASAVELHVNKLLQARPINLKPRRRPACVSA  52

Query  2302  SLADKDE--YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLG  2129
             SL+ + E  YYSQRPPTPLLDTINYP+HMKNLSVKEL QLA+ELRSDVIF+VSKTGGHLG
Sbjct  53    SLSSEREAEYYSQRPPTPLLDTINYPVHMKNLSVKELRQLADELRSDVIFHVSKTGGHLG  112

Query  2128  SSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRS  1949
             SSLGVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KMPT+RQTNGLAGFTKR+
Sbjct  113   SSLGVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMPTMRQTNGLAGFTKRA  172

Query  1948  ESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLD  1769
             ESEYD FGTGHSSTTISA LGMAVGRDLKG KNNV+AVIGDGAMTAGQAYEAMNNAGYLD
Sbjct  173   ESEYDSFGTGHSSTTISAALGMAVGRDLKGGKNNVVAVIGDGAMTAGQAYEAMNNAGYLD  232

Query  1768  SDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGP  1589
             SDMIVILNDNKQVSLPTATLDGP+PPVGALSSALS+LQS+RPLRELREVAKGVT+QIGG 
Sbjct  233   SDMIVILNDNKQVSLPTATLDGPVPPVGALSSALSKLQSSRPLRELREVAKGVTRQIGGS  292

Query  1588  MHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVL  1409
             +HELAAKVDEYARGMISG GS+LFEELGLYYIGPVDGHNIDDL++IL +VKSTKTTGPVL
Sbjct  293   VHELAAKVDEYARGMISGPGSSLFEELGLYYIGPVDGHNIDDLITILNDVKSTKTTGPVL  352

Query  1408  IHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADK  1229
             IHVVTEKGRGYPYAE+AADKYHGV KFDPATGKQFK+ AKT SYT YFAEALIAEAE D 
Sbjct  353   IHVVTEKGRGYPYAERAADKYHGVAKFDPATGKQFKSPAKTLSYTNYFAEALIAEAEQDS  412

Query  1228  DIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQ  1049
              IVAIHAAMGGGTGLN F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+Q
Sbjct  413   KIVAIHAAMGGGTGLNYFLRRFPNRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQ  472

Query  1048  RAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAEL  869
             R YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +MACLPNMVVMAPSDEAEL
Sbjct  473   RGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPSDEAEL  532

Query  868   FHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTA  689
              HMVATAAAIDDRPSC RYPRGNGVGV LPP  KGTPLEVG+GRIL+EG+RVAL+GYG+A
Sbjct  533   CHMVATAAAIDDRPSCFRYPRGNGVGVPLPPNYKGTPLEVGKGRILLEGDRVALLGYGSA  592

Query  688   VQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVA  509
             VQ CL+AA+L++  GL+VTVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHVA
Sbjct  593   VQYCLTAASLVQRHGLKVTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVA  652

Query  508   QFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALE  329
             QFMALDGLLDG LKWRPLVLPDRYIDHG+PADQLAEAGLTPSHIAA+VFNILG+ REAL 
Sbjct  653   QFMALDGLLDGKLKWRPLVLPDRYIDHGSPADQLAEAGLTPSHIAASVFNILGQNREALA  712

Query  328   IM  323
             IM
Sbjct  713   IM  714



>ref|XP_010434951.1| PREDICTED: 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic-like 
[Camelina sativa]
Length=718

 Score =  1206 bits (3120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/664 (89%), Positives = 627/664 (94%), Gaps = 0/664 (0%)
 Frame = -2

Query  2323  RSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKT  2144
             R + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLSVKEL QL++ELRSDVIFNVSKT
Sbjct  54    RKAKVYASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSVKELKQLSDELRSDVIFNVSKT  113

Query  2143  GGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAG  1964
             GGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT+RQTNGL+G
Sbjct  114   GGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPTMRQTNGLSG  173

Query  1963  FTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNN  1784
             FTKR ESE+DCFGTGHSSTTISAGLGMAVGRDLKG  NNV+AVIGDGAMTAGQAYEAMNN
Sbjct  174   FTKRGESEHDCFGTGHSSTTISAGLGMAVGRDLKGNNNNVVAVIGDGAMTAGQAYEAMNN  233

Query  1783  AGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTK  1604
             AGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LRELREVAKGVTK
Sbjct  234   AGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALRELREVAKGVTK  293

Query  1603  QIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKT  1424
             QIGGPMH+LAAKVDEYARGMISG+GS+LFEELGLYYIGPVDGHNIDD+V+IL+EVKS +T
Sbjct  294   QIGGPMHQLAAKVDEYARGMISGTGSSLFEELGLYYIGPVDGHNIDDMVAILKEVKSART  353

Query  1423  TGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAE  1244
             TGPVLIHVVTEKGRGYPYAE+A DKYHGV KFDPATGKQFK + KTQSYTTYFAEAL+AE
Sbjct  354   TGPVLIHVVTEKGRGYPYAERADDKYHGVVKFDPATGKQFKTTNKTQSYTTYFAEALVAE  413

Query  1243  AEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIY  1064
             AE DK++VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIY
Sbjct  414   AEVDKNVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIY  473

Query  1063  SSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPS  884
             SSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNM+VMAPS
Sbjct  474   SSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMIVMAPS  533

Query  883   DEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALV  704
             DEA+LF+MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG P+E+GRGRIL EGERVAL+
Sbjct  534   DEADLFNMVATAAAIDDRPSCFRYPRGNGIGVALPPGNKGVPIEIGRGRILKEGERVALL  593

Query  703   GYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGF  524
             GYG+AVQSCL AA +LE RGL VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGF
Sbjct  594   GYGSAVQSCLGAAIMLEERGLNVTVADARFCKPLDRALIRSLAKSHEVLITVEEGSIGGF  653

Query  523   GSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKA  344
             GSHV QF+ALDGLLDG LKWRP+VLPDRYIDHGAPADQLAEAGL PSHIAAT  N++G  
Sbjct  654   GSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGAPADQLAEAGLMPSHIAATALNLIGAP  713

Query  343   REAL  332
             REAL
Sbjct  714   REAL  717



>ref|XP_009352186.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
Length=714

 Score =  1206 bits (3120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/720 (85%), Positives = 667/720 (93%), Gaps = 7/720 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVG-SDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MALCT + P D+S+    +D+QK     S +  G+ L    QQK +Q+  +KR SG+ AS
Sbjct  1     MALCTFSFPADISKSAAPADVQK-----SLFSMGTSLPCPSQQKLNQV-MRKRPSGICAS  54

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L+++ EY+SQRPPTPLLDTINYPIHMKNLSVKEL QLA+ELRSDVIFNVSKTGGHLGSSL
Sbjct  55    LSERGEYHSQRPPTPLLDTINYPIHMKNLSVKELKQLADELRSDVIFNVSKTGGHLGSSL  114

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KM T+RQT+GLAGFTKR ESE
Sbjct  115   GVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMHTMRQTDGLAGFTKRFESE  174

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YDCFGTGHSSTTISAGLGMAVGRDL+G  N+V+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  175   YDCFGTGHSSTTISAGLGMAVGRDLRGGNNHVLAVIGDGAMTAGQAYEAMNNAGYLDSDM  234

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             I+ILNDNKQVSLPTA+LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG +H 
Sbjct  235   IIILNDNKQVSLPTASLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGSVHN  294

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISG+GS+LFEELGLYYIGPVDGHNIDDL+SIL+EVK TKTTGPVLIH+
Sbjct  295   LAAKVDEYARGMISGTGSSLFEELGLYYIGPVDGHNIDDLISILKEVKITKTTGPVLIHL  354

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             +TEKGRGYPYAEKAADKYHGV KFDPATGKQFKASA TQSYTTYFAEALIAEAEAD DIV
Sbjct  355   ITEKGRGYPYAEKAADKYHGVAKFDPATGKQFKASASTQSYTTYFAEALIAEAEADTDIV  414

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLF  RFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAY
Sbjct  415   AIHAAMGGGTGLNLFLHRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAY  474

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTH G+FDVTFMACLPNMVVMAPSDEAELFHM
Sbjct  475   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHSGSFDVTFMACLPNMVVMAPSDEAELFHM  534

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNGVGV LP GNKGTPLE G+GRIL+EGER AL+GYG AVQS
Sbjct  535   VATAAAIDDRPSCFRYPRGNGVGVELPLGNKGTPLEGGKGRILIEGERGALLGYGAAVQS  594

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+A++L+E+ GLR+TVADARFCKPLD ALIRSLAKSHE +IT+EEGSIGGFGSHVA F+
Sbjct  595   CLAASSLVESHGLRLTVADARFCKPLDRALIRSLAKSHEFLITIEEGSIGGFGSHVAHFL  654

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDG LKWRP+VLPDRYIDHG+PADQLA+AGLTPSHIAATVFN+LG+ R+ALEI++
Sbjct  655   ALDGLLDGKLKWRPIVLPDRYIDHGSPADQLAQAGLTPSHIAATVFNMLGQKRKALEIVS  714



>ref|XP_010440286.1| PREDICTED: 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic-like 
[Camelina sativa]
Length=722

 Score =  1206 bits (3119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/668 (88%), Positives = 629/668 (94%), Gaps = 0/668 (0%)
 Frame = -2

Query  2335  NYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFN  2156
             ++  R + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLSVKEL QL++ELRSDVIFN
Sbjct  54    SHSNRKAKVYASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSVKELKQLSDELRSDVIFN  113

Query  2155  VSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTN  1976
             VSKTGGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT+RQTN
Sbjct  114   VSKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPTMRQTN  173

Query  1975  GLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYE  1796
             GL+GFTKR ESE+DCFGTGHSSTTISAGLGMAVGRDLKG  NNV+AVIGDGAMTAGQAYE
Sbjct  174   GLSGFTKRGESEHDCFGTGHSSTTISAGLGMAVGRDLKGNNNNVVAVIGDGAMTAGQAYE  233

Query  1795  AMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAK  1616
             AMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LRELREVAK
Sbjct  234   AMNNAGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALRELREVAK  293

Query  1615  GVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVK  1436
             GVTKQIGGPMH+LAAKVDEYARGMISG+GS+LFEELGLYYIGPVDGHNIDD+V+IL+EVK
Sbjct  294   GVTKQIGGPMHQLAAKVDEYARGMISGTGSSLFEELGLYYIGPVDGHNIDDMVAILKEVK  353

Query  1435  STKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEA  1256
             S +TTGPVLIHVVTEKGRGYPYAE+A DKYHGV KFDPATGKQFK + KTQSYTTYFAEA
Sbjct  354   SARTTGPVLIHVVTEKGRGYPYAERADDKYHGVVKFDPATGKQFKTTNKTQSYTTYFAEA  413

Query  1255  LIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPF  1076
             L+AEAE DKD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPF
Sbjct  414   LVAEAEVDKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPF  473

Query  1075  CAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVV  896
             CAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNM+V
Sbjct  474   CAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMIV  533

Query  895   MAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGER  716
             MAPSDEA+LF+MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG P+E+GRGRIL EGER
Sbjct  534   MAPSDEADLFNMVATAAAIDDRPSCFRYPRGNGIGVALPPGNKGVPIEIGRGRILKEGER  593

Query  715   VALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGS  536
             VAL+GYG+AVQSCL AA +LE RGL VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGS
Sbjct  594   VALLGYGSAVQSCLGAAIMLEERGLNVTVADARFCKPLDRALIRSLAKSHEVLITVEEGS  653

Query  535   IGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNI  356
             IGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDHGAPADQLAEAGL PSHIAAT  ++
Sbjct  654   IGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGAPADQLAEAGLMPSHIAATALSL  713

Query  355   LGKAREAL  332
             +G  REAL
Sbjct  714   IGAPREAL  721



>ref|XP_009146913.1| PREDICTED: 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic-like 
[Brassica rapa]
Length=715

 Score =  1206 bits (3119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 601/716 (84%), Positives = 650/716 (91%), Gaps = 3/716 (0%)
 Frame = -2

Query  2476  MALCTCALPG-DLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MAL   A P   +++ V +D  K    SS     +DL    + +P+  +  K+   V AS
Sbjct  1     MALSAFAFPSYIIAKGVLTDSCKQTSLSSSRSLATDLPSPCR-RPNNSHSNKKVK-VNAS  58

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L +K EYYS RPPTPLLDTINYPIHMKNLS+KEL QL++ELRSDVIFNVSKTGGHLGSSL
Sbjct  59    LVEKGEYYSNRPPTPLLDTINYPIHMKNLSIKELKQLSDELRSDVIFNVSKTGGHLGSSL  118

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT+RQTNGL+GFTKR ESE
Sbjct  119   GVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPTMRQTNGLSGFTKRGESE  178

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             +DCFGTGHSSTTISAGLGMAVGRDLKG+ NNV+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  179   HDCFGTGHSSTTISAGLGMAVGRDLKGKSNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  238

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LRELREVAKGVTKQIGGPMH+
Sbjct  239   IVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALRELREVAKGVTKQIGGPMHQ  298

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDD+V+IL+EVKS +TTGPVLIHV
Sbjct  299   LAAKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDMVAILKEVKSARTTGPVLIHV  358

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAE+A DKYHGV KFDPATGKQFK+S KTQSYTTYFAEAL+AEAE DKD+V
Sbjct  359   VTEKGRGYPYAERADDKYHGVVKFDPATGKQFKSSNKTQSYTTYFAEALVAEAEVDKDVV  418

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAY
Sbjct  419   AIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAY  478

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNM+VMAPSDEAELF+M
Sbjct  479   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMIVMAPSDEAELFNM  538

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATA+AIDDRPSC RYPRGNG+GV LPPGNKG PLEVG+GRIL EGERVAL+GYG+AVQS
Sbjct  539   VATASAIDDRPSCFRYPRGNGIGVALPPGNKGVPLEVGKGRILKEGERVALLGYGSAVQS  598

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL AAA+L+ RGL +TVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGFGSHV QF+
Sbjct  599   CLGAAAMLQERGLNITVADARFCKPLDRALIRSLAKSHEVLITVEEGSIGGFGSHVVQFL  658

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             ALDGLLDG LKWRP+VLPDRYIDHG+PADQ+AEAGL PSHIAAT  N++G   EAL
Sbjct  659   ALDGLLDGKLKWRPMVLPDRYIDHGSPADQMAEAGLMPSHIAATALNLIGAPWEAL  714



>gb|AAC49368.1| DEF [Arabidopsis thaliana]
Length=717

 Score =  1203 bits (3113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/673 (88%), Positives = 632/673 (94%), Gaps = 0/673 (0%)
 Frame = -2

Query  2350  KPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRS  2171
             KP+  ++  R + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLSVKEL QL++ELRS
Sbjct  44    KPNNNSHSNRRAKVCASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSVKELKQLSDELRS  103

Query  2170  DVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPT  1991
             DVIFNVSKTGGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT
Sbjct  104   DVIFNVSKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPT  163

Query  1990  IRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTA  1811
             +RQTNGL+GFTKR ESE+DCFGTGHSSTTISAGLGMAVGRDLKG+ NNV+AVIGDGAMTA
Sbjct  164   MRQTNGLSGFTKRGESEHDCFGTGHSSTTISAGLGMAVGRDLKGKNNNVVAVIGDGAMTA  223

Query  1810  GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLREL  1631
             GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LREL
Sbjct  224   GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALREL  283

Query  1630  REVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSI  1451
             REVAKG+TKQIGGPMH+LAAKVD YARGMISG+GS+LFEELGLYYIGPVDGHNIDDLV+I
Sbjct  284   REVAKGMTKQIGGPMHQLAAKVDVYARGMISGTGSSLFEELGLYYIGPVDGHNIDDLVAI  343

Query  1450  LQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTT  1271
             L+EVKST+TTGPVLIHVVTEKGRGYPYAE+A DKYHGV KFDPATG+QFK + +TQSYTT
Sbjct  344   LKEVKSTRTTGPVLIHVVTEKGRGYPYAERADDKYHGVVKFDPATGRQFKTTNETQSYTT  403

Query  1270  YFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACE  1091
             YFAEAL+AEAE DKD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACE
Sbjct  404   YFAEALVAEAEVDKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACE  463

Query  1090  GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACL  911
             GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACL
Sbjct  464   GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACL  523

Query  910   PNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRIL  731
             PNM+VMAPSDEA+LF+MVATA AIDDRPSC RYPRGNG+GV LPPGNKG P+E+G+GRIL
Sbjct  524   PNMIVMAPSDEADLFNMVATAVAIDDRPSCFRYPRGNGIGVALPPGNKGVPIEIGKGRIL  583

Query  730   MEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMIT  551
              EGERVAL+GYG+AVQSCL AA +LE RGL VTVADARFCKPLD ALIRSLAKSHEV+IT
Sbjct  584   KEGERVALLGYGSAVQSCLGAAVMLEERGLNVTVADARFCKPLDRALIRSLAKSHEVLIT  643

Query  550   VEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAA  371
             VEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDHGAPADQLAEAGL PSHIAA
Sbjct  644   VEEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGAPADQLAEAGLMPSHIAA  703

Query  370   TVFNILGKAREAL  332
             T  N++G  REAL
Sbjct  704   TALNLIGAPREAL  716



>emb|CAA74713.1| transketolase [Arabidopsis thaliana]
Length=739

 Score =  1202 bits (3110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/673 (87%), Positives = 632/673 (94%), Gaps = 0/673 (0%)
 Frame = -2

Query  2350  KPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRS  2171
             KP+  ++  R + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLSVKEL QL++ELRS
Sbjct  66    KPNNNSHSNRRAKVCASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSVKELKQLSDELRS  125

Query  2170  DVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPT  1991
             DVIFNVSKTGGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT
Sbjct  126   DVIFNVSKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPT  185

Query  1990  IRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTA  1811
             +RQTNGL+GFTKR ESE+DCFGTGHSSTTISAGLGMA+GRDLKG+ NNV+AVIGDGAMTA
Sbjct  186   MRQTNGLSGFTKRGESEHDCFGTGHSSTTISAGLGMAIGRDLKGKNNNVVAVIGDGAMTA  245

Query  1810  GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLREL  1631
             GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LREL
Sbjct  246   GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALREL  305

Query  1630  REVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSI  1451
             REVAKG+TKQIGGPMH++AAKVD YARGMISG+GS+LFEELGLYYIGPVDGHNIDDLV+I
Sbjct  306   REVAKGMTKQIGGPMHQVAAKVDVYARGMISGTGSSLFEELGLYYIGPVDGHNIDDLVAI  365

Query  1450  LQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTT  1271
             L+EVKST+TTGPVLIHVVTEKGRGYPYAE+A DKYHGV KFDPATG+QFK + +TQSYTT
Sbjct  366   LKEVKSTRTTGPVLIHVVTEKGRGYPYAERADDKYHGVVKFDPATGRQFKTTNETQSYTT  425

Query  1270  YFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACE  1091
             YFAEAL+AEAE DKD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACE
Sbjct  426   YFAEALVAEAEVDKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACE  485

Query  1090  GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACL  911
             GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACL
Sbjct  486   GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACL  545

Query  910   PNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRIL  731
             PNM+VMAPSDEA+LF+MVATA AIDDRPSC RYPRGNG+GV LPPGNKG P+E+G+GRIL
Sbjct  546   PNMIVMAPSDEADLFNMVATAVAIDDRPSCFRYPRGNGIGVALPPGNKGVPIEIGKGRIL  605

Query  730   MEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMIT  551
              EGERVAL+GYG+AVQSCL AA +LE RGL VTVADARFCKPLD ALIRSLAKSHEV+IT
Sbjct  606   KEGERVALLGYGSAVQSCLGAAVMLEERGLNVTVADARFCKPLDRALIRSLAKSHEVLIT  665

Query  550   VEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAA  371
             VEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDHGAPADQLAEAGL PSHIAA
Sbjct  666   VEEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGAPADQLAEAGLMPSHIAA  725

Query  370   TVFNILGKAREAL  332
             T  N++G  REAL
Sbjct  726   TALNLIGAPREAL  738



>ref|NP_001288863.1| 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic [Brassica 
rapa]
 gb|ABE60813.1| CLA1-like protein [Brassica rapa]
Length=716

 Score =  1202 bits (3109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/668 (88%), Positives = 628/668 (94%), Gaps = 0/668 (0%)
 Frame = -2

Query  2335  NYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFN  2156
             ++  R + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLS KEL QL++ELRSDVIFN
Sbjct  48    SHSNRKAKVNASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSTKELKQLSDELRSDVIFN  107

Query  2155  VSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTN  1976
             VSKTGGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT+RQTN
Sbjct  108   VSKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPTMRQTN  167

Query  1975  GLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYE  1796
             GL+GFTKR ESE+DCFGTGHSSTTISAGL MAVGRDLKG+ NNV+AVIGDGAMTAGQAYE
Sbjct  168   GLSGFTKRGESEHDCFGTGHSSTTISAGLRMAVGRDLKGKNNNVVAVIGDGAMTAGQAYE  227

Query  1795  AMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAK  1616
             AMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LRELREVAK
Sbjct  228   AMNNAGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALRELREVAK  287

Query  1615  GVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVK  1436
             GVTKQIGGPMH+LAAKVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDDLV+IL+EVK
Sbjct  288   GVTKQIGGPMHQLAAKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDLVAILKEVK  347

Query  1435  STKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEA  1256
             S +TTGPVLIHV+TEKGRGYPYAE+A DKYHGV KFDPATGKQFK + KTQSYTTYFAEA
Sbjct  348   SARTTGPVLIHVITEKGRGYPYAERADDKYHGVVKFDPATGKQFKTTNKTQSYTTYFAEA  407

Query  1255  LIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPF  1076
             L+AEAE DKD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPF
Sbjct  408   LVAEAEVDKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPF  467

Query  1075  CAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVV  896
             CAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNM+V
Sbjct  468   CAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMIV  527

Query  895   MAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGER  716
             MAPSDEAELF++VATAAAIDDRPSC RYPRGNG+GV LPPGNKG P+EVG+GRIL EGER
Sbjct  528   MAPSDEAELFNIVATAAAIDDRPSCFRYPRGNGIGVALPPGNKGVPVEVGKGRILKEGER  587

Query  715   VALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGS  536
             VAL+GYG+AVQSCL AA +L+ RGL VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGS
Sbjct  588   VALLGYGSAVQSCLGAAVMLQERGLNVTVADARFCKPLDRALIRSLAKSHEVLITVEEGS  647

Query  535   IGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNI  356
             IGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDHG+PADQ+AEAGL PSHIAAT  N+
Sbjct  648   IGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGSPADQMAEAGLMPSHIAATALNL  707

Query  355   LGKAREAL  332
             +G  REAL
Sbjct  708   IGAPREAL  715



>ref|XP_002441088.1| hypothetical protein SORBIDRAFT_09g020140 [Sorghum bicolor]
 gb|EES19518.1| hypothetical protein SORBIDRAFT_09g020140 [Sorghum bicolor]
Length=722

 Score =  1201 bits (3107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/665 (89%), Positives = 630/665 (95%), Gaps = 2/665 (0%)
 Frame = -2

Query  2311  VQASLADKDE--YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGG  2138
             V ASL+ + E  YYSQRPPTPLLDTINYP+HMKNLSVKEL QLA+ELRSDVIF+VSKTGG
Sbjct  53    VSASLSPEREAEYYSQRPPTPLLDTINYPVHMKNLSVKELRQLADELRSDVIFHVSKTGG  112

Query  2137  HLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFT  1958
             HLGSSLGVVELTVALHYVFNAPQD+ILWDVGHQSYPHKILTGRR+KMPT+RQTNGLAGFT
Sbjct  113   HLGSSLGVVELTVALHYVFNAPQDRILWDVGHQSYPHKILTGRRDKMPTMRQTNGLAGFT  172

Query  1957  KRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAG  1778
             KR+ESEYD FGTGHSSTTISA LGMAVGRDLKG KNNV+AVIGDGAMTAGQAYEAMNNAG
Sbjct  173   KRAESEYDSFGTGHSSTTISAALGMAVGRDLKGGKNNVVAVIGDGAMTAGQAYEAMNNAG  232

Query  1777  YLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQI  1598
             YLDSDMIVILNDNKQVSLPTATLDGP+PPVGALSSALS+LQS+RPLRELREVAKGVTKQI
Sbjct  233   YLDSDMIVILNDNKQVSLPTATLDGPVPPVGALSSALSKLQSSRPLRELREVAKGVTKQI  292

Query  1597  GGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTG  1418
             GG +HELAAKVDEYARGMISG GS+LFEELGLYYIGPVDGHNIDDL++IL +VKSTKTTG
Sbjct  293   GGSVHELAAKVDEYARGMISGPGSSLFEELGLYYIGPVDGHNIDDLITILNDVKSTKTTG  352

Query  1417  PVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAE  1238
             PVLIHVVTEKGRGYPYAE+AADKYHGV KFDPATGKQFK+ AKT SYT YFAE+LIAEAE
Sbjct  353   PVLIHVVTEKGRGYPYAERAADKYHGVAKFDPATGKQFKSPAKTLSYTNYFAESLIAEAE  412

Query  1237  ADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSS  1058
              D  IVAIHAAMGGGTGLN F RRFPSRCFDVGIAEQH VTFAAGLACEGLKPFCAIYSS
Sbjct  413   QDSKIVAIHAAMGGGTGLNYFLRRFPSRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSS  472

Query  1057  FMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDE  878
             F+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +MACLPNMVVMAPSDE
Sbjct  473   FLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPSDE  532

Query  877   AELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGY  698
             AEL HMVATAAAIDDRPSC RYPRGNG+GV LPP  KGTPLEVG+GRILMEG+RVAL+GY
Sbjct  533   AELCHMVATAAAIDDRPSCFRYPRGNGIGVPLPPNYKGTPLEVGKGRILMEGDRVALLGY  592

Query  697   GTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGS  518
             G+AVQ CL+AA+L+E  GLRVTVADARFCKPLDHALIRSLA+SHEV+ITVEEGSIGGFGS
Sbjct  593   GSAVQYCLAAASLVERHGLRVTVADARFCKPLDHALIRSLARSHEVIITVEEGSIGGFGS  652

Query  517   HVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKARE  338
             HVAQFMALDGLLDG LKWRPLVLPDRYIDHG+PADQLAEAGLTPSHIAATVFNILG+ RE
Sbjct  653   HVAQFMALDGLLDGKLKWRPLVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNILGQNRE  712

Query  337   ALEIM  323
             AL IM
Sbjct  713   ALAIM  717



>ref|XP_006414485.1| hypothetical protein EUTSA_v10024542mg [Eutrema salsugineum]
 gb|ESQ55938.1| hypothetical protein EUTSA_v10024542mg [Eutrema salsugineum]
Length=715

 Score =  1200 bits (3105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/667 (88%), Positives = 630/667 (94%), Gaps = 0/667 (0%)
 Frame = -2

Query  2332  YKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNV  2153
             +  R + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLS+KEL QL++ELRSDVIFNV
Sbjct  48    HSNRKAKVSASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSIKELKQLSDELRSDVIFNV  107

Query  2152  SKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNG  1973
             SKTGGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT+RQTNG
Sbjct  108   SKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPTMRQTNG  167

Query  1972  LAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEA  1793
             L+GFTKR ESE+DCFGTGHSSTTISAGLGMAVGRDLKG+ NNV+AVIGDGAMTAGQAYEA
Sbjct  168   LSGFTKRGESEHDCFGTGHSSTTISAGLGMAVGRDLKGKSNNVVAVIGDGAMTAGQAYEA  227

Query  1792  MNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKG  1613
             MNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LRELREVAKG
Sbjct  228   MNNAGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALRELREVAKG  287

Query  1612  VTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKS  1433
             VTKQIGGPMH+LAAKVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDDLV+IL+EVKS
Sbjct  288   VTKQIGGPMHQLAAKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDLVAILKEVKS  347

Query  1432  TKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEAL  1253
              +TTGPVLIHV+TEKGRGYPYAE+A DKYHGV KFDPATGKQFK+S KTQSYTTYFAEAL
Sbjct  348   ARTTGPVLIHVITEKGRGYPYAERADDKYHGVVKFDPATGKQFKSSNKTQSYTTYFAEAL  407

Query  1252  IAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFC  1073
             +AEAE DKD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPFC
Sbjct  408   VAEAEVDKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFC  467

Query  1072  AIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVM  893
             AIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNM+VM
Sbjct  468   AIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMIVM  527

Query  892   APSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERV  713
             APSDEAELF++VATAAAIDDRPSC RYPRGNG+GV LPPGNKG P+E+G+GRIL EGERV
Sbjct  528   APSDEAELFNIVATAAAIDDRPSCFRYPRGNGIGVALPPGNKGVPIEIGKGRILKEGERV  587

Query  712   ALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSI  533
             AL+GYG+AVQSCL AA +L+ RGL +TVADARFCKPLD ALIRSLAK+HEV+ITVEEGSI
Sbjct  588   ALLGYGSAVQSCLGAAMMLQERGLNITVADARFCKPLDGALIRSLAKTHEVLITVEEGSI  647

Query  532   GGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNIL  353
             GGFGSHV QF+AL+GLLDG LKWRP+VLPDRYIDHG+PADQ+AEAGL PSHIAAT  N++
Sbjct  648   GGFGSHVVQFLALEGLLDGKLKWRPMVLPDRYIDHGSPADQMAEAGLMPSHIAATALNLI  707

Query  352   GKAREAL  332
             G  REAL
Sbjct  708   GAPREAL  714



>gb|AEK69518.1| chloroplast 1-deoxy-D-xylulose-5-phosphate synthase 1 [Alpinia 
officinarum]
Length=715

 Score =  1199 bits (3102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/719 (83%), Positives = 656/719 (91%), Gaps = 4/719 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL     P  L     S+ QK    SS +   ++LH H Q+    +  KKRSS V ASL
Sbjct  1     MALFAFPFPCHLYGTAASNHQK-SATSSPFL--TELH-HRQEHSGSLKPKKRSSCVCASL  56

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY+SQRPPTPLLDTINYPIHMKNLS+KEL QL+ ELRSDVIFNVSKTGGHLGSSLG
Sbjct  57    SEIGEYHSQRPPTPLLDTINYPIHMKNLSIKELKQLSEELRSDVIFNVSKTGGHLGSSLG  116

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFNAP+DKI WDVGHQSYPHKILTGRR+KM T+RQT+GL+GFTKRSES+Y
Sbjct  117   VVELTVALHYVFNAPRDKIPWDVGHQSYPHKILTGRRDKMQTLRQTDGLSGFTKRSESDY  176

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             D FG GHSST+ISA LGMAVGRDL GRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  177   DAFGAGHSSTSISAALGMAVGRDLMGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  236

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGP+PPVGALSS LSRLQS++PLRELREVAKG+TK+IGG MHE+
Sbjct  237   VILNDNKQVSLPTATLDGPVPPVGALSSTLSRLQSSKPLRELREVAKGMTKRIGGSMHEI  296

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLV+IL+EVKSTKTTGPVLIHVV
Sbjct  297   AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVTILKEVKSTKTTGPVLIHVV  356

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGVT+FDPATGKQFK+S++T+SYT YFA+AL+AEAE DKDIVA
Sbjct  357   TEKGRGYPYAERAADKYHGVTRFDPATGKQFKSSSQTKSYTNYFADALVAEAEVDKDIVA  416

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLN F R+FP RCFDVGIAEQH VTFAAGL CEGLKPFCAIYSSF+QRAYD
Sbjct  417   IHAAMGGGTGLNHFLRKFPDRCFDVGIAEQHAVTFAAGLTCEGLKPFCAIYSSFLQRAYD  476

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFA+DRAGLVG+DGPTH GAFDV +MACLPNMVVMAPSDEAELFHMV
Sbjct  477   QVVHDVDLQKLPVRFALDRAGLVGADGPTHSGAFDVAYMACLPNMVVMAPSDEAELFHMV  536

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNGVGV L PGNKG PLE+G+GRIL+EGERVAL+GYGTAVQSC
Sbjct  537   ATAAAIDDRPSCFRYPRGNGVGVPLLPGNKGVPLEIGKGRILIEGERVALLGYGTAVQSC  596

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+A +++E +GL++TVADARFCKPLD +LIRSLAKSHEV+ITVEEGSIGGF SHVAQFMA
Sbjct  597   LAAXSMVELQGLKITVADARFCKPLDRSLIRSLAKSHEVLITVEEGSIGGFSSHVAQFMA  656

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGLLDG LKWRPLVLPDRYIDHG+P DQLAEAGLTPSHIAA+VFNI+G+ REAL++M+
Sbjct  657   LDGLLDGKLKWRPLVLPDRYIDHGSPRDQLAEAGLTPSHIAASVFNIIGQTREALKMMS  715



>ref|XP_010524522.1| PREDICTED: 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic-like 
[Tarenaya hassleriana]
Length=715

 Score =  1198 bits (3099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/715 (85%), Positives = 655/715 (92%), Gaps = 1/715 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL   ALP  +SR   +D  +    SS  F  +DL      + + I+ K++  GV ASL
Sbjct  1     MALSAFALPSYISRGTPTDSYRSTSLSSSSFFSTDLP-SVPSRNTNIHSKRKPGGVYASL  59

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             A+  EYYS RPPTPLLDTINYP+HMKNLSVKELNQLA+ELRSDVIFNVSKTGGHLGSSLG
Sbjct  60    AENGEYYSNRPPTPLLDTINYPVHMKNLSVKELNQLADELRSDVIFNVSKTGGHLGSSLG  119

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KM TIRQTNGL+GFTKR+ESEY
Sbjct  120   VVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMQTIRQTNGLSGFTKRAESEY  179

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             D FGTGHSSTTISAGLGMAVGRD KGR NNV+AVIGDGAMTAGQA+EAMNNAGYLDSDMI
Sbjct  180   DSFGTGHSSTTISAGLGMAVGRDFKGRNNNVVAVIGDGAMTAGQAFEAMNNAGYLDSDMI  239

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGP PPVGALSSALSRLQSNRPLRELREVAKGVTKQ+G PMH+L
Sbjct  240   VILNDNKQVSLPTATLDGPAPPVGALSSALSRLQSNRPLRELREVAKGVTKQLGRPMHQL  299

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSG+TLFEELGLYYIGPVDGHNIDDLV+IL EVKST+TTGPVLIHVV
Sbjct  300   AAKVDEYARGMISGSGATLFEELGLYYIGPVDGHNIDDLVAILNEVKSTQTTGPVLIHVV  359

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+A DKYHGV KFD ATGKQFK SAKTQSYTTYFAEALIAEAEADKDIVA
Sbjct  360   TEKGRGYPYAERADDKYHGVVKFDLATGKQFKTSAKTQSYTTYFAEALIAEAEADKDIVA  419

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSFMQRAYD
Sbjct  420   IHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGIKPFCAIYSSFMQRAYD  479

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV
Sbjct  480   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  539

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNG+GV LPPGNKG PLE+GRGRILMEG+RVAL+GYG+AVQ+C
Sbjct  540   ATAAAIDDRPSCFRYPRGNGIGVPLPPGNKGVPLEIGRGRILMEGDRVALLGYGSAVQNC  599

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA++L+ R +++TVADARFCKPLD  LIRSLAKSHEV+ITVEEGSIGGFGSHV QF+A
Sbjct  600   LAAASMLKERDVKITVADARFCKPLDRDLIRSLAKSHEVLITVEEGSIGGFGSHVVQFLA  659

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             LDGLLDG LKWRP+VLPDRYI+HG+P DQLAEAGLTPSHIAATV N+LG  REAL
Sbjct  660   LDGLLDGKLKWRPIVLPDRYIEHGSPVDQLAEAGLTPSHIAATVMNLLGSPREAL  714



>ref|XP_008777286.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic [Phoenix dactylifera]
Length=709

 Score =  1197 bits (3096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/699 (86%), Positives = 648/699 (93%), Gaps = 2/699 (0%)
 Frame = -2

Query  2416  QKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTIN  2237
             QKP   SS W  G+DLH  +Q +   +  +K+   V ASL+++ EY+SQRPPTPLLDTIN
Sbjct  13    QKPSLLSSHWLGGADLH-SYQHQYRLLKTRKKPC-VGASLSERGEYHSQRPPTPLLDTIN  70

Query  2236  YPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKIL  2057
             +PIHMKNLS+KEL QLA+ELRSD+IF+VS+TGGHLGSSLGVVELTVALH+ FNAPQDKIL
Sbjct  71    FPIHMKNLSIKELKQLADELRSDIIFHVSETGGHLGSSLGVVELTVALHHAFNAPQDKIL  130

Query  2056  WDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAV  1877
             WDVGHQSYPHKILTGRR+KMPT+RQ NGL+GFTKRSESEYD FG GHSST+ISA LGMAV
Sbjct  131   WDVGHQSYPHKILTGRRDKMPTLRQKNGLSGFTKRSESEYDSFGAGHSSTSISAALGMAV  190

Query  1876  GRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPI  1697
             GRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDN QVSLPTA LDGPI
Sbjct  191   GRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNNQVSLPTANLDGPI  250

Query  1696  PPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLF  1517
             PPVGALSSALSRLQS+RPLRELREVAKGVTKQIGG MHELAAKVDEYARGMISGSGSTLF
Sbjct  251   PPVGALSSALSRLQSSRPLRELREVAKGVTKQIGGSMHELAAKVDEYARGMISGSGSTLF  310

Query  1516  EELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGV  1337
             EELGLYYIGPVDGHN+DDLV+IL+EVKSTKTTGPV IHVVTEKGRGYPYAE+AADKYHGV
Sbjct  311   EELGLYYIGPVDGHNMDDLVTILKEVKSTKTTGPVFIHVVTEKGRGYPYAERAADKYHGV  370

Query  1336  TKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPS  1157
              KFDPA+GKQFK+S KTQSYT YFAEALIAEAE DKDIVAIHAAMGGGTGLN F RRFP+
Sbjct  371   AKFDPASGKQFKSSPKTQSYTKYFAEALIAEAEVDKDIVAIHAAMGGGTGLNYFVRRFPA  430

Query  1156  RCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRA  977
             RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYDQV+HDVDLQKLPVRFAMDRA
Sbjct  431   RCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVIHDVDLQKLPVRFAMDRA  490

Query  976   GLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgng  797
             GLVG+DGPTHCG+FDVT+MACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC RYPRGNG
Sbjct  491   GLVGADGPTHCGSFDVTYMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRYPRGNG  550

Query  796   vgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADAR  617
             VGV LP GNKG PLEVG+GRIL+EGERVAL+GYG AVQ+CL+AA+L++  GL+VTVADAR
Sbjct  551   VGVPLPAGNKGVPLEVGKGRILIEGERVALLGYGAAVQACLAAASLVQQHGLKVTVADAR  610

Query  616   FCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRY  437
             FCKPLD AL+RSL KSHEV+ITVEEGSIGGFGSHVAQFMALDGLLDG  KWRP+VLPD Y
Sbjct  611   FCKPLDRALVRSLVKSHEVLITVEEGSIGGFGSHVAQFMALDGLLDGTTKWRPMVLPDGY  670

Query  436   IDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             IDHG+PADQL EAGLTP HIAATVF+ILG+ REALEIM+
Sbjct  671   IDHGSPADQLEEAGLTPYHIAATVFSILGQTREALEIMS  709



>gb|EEC79215.1| hypothetical protein OsI_19939 [Oryza sativa Indica Group]
Length=720

 Score =  1196 bits (3093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/689 (86%), Positives = 639/689 (93%), Gaps = 3/689 (0%)
 Frame = -2

Query  2377  SDLHLH-FQQKPSQINYKKRSSGVQASLADKD--EYYSQRPPTPLLDTINYPIHMKNLSV  2207
             ++L LH  Q +P +   +  SS   +   +++  EY+SQRPPTPLLDT+NYPIHMKNLS+
Sbjct  28    AELSLHKLQSRPHKARRRSSSSISASLSTEREAAEYHSQRPPTPLLDTVNYPIHMKNLSL  87

Query  2206  KELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPH  2027
             KEL QLA+ELRSDVIF+VSKTGGHLGSSLGVVELTVALHYVFN PQDKILWDVGHQSYPH
Sbjct  88    KELQQLADELRSDVIFHVSKTGGHLGSSLGVVELTVALHYVFNTPQDKILWDVGHQSYPH  147

Query  2026  KILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNN  1847
             KILTGRR+KMPT+RQTNGL+GFTKRSESEYD FGTGHSSTTISA LGMAVGRDLKG KNN
Sbjct  148   KILTGRRDKMPTMRQTNGLSGFTKRSESEYDSFGTGHSSTTISAALGMAVGRDLKGGKNN  207

Query  1846  VIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSAL  1667
             V+AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSAL
Sbjct  208   VVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPAPPVGALSSAL  267

Query  1666  SRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGP  1487
             S+LQS+RPLRELREVAKGVTKQIGG +HELAAKVDEYARGMISGSGSTLFEELGLYYIGP
Sbjct  268   SKLQSSRPLRELREVAKGVTKQIGGSVHELAAKVDEYARGMISGSGSTLFEELGLYYIGP  327

Query  1486  VDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQ  1307
             VDGHNIDDL++IL+EVKSTKTTGPVLIHVVTEKGRGYPYAE+AADKYHGV KFDPATGKQ
Sbjct  328   VDGHNIDDLITILREVKSTKTTGPVLIHVVTEKGRGYPYAERAADKYHGVAKFDPATGKQ  387

Query  1306  FKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQ  1127
             FK+ AKT SYT YFAEALIAEAE D  +VAIHAAMGGGTGLN F RRFP+RCFDVGIAEQ
Sbjct  388   FKSLAKTLSYTNYFAEALIAEAEQDNRVVAIHAAMGGGTGLNYFLRRFPNRCFDVGIAEQ  447

Query  1126  HGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTH  947
             H VTFAAGLACEGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTH
Sbjct  448   HAVTFAAGLACEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTH  507

Query  946   CGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnk  767
             CGAFDVT+MACLPNMVVMAPSDEAEL HMVATAAAIDDRPSC RYPRGNG+GV LPP  K
Sbjct  508   CGAFDVTYMACLPNMVVMAPSDEAELCHMVATAAAIDDRPSCFRYPRGNGIGVPLPPNYK  567

Query  766   GTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALI  587
             G PLEVG+GR+L+EGERVAL+GYG+AVQ CL+AA+L+E  GL+VTVADARFCKPLD ALI
Sbjct  568   GVPLEVGKGRVLLEGERVALLGYGSAVQYCLAAASLVERHGLKVTVADARFCKPLDQALI  627

Query  586   RSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQL  407
             R LA SHEV++TVEEGSIGGFGSHVAQFMALDGLLDG LKWRPLVLPDRYIDHG+PADQL
Sbjct  628   RRLASSHEVLLTVEEGSIGGFGSHVAQFMALDGLLDGKLKWRPLVLPDRYIDHGSPADQL  687

Query  406   AEAGLTPSHIAATVFNILGKAREALEIMT  320
             AEAGLTPSHIAATVFN+LG+AREAL IMT
Sbjct  688   AEAGLTPSHIAATVFNVLGQAREALAIMT  716



>ref|XP_003568467.1| PREDICTED: 1-deoxy-D-xylulose-5-phosphate synthase 1, chloroplastic 
[Brachypodium distachyon]
Length=706

 Score =  1195 bits (3092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/671 (88%), Positives = 633/671 (94%), Gaps = 2/671 (0%)
 Frame = -2

Query  2326  KRSSGVQASL-ADKD-EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNV  2153
             ++ S + ASL A+++ EY+SQRPPTPLLDT+NYPIHMKNLS+KEL QL++ELRSDVIF+V
Sbjct  32    RKRSCISASLSAEREAEYHSQRPPTPLLDTVNYPIHMKNLSLKELQQLSDELRSDVIFHV  91

Query  2152  SKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNG  1973
             SKTGGHLGSSLGVVELTVALHYVFN PQDKILWDVGHQSYPHKILTGRR+KMPT+RQTNG
Sbjct  92    SKTGGHLGSSLGVVELTVALHYVFNTPQDKILWDVGHQSYPHKILTGRRDKMPTMRQTNG  151

Query  1972  LAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEA  1793
             L+GF KRSESEYD FGTGHSSTTISA LGMAVGRDLKG KNNV+AVIGDGAMTAGQAYEA
Sbjct  152   LSGFVKRSESEYDSFGTGHSSTTISAALGMAVGRDLKGAKNNVVAVIGDGAMTAGQAYEA  211

Query  1792  MNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKG  1613
             MNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALS ALS+LQS+RPLRELREVAKG
Sbjct  212   MNNAGYLDSDMIVILNDNKQVSLPTATLDGPAPPVGALSGALSKLQSSRPLRELREVAKG  271

Query  1612  VTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKS  1433
             VTKQIGG +HELAAKVDEYARGMISGSGS+LFEELGLYYIGPVDGHNIDDL++IL+EVK 
Sbjct  272   VTKQIGGSVHELAAKVDEYARGMISGSGSSLFEELGLYYIGPVDGHNIDDLITILREVKG  331

Query  1432  TKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEAL  1253
             TKTTGPVLIHVVTEKGRGYPYAE+A+DKYHGV KFDPATGKQFK+ AKT SYT YFAEAL
Sbjct  332   TKTTGPVLIHVVTEKGRGYPYAERASDKYHGVAKFDPATGKQFKSPAKTLSYTNYFAEAL  391

Query  1252  IAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFC  1073
             IAEAE D  IVAIHAAMGGGTGLN F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFC
Sbjct  392   IAEAEQDSKIVAIHAAMGGGTGLNYFLRRFPNRCFDVGIAEQHAVTFAAGLACEGLKPFC  451

Query  1072  AIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVM  893
             AIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVM
Sbjct  452   AIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVM  511

Query  892   APSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERV  713
             APSDEAEL +MVATAAAIDDRPSC RYPRGNG+GV LPP  KG PLEVG+GRILMEGERV
Sbjct  512   APSDEAELLNMVATAAAIDDRPSCFRYPRGNGIGVPLPPNYKGIPLEVGKGRILMEGERV  571

Query  712   ALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSI  533
             AL+GYG+AVQ C++A++++E  GLRVTVADARFCKPLDHALIRSLAKSHEV+ITVEEGSI
Sbjct  572   ALLGYGSAVQYCVAASSIVEEHGLRVTVADARFCKPLDHALIRSLAKSHEVIITVEEGSI  631

Query  532   GGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNIL  353
             GGFGSHVAQFMALDGLLDG LKWRP+VLPD+YIDHG+PADQL EAGLTPSHIAATVFNIL
Sbjct  632   GGFGSHVAQFMALDGLLDGKLKWRPVVLPDKYIDHGSPADQLVEAGLTPSHIAATVFNIL  691

Query  352   GKAREALEIMT  320
             G+AREAL IMT
Sbjct  692   GQAREALAIMT  702



>ref|NP_001055524.1| Os05g0408900 [Oryza sativa Japonica Group]
 sp|O22567.2|DXS1_ORYSJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1, chloroplastic; 
Short=1-deoxyxylulose-5-phosphate synthase; Short=DXP 
synthase; Short=DXPS; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAT58851.1| putative 1-deoxy-D-xylulose-5-phosphate synthase [Oryza sativa 
Japonica Group]
 dbj|BAF17438.1| Os05g0408900 [Oryza sativa Japonica Group]
 dbj|BAG89290.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96994.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63700.1| hypothetical protein OsJ_18518 [Oryza sativa Japonica Group]
Length=720

 Score =  1195 bits (3092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/689 (86%), Positives = 638/689 (93%), Gaps = 3/689 (0%)
 Frame = -2

Query  2377  SDLHLH-FQQKPSQINYKKRSSGVQASLADKD--EYYSQRPPTPLLDTINYPIHMKNLSV  2207
             ++L LH  Q +P +   +  SS   +   +++  EY+SQRPPTPLLDT+NYPIHMKNLS+
Sbjct  28    AELSLHKLQSRPHKARRRSSSSISASLSTEREAAEYHSQRPPTPLLDTVNYPIHMKNLSL  87

Query  2206  KELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPH  2027
             KEL QLA+ELRSDVIF+VSKTGGHLGSSLGVVELTVALHYVFN PQDKILWDVGHQSYPH
Sbjct  88    KELQQLADELRSDVIFHVSKTGGHLGSSLGVVELTVALHYVFNTPQDKILWDVGHQSYPH  147

Query  2026  KILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNN  1847
             KILTGRR+KMPT+RQTNGL+GFTKRSESEYD FGTGHSSTTISA LGMAVGRDLKG KNN
Sbjct  148   KILTGRRDKMPTMRQTNGLSGFTKRSESEYDSFGTGHSSTTISAALGMAVGRDLKGGKNN  207

Query  1846  VIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSAL  1667
             V+AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSAL
Sbjct  208   VVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPAPPVGALSSAL  267

Query  1666  SRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGP  1487
             S+LQS+RPLRELREVAKGVTKQIGG +HELAAKVDEYARGMISGSGSTLFEELGLYYIGP
Sbjct  268   SKLQSSRPLRELREVAKGVTKQIGGSVHELAAKVDEYARGMISGSGSTLFEELGLYYIGP  327

Query  1486  VDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQ  1307
             VDGHNIDDL++IL+EVKSTKTTGPVLIHVVTEKGRGYPYAE+AADKYHGV KFDPATGKQ
Sbjct  328   VDGHNIDDLITILREVKSTKTTGPVLIHVVTEKGRGYPYAERAADKYHGVAKFDPATGKQ  387

Query  1306  FKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQ  1127
             FK+ AKT SYT YFAEALIAEAE D  +VAIHAAMGGGTGLN F RRFP+RCFDVGIAEQ
Sbjct  388   FKSPAKTLSYTNYFAEALIAEAEQDNRVVAIHAAMGGGTGLNYFLRRFPNRCFDVGIAEQ  447

Query  1126  HGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTH  947
             H VTFAAGLACEGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTH
Sbjct  448   HAVTFAAGLACEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTH  507

Query  946   CGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnk  767
             CGAFDVT+MACLPNMVVMAPSDEAEL HMVATAAAIDDRPSC RYPRGNG+GV LPP  K
Sbjct  508   CGAFDVTYMACLPNMVVMAPSDEAELCHMVATAAAIDDRPSCFRYPRGNGIGVPLPPNYK  567

Query  766   GTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALI  587
             G PLEVG+GR+L+EGERVAL+GYG+AVQ CL+AA+L+E  GL+VTVADARFCKPLD  LI
Sbjct  568   GVPLEVGKGRVLLEGERVALLGYGSAVQYCLAAASLVERHGLKVTVADARFCKPLDQTLI  627

Query  586   RSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQL  407
             R LA SHEV++TVEEGSIGGFGSHVAQFMALDGLLDG LKWRPLVLPDRYIDHG+PADQL
Sbjct  628   RRLASSHEVLLTVEEGSIGGFGSHVAQFMALDGLLDGKLKWRPLVLPDRYIDHGSPADQL  687

Query  406   AEAGLTPSHIAATVFNILGKAREALEIMT  320
             AEAGLTPSHIAATVFN+LG+AREAL IMT
Sbjct  688   AEAGLTPSHIAATVFNVLGQAREALAIMT  716



>gb|KFK39457.1| hypothetical protein AALP_AA3G247300 [Arabis alpina]
Length=718

 Score =  1194 bits (3089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/668 (89%), Positives = 634/668 (95%), Gaps = 0/668 (0%)
 Frame = -2

Query  2335  NYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFN  2156
             ++ KR + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLS+KEL QL++ELRSDVIFN
Sbjct  50    SHSKRKAKVNASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSIKELKQLSDELRSDVIFN  109

Query  2155  VSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTN  1976
             VSKTGGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT+RQTN
Sbjct  110   VSKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPTMRQTN  169

Query  1975  GLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYE  1796
             GL+GFTKR ESE+DCFGTGHSSTTISAGLGMAVGRDLKG+ NNV+AVIGDGAMTAGQAYE
Sbjct  170   GLSGFTKRGESEHDCFGTGHSSTTISAGLGMAVGRDLKGKSNNVVAVIGDGAMTAGQAYE  229

Query  1795  AMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAK  1616
             AMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LRELREVAK
Sbjct  230   AMNNAGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALRELREVAK  289

Query  1615  GVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVK  1436
             GVTKQIGGPMH+LAAKVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDDLV+IL+EVK
Sbjct  290   GVTKQIGGPMHQLAAKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDLVAILKEVK  349

Query  1435  STKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEA  1256
             S +TTGPVLIHVVTEKGRGYPYAE+A DKYHGV KFDPATGKQFK+S KTQSYTTYFAEA
Sbjct  350   SARTTGPVLIHVVTEKGRGYPYAERADDKYHGVVKFDPATGKQFKSSNKTQSYTTYFAEA  409

Query  1255  LIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPF  1076
             L+AEAEADKD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPF
Sbjct  410   LVAEAEADKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPF  469

Query  1075  CAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVV  896
             CAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV FMACLPNM+V
Sbjct  470   CAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAFMACLPNMIV  529

Query  895   MAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGER  716
             MAPSDEAELF+MVATAA+IDDRPSC RYPRGNG+GV LPPGNKG P+E+G+GRIL EGER
Sbjct  530   MAPSDEAELFNMVATAASIDDRPSCFRYPRGNGIGVALPPGNKGVPVEIGKGRILKEGER  589

Query  715   VALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGS  536
             VAL+GYG+AVQSCL AA++LE RG+ +TVADARFCKPLD ALIRSLAKSHEV+ITVEEGS
Sbjct  590   VALLGYGSAVQSCLGAASMLEERGINITVADARFCKPLDRALIRSLAKSHEVLITVEEGS  649

Query  535   IGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNI  356
             IGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDHGAPADQLAEAGL PSHIAATV N+
Sbjct  650   IGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGAPADQLAEAGLMPSHIAATVLNL  709

Query  355   LGKAREAL  332
             +G  REAL
Sbjct  710   IGTPREAL  717



>ref|XP_006654395.1| PREDICTED: 1-deoxy-D-xylulose-5-phosphate synthase 1, chloroplastic-like 
[Oryza brachyantha]
Length=719

 Score =  1193 bits (3087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/689 (86%), Positives = 636/689 (92%), Gaps = 3/689 (0%)
 Frame = -2

Query  2377  SDLHLHFQQKPSQINYKKRSSGVQASLA---DKDEYYSQRPPTPLLDTINYPIHMKNLSV  2207
             ++L LH  Q       ++RSS + ASL+   +  EY+SQRPPTPLLDTIN+PIHMKNLS+
Sbjct  27    AELCLHKLQTRPPKQPRRRSSCISASLSTEREAAEYHSQRPPTPLLDTINFPIHMKNLSI  86

Query  2206  KELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPH  2027
              EL QLA+ELRSDVIF+VSKTGGHLGSSLGVVELTVALHYVFN PQDKILWDVGHQSYPH
Sbjct  87    NELQQLADELRSDVIFHVSKTGGHLGSSLGVVELTVALHYVFNTPQDKILWDVGHQSYPH  146

Query  2026  KILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNN  1847
             KILTGRR+KMPT+RQTNGL+GFTKR+ESEYD FGTGHSSTTISA LGMAVGRDLKG KNN
Sbjct  147   KILTGRRDKMPTMRQTNGLSGFTKRAESEYDSFGTGHSSTTISAALGMAVGRDLKGGKNN  206

Query  1846  VIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSAL  1667
             V+AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP  PVGALSSAL
Sbjct  207   VVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPAAPVGALSSAL  266

Query  1666  SRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGP  1487
             S+LQS+RPLRELREVAKGVTKQIGG +HELAAKVDEYARGMISGSGSTLFEELGLYYIGP
Sbjct  267   SKLQSSRPLRELREVAKGVTKQIGGSVHELAAKVDEYARGMISGSGSTLFEELGLYYIGP  326

Query  1486  VDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQ  1307
             VDGHNIDDL++IL+EVKSTKTTGPVLIHVVTEKGRGYPYAE+AADKYHGV KFDPATGKQ
Sbjct  327   VDGHNIDDLITILREVKSTKTTGPVLIHVVTEKGRGYPYAERAADKYHGVAKFDPATGKQ  386

Query  1306  FKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQ  1127
             FK+ AKT SYT YFAEALIAEAE D  +VAIHAAMGGGTGLN F RRFP+RCFDVGIAEQ
Sbjct  387   FKSPAKTLSYTNYFAEALIAEAEQDSRVVAIHAAMGGGTGLNYFLRRFPNRCFDVGIAEQ  446

Query  1126  HGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTH  947
             H VTFAAGLACEGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTH
Sbjct  447   HAVTFAAGLACEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTH  506

Query  946   CGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnk  767
             CGAFDVT+MACLPNMVVMAPSDEAEL HMVATAAAIDDRPSC RYPRGNG+GV LPP  K
Sbjct  507   CGAFDVTYMACLPNMVVMAPSDEAELCHMVATAAAIDDRPSCFRYPRGNGIGVPLPPNYK  566

Query  766   GTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALI  587
             G PLEVG+GR+L+EGERVAL+GYG+A Q CL+AA+L+E  GLRVTVADARFCKPLD  LI
Sbjct  567   GVPLEVGKGRVLLEGERVALLGYGSAGQYCLAAASLVERHGLRVTVADARFCKPLDQGLI  626

Query  586   RSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQL  407
             R LA SHEV++TVEEGSIGGFGSHVAQF+ALDGLLDG LKWRPLVLPDRYIDHGAPADQL
Sbjct  627   RRLANSHEVLLTVEEGSIGGFGSHVAQFLALDGLLDGKLKWRPLVLPDRYIDHGAPADQL  686

Query  406   AEAGLTPSHIAATVFNILGKAREALEIMT  320
             AEAGLTPSHIAATVFN+LG+AREAL IMT
Sbjct  687   AEAGLTPSHIAATVFNVLGQAREALAIMT  715



>emb|CDY64791.1| BnaA01g35430D [Brassica napus]
Length=716

 Score =  1191 bits (3082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/720 (83%), Positives = 647/720 (90%), Gaps = 10/720 (1%)
 Frame = -2

Query  2476  MALCTCALPG-DLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MAL   A P   +++ V +D  K    SS     +DL    + +P+  ++  R   V AS
Sbjct  1     MALSAFAFPSYIIAKGVLTDSCKQTSLSSSRSLATDLPSPCR-RPNN-SHSNRKVKVNAS  58

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L +K EYYS RPPTPLLDTINYPIHMKNLS+KEL QL++ELRSDVIFNVSKTGGHLGSSL
Sbjct  59    LVEKGEYYSNRPPTPLLDTINYPIHMKNLSIKELKQLSDELRSDVIFNVSKTGGHLGSSL  118

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT+RQTNGL+GFTKR ESE
Sbjct  119   GVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPTMRQTNGLSGFTKRGESE  178

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             +DCFGTGHSSTTISAGLGMAVGRDLKG+ NNV+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  179   HDCFGTGHSSTTISAGLGMAVGRDLKGKSNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  238

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LRELRE   GVTKQIGGPMH+
Sbjct  239   IVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALRELRE---GVTKQIGGPMHQ  295

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDD+V+IL+EVKS +TTGPVLIHV
Sbjct  296   LAAKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDMVAILKEVKSARTTGPVLIHV  355

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKGRGYPYAE+A DKYHGV KFDPATGKQFK+S KTQSYTTYFAEAL+AEAE DKD+V
Sbjct  356   VTEKGRGYPYAERADDKYHGVVKFDPATGKQFKSSNKTQSYTTYFAEALVAEAEVDKDVV  415

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAY
Sbjct  416   AIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAY  475

Query  1039  DQ----VVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAE  872
             DQ    VVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNM+VMAPSDEAE
Sbjct  476   DQAKYVVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMIVMAPSDEAE  535

Query  871   LFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGT  692
             LFHMVATA+AIDDRPSC RYPRGNG+GV LPPGNKG PLEVG+GRIL EGERVAL+GYG+
Sbjct  536   LFHMVATASAIDDRPSCFRYPRGNGIGVALPPGNKGVPLEVGKGRILKEGERVALLGYGS  595

Query  691   AVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHV  512
             AVQSCL AAA+L+ RGL +TVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGFGSHV
Sbjct  596   AVQSCLGAAAMLQERGLNITVADARFCKPLDRALIRSLAKSHEVLITVEEGSIGGFGSHV  655

Query  511   AQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
              QF+ALDGLLDG LKWRP+VLPDRYIDHG+PADQ+AEAGL PSHIAAT  N++G   EAL
Sbjct  656   VQFLALDGLLDGKLKWRPMVLPDRYIDHGSPADQMAEAGLMPSHIAATALNLIGAPWEAL  715



>gb|AAP14353.1| 1-deoxy-D-xylulose-5-phosphate synthase [Andrographis paniculata]
Length=691

 Score =  1191 bits (3080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/662 (88%), Positives = 625/662 (94%), Gaps = 0/662 (0%)
 Frame = -2

Query  2305  ASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGS  2126
             ASLA++ EY+S++PPTPLLDTI+YPIHMKNLS KEL QLA+E RSDVIFNVSKTGGHLGS
Sbjct  30    ASLAERGEYFSEKPPTPLLDTIDYPIHMKNLSTKELKQLADEPRSDVIFNVSKTGGHLGS  89

Query  2125  SLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSE  1946
             SLGV+ELTVA+HYVFNAPQD+ILWDVGHQSYPHKILTGRR  MPT+RQT+GL GFTKRSE
Sbjct  90    SLGVIELTVAIHYVFNAPQDRILWDVGHQSYPHKILTGRRNMMPTLRQTDGLCGFTKRSE  149

Query  1945  SEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDS  1766
             S YDCFG GHSSTTISAGLGMAVGRDL+GRKN+V+AVIGDGAM AGQAYEAMNNAGYLDS
Sbjct  150   SNYDCFGAGHSSTTISAGLGMAVGRDLQGRKNHVVAVIGDGAMIAGQAYEAMNNAGYLDS  209

Query  1765  DMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM  1586
             DMIVILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG M
Sbjct  210   DMIVILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGSM  269

Query  1585  HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLI  1406
             HELAAKVDEYARG+ISGSGSTLFEELGLYYIGPVDGHNIDDL +IL+EVKSTKTTGPV I
Sbjct  270   HELAAKVDEYARGLISGSGSTLFEELGLYYIGPVDGHNIDDLTAILKEVKSTKTTGPVSI  329

Query  1405  HVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKD  1226
             HVVTEKGRGY YAEKAADKYHGV KFDPATGKQFK+S  TQ+YTTYFAEALIAEAE D  
Sbjct  330   HVVTEKGRGYSYAEKAADKYHGVAKFDPATGKQFKSSTPTQAYTTYFAEALIAEAEQDNI  389

Query  1225  IVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQR  1046
             IVAIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QR
Sbjct  390   IVAIHAAMGGGTGLNLFDRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQR  449

Query  1045  AYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELF  866
             AYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAP+DEAELF
Sbjct  450   AYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPADEAELF  509

Query  865   HMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAV  686
             HMVATAAAIDDRPSC RYPRGNG+GV LPPGNKG PLE+G+GRIL+EGERVAL+GYGTAV
Sbjct  510   HMVATAAAIDDRPSCFRYPRGNGIGVELPPGNKGIPLEIGKGRILLEGERVALLGYGTAV  569

Query  685   QSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQ  506
             QSC++AAAL+E  GL++TVADARFCKPLD  LIR LA SHEV+ITVEEG++GGF +HVAQ
Sbjct  570   QSCMTAAALMEPHGLQLTVADARFCKPLDQGLIRRLANSHEVLITVEEGAVGGFAAHVAQ  629

Query  505   FMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             FMALDGLLDG LKWRPLVLPDRYIDHG+PADQL EAGLT  HIAATVFNILGKAREAL+I
Sbjct  630   FMALDGLLDGKLKWRPLVLPDRYIDHGSPADQLMEAGLTSHHIAATVFNILGKAREALQI  689

Query  325   MT  320
             M+
Sbjct  690   MS  691



>ref|XP_006855370.1| hypothetical protein AMTR_s00057p00123940 [Amborella trichopoda]
 gb|ERN16837.1| hypothetical protein AMTR_s00057p00123940 [Amborella trichopoda]
Length=713

 Score =  1189 bits (3075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/702 (83%), Positives = 645/702 (92%), Gaps = 2/702 (0%)
 Frame = -2

Query  2419  LQKPRPFSSQWFHGSDLHLHFQQKPS--QINYKKRSSGVQASLADKDEYYSQRPPTPLLD  2246
             L  P PF +     S+     +  P    I  K++   +  +L+++ EY+S+RPPTPLLD
Sbjct  12    LTTPAPFLAGGLDTSNTSFSSRALPQLQAIGMKRKGGCLCGALSERGEYHSERPPTPLLD  71

Query  2245  TINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQD  2066
             TINYPIHMKNLS+ EL QLA+E+RSDVIF+VSKTGGHLGSSLGVVELTVA+HYVFNAPQD
Sbjct  72    TINYPIHMKNLSIPELKQLADEVRSDVIFHVSKTGGHLGSSLGVVELTVAIHYVFNAPQD  131

Query  2065  KILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLG  1886
             KILWDVGHQ+YPHKILTGRREKM T+RQTNGL+GFTKRSESEYDCFG GHSST+ISAGLG
Sbjct  132   KILWDVGHQTYPHKILTGRREKMGTLRQTNGLSGFTKRSESEYDCFGAGHSSTSISAGLG  191

Query  1885  MAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLD  1706
             MAVGRDLKGRKN+V+ VIGDGAMTAGQAYEAMNNAGYLDS+MIVILNDNKQVSLPTATLD
Sbjct  192   MAVGRDLKGRKNHVVVVIGDGAMTAGQAYEAMNNAGYLDSNMIVILNDNKQVSLPTATLD  251

Query  1705  GPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGS  1526
             GPIPPVGALSSALSRLQS+R LR+LREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGS
Sbjct  252   GPIPPVGALSSALSRLQSSRSLRQLREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGS  311

Query  1525  TLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKY  1346
             TLFEELGLYYIGPVDGHN+DDL++IL++VK+T TTGPVLIHV TEKGRGYPYAE+A DKY
Sbjct  312   TLFEELGLYYIGPVDGHNLDDLITILRDVKATPTTGPVLIHVATEKGRGYPYAERAYDKY  371

Query  1345  HGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRR  1166
             HGV KFDPATGKQFK +A T+SYT+YFA+ALIAEAEAD DIVAIHAAMGGGTGLN F RR
Sbjct  372   HGVAKFDPATGKQFKGTANTKSYTSYFADALIAEAEADPDIVAIHAAMGGGTGLNAFLRR  431

Query  1165  FPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAM  986
             FP+RCFDVGIAEQH VTFAAGL CEG+KPFCAIYSSF+QRAYDQV+HDVDLQKLPVRFAM
Sbjct  432   FPNRCFDVGIAEQHAVTFAAGLTCEGVKPFCAIYSSFLQRAYDQVIHDVDLQKLPVRFAM  491

Query  985   DRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYpr  806
             DRAGLVG+DGPTHCGAFDVTF+ACLPNMVVMAPS+EAELFHMVATAAAIDDRPSC RYPR
Sbjct  492   DRAGLVGADGPTHCGAFDVTFLACLPNMVVMAPSNEAELFHMVATAAAIDDRPSCFRYPR  551

Query  805   gngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVA  626
             GNGVG+ LP GNKGTPLE+G+GRIL+EGERVAL+GYG AVQSCL+AA+LLE RGLR TVA
Sbjct  552   GNGVGIPLPEGNKGTPLEIGKGRILVEGERVALLGYGMAVQSCLAAASLLERRGLRPTVA  611

Query  625   DARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLP  446
             DARFCKPLD  +IR LAK+H+V+ITVEEGSIGGFG+HVAQFM+LDGLLDG+ KWRPLVLP
Sbjct  612   DARFCKPLDQGMIRRLAKTHQVLITVEEGSIGGFGAHVAQFMSLDGLLDGSTKWRPLVLP  671

Query  445   DRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             D YIDHG+PA+QLAEAGLTP+HIAATVFNILG+ REALE+M+
Sbjct  672   DNYIDHGSPANQLAEAGLTPAHIAATVFNILGQTREALEVMS  713



>dbj|BAJ94232.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=712

 Score =  1187 bits (3071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/682 (85%), Positives = 631/682 (93%), Gaps = 0/682 (0%)
 Frame = -2

Query  2365  LHFQQKPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLA  2186
             +  Q +P +   K+ SS   +    + EY+SQRPPTPLLDT+NYPIHMKNLS+KEL QL+
Sbjct  27    VELQARPLKTPRKRSSSISASLSEREAEYHSQRPPTPLLDTVNYPIHMKNLSLKELQQLS  86

Query  2185  NELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRR  2006
             +ELRSDVIF+VSKTGGHLGSSLGVVELTVALHYVFN PQDK+LWDVGHQSYPHKILTGRR
Sbjct  87    DELRSDVIFHVSKTGGHLGSSLGVVELTVALHYVFNTPQDKLLWDVGHQSYPHKILTGRR  146

Query  2005  EKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGD  1826
             +KMPT+RQTNGL+GF KRSESEYD FGTGHSSTTISA LGMAVGRDLKG KNNV+AVIGD
Sbjct  147   DKMPTMRQTNGLSGFIKRSESEYDSFGTGHSSTTISAALGMAVGRDLKGAKNNVVAVIGD  206

Query  1825  GAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNR  1646
             GAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALS ALS+LQS+R
Sbjct  207   GAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPAPPVGALSGALSKLQSSR  266

Query  1645  PLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNID  1466
             PLRELREVAKGVTKQIGG +HE+AAKVDEYARGMISGSGS+LFEELGLYYIGPVDGHNID
Sbjct  267   PLRELREVAKGVTKQIGGSVHEIAAKVDEYARGMISGSGSSLFEELGLYYIGPVDGHNID  326

Query  1465  DLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKT  1286
             DL++IL+EVK TKTTGPVLIHV+TEKGRGYPYAE+A+DKYHGV KFDPATGKQFK  AKT
Sbjct  327   DLITILREVKGTKTTGPVLIHVITEKGRGYPYAERASDKYHGVAKFDPATGKQFKVPAKT  386

Query  1285  QSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAA  1106
              SYT YFAEALIAEAE D  IVAIHAAMGGGTGLN F RRFP+RCFDVGIAEQH VTFAA
Sbjct  387   LSYTNYFAEALIAEAEQDSKIVAIHAAMGGGTGLNYFLRRFPNRCFDVGIAEQHAVTFAA  446

Query  1105  GLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVT  926
             GLACEGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT
Sbjct  447   GLACEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVT  506

Query  925   FMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVG  746
             FMACLPNMVVMAPSDEAEL +MVATAAAIDDRPSC RYPRGNG+GV LP   KGT +EVG
Sbjct  507   FMACLPNMVVMAPSDEAELLNMVATAAAIDDRPSCFRYPRGNGIGVPLPENYKGTAIEVG  566

Query  745   RGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSH  566
             +GRI++EGERVAL+GYG+AVQ C++A++++   GLRVTVADARFCKPLDHALIRSLAKSH
Sbjct  567   KGRIMIEGERVALLGYGSAVQYCMAASSIVAQHGLRVTVADARFCKPLDHALIRSLAKSH  626

Query  565   EVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTP  386
             EV+ITVEEGSIGGFGSHVAQFMALDGLLDG LKWRP+VLPD+YIDHG+PADQLAEAGLTP
Sbjct  627   EVIITVEEGSIGGFGSHVAQFMALDGLLDGKLKWRPVVLPDKYIDHGSPADQLAEAGLTP  686

Query  385   SHIAATVFNILGKAREALEIMT  320
             SHIAATVFNILG+AREAL IMT
Sbjct  687   SHIAATVFNILGQAREALAIMT  708



>emb|CDY09752.1| BnaC07g33090D [Brassica napus]
Length=718

 Score =  1184 bits (3063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/673 (86%), Positives = 626/673 (93%), Gaps = 8/673 (1%)
 Frame = -2

Query  2335  NYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFN  2156
             ++  R + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLS+KEL QL++ELRSDVIFN
Sbjct  48    SHSNRKAKVNASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSIKELKQLSDELRSDVIFN  107

Query  2155  VSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTN  1976
             VSKTGGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR+KMPT+RQTN
Sbjct  108   VSKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRDKMPTMRQTN  167

Query  1975  GLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYE  1796
             GL+GFTKR ESE+DCFGTGHSSTTISAGLGMAVGRDLKG+ NNV+AVIGDGAMTAGQAYE
Sbjct  168   GLSGFTKRGESEHDCFGTGHSSTTISAGLGMAVGRDLKGKNNNVVAVIGDGAMTAGQAYE  227

Query  1795  AMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAK  1616
             AMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LRELRE   
Sbjct  228   AMNNAGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALRELRE---  284

Query  1615  GVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVK  1436
             GVTKQIGGPMH+LAAKVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDDLV+IL+EVK
Sbjct  285   GVTKQIGGPMHQLAAKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDLVAILKEVK  344

Query  1435  STKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEA  1256
             S +TTGPVLIHV+TEKGRGYPYAE+A DKYHGV KFDPATGKQFK++ KTQSYTTYFAEA
Sbjct  345   SARTTGPVLIHVITEKGRGYPYAERADDKYHGVVKFDPATGKQFKSTNKTQSYTTYFAEA  404

Query  1255  LIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPF  1076
             L+AEAE DKD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPF
Sbjct  405   LVAEAEGDKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPF  464

Query  1075  CAIYSSFMQRAYDQ-----VVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACL  911
             CAIYSSFMQRAYDQ     VVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACL
Sbjct  465   CAIYSSFMQRAYDQAKYEVVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACL  524

Query  910   PNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRIL  731
             PNM+VMAPSDEAELF++VATAAAIDDRPSC RYPRGNG+GV LPPGNKG P EVG+GRIL
Sbjct  525   PNMIVMAPSDEAELFNIVATAAAIDDRPSCFRYPRGNGIGVALPPGNKGVPFEVGKGRIL  584

Query  730   MEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMIT  551
              EGERVAL+GYG+AVQSCL AA +L+ RGL  TVADARFCKPLD ALIR+LAKSHEV+IT
Sbjct  585   KEGERVALLGYGSAVQSCLGAAVMLQERGLNATVADARFCKPLDRALIRNLAKSHEVLIT  644

Query  550   VEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAA  371
             VEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDHG+ ADQ+AEAGL PSHIAA
Sbjct  645   VEEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGSSADQIAEAGLMPSHIAA  704

Query  370   TVFNILGKAREAL  332
             T  N++G  REAL
Sbjct  705   TALNLIGAPREAL  717



>ref|XP_010551048.1| PREDICTED: 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic-like 
[Tarenaya hassleriana]
Length=715

 Score =  1184 bits (3062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/715 (83%), Positives = 647/715 (90%), Gaps = 1/715 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL   A P  +SR   +D  K     S     +DL      + +  + K++ + V ASL
Sbjct  1     MALSAFAFPSYISRGTPTDSYKSTSLYSSSLFSTDLP-SLSPRHTNTHSKRKPARVYASL  59

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             A+K EYYS R PTPLLDTINYPIHMKN SVKEL QLA+ELRSDVIFNVSKTGGHLGSSLG
Sbjct  60    AEKGEYYSNRQPTPLLDTINYPIHMKNFSVKELKQLADELRSDVIFNVSKTGGHLGSSLG  119

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFN PQDKILWDVGHQSYPHKILTGRREKM T+RQTNGL+GFTKR+ESE+
Sbjct  120   VVELTVALHYVFNTPQDKILWDVGHQSYPHKILTGRREKMNTLRQTNGLSGFTKRAESEH  179

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFGTGHSSTTISAGLGMAVGRDLK R +NV+AVIGDGAMTAGQAYEA+NNAGYLDS+MI
Sbjct  180   DCFGTGHSSTTISAGLGMAVGRDLKERNSNVVAVIGDGAMTAGQAYEALNNAGYLDSNMI  239

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGP PPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG  H+L
Sbjct  240   VILNDNKQVSLPTATLDGPAPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGRTHQL  299

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSG+T+FEELGLYYIGPVDGHN++DLV+IL EVKST+TTGPVLIHVV
Sbjct  300   AAKVDEYARGMISGSGATMFEELGLYYIGPVDGHNVNDLVTILNEVKSTRTTGPVLIHVV  359

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGV KFDPATGKQFK +AKTQSYTTYFAEALIAEAE DKDIVA
Sbjct  360   TEKGRGYPYAERAADKYHGVVKFDPATGKQFKTTAKTQSYTTYFAEALIAEAEEDKDIVA  419

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLFQ RFP RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSFMQRAYD
Sbjct  420   IHAAMGGGTGLNLFQSRFPERCFDVGIAEQHAVTFAAGLACEGVKPFCAIYSSFMQRAYD  479

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QV+HDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV
Sbjct  480   QVIHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  539

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAA+DDRPSC RYPRGNG+GV LPPGNKG PLE+GRGRILMEGERVA++GYG+AVQSC
Sbjct  540   ATAAALDDRPSCFRYPRGNGIGVPLPPGNKGVPLEIGRGRILMEGERVAILGYGSAVQSC  599

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             ++AA++L+ R + +TVADARFCKPLD  LIRSLAKSHEV+ITVEEGSIGGFGSHV QF+A
Sbjct  600   VAAASMLKDRDVNITVADARFCKPLDRDLIRSLAKSHEVLITVEEGSIGGFGSHVVQFLA  659

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             LDGLLDG LKWRP+VLPDRYI+HG+P DQLAEAGL P+HIAATV N+LG  +EAL
Sbjct  660   LDGLLDGKLKWRPMVLPDRYIEHGSPVDQLAEAGLMPTHIAATVMNLLGIRKEAL  714



>gb|EMT18567.1| Putative 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Aegilops tauschii]
Length=712

 Score =  1184 bits (3062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/670 (86%), Positives = 627/670 (94%), Gaps = 1/670 (0%)
 Frame = -2

Query  2326  KRSSGVQASLADKD-EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVS  2150
             +RS G+ ASL++++ EY+SQRPPTPLLDT+NYPIHMKNLS+KEL QL++ELRSDVIF+VS
Sbjct  39    RRSYGISASLSEREAEYHSQRPPTPLLDTVNYPIHMKNLSLKELQQLSDELRSDVIFHVS  98

Query  2149  KTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGL  1970
             KTGGHLGSSLGVVELTVALHYVFN PQDK+LWDVGHQSYPHKILTGRR+KMPT+RQTNGL
Sbjct  99    KTGGHLGSSLGVVELTVALHYVFNTPQDKLLWDVGHQSYPHKILTGRRDKMPTMRQTNGL  158

Query  1969  AGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAM  1790
             +GF KRSESEYD FGTGHSSTTISA LGMAVGRDLKG KNNV+AVIGDGAMTAGQAYEAM
Sbjct  159   SGFVKRSESEYDSFGTGHSSTTISAALGMAVGRDLKGAKNNVVAVIGDGAMTAGQAYEAM  218

Query  1789  NNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGV  1610
             NNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALS ALS+LQS+RPLRELREVAKGV
Sbjct  219   NNAGYLDSDMIVILNDNKQVSLPTATLDGPAPPVGALSGALSKLQSSRPLRELREVAKGV  278

Query  1609  TKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKST  1430
             TKQIGG +HE+AAKVDEYARGMISGSGS+LFEELGLYYIGPVDGHNIDDL++IL+EVK T
Sbjct  279   TKQIGGSVHEIAAKVDEYARGMISGSGSSLFEELGLYYIGPVDGHNIDDLITILREVKGT  338

Query  1429  KTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALI  1250
             KTTGPVLIHV+TEKGRGYPYAE+A+DKYHGV KFDPATGKQFK  AKT SYT YFAEALI
Sbjct  339   KTTGPVLIHVITEKGRGYPYAERASDKYHGVAKFDPATGKQFKVPAKTLSYTNYFAEALI  398

Query  1249  AEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCA  1070
             AEAE D  IVAIHAAMGGGTGLN F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCA
Sbjct  399   AEAEQDSKIVAIHAAMGGGTGLNYFLRRFPNRCFDVGIAEQHAVTFAAGLACEGLKPFCA  458

Query  1069  IYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMA  890
             IYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV FMACLPNMVVMA
Sbjct  459   IYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAFMACLPNMVVMA  518

Query  889   PSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVA  710
             PSDEAEL +MVATAAAIDDRPSC RYPRGNG+GV LP   KGT +EVG+GRI++EGERVA
Sbjct  519   PSDEAELLNMVATAAAIDDRPSCFRYPRGNGIGVPLPENYKGTAIEVGKGRIMIEGERVA  578

Query  709   LVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIG  530
             L+GYG+AVQ C++A++++   GLRVTVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIG
Sbjct  579   LLGYGSAVQYCMAASSIVAQHGLRVTVADARFCKPLDHALIRSLAKSHEVIITVEEGSIG  638

Query  529   GFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILG  350
             GFGSHVAQFMALDGLLDG LKWR   LPD+YIDHG+PADQL EAGLTPSHIAATVFNILG
Sbjct  639   GFGSHVAQFMALDGLLDGKLKWRAGGLPDKYIDHGSPADQLVEAGLTPSHIAATVFNILG  698

Query  349   KAREALEIMT  320
             +AREAL IMT
Sbjct  699   QAREALAIMT  708



>gb|KDO74969.1| hypothetical protein CISIN_1g004923mg [Citrus sinensis]
Length=676

 Score =  1173 bits (3035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/674 (86%), Positives = 629/674 (93%), Gaps = 3/674 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQK--PSQINYKKRSSGVQA  2303
             MAL   + P  +S+   S   K  P +S +F G+ L  HF  K    QI  KKR +GV A
Sbjct  1     MALSAFSFPTYVSKATNSGPHKSSPVTSHFF-GAALFSHFSHKLDNHQIQLKKRPNGVCA  59

Query  2302  SLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSS  2123
             SL+++ EY+SQRPPTPLLDTINYPIHMKNLS++EL QLA+ELR+DVIFNVSKTGGHLGSS
Sbjct  60    SLSERGEYHSQRPPTPLLDTINYPIHMKNLSIRELKQLADELRADVIFNVSKTGGHLGSS  119

Query  2122  LGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSES  1943
             LGV+ELTVALHYVFNAP+D+ILWDVGHQ+YPHKILTGRR+KM T+RQT+GL+GFTKRSES
Sbjct  120   LGVIELTVALHYVFNAPKDRILWDVGHQTYPHKILTGRRDKMHTMRQTDGLSGFTKRSES  179

Query  1942  EYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSD  1763
             EYDCFGTGHSST+ISAGLGMAVGRDLKGRKNNV+AVIGDGAMTAGQAYEAMNNAGYLDSD
Sbjct  180   EYDCFGTGHSSTSISAGLGMAVGRDLKGRKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSD  239

Query  1762  MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  1583
             MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH
Sbjct  240   MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  299

Query  1582  ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIH  1403
             ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLV+IL+EVK+TKTTGPVLIH
Sbjct  300   ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNVDDLVAILEEVKNTKTTGPVLIH  359

Query  1402  VVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDI  1223
             VVTEKGRGYPYAEKAADKYHGV KFDPATGKQFK+SA+TQSYTTYFAEALIAEAE DKD+
Sbjct  360   VVTEKGRGYPYAEKAADKYHGVAKFDPATGKQFKSSARTQSYTTYFAEALIAEAEVDKDV  419

Query  1222  VAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRA  1043
             VAIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRA
Sbjct  420   VAIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRA  479

Query  1042  YDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  863
             YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFMACLPNMVVMAPSDEAELFH
Sbjct  480   YDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFMACLPNMVVMAPSDEAELFH  539

Query  862   MVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQ  683
             MVATAAAIDDRPSC RYPRGNG+GV LPPGNKG PLEVG+GRIL+EGERVAL+GYGTAVQ
Sbjct  540   MVATAAAIDDRPSCFRYPRGNGIGVELPPGNKGIPLEVGKGRILIEGERVALLGYGTAVQ  599

Query  682   SCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQF  503
             SCL+A+ALLE+ GLR+TVADARFCKPLDHALIRSLAKSHEV+ITVEEGSIGGFGSHV QF
Sbjct  600   SCLAASALLESNGLRLTVADARFCKPLDHALIRSLAKSHEVLITVEEGSIGGFGSHVVQF  659

Query  502   MALDGLLDGNLKWR  461
             +A DGLLDG +K R
Sbjct  660   LAQDGLLDGTVKVR  673



>ref|XP_002312717.1| 1-deoxy-D-xylulose 5-phosphate synthase family protein [Populus 
trichocarpa]
 gb|EEE90084.1| 1-deoxy-D-xylulose 5-phosphate synthase family protein [Populus 
trichocarpa]
Length=713

 Score =  1170 bits (3028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/702 (85%), Positives = 638/702 (91%), Gaps = 21/702 (3%)
 Frame = -2

Query  2362  HFQQKPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLAN  2183
             H      +++ KKR +GV ASL++  E+ SQRPPTPLLDT+NYPIHMKNLS+KEL QLA 
Sbjct  11    HVNSVTREVHVKKRPNGVCASLSESGEFPSQRPPTPLLDTVNYPIHMKNLSIKELKQLAE  70

Query  2182  ELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRRE  2003
             ELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFN+PQDKILWDVGHQ+YPHKILTGRR+
Sbjct  71    ELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNSPQDKILWDVGHQAYPHKILTGRRD  130

Query  2002  KMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDG  1823
             KM TIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGR NNV+AVIGDG
Sbjct  131   KMHTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRANNVVAVIGDG  190

Query  1822  AMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRP  1643
             AMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSNRP
Sbjct  191   AMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSNRP  250

Query  1642  LRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDD  1463
             LRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDD
Sbjct  251   LRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDD  310

Query  1462  LVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQ  1283
             L++IL+EVKSTKTTGPVLIHVVTEKGRGYPYAE+AADKYHGV KFDPATGKQ KASA TQ
Sbjct  311   LIAILKEVKSTKTTGPVLIHVVTEKGRGYPYAERAADKYHGVNKFDPATGKQSKASASTQ  370

Query  1282  SYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAG  1103
             SYTTYFAEALIAEAEADKD+VAIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAG
Sbjct  371   SYTTYFAEALIAEAEADKDVVAIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAG  430

Query  1102  LACEGLKPFCAIYSSFMQ-RAYDQ---------VVHDVDLQ-----------KLPVRFAM  986
             LACEGLKPFCAIYS F+    YD          ++ D D             KLPVRFAM
Sbjct  431   LACEGLKPFCAIYSFFLLILLYDNTQQYLVGIILLPDTDSSPHVDTIINVKMKLPVRFAM  490

Query  985   DRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYpr  806
             DRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC RYPR
Sbjct  491   DRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRYPR  550

Query  805   gngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVA  626
             GNGVGV LPP NKG PLEVG+GRIL+EGERVAL+GYGTAVQSCL+AA+L+E  G+ +TVA
Sbjct  551   GNGVGVQLPPENKGIPLEVGKGRILIEGERVALLGYGTAVQSCLAAASLVERHGIHLTVA  610

Query  625   DARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLP  446
             DARFCKPLD+ALIRSLAKSHEV+ITVEEGSIGGFGSHVA F+ALDGLLDG LKWRP+VLP
Sbjct  611   DARFCKPLDNALIRSLAKSHEVLITVEEGSIGGFGSHVAHFLALDGLLDGKLKWRPVVLP  670

Query  445   DRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             DRYIDHG+PADQL EAGLTPSHIAATVFNILG+ R +LEIM+
Sbjct  671   DRYIDHGSPADQLVEAGLTPSHIAATVFNILGQRRNSLEIMS  712



>gb|AHJ57306.1| chloroplast 1-deoxy-D-xylulose-5-phosphate synthase [Hedychium 
coronarium]
Length=712

 Score =  1167 bits (3019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/717 (80%), Positives = 641/717 (89%), Gaps = 6/717 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL T + P  L     S+  K    SS     S+ H       S    KKR + V ASL
Sbjct  1     MALSTFSFPCHLLAAAASNHHK----SSMLI--SEHHRQQHHSKSLKQLKKRRASVCASL  54

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             ++  EY+SQRPPTPLLDTINYP HMKNLS++EL QL++ELRSD+IFNVS TGGHLGSSLG
Sbjct  55    SEIGEYHSQRPPTPLLDTINYPAHMKNLSLRELKQLSDELRSDIIFNVSNTGGHLGSSLG  114

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVA+HYVF+APQDKILWDVGHQSYPHKILTGRR+KM T+RQTNGL+GFTKRSES+Y
Sbjct  115   VVELTVAMHYVFSAPQDKILWDVGHQSYPHKILTGRRDKMQTLRQTNGLSGFTKRSESDY  174

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             D FG GHSST+ISA LGMA+GRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLD+DMI
Sbjct  175   DAFGAGHSSTSISAALGMAIGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDTDMI  234

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN+PLRELRE+AKG+TKQIG  +H++
Sbjct  235   VILNDNKQVSLPTATLDGPAPPVGALSSALSRLQSNKPLRELRELAKGMTKQIGRSVHDV  294

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMISGSGS+ FEELGLYYIGPVDGHNIDDL++IL+E+KSTKTTGPVL+HV+
Sbjct  295   AAKVDEYARGMISGSGSSFFEELGLYYIGPVDGHNIDDLITILKEIKSTKTTGPVLVHVI  354

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAE+AADKYHGVTKFDPATGKQFK+S  T+SYT YFA+AL+AEAE DKDIVA
Sbjct  355   TEKGRGYPYAERAADKYHGVTKFDPATGKQFKSSCSTKSYTNYFADALVAEAEVDKDIVA  414

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLN F R+FP RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYD
Sbjct  415   IHAAMGGGTGLNHFLRKFPDRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYD  474

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFA+DRAGLVG+DGPTH GAFDV +MACLPNMVVMAPSDEAEL HMV
Sbjct  475   QVVHDVDLQKLPVRFALDRAGLVGADGPTHSGAFDVAYMACLPNMVVMAPSDEAELCHMV  534

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNGV V LPPGNKG PLE+G+GRIL+EGERVALVGYGTAV+SC
Sbjct  535   ATAAAIDDRPSCFRYPRGNGVAVPLPPGNKGVPLEIGKGRILIEGERVALVGYGTAVRSC  594

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AA+++E  GL++TVADARFCKPLD +LIRSLAKSHEV+ITVEE SIGGF SHVAQFMA
Sbjct  595   LAAASMVELYGLKITVADARFCKPLDRSLIRSLAKSHEVLITVEEASIGGFSSHVAQFMA  654

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             LDGL DG LKWRPL  PDRYIDHG+  DQL+EAGLTPSHIAA+VF+++G+ R+AL+I
Sbjct  655   LDGLFDGKLKWRPLGFPDRYIDHGSAGDQLSEAGLTPSHIAASVFDVIGRTRDALKI  711



>gb|ABS50518.1| 1-deoxy-D-xylulose 5-phosphate synthase type I [Picea abies]
Length=717

 Score =  1163 bits (3008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/690 (82%), Positives = 634/690 (92%), Gaps = 4/690 (1%)
 Frame = -2

Query  2377  SDLHLHFQQKPSQINYKK---RSSGVQAS-LADKDEYYSQRPPTPLLDTINYPIHMKNLS  2210
             S   L +Q K +++ ++K   R   V A+ L+D+ EYYS++PPTPLLDTINYPIHMKNLS
Sbjct  28    SSRSLRYQIKHTKLEFEKLGRRFGKVHAAALSDQGEYYSEKPPTPLLDTINYPIHMKNLS  87

Query  2209  VKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYP  2030
             ++EL QL+NELRSD IF V++TGGHLGSSLGVVELTVALHYVF+AP+DKILWDVGH +YP
Sbjct  88    IRELKQLSNELRSDTIFEVARTGGHLGSSLGVVELTVALHYVFDAPEDKILWDVGHXAYP  147

Query  2029  HKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKN  1850
             HKILTGRR+KMPT+RQTNGL+GFTKRSESEYDCFG GHSST+ISAGLGMAVGRDLKGR N
Sbjct  148   HKILTGRRDKMPTLRQTNGLSGFTKRSESEYDCFGAGHSSTSISAGLGMAVGRDLKGRNN  207

Query  1849  NVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSA  1670
             +VI+VIGDGAMTAGQA+EAMNNAGYLDS+MIVILNDNKQVSLPTA LDGP+PPVGALSSA
Sbjct  208   HVISVIGDGAMTAGQAFEAMNNAGYLDSNMIVILNDNKQVSLPTANLDGPMPPVGALSSA  267

Query  1669  LSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIG  1490
             LS+LQS++PLRELREVAKGVTKQ+G PMHELAAKVDEYARGMISGS STLFEELGLYYIG
Sbjct  268   LSKLQSSKPLRELREVAKGVTKQLGAPMHELAAKVDEYARGMISGSRSTLFEELGLYYIG  327

Query  1489  PVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGK  1310
             PVDGHNIDDL++ILQ+VK+T TTGPVLIHVVTEKGRGYPYA +AADKYHGV KFDPATGK
Sbjct  328   PVDGHNIDDLLTILQDVKATHTTGPVLIHVVTEKGRGYPYAXRAADKYHGVAKFDPATGK  387

Query  1309  QFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAE  1130
             QFK  A TQ+YT YFAEALI+EA+ D  +VAIHAAMGGGTGLN+F +RFPSRCFDVGIAE
Sbjct  388   QFKGKAPTQTYTAYFAEALISEADIDNXVVAIHAAMGGGTGLNMFSKRFPSRCFDVGIAE  447

Query  1129  QHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPT  950
             QH VTFAAGLACEGLKPFCAIYSSF+QRAYDQV+HDVDLQKLPVRFAMDRAGLVG+DGPT
Sbjct  448   QHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVIHDVDLQKLPVRFAMDRAGLVGADGPT  507

Query  949   HCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgn  770
             HCGAFDVT++ACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC R+PRGNGVG  LPPGN
Sbjct  508   HCGAFDVTYLACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRFPRGNGVGARLPPGN  567

Query  769   kGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHAL  590
             KG PLEVG+GRIL+EG+RVAL+GYGT VQ+CL+A+ALLE +GL +TVADARFCKPLD  L
Sbjct  568   KGVPLEVGKGRILLEGDRVALLGYGTVVQNCLAASALLEEQGLSLTVADARFCKPLDRDL  627

Query  589   IRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQ  410
             IRSLA+ HEV+ITVEEG+IGGFGSHVA F+ALDG LDG LKWRP+VLPD YI+HGAP DQ
Sbjct  628   IRSLAREHEVIITVEEGTIGGFGSHVAHFLALDGFLDGKLKWRPMVLPDHYIEHGAPNDQ  687

Query  409   LAEAGLTPSHIAATVFNILGKAREALEIMT  320
             + EAGLT SHIAA+V NILG+ REAL++M+
Sbjct  688   MVEAGLTASHIAASVLNILGRTREALQVMS  717



>ref|XP_010938854.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic isoform X3 [Elaeis guineensis]
Length=635

 Score =  1162 bits (3007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/635 (90%), Positives = 608/635 (96%), Gaps = 0/635 (0%)
 Frame = -2

Query  2224  MKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVG  2045
             MKNLS+KEL QL +ELRSD+IF+VSKTGGHLGSSLGVVELTVALH+VFNAPQDKILWDVG
Sbjct  1     MKNLSIKELKQLGDELRSDIIFHVSKTGGHLGSSLGVVELTVALHHVFNAPQDKILWDVG  60

Query  2044  HQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDL  1865
             HQSYPHKILTGRR+KMPT+RQTNGL+GFTKRSESEYD FG GHSST+ISA LGMAVGRDL
Sbjct  61    HQSYPHKILTGRRDKMPTLRQTNGLSGFTKRSESEYDSFGAGHSSTSISAALGMAVGRDL  120

Query  1864  KGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVG  1685
             KGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTA LDGPIPPVG
Sbjct  121   KGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTANLDGPIPPVG  180

Query  1684  ALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELG  1505
             ALSSALSRLQS+RPLRELREVAKGVTKQIGG MH+LAAKVDEYARGMISGSGSTLFEELG
Sbjct  181   ALSSALSRLQSSRPLRELREVAKGVTKQIGGSMHKLAAKVDEYARGMISGSGSTLFEELG  240

Query  1504  LYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFD  1325
             LYYIGPVDGHN+DDLV+IL+EVKSTKTTGPV IHVVTEKGRGYPYAE+AADKYHGV KFD
Sbjct  241   LYYIGPVDGHNMDDLVTILKEVKSTKTTGPVFIHVVTEKGRGYPYAERAADKYHGVAKFD  300

Query  1324  PATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFD  1145
             P+TGKQFK+S KTQSYT YFAEALI+EAE DKDIVAIHAAMGGGTGLN F RRFP+RCFD
Sbjct  301   PSTGKQFKSSTKTQSYTNYFAEALISEAEVDKDIVAIHAAMGGGTGLNYFLRRFPTRCFD  360

Query  1144  VGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG  965
             VGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYDQV+HDVDLQKLPVRFAMDRAGLVG
Sbjct  361   VGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVIHDVDLQKLPVRFAMDRAGLVG  420

Query  964   SDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvv  785
             +DGPTHCG+FDVT+MACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC RYPRGNGVGV 
Sbjct  421   ADGPTHCGSFDVTYMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRYPRGNGVGVP  480

Query  784   lppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKP  605
             LP GNKG PLEVG+GRIL+EGERVAL+GYG AVQ CL+AA+LLE   L+VTVADARFCKP
Sbjct  481   LPAGNKGVPLEVGKGRILIEGERVALLGYGAAVQGCLAAASLLEEHSLKVTVADARFCKP  540

Query  604   LDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHG  425
             LDHALIRSLA+SHE++ITVEEGSIGGFGSHVAQFM+LDGLLDG  KWRP+VLPDRYIDHG
Sbjct  541   LDHALIRSLARSHELLITVEEGSIGGFGSHVAQFMSLDGLLDGTTKWRPVVLPDRYIDHG  600

Query  424   APADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             +PADQL+EAGLTPSHIAATVFNILG+ REALEIM+
Sbjct  601   SPADQLSEAGLTPSHIAATVFNILGQTREALEIMS  635



>ref|XP_007147849.1| hypothetical protein PHAVU_006G159900g [Phaseolus vulgaris]
 gb|ESW19843.1| hypothetical protein PHAVU_006G159900g [Phaseolus vulgaris]
Length=719

 Score =  1159 bits (2999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/722 (82%), Positives = 646/722 (89%), Gaps = 6/722 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQ--KPRPFSSQWFHGS-DLHLHFQQKPSQINYKKRSSGVQ  2306
             MAL   + P  L R   SD +   P P  S   H S DL     ++ +Q+  +KR  GV 
Sbjct  1     MALSALSFPLHL-RQTTSDPKASTPLPLPSSHSHFSVDLLTQSSRRHTQV--RKRRHGVC  57

Query  2305  ASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGS  2126
             ASL++  EY+SQ+PPTPLLDTINYPIHMKNLS KELNQLA ELRSDVIF+VS+TGGHLGS
Sbjct  58    ASLSETGEYHSQKPPTPLLDTINYPIHMKNLSDKELNQLAEELRSDVIFHVSRTGGHLGS  117

Query  2125  SLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSE  1946
             SLGVVELT+ALHYVFN+P+DKILWDVGHQSYPHKILTGRR+ M T+RQ +GLAGFTKRSE
Sbjct  118   SLGVVELTIALHYVFNSPKDKILWDVGHQSYPHKILTGRRDMMHTMRQADGLAGFTKRSE  177

Query  1945  SEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDS  1766
             SE+DCFGTGHSSTTISA LGMA+GRDLKG KNNV+ VIGDGAMTAGQAYEAMNNAGYLDS
Sbjct  178   SEHDCFGTGHSSTTISAALGMAIGRDLKGEKNNVVTVIGDGAMTAGQAYEAMNNAGYLDS  237

Query  1765  DMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM  1586
             DMIVILNDNKQVSLPTA LDGPIPPVGALSS LS+LQSNRPLRELREVAKGVTKQIGG M
Sbjct  238   DMIVILNDNKQVSLPTADLDGPIPPVGALSSTLSKLQSNRPLRELREVAKGVTKQIGGQM  297

Query  1585  HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLI  1406
             HE+AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGH IDDLV+IL EVKSTKTTGPVLI
Sbjct  298   HEIAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHRIDDLVAILNEVKSTKTTGPVLI  357

Query  1405  HVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKD  1226
             HVVTEKG GYPYAE+A DKYHGV KFDPATGKQFKA   T+S T+ FAEALIAEAEADKD
Sbjct  358   HVVTEKGHGYPYAERAVDKYHGVAKFDPATGKQFKAKETTKSITSCFAEALIAEAEADKD  417

Query  1225  IVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQR  1046
             IV IHAAMGGGTG+N+F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPF AIYSSF+QR
Sbjct  418   IVGIHAAMGGGTGMNMFLRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFVAIYSSFIQR  477

Query  1045  AYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELF  866
              YDQVVHDVDLQKLPVRFA+DRAG VG+DGPTHCGAFDVTFMACLPNMVVMAPSDEAEL 
Sbjct  478   GYDQVVHDVDLQKLPVRFAIDRAGFVGADGPTHCGAFDVTFMACLPNMVVMAPSDEAELV  537

Query  865   HMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAV  686
             HMVATAAAI+DRPSC RYPRGNG+GV LPPGN+G PLE+G+GRIL+EGERVAL+GYG+AV
Sbjct  538   HMVATAAAINDRPSCFRYPRGNGIGVELPPGNRGIPLEIGKGRILIEGERVALLGYGSAV  597

Query  685   QSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQ  506
             QSC++AA+LLE  GLRVTVADARFCKPLDH+LI SLAKSHEV+ITVEEGS+GGFGSHVAQ
Sbjct  598   QSCVAAASLLEHHGLRVTVADARFCKPLDHSLISSLAKSHEVLITVEEGSVGGFGSHVAQ  657

Query  505   FMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             FMAL GLLDG LKWRP+VLPD YIDHG+  DQL EAGLTPSHIAATVFN+LG+ REALEI
Sbjct  658   FMALAGLLDGKLKWRPMVLPDCYIDHGSRDDQLKEAGLTPSHIAATVFNLLGQTREALEI  717

Query  325   MT  320
             MT
Sbjct  718   MT  719



>gb|AAS89341.1| 1-deoxy-D-xylulose-5-phosphate synthase [Ginkgo biloba]
Length=717

 Score =  1152 bits (2981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/706 (81%), Positives = 637/706 (90%), Gaps = 10/706 (1%)
 Frame = -2

Query  2407  RPFSSQ----WFHGSDLHLHFQQKPSQINY----KKRSSGVQASLADKDEYYSQRPPTPL  2252
             RP S Q    +F      L  Q KP  + +    +K      A+L++K EYYS++PPTPL
Sbjct  12    RPNSKQSPSMFFGLLPCGLRQQIKPGNLEFEQSRRKVGKAYAAALSEKGEYYSEKPPTPL  71

Query  2251  LDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAP  2072
             LDTINYPIHMKNLS++EL QLA+ELR+D+IF+VS+TGGHLGSSLGV+ELTVA+HYVFNAP
Sbjct  72    LDTINYPIHMKNLSLRELKQLADELRADLIFDVSRTGGHLGSSLGVIELTVAIHYVFNAP  131

Query  2071  QDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAG  1892
             +DKI WDVGHQ+YPHKILTGRR+KMPT+RQTNGL+GFTKRSESEYD FG GHSST+ISAG
Sbjct  132   EDKIFWDVGHQAYPHKILTGRRDKMPTLRQTNGLSGFTKRSESEYDSFGAGHSSTSISAG  191

Query  1891  LGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTAT  1712
             LGMAVGRDLKGR N+VI+VIGDGAMTAGQAYEAMNNAGYLDS+MIVILNDNKQVSLPTA 
Sbjct  192   LGMAVGRDLKGRNNHVISVIGDGAMTAGQAYEAMNNAGYLDSNMIVILNDNKQVSLPTAN  251

Query  1711  LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGS  1532
             LDGPIPPVGALSSALSRLQS+RPLRELREVAKGVTKQ+GG MHELAAKVDEYARGMISGS
Sbjct  252   LDGPIPPVGALSSALSRLQSSRPLRELREVAKGVTKQLGGSMHELAAKVDEYARGMISGS  311

Query  1531  GSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAAD  1352
              STLFEE+GLYYIGPVDGHNIDDLV+IL+EVK+T TTGPVLIHVVTEKGRGYPYAE+AAD
Sbjct  312   RSTLFEEMGLYYIGPVDGHNIDDLVTILREVKATHTTGPVLIHVVTEKGRGYPYAERAAD  371

Query  1351  KYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQ  1172
             KYHGV KFDPATGKQFK  A+TQSYTTYFAEALIAEAE DK+IVAIHAAMGGGTGLN+F 
Sbjct  372   KYHGVVKFDPATGKQFKGKAQTQSYTTYFAEALIAEAEVDKNIVAIHAAMGGGTGLNMFL  431

Query  1171  RRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY--DQVVHDVDLQKLPV  998
             +RFPSRCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAY       DVDLQKLPV
Sbjct  432   KRFPSRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVVHDVDVDLQKLPV  491

Query  997   RFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCL  818
             RFAMDRAGLVG+DGPTHCGAFDVT+++CLPNMVVMAPSDEAELFHMVATAAAIDDRPSC 
Sbjct  492   RFAMDRAGLVGADGPTHCGAFDVTYLSCLPNMVVMAPSDEAELFHMVATAAAIDDRPSCF  551

Query  817   RYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLR  638
             RYPRGNG+GV LP GNKG PLEVG+GRIL EG+RVAL+GYGT VQ+CL+A ALLE +GL 
Sbjct  552   RYPRGNGIGVQLPIGNKGVPLEVGKGRILAEGDRVALLGYGTVVQNCLAAGALLEEQGLS  611

Query  637   VTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRP  458
             +TVADARFCKPLD  LIRSLA+ HEV+ITVEEGSIGGFGSHV+QF++LDGLLDG LKWRP
Sbjct  612   LTVADARFCKPLDRDLIRSLAREHEVLITVEEGSIGGFGSHVSQFLSLDGLLDGKLKWRP  671

Query  457   LVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LVLPDRYI+HGAP DQ+A+AGLT SHIAA+V NILG+ R+A +IM+
Sbjct  672   LVLPDRYIEHGAPIDQMADAGLTASHIAASVLNILGRTRDAPQIMS  717



>gb|ACC54557.1| putative 1-D-deoxyxylulose 5-phosphate synthase type 1 [Pinus 
densiflora]
Length=707

 Score =  1152 bits (2979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/698 (80%), Positives = 634/698 (91%), Gaps = 8/698 (1%)
 Frame = -2

Query  2401  FSSQWFHGSDLHLHFQQKPSQINYKKRSSGV----QASLADKDEYYSQRPPTPLLDTINY  2234
              SS  F  S   L  Q KP+++  KK    V     ++L+D+ EYYS++PPTPLLDTINY
Sbjct  14    LSSMGFAFSSGSLCHQIKPAKLESKKLGRRVGKAYASALSDQGEYYSEKPPTPLLDTINY  73

Query  2233  PIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILW  2054
             PIHMKNLS++EL QL+NELRSD+IF VS+TGGHLGSSLGVVELTVALHYVF+AP+DKILW
Sbjct  74    PIHMKNLSIRELKQLSNELRSDIIFEVSRTGGHLGSSLGVVELTVALHYVFDAPEDKILW  133

Query  2053  DVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVG  1874
             DVGHQ+YPHKILTGRR+KMPT+RQTNGL+GFTKRSESEYDCFG GHSST+ISAGLGMA G
Sbjct  134   DVGHQAYPHKILTGRRDKMPTLRQTNGLSGFTKRSESEYDCFGAGHSSTSISAGLGMAAG  193

Query  1873  RDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIP  1694
             RDLKG+ N+VI+VIGDGAMTAGQA+EAMNNA YLDS+MIVILNDNKQVSLPTA LDGPIP
Sbjct  194   RDLKGKNNHVISVIGDGAMTAGQAFEAMNNARYLDSNMIVILNDNKQVSLPTANLDGPIP  253

Query  1693  PVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFE  1514
             PVGALS    +LQS++PLRELREVAKGVTKQ+G PMHELAAKVDEYARGMISGS STLFE
Sbjct  254   PVGALS----KLQSSKPLRELREVAKGVTKQLGAPMHELAAKVDEYARGMISGSRSTLFE  309

Query  1513  ELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVT  1334
             ELGLYYIGPVDGHNIDDL++IL++VK+T TTGPVLIHVVTEKGRGYPYAE+AADKYHGV 
Sbjct  310   ELGLYYIGPVDGHNIDDLLTILRDVKATHTTGPVLIHVVTEKGRGYPYAERAADKYHGVV  369

Query  1333  KFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSR  1154
             KFDPATGKQFK  A TQ+YTTYFAEALI+EAEADK+IVA+HAAMGGGTGLN+F +RFP+R
Sbjct  370   KFDPATGKQFKGKAPTQTYTTYFAEALISEAEADKNIVAVHAAMGGGTGLNMFSKRFPTR  429

Query  1153  CFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAG  974
             CFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYDQV+HDVDLQ LPVRFAMDRAG
Sbjct  430   CFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVIHDVDLQNLPVRFAMDRAG  489

Query  973   LVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngv  794
             LVG+DGPTHCGAFDVT++ACLPNMVVMAPS+EAELFHMVATAAAIDDRPSC  +PRGNGV
Sbjct  490   LVGADGPTHCGAFDVTYLACLPNMVVMAPSNEAELFHMVATAAAIDDRPSCFGFPRGNGV  549

Query  793   gvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARF  614
             G  LPPGNKG PLE+G+GRIL+EG+RVAL+GYGT VQ+CL+A+ALLE + L VTVADARF
Sbjct  550   GAQLPPGNKGVPLEIGKGRILVEGDRVALLGYGTVVQNCLAASALLEEQDLSVTVADARF  609

Query  613   CKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYI  434
             CKPLD  L+RSLA+ HEV+ITVEEG+IGGFGSHVA F+ALDG LDG LKWRP+VLPD YI
Sbjct  610   CKPLDRDLVRSLAREHEVLITVEEGTIGGFGSHVAHFLALDGFLDGKLKWRPMVLPDHYI  669

Query  433   DHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             +HGAP+DQ+ EAGLT SHIAA+V N+LG+ REAL++M+
Sbjct  670   EHGAPSDQMIEAGLTASHIAASVLNMLGRTREALQVMS  707



>gb|AEZ55865.1| chloroplast 1-deoxy-D-xylulose 5-phosphate synthase 1 [Mitragyna 
speciosa]
Length=669

 Score =  1147 bits (2968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/669 (87%), Positives = 626/669 (94%), Gaps = 2/669 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MA    A PG+LSR V SD  K R   S W +G+DL   FQ + SQ+   K+S+GV+ASL
Sbjct  1     MAFSALAFPGNLSRTVVSDSLKQRFLYSNWLYGTDLQFQFQSQSSQV--MKKSNGVRASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             +++ EYYS RPPTPLLDTINYPIHMKNLS KEL QLA+ LRSD+IFNVSKTGGHLGSSLG
Sbjct  59    SERGEYYSHRPPTPLLDTINYPIHMKNLSTKELKQLADVLRSDIIFNVSKTGGHLGSSLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHYVFN PQDKILWDVGHQSYPHKILTGRR KMPT+RQT+GL+GFTKRSESEY
Sbjct  119   VVELTVALHYVFNCPQDKILWDVGHQSYPHKILTGRRYKMPTLRQTDGLSGFTKRSESEY  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFG GHSST+ISAGLGMAVGRDLKGRKN+V+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  179   DCFGAGHSSTSISAGLGMAVGRDLKGRKNHVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGP+PPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG +HEL
Sbjct  239   VILNDNKQVSLPTATLDGPVPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGSVHEL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARG+ISGSGSTLFEELG YYIGPVDGH+IDDLV+IL+EVKSTKTTGPVLIHVV
Sbjct  299   AAKVDEYARGLISGSGSTLFEELGFYYIGPVDGHSIDDLVAILKEVKSTKTTGPVLIHVV  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKGRGYPYAEKAADKYHGV KFDPATGKQFK+S KTQSYTTYFAEAL+AEAEADKD+VA
Sbjct  359   TEKGRGYPYAEKAADKYHGVVKFDPATGKQFKSSGKTQSYTTYFAEALVAEAEADKDVVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLF  RFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  419   IHAAMGGGTGLNLFLHRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV FMACLPNMVVMAPSDEAE+FHMV
Sbjct  479   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAFMACLPNMVVMAPSDEAEVFHMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSCLRYPRGNG+GV LPPGNKG PLEVG+GRIL+EGERVAL+GYGTAVQSC
Sbjct  539   ATAAAIDDRPSCLRYPRGNGIGVELPPGNKGIPLEVGKGRILIEGERVALLGYGTAVQSC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AAAL+E  GLR+TVADARFCKPLDH+LIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMA
Sbjct  599   LAAAALVEPHGLRLTVADARFCKPLDHSLIRSLAKSHEVLITVEEGSIGGFGSHVAQFMA  658

Query  496   LDGLLDGNL  470
             L+GLLDGNL
Sbjct  659   LNGLLDGNL  667



>emb|CDY48893.1| BnaA03g36320D [Brassica napus]
Length=716

 Score =  1144 bits (2960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/715 (81%), Positives = 633/715 (89%), Gaps = 2/715 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL     P  LSR   +D  K    SS  F     +L      S ++  K S+ V  SL
Sbjct  1     MALSVFRFPSYLSRETSTDHCKTTSLSS--FKSLATYLPSICHRSTVSRSKISTTVNGSL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
               + +YYS RPPTPLLDTIN+PIHMKNLS+KEL  L++ELRSDVIFNVSKTGGHLGS+LG
Sbjct  59    VKRGDYYSTRPPTPLLDTINHPIHMKNLSIKELKALSDELRSDVIFNVSKTGGHLGSNLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KM T+RQTNGL+GFT+R ESE+
Sbjct  119   VVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMKTLRQTNGLSGFTQRGESEH  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             D FGTGHSSTTISAGLGMAVGRDLKGR NNV+AVIGDGAMTAGQAYEAMNNAGYL+SDMI
Sbjct  179   DSFGTGHSSTTISAGLGMAVGRDLKGRDNNVVAVIGDGAMTAGQAYEAMNNAGYLESDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTA LDGP PPVG+LS ALS+LQS RPLRELRE AKG+TK+IGG MH L
Sbjct  239   VILNDNKQVSLPTANLDGPTPPVGSLSRALSKLQSKRPLRELREAAKGMTKKIGGSMHRL  298

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             A+KVDE ARGMISG+GSTLFEELG YYIGPVDGHN+DDLVSIL+EVKST+T+GPVLIHVV
Sbjct  299   ASKVDENARGMISGAGSTLFEELGFYYIGPVDGHNLDDLVSILKEVKSTRTSGPVLIHVV  358

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKG GYPYAE+  DKYHGV KFDPATGKQFK  A+T+SYTTYFAEALIAEAE DKD+VA
Sbjct  359   TEKGHGYPYAERGDDKYHGVVKFDPATGKQFKNIAETKSYTTYFAEALIAEAEEDKDVVA  418

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLNLFQRRF +RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYD
Sbjct  419   IHAAMGGGTGLNLFQRRFSTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYD  478

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNM+VMAPSDEAELF+MV
Sbjct  479   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMIVMAPSDEAELFNMV  538

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC RYPRGNGVGV LPPGNKG PLEVG+GRIL EGERVAL+GYG+AVQ+C
Sbjct  539   ATAAAIDDRPSCFRYPRGNGVGVSLPPGNKGVPLEVGKGRILREGERVALLGYGSAVQNC  598

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L A+++L+ RGL++TVADARFCKPLD ALIR LAKSHEV+ITVEEGSIGGFGSHV QF+A
Sbjct  599   LEASSVLDKRGLKITVADARFCKPLDIALIRKLAKSHEVLITVEEGSIGGFGSHVVQFLA  658

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             LDGLLDG LKWRP+VLPDRYI+HG+P DQLAEAGLT SHIAATV N++G  RE L
Sbjct  659   LDGLLDGKLKWRPMVLPDRYIEHGSPLDQLAEAGLTASHIAATVLNLIGTPRETL  713



>ref|XP_009135754.1| PREDICTED: LOW QUALITY PROTEIN: 1-deoxy-D-xylulose-5-phosphate 
synthase, chloroplastic [Brassica rapa]
Length=717

 Score =  1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/716 (81%), Positives = 635/716 (89%), Gaps = 3/716 (0%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL     P  LSR   +D  K    SS  F     +L      S ++  K S+ V  SL
Sbjct  1     MALSVFRFPSYLSRETSTDHCKTTSLSS--FKSLATYLPSICHRSTVSRSKISTTVNGSL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
               + +YYS RPPTPLLDTIN+PIHMKNLS+KEL  L++ELRSDVIFNVSKTGGHLGS+LG
Sbjct  59    VKRGDYYSTRPPTPLLDTINHPIHMKNLSIKELKALSDELRSDVIFNVSKTGGHLGSNLG  118

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KM T+RQTNGL+GFT+R ESE+
Sbjct  119   VVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMKTLRQTNGLSGFTQRGESEH  178

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             D FGTGHSSTTISAGLGMAVGRDLKGR NNV+AVIGDGAMTAGQAYEAMNNAGYL+SDMI
Sbjct  179   DSFGTGHSSTTISAGLGMAVGRDLKGRDNNVVAVIGDGAMTAGQAYEAMNNAGYLESDMI  238

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALS-RLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             VILNDNKQVSLPTA LDGP PPVGALS ALS +LQS RPLRELRE AKG+TK+IGG MH 
Sbjct  239   VILNDNKQVSLPTANLDGPTPPVGALSRALSNKLQSKRPLRELREAAKGMTKKIGGSMHR  298

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LA+KVDEYARGMISG+GSTLFEELG YYIGPVDGHN+DDLVSIL+EVKST+T+GPVLIHV
Sbjct  299   LASKVDEYARGMISGAGSTLFEELGFYYIGPVDGHNLDDLVSILKEVKSTRTSGPVLIHV  358

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             VTEKG GYPYAE+A DKYHGV KFDPATGK+FK  A+T+SYTTYFAEALIAEAE DKD+V
Sbjct  359   VTEKGHGYPYAERADDKYHGVVKFDPATGKEFKNIAETKSYTTYFAEALIAEAEEDKDVV  418

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTGLNLFQRRF +RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAY
Sbjct  419   AIHAAMGGGTGLNLFQRRFSTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAY  478

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNM+VMAPSDEAELF+M
Sbjct  479   DQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMIVMAPSDEAELFNM  538

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNGVGV LPPGNKG PLEVG+GRIL +GERVAL+GYG+AVQ+
Sbjct  539   VATAAAIDDRPSCFRYPRGNGVGVSLPPGNKGVPLEVGKGRILRDGERVALLGYGSAVQN  598

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL A+++L+ RGL++TVADARFCKPLD ALIR LAKSHEV+ITVEEGSIGGFGSHV QF+
Sbjct  599   CLEASSVLDKRGLKITVADARFCKPLDIALIRKLAKSHEVLITVEEGSIGGFGSHVVQFL  658

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             ALDGLLDG LKWRP+VLPDRYI+HG+P DQLAEAGLT SHIAATV N++G  RE L
Sbjct  659   ALDGLLDGKLKWRPMVLPDRYIEHGSPLDQLAEAGLTASHIAATVLNLIGTPRETL  714



>ref|XP_010244642.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic isoform X2 [Nelumbo nucifera]
 ref|XP_010244643.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic isoform X2 [Nelumbo nucifera]
Length=638

 Score =  1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/633 (88%), Positives = 608/633 (96%), Gaps = 0/633 (0%)
 Frame = -2

Query  2224  MKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVG  2045
             MKNLS KEL QLA+ELRSD+IF+VSKTGGHLGS+LGVVELTVALHYVFN P+DKILWDVG
Sbjct  1     MKNLSTKELMQLADELRSDIIFSVSKTGGHLGSNLGVVELTVALHYVFNCPEDKILWDVG  60

Query  2044  HQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDL  1865
             HQSYPHKILTGRR+KMPT+R+TNGL+GFTKRSES+YDCFGTGHSST+ISA LGMAVGRDL
Sbjct  61    HQSYPHKILTGRRDKMPTLRRTNGLSGFTKRSESDYDCFGTGHSSTSISAALGMAVGRDL  120

Query  1864  KGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVG  1685
             KGR+N VI+VIGDGAMTAGQAYEAMN+AGYLDSDMIVILNDN+QVSLPTATLDGP PPVG
Sbjct  121   KGRENCVISVIGDGAMTAGQAYEAMNSAGYLDSDMIVILNDNRQVSLPTATLDGPAPPVG  180

Query  1684  ALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELG  1505
             ALSSALSRLQS+RPLRELREVAKG+TK+IGG MH+LAAKVDEYARGM+SGSGSTLFEELG
Sbjct  181   ALSSALSRLQSSRPLRELREVAKGITKKIGGDMHKLAAKVDEYARGMVSGSGSTLFEELG  240

Query  1504  LYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFD  1325
             LYYIGPVDGHNIDDLV+IL EVK+T+TTGPVLIHVVTEKGRGYPYAE+AADKYHGV KFD
Sbjct  241   LYYIGPVDGHNIDDLVAILWEVKNTRTTGPVLIHVVTEKGRGYPYAERAADKYHGVVKFD  300

Query  1324  PATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFD  1145
             PATGKQFK+S  TQSYT YFA+ALIAEAEADK IVAIHAAMGGGTGLNLFQ  FP+RCFD
Sbjct  301   PATGKQFKSSTPTQSYTAYFAQALIAEAEADKYIVAIHAAMGGGTGLNLFQHSFPTRCFD  360

Query  1144  VGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG  965
             VGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYDQV+HDVDLQKLPVRFA+DRAGLVG
Sbjct  361   VGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVIHDVDLQKLPVRFALDRAGLVG  420

Query  964   SDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvv  785
             +DGPTH G+FDVTFMACLPNMVVMAPSDEAEL+HMVATAAAI+DRPSC RYPRGNG+GV 
Sbjct  421   ADGPTHSGSFDVTFMACLPNMVVMAPSDEAELYHMVATAAAINDRPSCFRYPRGNGIGVK  480

Query  784   lppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKP  605
             LPPGNKG PLEVG+GR+L+EGERVAL+GYGTAVQSCL+AA+L+E  GLRVTVADARFCKP
Sbjct  481   LPPGNKGIPLEVGKGRVLIEGERVALLGYGTAVQSCLAAASLVEHHGLRVTVADARFCKP  540

Query  604   LDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHG  425
             LDH+LIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMAL+GLLDG LKWRPLVLPDRYIDHG
Sbjct  541   LDHSLIRSLAKSHEVLITVEEGSIGGFGSHVAQFMALNGLLDGKLKWRPLVLPDRYIDHG  600

Query  424   APADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             +PADQ+AEAGLTPS IAATVF+ILG+ REALEI
Sbjct  601   SPADQMAEAGLTPSQIAATVFSILGQKREALEI  633



>gb|KFK39452.1| hypothetical protein AALP_AA3G246700 [Arabis alpina]
Length=670

 Score =  1138 bits (2944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/660 (86%), Positives = 613/660 (93%), Gaps = 0/660 (0%)
 Frame = -2

Query  2311  VQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHL  2132
             V  SLA+K EYYS RPPTPLLDTIN+PIHMKNL +KEL  LA+ELR+DVIFNVS+TGGHL
Sbjct  8     VHGSLAEKSEYYSNRPPTPLLDTINHPIHMKNLCIKELKVLADELRNDVIFNVSETGGHL  67

Query  2131  GSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKR  1952
             GS+LGVVELTVALHY+F+ PQDKILWDVGHQSYPHKILTGRR KM T+RQTNGL+GFTKR
Sbjct  68    GSNLGVVELTVALHYIFSTPQDKILWDVGHQSYPHKILTGRRGKMKTLRQTNGLSGFTKR  127

Query  1951  SESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYL  1772
              ESE+D FGTGHSSTTISAGLGMAVGRDLKGR NNV+AVIGDGAMTAGQAYEAMNNAGYL
Sbjct  128   GESEHDSFGTGHSSTTISAGLGMAVGRDLKGRNNNVVAVIGDGAMTAGQAYEAMNNAGYL  187

Query  1771  DSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG  1592
             DSDMIVILNDNKQVSLPTA LDGP PPVGALSSALS+LQSNRPLRELREVAKG+TKQIGG
Sbjct  188   DSDMIVILNDNKQVSLPTANLDGPTPPVGALSSALSKLQSNRPLRELREVAKGMTKQIGG  247

Query  1591  PMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPV  1412
              MH LA+KVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDDLVSIL+EVKSTKT GPV
Sbjct  248   RMHRLASKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDLVSILKEVKSTKTIGPV  307

Query  1411  LIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEAD  1232
             LIHVVTEKGRGYPYAEKA DKYHGV KFDPATGKQFK+  KT+SYTTYFAEALIAEAEAD
Sbjct  308   LIHVVTEKGRGYPYAEKADDKYHGVVKFDPATGKQFKSIGKTKSYTTYFAEALIAEAEAD  367

Query  1231  KDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFM  1052
             KDIVAIHAAMGGGTGLNLF+ RFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFM
Sbjct  368   KDIVAIHAAMGGGTGLNLFESRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFM  427

Query  1051  QRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAE  872
             QR +DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNM+VMAP+DEAE
Sbjct  428   QRTFDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMIVMAPADEAE  487

Query  871   LFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGT  692
             LF+MVATAAAIDDRPSC RYPR NG GV LPPGNKG PL++G+GRIL EGERVAL+GYGT
Sbjct  488   LFNMVATAAAIDDRPSCFRYPRRNGTGVSLPPGNKGVPLQIGKGRILKEGERVALLGYGT  547

Query  691   AVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHV  512
             AVQ+CL AA +L+ RGL++TV DA FCKPLD +LIR+LAKSHEV+ITVEEGSIGGFGSHV
Sbjct  548   AVQNCLEAATILDERGLKITVVDAIFCKPLDVSLIRNLAKSHEVLITVEEGSIGGFGSHV  607

Query  511   AQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
              QF+ALDGLLDG LKWRP+VLPD+YI+HG+P  QLAEAGLT SHIAAT  N++   REAL
Sbjct  608   VQFLALDGLLDGKLKWRPMVLPDQYIEHGSPLHQLAEAGLTASHIAATALNLIRTPREAL  667



>gb|AEZ55688.1| putative 1-deoxy-D-xylulose 5-phosphate synthase of [Salvia miltiorrhiza]
Length=703

 Score =  1138 bits (2944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/720 (80%), Positives = 639/720 (89%), Gaps = 22/720 (3%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL T +  G L + VGSD    R       HG D   HF  K      K+ SSG+ AS 
Sbjct  1     MALNTLSFCGSLRKGVGSDAHSNR------LHGVDQQCHFSFKA-----KRSSSGICASS  49

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             + + EY+S++PPTPLLD+INYP HMKNLS+KEL QLA+ELRSD+IFNVSKTGGHLGS LG
Sbjct  50    SKRGEYFSEKPPTPLLDSINYPNHMKNLSLKELQQLADELRSDLIFNVSKTGGHLGSGLG  109

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             V+ELTVALHYVF APQD+ILWDVGHQSYPHKILTGRR++MPT+RQT+GL+GFTKRSES+Y
Sbjct  110   VIELTVALHYVFEAPQDRILWDVGHQSYPHKILTGRRDRMPTLRQTDGLSGFTKRSESDY  169

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             DCFG GHSSTTISAGLGMAVGRDLKGRKN+V+AVIGDGAMTAGQAYEAMNNAGYLDSDMI
Sbjct  170   DCFGAGHSSTTISAGLGMAVGRDLKGRKNHVVAVIGDGAMTAGQAYEAMNNAGYLDSDMI  229

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGP PPVGALS ALSRLQSNRPLREL E +KG      G MHEL
Sbjct  230   VILNDNKQVSLPTATLDGPSPPVGALSRALSRLQSNRPLRELGEASKG------GSMHEL  283

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAK   + RG++SGSGSTLFEELGLYYIGPVDGHNI DL +IL  VK+TK TGPVLIHVV
Sbjct  284   AAK---HGRGLMSGSGSTLFEELGLYYIGPVDGHNIHDLTTILARVKNTKITGPVLIHVV  340

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKG+GYPYAE+AADKYHGV+KFDPATGKQFKA+A+TQSYTT FA ALIAEAEAD+D+VA
Sbjct  341   TEKGKGYPYAERAADKYHGVSKFDPATGKQFKANARTQSYTTCFARALIAEAEADEDVVA  400

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGL+LF  RFP+RCFDVGIAEQH VTFAAGLACEG+KPFCAIYSSFMQRAYD
Sbjct  401   IHAAMGGGTGLDLFNHRFPTRCFDVGIAEQHAVTFAAGLACEGIKPFCAIYSSFMQRAYD  460

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV+FMACLPNMVVMAPSDEAEL HMV
Sbjct  461   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVSFMACLPNMVVMAPSDEAELCHMV  520

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             +TAAAIDDRP C RYPRG+GVGV LPPGNKG PLEVGRGRIL+EGERVAL+GYG AVQSC
Sbjct  521   STAAAIDDRPCCFRYPRGDGVGVELPPGNKGVPLEVGRGRILVEGERVALLGYGAAVQSC  580

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L+AAALLE  GLR+TVADARFCKPLD AL+R+LA++H+ +ITVEEGS+GGFGSHVA F+A
Sbjct  581   LAAAALLEPHGLRLTVADARFCKPLDRALVRNLARTHDALITVEEGSVGGFGSHVAHFLA  640

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILG--KAREALEIM  323
             LDGLLDGNLKWRPLVLPDRY+DHGAPADQL + GLTPS IAAT+FNILG  K+REALEI+
Sbjct  641   LDGLLDGNLKWRPLVLPDRYVDHGAPADQLTQVGLTPSCIAATIFNILGSWKSREALEII  700



>gb|KEH32266.1| 1-deoxy-D-xylulose-5-phosphate synthase [Medicago truncatula]
Length=678

 Score =  1136 bits (2938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/678 (84%), Positives = 614/678 (91%), Gaps = 4/678 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGV-QAS  2300
             M LC+ A P   S +   D ++  P  S     S   LHF     Q N  K+  GV  AS
Sbjct  1     MDLCSLACP---SFVTPCDPRRTLPLPSSSSSHSQWGLHFFSHSQQHNKLKKKFGVVHAS  57

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L++  EYYSQRPPTPLLDTINYPIHMKNLS KEL QLA+ELRSDVIF+VS+TGGHLGSSL
Sbjct  58    LSEMGEYYSQRPPTPLLDTINYPIHMKNLSTKELKQLADELRSDVIFSVSRTGGHLGSSL  117

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELT+ALHYVFN PQDKILWDVGHQSYPHKILTGRR+KM T+RQTNGL+GFTKRSESE
Sbjct  118   GVVELTIALHYVFNTPQDKILWDVGHQSYPHKILTGRRDKMHTMRQTNGLSGFTKRSESE  177

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YD FGTGHSSTTISAGLGMAVGRDLKGRKN+V+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  178   YDSFGTGHSSTTISAGLGMAVGRDLKGRKNDVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  237

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSN+PLRELREVAKGVTK+IGGPMHE
Sbjct  238   IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNKPLRELREVAKGVTKRIGGPMHE  297

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDDLV+IL+EVK+T +TGPVLIHV
Sbjct  298   LAAKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDLVAILKEVKTTNSTGPVLIHV  357

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             +TEKGRGYPYAEKAADKYHGV KFDP TGKQFK +AKTQSYTTYFAEALIAEA+ADKDI+
Sbjct  358   ITEKGRGYPYAEKAADKYHGVAKFDPPTGKQFKVAAKTQSYTTYFAEALIAEAKADKDII  417

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTG+N+F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAY
Sbjct  418   AIHAAMGGGTGMNIFHRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAY  477

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTH G+FDVTFMACLPNMVVMAPSDEAEL HM
Sbjct  478   DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHSGSFDVTFMACLPNMVVMAPSDEAELCHM  537

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNG+GV LP   KG PLE+G+GRIL+EGERVAL+GYG+AVQ+
Sbjct  538   VATAAAIDDRPSCFRYPRGNGIGVELPTEYKGIPLEIGKGRILIEGERVALLGYGSAVQN  597

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+AA+L+E  GLR+TVADARFCKPLD +LIRSLAKSHEV+ITVEEGSIGGFGSHVAQFM
Sbjct  598   CLAAASLVEQHGLRLTVADARFCKPLDRSLIRSLAKSHEVLITVEEGSIGGFGSHVAQFM  657

Query  499   ALDGLLDGNLKWRPLVLP  446
             ALDGLLDGNLK R    P
Sbjct  658   ALDGLLDGNLKVRKQTSP  675



>emb|CDY32433.1| BnaC03g42170D [Brassica napus]
Length=716

 Score =  1133 bits (2930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/672 (85%), Positives = 618/672 (92%), Gaps = 5/672 (1%)
 Frame = -2

Query  2347  PSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSD  2168
             PS+I      + V  SL  K +YYS RPPTPLLDTIN+PIHMKNLS+KEL  L++ELRSD
Sbjct  47    PSKIR-----TTVNGSLVKKGDYYSTRPPTPLLDTINHPIHMKNLSIKELKALSDELRSD  101

Query  2167  VIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTI  1988
             V+FNVSKTGGHLGS+LGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KM T+
Sbjct  102   VVFNVSKTGGHLGSNLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMKTL  161

Query  1987  RQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAG  1808
             RQTNGL+GFTKR ESE+D FGTGHSSTTISAGLGMAVGRDLKGR NNV+AVIGDGAMTAG
Sbjct  162   RQTNGLSGFTKRGESEHDSFGTGHSSTTISAGLGMAVGRDLKGRDNNVVAVIGDGAMTAG  221

Query  1807  QAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELR  1628
             QAYEAMNNAGYLDSDMIVILNDNKQVSLPTA LDGP PPVGALS ALS+LQS RPLRELR
Sbjct  222   QAYEAMNNAGYLDSDMIVILNDNKQVSLPTANLDGPTPPVGALSRALSKLQSKRPLRELR  281

Query  1627  EVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSIL  1448
             E AKG+TK+IGG MH LA+KVDEYARGMISG+GSTLFEELG YYIGPVDGHNIDDLVSIL
Sbjct  282   EAAKGMTKKIGGSMHRLASKVDEYARGMISGAGSTLFEELGFYYIGPVDGHNIDDLVSIL  341

Query  1447  QEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTY  1268
             +EVKST+T+GPVLIHVVTEKG GY YAE+A DKYHGV KFDP TGKQFK  ++T+SYTTY
Sbjct  342   KEVKSTRTSGPVLIHVVTEKGHGYHYAERAHDKYHGVVKFDPETGKQFKNISETKSYTTY  401

Query  1267  FAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEG  1088
             FAEALIAEAEA KD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEG
Sbjct  402   FAEALIAEAEAHKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEG  461

Query  1087  LKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLP  908
             LKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLP
Sbjct  462   LKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLP  521

Query  907   NMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILM  728
             NM+VMAPSDEAELF+MVATAAAIDD PSC RYPRGNGVGV LPPGNKG PLEVG+GRIL 
Sbjct  522   NMIVMAPSDEAELFNMVATAAAIDDHPSCFRYPRGNGVGVSLPPGNKGVPLEVGKGRILR  581

Query  727   EGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITV  548
             EGERVAL+GYG+AVQ+CL A+++L+ RGL++TVADARFCKPLD ALIR+LAKSHEV+ITV
Sbjct  582   EGERVALLGYGSAVQNCLEASSILDKRGLKMTVADARFCKPLDIALIRNLAKSHEVLITV  641

Query  547   EEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAAT  368
             EEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYI+HG+P DQLAEAGLT SHIAAT
Sbjct  642   EEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIEHGSPLDQLAEAGLTASHIAAT  701

Query  367   VFNILGKAREAL  332
             V N++G  RE L
Sbjct  702   VLNLIGTPRETL  713



>ref|XP_001756357.1| 1-deoxyxylulose 5-phosphate synthase [Physcomitrella patens]
 gb|EDQ78753.1| 1-deoxyxylulose 5-phosphate synthase [Physcomitrella patens]
Length=729

 Score =  1131 bits (2926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/655 (84%), Positives = 600/655 (92%), Gaps = 0/655 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
             EY +++PPTPLLDTINYP+HMKNL+V+EL QLANE+R++ I  VSKTGGHLGSSLGVVEL
Sbjct  75    EYPAEKPPTPLLDTINYPMHMKNLTVRELKQLANEVRAETIHTVSKTGGHLGSSLGVVEL  134

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TVALH+VFN P+DK LWDVGHQ+YPHKILTGRR KM T+RQT+GL+GF KR+ESEYD FG
Sbjct  135   TVALHHVFNCPEDKFLWDVGHQTYPHKILTGRRGKMHTLRQTDGLSGFVKRAESEYDAFG  194

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAVGRDLKG+KNNVIAVIGDGAMTAGQAYEAMNNAGYLD +MIVILN
Sbjct  195   AGHSSTSISAGLGMAVGRDLKGKKNNVIAVIGDGAMTAGQAYEAMNNAGYLDCNMIVILN  254

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DNKQVSLPTATLDGP PPVGALSSALSRLQS+RPLRELREVAKGVTKQ+GGP H LA+KV
Sbjct  255   DNKQVSLPTATLDGPAPPVGALSSALSRLQSSRPLRELREVAKGVTKQLGGPAHVLASKV  314

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             DEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLV+IL+EVK+T TTGPVLIH+VTEKG
Sbjct  315   DEYARGMISGSGSTLFEELGLYYIGPVDGHNMDDLVTILREVKNTSTTGPVLIHLVTEKG  374

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             RGYPYAE+AADKYHGV KFDPATGKQ K  A TQ+YTTYFAEALIAEAE DKD+V IHAA
Sbjct  375   RGYPYAERAADKYHGVVKFDPATGKQNKVKAPTQAYTTYFAEALIAEAEVDKDVVGIHAA  434

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTG+N+F +RFP RCFDVGIAEQH VTFAAGLACEGLKPFC+IYSSF+QR YDQVVH
Sbjct  435   MGGGTGMNIFAKRFPERCFDVGIAEQHAVTFAAGLACEGLKPFCSIYSSFLQRGYDQVVH  494

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAP+DEAELFHMVATAA
Sbjct  495   DVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPADEAELFHMVATAA  554

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC RYPRGNG+GV LP  NKG P+EVGRGRIL+EG  VAL+GYGT VQ+CL+A 
Sbjct  555   AIDDRPSCFRYPRGNGIGVQLPAKNKGIPIEVGRGRILLEGTEVALLGYGTMVQNCLAAH  614

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              LL   G+  TVADARFCKPLD  LIR LAK+H+V+ITVEEGSIGGFGSHV QFMALDGL
Sbjct  615   VLLADLGVSATVADARFCKPLDRDLIRQLAKNHQVLITVEEGSIGGFGSHVVQFMALDGL  674

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDG LKWRPLVLPDRYI+HGAP DQ AEAGLT  HIAAT  N+LGK REAL++MT
Sbjct  675   LDGKLKWRPLVLPDRYIEHGAPKDQYAEAGLTAGHIAATALNVLGKTREALQVMT  729



>gb|ACJ67021.1| 1-deoxy-D-xylulose 5-phosphate synthase type I [Pinus taeda]
Length=707

 Score =  1127 bits (2914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/698 (79%), Positives = 626/698 (90%), Gaps = 8/698 (1%)
 Frame = -2

Query  2401  FSSQWFHGSDLHLHFQQKPSQINYKKRSSGV----QASLADKDEYYSQRPPTPLLDTINY  2234
              SS  F  S   L  Q KP+++   K    V     ++L+D+ EYYS++PPTPLLDTINY
Sbjct  14    LSSMGFAFSSGSLCHQIKPTKLESMKLGRRVGKAYASALSDQGEYYSEKPPTPLLDTINY  73

Query  2233  PIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILW  2054
             PIHMKNLS++EL QL+NELRSD+IF+V++TGGHL ++LGVV+LTVALHYVFN P DKI+W
Sbjct  74    PIHMKNLSIRELKQLSNELRSDIIFDVAETGGHLSANLGVVDLTVALHYVFNTPHDKIVW  133

Query  2053  DVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVG  1874
             DVGHQSYP+KILTGRR KM T+RQT+G+AGF +R ESE+D FG GHSST+ISA +GMAVG
Sbjct  134   DVGHQSYPYKILTGRRSKMSTLRQTSGIAGFPRRVESEHDAFGAGHSSTSISAAVGMAVG  193

Query  1873  RDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIP  1694
             RDL G+ N+VI VIGDGAMTAGQAYEAMNNAG+LDS+MIVILNDNKQVSLPTA LDGPIP
Sbjct  194   RDLLGKHNHVIGVIGDGAMTAGQAYEAMNNAGFLDSNMIVILNDNKQVSLPTANLDGPIP  253

Query  1693  PVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFE  1514
             PVGALS    +LQS++PLRELREVAKGVTKQ+G PMHELAAKVDEYARGMISGS STLFE
Sbjct  254   PVGALS----KLQSSKPLRELREVAKGVTKQLGAPMHELAAKVDEYARGMISGSRSTLFE  309

Query  1513  ELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVT  1334
             ELGLYYIGPVDGHNIDDL++IL+EVK+T TTGPVLIHVVTEKGRGYPYAE+AADKYHGV 
Sbjct  310   ELGLYYIGPVDGHNIDDLLTILREVKATHTTGPVLIHVVTEKGRGYPYAERAADKYHGVV  369

Query  1333  KFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSR  1154
             KFDPATGKQFK  A TQ+YTTYFAEALI+EAEADK+IVAIHAAMGGGTGLN+F +RFP+R
Sbjct  370   KFDPATGKQFKGKAPTQTYTTYFAEALISEAEADKNIVAIHAAMGGGTGLNMFSKRFPTR  429

Query  1153  CFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAG  974
             CFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYDQV+HDVDLQKLPVRFAMDRAG
Sbjct  430   CFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVIHDVDLQKLPVRFAMDRAG  489

Query  973   LVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngv  794
             LVG+DGPTHCGAFDVT++ACLPNMVVMAPS+E ELFHMVATAAAIDDRPSC R+PRGNGV
Sbjct  490   LVGADGPTHCGAFDVTYLACLPNMVVMAPSNETELFHMVATAAAIDDRPSCFRFPRGNGV  549

Query  793   gvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARF  614
             G  LPPGNKG PLE+G+GRIL+EG+RVAL+GYGT VQ+CL+A+ALLE + L VTVADARF
Sbjct  550   GAQLPPGNKGVPLEIGKGRILVEGDRVALLGYGTVVQNCLAASALLEEQDLSVTVADARF  609

Query  613   CKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYI  434
             CKPLD  LIRSLA+ HEV+ITVEEG+IGGFGSHVA F+ALDG LDG LKWRP+VLPD YI
Sbjct  610   CKPLDRDLIRSLAREHEVLITVEEGTIGGFGSHVAHFLALDGFLDGKLKWRPMVLPDHYI  669

Query  433   DHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             +HGAP+DQ+ EAGLT SHIAA+V N+LG+ REAL++M+
Sbjct  670   EHGAPSDQMIEAGLTASHIAASVLNVLGRTREALQVMS  707



>ref|XP_010510254.1| PREDICTED: 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=701

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/677 (82%), Positives = 611/677 (90%), Gaps = 4/677 (1%)
 Frame = -2

Query  2350  KPSQINYKKRSS---GVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANE  2180
             KP+ ++  + ++    V+A+LA+K EYYS RPPTPLLDTIN+P+HMKNLS+KEL  L+ E
Sbjct  22    KPTSVSSARNTTCVLKVRATLAEKGEYYSNRPPTPLLDTINHPMHMKNLSIKELKVLSEE  81

Query  2179  LRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREK  2000
             LRSDVIFNVSKTGGHLGS+LGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR K
Sbjct  82    LRSDVIFNVSKTGGHLGSNLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRVK  141

Query  1999  MPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGA  1820
             M T+RQTNGL+G+T R ESE+D FGTGHSSTTISAGLGMAVGRDLKG  NNV+ VIGDGA
Sbjct  142   MKTLRQTNGLSGYTNRRESEHDSFGTGHSSTTISAGLGMAVGRDLKGMNNNVVVVIGDGA  201

Query  1819  MTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPL  1640
             MTAGQAYEAMNNAGYL+SDMIV+LNDNKQVSLPTA LDGP PPVGALS ALS LQSNRPL
Sbjct  202   MTAGQAYEAMNNAGYLESDMIVVLNDNKQVSLPTANLDGPTPPVGALSRALSTLQSNRPL  261

Query  1639  RELREVAKGVTKQIGGPMHELAAKVDEYARGMISG-SGSTLFEELGLYYIGPVDGHNIDD  1463
             +ELREVAKGV KQIGG MH+LA+KVDEY RGMISG + STLFEEL  YYIGPVDGH +DD
Sbjct  262   KELREVAKGVKKQIGGSMHQLASKVDEYTRGMISGTTSSTLFEELVFYYIGPVDGHKLDD  321

Query  1462  LVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQ  1283
             LVSIL++VKSTKT GPVLIHVVTEKGRGY YAE+A DKYHGV KFDPATGKQFK  AKT+
Sbjct  322   LVSILEKVKSTKTIGPVLIHVVTEKGRGYTYAERADDKYHGVLKFDPATGKQFKNIAKTK  381

Query  1282  SYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAG  1103
             SYT+ F EALIAEAEADKD+VAIHAAMGGGT LN F+ RFP+RCFDVGIAEQH VTF+AG
Sbjct  382   SYTSCFVEALIAEAEADKDVVAIHAAMGGGTMLNRFESRFPTRCFDVGIAEQHAVTFSAG  441

Query  1102  LACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTF  923
             LACEGLKPFC IYSSFMQRAYDQVVHDVDLQKLPVRFA+DRAGL+G DGPTHCGAFDVTF
Sbjct  442   LACEGLKPFCTIYSSFMQRAYDQVVHDVDLQKLPVRFAIDRAGLMGEDGPTHCGAFDVTF  501

Query  922   MACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGR  743
             MACLP+M+VMAPSDEAEL +MVATAAAIDDRPSC RY RGNG+GV LPPGNKG PL++G+
Sbjct  502   MACLPSMIVMAPSDEAELCNMVATAAAIDDRPSCFRYHRGNGIGVSLPPGNKGVPLQIGK  561

Query  742   GRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHE  563
             GRIL EGERVAL+GYG+AVQSCL AA++L  RGL++TVADARFCKPLD ALIR+LAKSHE
Sbjct  562   GRILREGERVALLGYGSAVQSCLEAASMLGERGLKITVADARFCKPLDVALIRNLAKSHE  621

Query  562   VMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPS  383
             V+ITVEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYI+HG+P DQLAEAGLT S
Sbjct  622   VLITVEEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIEHGSPMDQLAEAGLTAS  681

Query  382   HIAATVFNILGKAREAL  332
             HIAAT  N++G  REAL
Sbjct  682   HIAATALNLMGTPREAL  698



>ref|XP_006299897.1| hypothetical protein CARUB_v10016105mg [Capsella rubella]
 gb|EOA32795.1| hypothetical protein CARUB_v10016105mg [Capsella rubella]
Length=702

 Score =  1122 bits (2903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/660 (83%), Positives = 605/660 (92%), Gaps = 0/660 (0%)
 Frame = -2

Query  2311  VQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHL  2132
             V+ +LA+K EYYS R PTPLLDTIN+P+HMKNLS+KEL  L++ELRSDVIFNVSKTGGHL
Sbjct  39    VRGTLAEKGEYYSNRQPTPLLDTINHPMHMKNLSMKELKVLSDELRSDVIFNVSKTGGHL  98

Query  2131  GSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKR  1952
             GS+LGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KM T+RQTNGL+G+T R
Sbjct  99    GSNLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMKTLRQTNGLSGYTNR  158

Query  1951  SESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYL  1772
              ESE+D FGTGHSSTTISAGLGMAVGRDLKG  N+V+AV+GDGAMTAGQAYEAMNNAGYL
Sbjct  159   RESEHDSFGTGHSSTTISAGLGMAVGRDLKGMNNSVVAVVGDGAMTAGQAYEAMNNAGYL  218

Query  1771  DSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGG  1592
             +SDMIVILNDNKQVSLPTA LDGP PPVGALS ALS LQSN PLRELREVAKGV KQIGG
Sbjct  219   ESDMIVILNDNKQVSLPTANLDGPTPPVGALSRALSSLQSNGPLRELREVAKGVRKQIGG  278

Query  1591  PMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPV  1412
              MH+ A+KVDEYARGMISG+ STLFEELG +YIGPVDGH IDDLV+IL++VKST+T GPV
Sbjct  279   SMHQFASKVDEYARGMISGTSSTLFEELGFHYIGPVDGHKIDDLVTILEKVKSTRTIGPV  338

Query  1411  LIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEAD  1232
             LIHVVTEKGRGYPYAE+A DKYHGV KF+PATGKQFK  AKT+SYT+ F EALIAEAEAD
Sbjct  339   LIHVVTEKGRGYPYAERADDKYHGVLKFEPATGKQFKNIAKTKSYTSCFVEALIAEAEAD  398

Query  1231  KDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFM  1052
             KD+VAIHAAMGGGT LN F+ RFP+RCFDVGIAEQH VTFAAGLACEGLKPFC IYSSFM
Sbjct  399   KDVVAIHAAMGGGTMLNHFESRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCTIYSSFM  458

Query  1051  QRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAE  872
             QRAYDQVVHDVDLQKLPVRFA+DRAGL+G+DGPTHCGAFDVTFMACLPNM+VMAPSDEAE
Sbjct  459   QRAYDQVVHDVDLQKLPVRFAIDRAGLMGADGPTHCGAFDVTFMACLPNMIVMAPSDEAE  518

Query  871   LFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGT  692
             L +MVATAAAIDDRPSC RY RGNG+GV LPPGNKG PL++G+GRIL EGERVAL+GYG+
Sbjct  519   LCNMVATAAAIDDRPSCFRYHRGNGIGVSLPPGNKGVPLQIGKGRILREGERVALLGYGS  578

Query  691   AVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHV  512
             AVQ+CL AA++L  RGL+VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGFGSHV
Sbjct  579   AVQNCLEAASMLGERGLKVTVADARFCKPLDVALIRSLAKSHEVLITVEEGSIGGFGSHV  638

Query  511   AQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
              QF+ALDGLLDG LKWRP+V+PDRYI+HG+P DQLAEAGLT SHIAAT  N++G  REAL
Sbjct  639   VQFLALDGLLDGKLKWRPMVIPDRYIEHGSPMDQLAEAGLTASHIAATALNLMGTPREAL  698



>ref|XP_003609568.1| 1-deoxy-D-xylulose 5-phosphate synthase [Medicago truncatula]
 gb|AES91765.1| 1-deoxy-D-xylulose-5-phosphate synthase [Medicago truncatula]
Length=672

 Score =  1122 bits (2902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/720 (79%), Positives = 615/720 (85%), Gaps = 49/720 (7%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGV-QAS  2300
             M LC+ A P   S +   D ++  P  S     S   LHF     Q N  K+  GV  AS
Sbjct  1     MDLCSLACP---SFVTPCDPRRTLPLPSSSSSHSQWGLHFFSHSQQHNKLKKKFGVVHAS  57

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L++  EYYSQRPPTPLLDTINYPIHMKNLS K                            
Sbjct  58    LSEMGEYYSQRPPTPLLDTINYPIHMKNLSTK----------------------------  89

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
                              DKILWDVGHQSYPHKILTGRR+KM T+RQTNGL+GFTKRSESE
Sbjct  90    -----------------DKILWDVGHQSYPHKILTGRRDKMHTMRQTNGLSGFTKRSESE  132

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             YD FGTGHSSTTISAGLGMAVGRDLKGRKN+V+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  133   YDSFGTGHSSTTISAGLGMAVGRDLKGRKNDVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  192

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHE  1580
             IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSN+PLRELREVAKGVTK+IGGPMHE
Sbjct  193   IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNKPLRELREVAKGVTKRIGGPMHE  252

Query  1579  LAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHV  1400
             LAAKVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDDLV+IL+EVK+T +TGPVLIHV
Sbjct  253   LAAKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDLVAILKEVKTTNSTGPVLIHV  312

Query  1399  VTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIV  1220
             +TEKGRGYPYAEKAADKYHGV KFDP TGKQFK +AKTQSYTTYFAEALIAEA+ADKDI+
Sbjct  313   ITEKGRGYPYAEKAADKYHGVAKFDPPTGKQFKVAAKTQSYTTYFAEALIAEAKADKDII  372

Query  1219  AIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAY  1040
             AIHAAMGGGTG+N+F RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAY
Sbjct  373   AIHAAMGGGTGMNIFHRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAY  432

Query  1039  DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHM  860
             DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTH G+FDVTFMACLPNMVVMAPSDEAEL HM
Sbjct  433   DQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHSGSFDVTFMACLPNMVVMAPSDEAELCHM  492

Query  859   VATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQS  680
             VATAAAIDDRPSC RYPRGNG+GV LP   KG PLE+G+GRIL+EGERVAL+GYG+AVQ+
Sbjct  493   VATAAAIDDRPSCFRYPRGNGIGVELPTEYKGIPLEIGKGRILIEGERVALLGYGSAVQN  552

Query  679   CLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFM  500
             CL+AA+L+E  GLR+TVADARFCKPLD +LIRSLAKSHEV+ITVEEGSIGGFGSHVAQFM
Sbjct  553   CLAAASLVEQHGLRLTVADARFCKPLDRSLIRSLAKSHEVLITVEEGSIGGFGSHVAQFM  612

Query  499   ALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             ALDGLLDGNLKWRP+VLPDRYIDHG+PADQL  AGLTPSHIAATVFNILG+ REALE+M+
Sbjct  613   ALDGLLDGNLKWRPVVLPDRYIDHGSPADQLCMAGLTPSHIAATVFNILGQTREALEVMS  672



>ref|XP_001754004.1| predicted protein [Physcomitrella patens]
 gb|EDQ81326.1| predicted protein [Physcomitrella patens]
Length=725

 Score =  1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/698 (79%), Positives = 613/698 (88%), Gaps = 2/698 (0%)
 Frame = -2

Query  2407  RPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLADKD--EYYSQRPPTPLLDTINY  2234
             R  SS +F    L+L   Q  S        S + A+   ++  EY S++PPTPLLDT+NY
Sbjct  28    RADSSGFFGIQKLNLLRGQHTSLCLRSNEKSKILAAKVPENGAEYPSEKPPTPLLDTVNY  87

Query  2233  PIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILW  2054
             P+HMKNL+ +EL QLA+ELR++ I  VSKTGGHLGSSLGVVELTVALHYVFNAP DKILW
Sbjct  88    PVHMKNLTKRELKQLADELRAETIHTVSKTGGHLGSSLGVVELTVALHYVFNAPDDKILW  147

Query  2053  DVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVG  1874
             DVGHQ+YPHKILTGRR KM T+RQT+GL+GF KR+ESEYD FG GHSST+ISAGLGMAVG
Sbjct  148   DVGHQTYPHKILTGRRGKMQTLRQTDGLSGFVKRAESEYDPFGAGHSSTSISAGLGMAVG  207

Query  1873  RDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIP  1694
             RDLKG+KNNVI+VIGDGAMTAGQAYEAMNNAGYLD +MIVILNDNKQVSLPTATLDGP P
Sbjct  208   RDLKGKKNNVISVIGDGAMTAGQAYEAMNNAGYLDCNMIVILNDNKQVSLPTATLDGPAP  267

Query  1693  PVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFE  1514
             PVGALSSALSRLQS+RPLRELREVAKGVTKQ GG  H LA+KVDEYARGMISGSGSTLFE
Sbjct  268   PVGALSSALSRLQSSRPLRELREVAKGVTKQFGGSAHILASKVDEYARGMISGSGSTLFE  327

Query  1513  ELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVT  1334
             ELGLYYIGPVDGHN+DDLV+IL+EVK+T TTGPVLIH+VTEKGRGYPYAE+AADKYHGV 
Sbjct  328   ELGLYYIGPVDGHNLDDLVTILREVKNTSTTGPVLIHLVTEKGRGYPYAERAADKYHGVV  387

Query  1333  KFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSR  1154
             KFDPATGKQ K    TQ+YTTYFAEALIAEAE DK I+ IHAAMGGGTG+N+F +RFP R
Sbjct  388   KFDPATGKQKKVKTATQAYTTYFAEALIAEAELDKSIIGIHAAMGGGTGMNMFAKRFPER  447

Query  1153  CFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAG  974
             CFDVGIAEQH VTFAAGLACEGLKPFC+IYSSF+QR YDQVVHDVDLQKLPVRFAMDRAG
Sbjct  448   CFDVGIAEQHAVTFAAGLACEGLKPFCSIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAG  507

Query  973   LVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngv  794
             LVG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAELF+MVATA  I+DRPSC RYPRGNG+
Sbjct  508   LVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELFNMVATAVTIEDRPSCFRYPRGNGI  567

Query  793   gvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARF  614
             GV LP  NKG P+EVG+GRIL+EG +VAL+GYGT VQ+CL+A +LL   G+  TVAD RF
Sbjct  568   GVELPANNKGAPIEVGKGRILLEGTQVALLGYGTMVQNCLAAHSLLAKLGISATVADGRF  627

Query  613   CKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYI  434
             CKPLD  LIR LAK+H+V+ITVEEGSIGGFGSHVAQFMALDGLLDG L+WRPLVLPDRYI
Sbjct  628   CKPLDRDLIRQLAKNHQVLITVEEGSIGGFGSHVAQFMALDGLLDGKLQWRPLVLPDRYI  687

Query  433   DHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             +HG+P DQ AEAGLT  HIAATV N+LGK REALE+M+
Sbjct  688   EHGSPKDQYAEAGLTAGHIAATVLNVLGKTREALELMS  725



>ref|XP_010466391.1| PREDICTED: 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic-like 
[Camelina sativa]
Length=701

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/677 (81%), Positives = 607/677 (90%), Gaps = 4/677 (1%)
 Frame = -2

Query  2350  KPSQINYKKRSS---GVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANE  2180
             KP+ ++  + ++    V+A+LA+K EYYS RPPTPLLDTIN+P+HMKNLS+KEL  L+ E
Sbjct  22    KPTSVSSTRNTTCIFKVRATLAEKGEYYSNRPPTPLLDTINHPMHMKNLSIKELEVLSEE  81

Query  2179  LRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREK  2000
             LRSDVIFNVSKTGGHLGS+LGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR K
Sbjct  82    LRSDVIFNVSKTGGHLGSNLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGK  141

Query  1999  MPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGA  1820
             M T+RQTNGL+G+T R ESE+D FGTGHSSTTISAGLGMAVGRDLKG  N+V+ VIGDG 
Sbjct  142   MKTLRQTNGLSGYTNRRESEHDSFGTGHSSTTISAGLGMAVGRDLKGMNNSVVVVIGDGG  201

Query  1819  MTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPL  1640
             MTAGQAYEAMNNAGYL+SDMIVILNDNKQVSLPTA LDGP PPVGALS ALS LQSN PL
Sbjct  202   MTAGQAYEAMNNAGYLESDMIVILNDNKQVSLPTANLDGPTPPVGALSRALSTLQSNHPL  261

Query  1639  RELREVAKGVTKQIGGPMHELAAKVDEYARGMISG-SGSTLFEELGLYYIGPVDGHNIDD  1463
             +ELREVAKGV KQIGG MH+LA+KVDEY RGMISG + STLFEELG YYIGPVDGH +DD
Sbjct  262   KELREVAKGVKKQIGGSMHQLASKVDEYTRGMISGTTSSTLFEELGFYYIGPVDGHKLDD  321

Query  1462  LVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQ  1283
             LVSIL++VKSTKT GPVLIHVVTEKGRGY YAE+A DKYHGV KFDPATGKQFK  AKT 
Sbjct  322   LVSILEKVKSTKTIGPVLIHVVTEKGRGYAYAERADDKYHGVLKFDPATGKQFKNVAKTN  381

Query  1282  SYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAG  1103
             SYT+ F EALIAEAEADKD+VAIHAAMGGGT LN F+ RFP+RCFDVGIAEQH VTF+AG
Sbjct  382   SYTSCFVEALIAEAEADKDVVAIHAAMGGGTMLNRFESRFPTRCFDVGIAEQHAVTFSAG  441

Query  1102  LACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTF  923
             LACEGLKPFC IYSSFMQRAYDQVVHDVDLQKLPVRFA+DRAGL+G DGPTHCGAFDVTF
Sbjct  442   LACEGLKPFCTIYSSFMQRAYDQVVHDVDLQKLPVRFAIDRAGLMGEDGPTHCGAFDVTF  501

Query  922   MACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGR  743
             MACLPNM+VMAPSDEAEL +MVA AAAIDDRPSC RY RGNG+GV LPPGNKG  L++G+
Sbjct  502   MACLPNMIVMAPSDEAELCNMVAMAAAIDDRPSCFRYHRGNGIGVSLPPGNKGVHLQIGK  561

Query  742   GRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHE  563
             GRIL EGERVAL+GYG+AVQSCL AA++L  RGL++TVADARFCKPLD ALIRSLAKSHE
Sbjct  562   GRILREGERVALLGYGSAVQSCLEAASMLGERGLKITVADARFCKPLDVALIRSLAKSHE  621

Query  562   VMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPS  383
             V+ITVEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYI+HG+P DQLAEAGLT S
Sbjct  622   VLITVEEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIEHGSPVDQLAEAGLTAS  681

Query  382   HIAATVFNILGKAREAL  332
             HIAAT  N++G  REAL
Sbjct  682   HIAATALNLMGTPREAL  698



>ref|XP_002989268.1| hypothetical protein SELMODRAFT_427859 [Selaginella moellendorffii]
 gb|EFJ09706.1| hypothetical protein SELMODRAFT_427859 [Selaginella moellendorffii]
Length=728

 Score =  1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/675 (80%), Positives = 608/675 (90%), Gaps = 4/675 (1%)
 Frame = -2

Query  2344  SQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDV  2165
             SQ N   R+S    +L++  EY+S++PPTPLLDTINYP+HMKNL V +L QLA ELR++ 
Sbjct  57    SQSNVVVRAS----ALSEAPEYFSEKPPTPLLDTINYPLHMKNLGVSDLEQLAEELRNET  112

Query  2164  IFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIR  1985
             IF+VSKTGGHLGSSLGVVELTVALH+VFN P+DKILWDVGHQ+YPHKILTGRR +M T+R
Sbjct  113   IFSVSKTGGHLGSSLGVVELTVALHHVFNTPEDKILWDVGHQTYPHKILTGRRSRMHTLR  172

Query  1984  QTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQ  1805
             QT+G+ GFTKRSESEYD FG GHSSTTISAGLGMAV RDL+G+KNNVIAVIGDGAMTAGQ
Sbjct  173   QTDGICGFTKRSESEYDPFGAGHSSTTISAGLGMAVARDLQGKKNNVIAVIGDGAMTAGQ  232

Query  1804  AYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELRE  1625
             AYEAMNNAGYLD+++IVILNDNKQVSLPTATLDGP PPVGALSSALSRLQS++ LRELRE
Sbjct  233   AYEAMNNAGYLDTNLIVILNDNKQVSLPTATLDGPAPPVGALSSALSRLQSSKKLRELRE  292

Query  1624  VAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQ  1445
             VAKGVTKQIGG MH+LAAKVDEYARGMISG+G+T FEELGLYYIGPVDGH IDDL++IL+
Sbjct  293   VAKGVTKQIGGHMHQLAAKVDEYARGMISGTGATFFEELGLYYIGPVDGHRIDDLIAILK  352

Query  1444  EVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYF  1265
             EVK+ +T GPVLIHVVTEKGRGYPYAE+AADKYHGV KFDPATGKQ K    T++YTTYF
Sbjct  353   EVKAAETIGPVLIHVVTEKGRGYPYAERAADKYHGVVKFDPATGKQQKGKPATKAYTTYF  412

Query  1264  AEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGL  1085
             AE+L+AEA+ D+ IVAIHAAMGGGTGLN+FQ++FP RCFDVGIAEQH VTFAAGLA EG+
Sbjct  413   AESLVAEAQKDESIVAIHAAMGGGTGLNIFQKQFPERCFDVGIAEQHAVTFAAGLASEGI  472

Query  1084  KPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPN  905
             KPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPN
Sbjct  473   KPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPN  532

Query  904   MVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILME  725
             MVVMAP+DEAEL HM+ATAAAIDDRPSC RYPRGNG+G +LP GNKGTP+E+G+GRIL+E
Sbjct  533   MVVMAPADEAELMHMIATAAAIDDRPSCFRYPRGNGIGALLPAGNKGTPVEIGKGRILVE  592

Query  724   GERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVE  545
             G RVAL+GYGT VQ+CL A  LL+  GL VTVADARFCKPLD  L+R LAK HEV+ITVE
Sbjct  593   GSRVALLGYGTMVQNCLGARNLLQEHGLSVTVADARFCKPLDQQLVRQLAKEHEVLITVE  652

Query  544   EGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATV  365
             EGSIGGFGSHV  F+ALDGLLDG LKWRP+VLPDRYIDHG+P DQ+AEAGLT SHIAAT 
Sbjct  653   EGSIGGFGSHVVHFLALDGLLDGKLKWRPIVLPDRYIDHGSPQDQMAEAGLTSSHIAATA  712

Query  364   FNILGKAREALEIMT  320
              ++LGK REAL + +
Sbjct  713   LSMLGKTREALHLKS  727



>ref|XP_001760423.1| predicted protein [Physcomitrella patens]
 gb|EDQ74814.1| predicted protein [Physcomitrella patens]
Length=736

 Score =  1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/700 (78%), Positives = 615/700 (88%), Gaps = 4/700 (1%)
 Frame = -2

Query  2407  RPFSSQWFHGSDLHLHFQQKPSQINY---KKRSSGVQASLADKD-EYYSQRPPTPLLDTI  2240
             R  +S +F    ++L  + +   I Y   +++S  V  ++ + D EY S++P TPLLDTI
Sbjct  32    RADASSFFGTQKMNLSKESQSVSIEYLGVQEKSRVVATAVTETDAEYPSEKPLTPLLDTI  91

Query  2239  NYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKI  2060
             NYPIHMKNL+V+EL QL +ELR++ I  VSKTGGHLGSSLGVVELTVALH+VFN P+DKI
Sbjct  92    NYPIHMKNLTVRELKQLVDELRAETIHTVSKTGGHLGSSLGVVELTVALHHVFNTPEDKI  151

Query  2059  LWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMA  1880
             LWDVGHQ+YPHKILTGRR KM T+RQT G++GF KR+ESEYD FG GHSST+ISAGLGMA
Sbjct  152   LWDVGHQTYPHKILTGRRGKMRTLRQTAGISGFVKRAESEYDPFGAGHSSTSISAGLGMA  211

Query  1879  VGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP  1700
             VGRDLKGR NNVIAVIGDGAMTAGQAYEAMNNAGYLD +MIVILNDNKQVSLPTATLDGP
Sbjct  212   VGRDLKGRTNNVIAVIGDGAMTAGQAYEAMNNAGYLDCNMIVILNDNKQVSLPTATLDGP  271

Query  1699  IPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTL  1520
              PPVGALSSALS+LQS+RPLRELREVAKGVTKQ+GG  H LAAKVDEYARGMISGSGSTL
Sbjct  272   APPVGALSSALSKLQSSRPLRELREVAKGVTKQLGGSAHVLAAKVDEYARGMISGSGSTL  331

Query  1519  FEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHG  1340
             FEELGLYYIGPV+GHN++DLV+IL+EVK+T TTGPVLIH+VTEKGRGYPYAE+AADKYHG
Sbjct  332   FEELGLYYIGPVNGHNLEDLVTILREVKNTATTGPVLIHLVTEKGRGYPYAERAADKYHG  391

Query  1339  VTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFP  1160
             V KFDPATGKQ K    TQ+YTTYFAEALIAEAE DK IV IHAAMGGGTG+N+F +RFP
Sbjct  392   VVKFDPATGKQHKVKTATQAYTTYFAEALIAEAELDKSIVGIHAAMGGGTGMNMFAKRFP  451

Query  1159  SRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDR  980
              RCFDVGIAEQH VTFAAGLACEGL+PFC+IYSSF+QR YDQVVHDVDLQKLPVRFAMDR
Sbjct  452   ERCFDVGIAEQHAVTFAAGLACEGLRPFCSIYSSFLQRGYDQVVHDVDLQKLPVRFAMDR  511

Query  979   AGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgn  800
             AGLVG+DGPTHCGAFDVT+MACLPNMVVMAP+DEAELF+MVATAA IDD PSC RYPRGN
Sbjct  512   AGLVGADGPTHCGAFDVTYMACLPNMVVMAPADEAELFNMVATAAVIDDSPSCFRYPRGN  571

Query  799   gvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADA  620
             G+GV LP  NKGTP+EVG+GRIL+EG  VAL+GYGT VQ+CL+A +LL   G+  TVAD 
Sbjct  572   GIGVQLPANNKGTPIEVGKGRILLEGTDVALLGYGTMVQNCLAAHSLLADVGISATVADG  631

Query  619   RFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDR  440
             RFCKPLD  LIR LA++H+V+ITVEEG++GGFGSHVAQFMALDGLLDG LKWRPLVLPDR
Sbjct  632   RFCKPLDRGLIRQLAENHQVLITVEEGAVGGFGSHVAQFMALDGLLDGKLKWRPLVLPDR  691

Query  439   YIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             YI+HGAP DQ AEAGLT  HIAAT  N+LGK R+AL+IM+
Sbjct  692   YIEHGAPNDQFAEAGLTAGHIAATALNVLGKTRQALQIMS  731



>emb|CDY52177.1| BnaC01g22400D [Brassica napus]
Length=733

 Score =  1113 bits (2880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/693 (82%), Positives = 610/693 (88%), Gaps = 25/693 (4%)
 Frame = -2

Query  2476  MALCTCALPG-DLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQAS  2300
             MAL   A P   +++ V +D  K    SS     +DL    + +P+  ++  R   V AS
Sbjct  1     MALSAFAFPSYIIAKGVLTDSCKQTSLSSSRSLATDLPSPCR-RPNN-SHSNRKVKVNAS  58

Query  2299  LADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSL  2120
             L +K EYYS RPPTPLLDTINYPIHMKNLS+KEL QL++ELRSDVIFNVSKTGGHLGSSL
Sbjct  59    LVEKGEYYSNRPPTPLLDTINYPIHMKNLSIKELKQLSDELRSDVIFNVSKTGGHLGSSL  118

Query  2119  GVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESE  1940
             GVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT+RQTNGL+GFTKR ESE
Sbjct  119   GVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPTMRQTNGLSGFTKRGESE  178

Query  1939  YDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDM  1760
             +DCFGTGHSSTTISAGLGMAVGRDLKG+ NNV+AVIGDGAMTAGQAYEAMNNAGYLDSDM
Sbjct  179   HDCFGTGHSSTTISAGLGMAVGRDLKGKSNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDM  238

Query  1759  IVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAK--GVTKQIGGPM  1586
             IVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LRELREVAK  GVTKQIGGPM
Sbjct  239   IVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALRELREVAKASGVTKQIGGPM  298

Query  1585  HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLI  1406
             H+LAAKVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDD+V+IL+EVKS +TTGPVLI
Sbjct  299   HQLAAKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDMVAILKEVKSARTTGPVLI  358

Query  1405  HVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKD  1226
             HVVTEKGRGYPYAE+A DKYHGV KFDPATGKQFK+S KTQSYTTYFAEAL+AEAE DKD
Sbjct  359   HVVTEKGRGYPYAERADDKYHGVVKFDPATGKQFKSSNKTQSYTTYFAEALVAEAEVDKD  418

Query  1225  IVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQR  1046
             +VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQR
Sbjct  419   VVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQR  478

Query  1045  AYDQ--------------------VVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVT  926
             AYDQ                    VVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT
Sbjct  479   AYDQASSQHSGLGPSIDPGYHQKEVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVT  538

Query  925   FMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVG  746
             FMACLPNM+VMAPSDEAELFHMVATA+AIDDRPSC RYPRGNG+GV LPPGNKG PLEVG
Sbjct  539   FMACLPNMIVMAPSDEAELFHMVATASAIDDRPSCFRYPRGNGIGVALPPGNKGIPLEVG  598

Query  745   RGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSH  566
             +GRIL EGERVAL+GYG+AVQSCL AA +L+ RGL +TVADARFCKPLD ALIRSLAKSH
Sbjct  599   KGRILKEGERVALLGYGSAVQSCLGAAVMLQERGLNITVADARFCKPLDRALIRSLAKSH  658

Query  565   EVMITVEEGSIGGFGSHVAQFMALDGLLDGNLK  467
             EV+ITVEEGSIGGFGSHV QF+ALDGLLDG LK
Sbjct  659   EVLITVEEGSIGGFGSHVVQFLALDGLLDGKLK  691



>emb|CDX90583.1| BnaA03g41980D [Brassica napus]
Length=684

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/668 (83%), Positives = 597/668 (89%), Gaps = 32/668 (5%)
 Frame = -2

Query  2335  NYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFN  2156
             ++  R + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLS KEL QL++ELRSDVIFN
Sbjct  48    SHSNRKAKVNASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSTKELKQLSDELRSDVIFN  107

Query  2155  VSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTN  1976
             VSKTGGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT+RQTN
Sbjct  108   VSKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPTMRQTN  167

Query  1975  GLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYE  1796
             GL+GFTKR ESE+DCFGTGHSSTTISAGLGMAVGRDLKG+ NNV+AVIGDGAMTAGQAYE
Sbjct  168   GLSGFTKRGESEHDCFGTGHSSTTISAGLGMAVGRDLKGKNNNVVAVIGDGAMTAGQAYE  227

Query  1795  AMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAK  1616
             AMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQSN  LRELRE   
Sbjct  228   AMNNAGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQSNPALRELRE---  284

Query  1615  GVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVK  1436
             GVTKQIGGPMH+LAAKVDEYARGMISG+GSTLFEELGLYYIGPVDGHNIDDLV+IL+EVK
Sbjct  285   GVTKQIGGPMHQLAAKVDEYARGMISGTGSTLFEELGLYYIGPVDGHNIDDLVAILKEVK  344

Query  1435  STKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEA  1256
             S +TTGPVLIHV+TEKGRGYPYAE+A DKYHGV KFDPATGKQFK + KTQSYTTYFAEA
Sbjct  345   SARTTGPVLIHVITEKGRGYPYAERADDKYHGVVKFDPATGKQFKTTNKTQSYTTYFAEA  404

Query  1255  LIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPF  1076
             L+AEAE DKD+VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH                
Sbjct  405   LVAEAEVDKDVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHA---------------  449

Query  1075  CAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVV  896
                           VVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFMACLPNM+V
Sbjct  450   --------------VVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMACLPNMIV  495

Query  895   MAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGER  716
             MAPSDEAEL+++VATAAAIDDRPSC RYPRGNG+GV LPPGNKG P+EVG+GRIL EGER
Sbjct  496   MAPSDEAELYNIVATAAAIDDRPSCFRYPRGNGIGVALPPGNKGVPVEVGKGRILKEGER  555

Query  715   VALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGS  536
             VAL+GYG+AVQSCL AA +L+ RGL VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGS
Sbjct  556   VALLGYGSAVQSCLGAAVMLQERGLNVTVADARFCKPLDRALIRSLAKSHEVLITVEEGS  615

Query  535   IGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNI  356
             IGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDHG+PADQ+AEAGL PSHIAAT  N+
Sbjct  616   IGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGSPADQMAEAGLMPSHIAATALNL  675

Query  355   LGKAREAL  332
             +G  REAL
Sbjct  676   IGAPREAL  683



>ref|XP_002984677.1| hypothetical protein SELMODRAFT_268893 [Selaginella moellendorffii]
 gb|EFJ14322.1| hypothetical protein SELMODRAFT_268893 [Selaginella moellendorffii]
Length=636

 Score =  1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/635 (85%), Positives = 593/635 (93%), Gaps = 0/635 (0%)
 Frame = -2

Query  2224  MKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVG  2045
             MKNLS K+L QLA+ELRSD+IF VSKTGGHLG+SLGV+ELTVALH+VFN P+DKILWDVG
Sbjct  1     MKNLSTKDLRQLADELRSDIIFTVSKTGGHLGASLGVIELTVALHHVFNMPEDKILWDVG  60

Query  2044  HQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDL  1865
             HQ+YPHKILTGRR +M T+RQTNGL+GFTKRSESEYD FG GHSST+ISAGLGMAV RDL
Sbjct  61    HQAYPHKILTGRRSRMHTLRQTNGLSGFTKRSESEYDSFGAGHSSTSISAGLGMAVARDL  120

Query  1864  KGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVG  1685
              G KN+VI+VIGDGAMTAGQAYEAMNNAGYLDS+MIVILNDNKQVSLPTATLDGP PPVG
Sbjct  121   MGNKNHVISVIGDGAMTAGQAYEAMNNAGYLDSNMIVILNDNKQVSLPTATLDGPAPPVG  180

Query  1684  ALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELG  1505
             ALSSALS+LQS+RPLRELREVAKGVTKQ+GGPMHELAAKVDEYARGMISGSGSTLFEELG
Sbjct  181   ALSSALSKLQSSRPLRELREVAKGVTKQLGGPMHELAAKVDEYARGMISGSGSTLFEELG  240

Query  1504  LYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFD  1325
             LYYIGPVDGH+I+DLV+IL+EVK+T+TTGPVLIH+VTEKGRGYPYAE+A+DKYHGV KFD
Sbjct  241   LYYIGPVDGHSIEDLVTILKEVKNTRTTGPVLIHIVTEKGRGYPYAERASDKYHGVVKFD  300

Query  1324  PATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFD  1145
             PATGKQFK    TQ+YTTYFAEALIAEAE D  I+AIHAAMGGGTGLN+FQ+RFP RCFD
Sbjct  301   PATGKQFKGKTATQAYTTYFAEALIAEAEVDNGIIAIHAAMGGGTGLNMFQKRFPDRCFD  360

Query  1144  VGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG  965
             VGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYDQVVHDVDLQKLPVRFAMDRAGLVG
Sbjct  361   VGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVVHDVDLQKLPVRFAMDRAGLVG  420

Query  964   SDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvv  785
             +DGPTHCGAFDVT+MACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC RYPRGNG+GVV
Sbjct  421   ADGPTHCGAFDVTYMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRYPRGNGIGVV  480

Query  784   lppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKP  605
             LPPGNKG PLEVG+GRIL+EG +VAL+GYGT VQSCL+A ALL + GL  TVADARFCKP
Sbjct  481   LPPGNKGIPLEVGKGRILVEGSKVALLGYGTMVQSCLAAQALLASCGLPATVADARFCKP  540

Query  604   LDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHG  425
             LD  LIR LA+ HEV+ITVEEGSIGGFGSHVAQFMALDGLLDG LKWRPLVLPDRYIDHG
Sbjct  541   LDRDLIRQLAREHEVLITVEEGSIGGFGSHVAQFMALDGLLDGTLKWRPLVLPDRYIDHG  600

Query  424   APADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             +P DQ+ EAGLT +HIAAT  +I+G+ R+ALEIM+
Sbjct  601   SPNDQMTEAGLTAAHIAATALDIMGRTRDALEIMS  635



>ref|XP_001771607.1| predicted protein [Physcomitrella patens]
 gb|EDQ63637.1| predicted protein [Physcomitrella patens]
Length=679

 Score =  1107 bits (2864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/673 (81%), Positives = 608/673 (90%), Gaps = 3/673 (0%)
 Frame = -2

Query  2329  KKRSSGVQASLADK-DEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNV  2153
             + +S  V +++ D+  EY +++PPTPLLDTINYPIHMKNL+V+EL QLA+E+R++ I  V
Sbjct  7     QTKSRIVTSAVPDQAGEYPAEKPPTPLLDTINYPIHMKNLTVRELKQLADEVRAETIHTV  66

Query  2152  SKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNG  1973
             SKTGGHLGSSLGVVELTVALH+VFN P+DK LWDVGHQ+YPHKILTGRR++M T+RQT+G
Sbjct  67    SKTGGHLGSSLGVVELTVALHHVFNCPEDKFLWDVGHQAYPHKILTGRRDRMHTLRQTDG  126

Query  1972  LAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEA  1793
             L+GF KR+ESEYD FG GHSST+ISAGLGMAVGRDLKG+KNNVIAVIGDGAMTAGQAYEA
Sbjct  127   LSGFVKRAESEYDAFGAGHSSTSISAGLGMAVGRDLKGKKNNVIAVIGDGAMTAGQAYEA  186

Query  1792  MNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKG  1613
             MNNAGYLD +MIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQS+RPLRELREVAKG
Sbjct  187   MNNAGYLDCNMIVILNDNKQVSLPTATLDGPAPPVGALSSALSRLQSSRPLRELREVAKG  246

Query  1612  VTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKS  1433
             VTKQ+GGP H LA+KVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDLV+IL+EVK+
Sbjct  247   VTKQLGGPAHVLASKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNMDDLVTILREVKN  306

Query  1432  TKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEAL  1253
             T TTGPVLIH+VTEKGRGYPYAE+AADKYHGV KFDPATGKQ K  A TQ+YTTYFAEAL
Sbjct  307   TSTTGPVLIHLVTEKGRGYPYAERAADKYHGVVKFDPATGKQNKVKAATQAYTTYFAEAL  366

Query  1252  IAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFC  1073
             IAEAE DKDI+ IHAAMGGGTG+N+F +RFP RCFDVGIAEQH VTFAAGLACEGLKPFC
Sbjct  367   IAEAEVDKDIIGIHAAMGGGTGMNMFAKRFPERCFDVGIAEQHAVTFAAGLACEGLKPFC  426

Query  1072  AIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVM  893
             +IYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPNMVVM
Sbjct  427   SIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVM  486

Query  892   APSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERV  713
             AP+DEAELFHMVATAA IDDRPSC RYPRGNG+G  LP  NKG P+E+G+GRIL+EG  V
Sbjct  487   APADEAELFHMVATAAQIDDRPSCFRYPRGNGIGAQLPENNKGIPVEIGKGRILLEGTEV  546

Query  712   ALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSI  533
             AL+GYGT VQ+CL+A ALL   G+  TVADARFCKPLD  LIR LAK+H+V+ITVEEGSI
Sbjct  547   ALLGYGTMVQNCLAARALLADLGVAATVADARFCKPLDRDLIRQLAKNHQVIITVEEGSI  606

Query  532   GGFGSHVAQFMALDGLLDGNLKWR--PLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFN  359
             GGFGSHVAQFMALDGLLDG LK    PLVLPDRYI+HGAP DQ AEAGLT  HIAAT  N
Sbjct  607   GGFGSHVAQFMALDGLLDGKLKASLLPLVLPDRYIEHGAPKDQYAEAGLTAGHIAATALN  666

Query  358   ILGKAREALEIMT  320
             +LGK REAL++MT
Sbjct  667   VLGKTREALQVMT  679



>ref|XP_003594033.1| 1-deoxy-D-xylulose 5-phosphate synthase [Medicago truncatula]
 gb|AES64284.1| 1-deoxy-D-xylulose-5-phosphate synthase [Medicago truncatula]
Length=718

 Score =  1106 bits (2861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/704 (79%), Positives = 619/704 (88%), Gaps = 12/704 (2%)
 Frame = -2

Query  2422  DLQKPRPF---SSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLADKDEYYSQRPPTPL  2252
             D +K  P    + QW   SDL  H   K +Q+  +K   GV AS+++  EY+ +R PTPL
Sbjct  21    DPKKSTPLGGSNYQW-GASDLISH--HKLNQV--RKIPYGVCASISETGEYHYERQPTPL  75

Query  2251  LDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAP  2072
             LDTINYPIHMKNLS KEL QLA ELRSD+IF+VS+TGGHLGS+LGVVELTVALHYVFNAP
Sbjct  76    LDTINYPIHMKNLSNKELKQLACELRSDIIFSVSQTGGHLGSNLGVVELTVALHYVFNAP  135

Query  2071  QDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAG  1892
              DKILWDVGHQSYPHKILTGRR KM T+RQ +GL+GFTKRSESE+D FGTGHSSTTISAG
Sbjct  136   IDKILWDVGHQSYPHKILTGRRNKMHTLRQKDGLSGFTKRSESEFDIFGTGHSSTTISAG  195

Query  1891  LGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTAT  1712
             LGMAVGRDLKG K+NV+ +IGDGAMTAGQA+EAMNNAGYL+S+MIVILNDNKQVSLPTA 
Sbjct  196   LGMAVGRDLKGEKHNVVTIIGDGAMTAGQAFEAMNNAGYLNSNMIVILNDNKQVSLPTAD  255

Query  1711  LDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGS  1532
             LDGPIPPVGALS  LSRLQSN PLRELREVAKGVTKQ G P+    AKV+EYA GMISGS
Sbjct  256   LDGPIPPVGALSRTLSRLQSNIPLRELREVAKGVTKQNGRPI----AKVEEYALGMISGS  311

Query  1531  GSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAAD  1352
             GSTLFEELGL YIGPVDGH+IDDLV+IL++VKS K TGPVLIHVVTEKG GY YAEKAAD
Sbjct  312   GSTLFEELGLDYIGPVDGHSIDDLVAILKQVKSPKKTGPVLIHVVTEKGLGYSYAEKAAD  371

Query  1351  KYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQ  1172
             KYHGV KFDPATGKQFK  A T   T+ F +ALIAEAEADK IV IHAAMGGGTG+N F 
Sbjct  372   KYHGVAKFDPATGKQFKTKAPTPVLTSCFVDALIAEAEADKGIVGIHAAMGGGTGMNHFL  431

Query  1171  RRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRF  992
             RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYDQVVHDVDLQKLPVRF
Sbjct  432   RRFPTRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVVHDVDLQKLPVRF  491

Query  991   AMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRY  812
              +D+AG VG DGPTHCG+FDVT+MACLPNMVVMAPSDEAE+ HMVATA AI+DRPSC R+
Sbjct  492   VIDKAGFVGEDGPTHCGSFDVTYMACLPNMVVMAPSDEAEIIHMVATAVAINDRPSCFRF  551

Query  811   prgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVT  632
             PR NG GV LPPGN+G P+E+G+GRIL+EGERVAL+G+GTAVQ+C++AA++LE  GLRVT
Sbjct  552   PRANGTGVELPPGNRGIPMEIGKGRILIEGERVALLGFGTAVQNCVAAASMLEDHGLRVT  611

Query  631   VADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLV  452
             VADARFCKPLDH+LIRSLAKSHEV+ITVEEGSIGGFGSHVAQFMALDGLLDG LKWRP+V
Sbjct  612   VADARFCKPLDHSLIRSLAKSHEVLITVEEGSIGGFGSHVAQFMALDGLLDGKLKWRPMV  671

Query  451   LPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
              PD YIDHG+PA+QLA AGLT SHIAATVFNILG+ REALE+MT
Sbjct  672   FPDIYIDHGSPAEQLAVAGLTSSHIAATVFNILGQTREALEVMT  715



>ref|XP_002978764.1| hypothetical protein SELMODRAFT_268187 [Selaginella moellendorffii]
 gb|EFJ20211.1| hypothetical protein SELMODRAFT_268187 [Selaginella moellendorffii]
Length=636

 Score =  1104 bits (2856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/635 (85%), Positives = 592/635 (93%), Gaps = 0/635 (0%)
 Frame = -2

Query  2224  MKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVG  2045
             MKNLS K+L QLA+ELRSD+IF VSKTGGHLG+SLGV+ELTVALH+VFN P+DKILWDVG
Sbjct  1     MKNLSTKDLRQLADELRSDIIFTVSKTGGHLGASLGVIELTVALHHVFNMPEDKILWDVG  60

Query  2044  HQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDL  1865
             HQ+YPHKILTGRR +M T+RQTNGL+GFTKRSESEYD FG GHSST+ISAGLGMAV RDL
Sbjct  61    HQAYPHKILTGRRSRMHTMRQTNGLSGFTKRSESEYDSFGAGHSSTSISAGLGMAVARDL  120

Query  1864  KGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVG  1685
              G KN+VI+VIGDGAMTAGQAYEAMNNAGYLDS+MIVILNDNKQVSLPTATLDGP PPVG
Sbjct  121   MGNKNHVISVIGDGAMTAGQAYEAMNNAGYLDSNMIVILNDNKQVSLPTATLDGPAPPVG  180

Query  1684  ALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELG  1505
             ALSSALS+LQS+RPLRELREVAKGVTKQ+GG MHELAAKVDEYARGMISGSGSTLFEELG
Sbjct  181   ALSSALSKLQSSRPLRELREVAKGVTKQLGGQMHELAAKVDEYARGMISGSGSTLFEELG  240

Query  1504  LYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFD  1325
             LYYIGPVDGH+I+DLV+IL+EVK+T+TTGPVLIH+VTEKGRGYPYAE+A+DKYHGV KFD
Sbjct  241   LYYIGPVDGHSIEDLVTILKEVKNTRTTGPVLIHIVTEKGRGYPYAERASDKYHGVVKFD  300

Query  1324  PATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFD  1145
             PATGKQFK    TQ+YTTYFAEALIAEAE D  I+AIHAAMGGGTGLN+FQ+RFP RCFD
Sbjct  301   PATGKQFKGKTATQAYTTYFAEALIAEAEVDNGIIAIHAAMGGGTGLNMFQKRFPDRCFD  360

Query  1144  VGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG  965
             VGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYDQVVHDVDLQKLPVRFAMDRAGLVG
Sbjct  361   VGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVVHDVDLQKLPVRFAMDRAGLVG  420

Query  964   SDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvv  785
             +DGPTHCGAFDVT+MACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC RYPRGNG+GVV
Sbjct  421   ADGPTHCGAFDVTYMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRYPRGNGIGVV  480

Query  784   lppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKP  605
             LPPGNKG PLEVG+GRIL+EG +VAL+GYGT VQSCL+A ALL + GL  TVADARFCKP
Sbjct  481   LPPGNKGIPLEVGKGRILVEGSKVALLGYGTMVQSCLAAQALLASCGLPATVADARFCKP  540

Query  604   LDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHG  425
             LD  LIR LA+ HEV+ITVEEGSIGGFGSHVAQFMALDGLLDG LKWRPLVLPDRYIDHG
Sbjct  541   LDRDLIRQLAREHEVLITVEEGSIGGFGSHVAQFMALDGLLDGTLKWRPLVLPDRYIDHG  600

Query  424   APADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             +P DQ+ EAGLT +HIAAT  +I+G+ R+ALEIM+
Sbjct  601   SPNDQMTEAGLTAAHIAATALDIMGRTRDALEIMS  635



>gb|EPS59801.1| hypothetical protein M569_15004, partial [Genlisea aurea]
Length=628

 Score =  1104 bits (2855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/628 (88%), Positives = 597/628 (95%), Gaps = 1/628 (0%)
 Frame = -2

Query  2212  SVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSY  2033
             ++++L QLA+ELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFN P D+ILWDVGHQSY
Sbjct  1     TMQDLKQLADELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNTPSDRILWDVGHQSY  60

Query  2032  PHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGL-GMAVGRDLKGR  1856
             PHKILTGRREKM T+RQT+GL GFTKRSESEYDCFG GHSSTTISAGL GMAVGRDLKGR
Sbjct  61    PHKILTGRREKMLTLRQTDGLCGFTKRSESEYDCFGAGHSSTTISAGLAGMAVGRDLKGR  120

Query  1855  KNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALS  1676
             KN+V+AVIGDGAMTAGQAYEAMNNAGYLD++MIVILNDNKQVSLPTA LDGP+PPVGALS
Sbjct  121   KNSVVAVIGDGAMTAGQAYEAMNNAGYLDTEMIVILNDNKQVSLPTANLDGPVPPVGALS  180

Query  1675  SALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYY  1496
             SALSRLQSNRPLRELREVAKGVTKQIGG MHE+AAKVDEYARG+ISGSG+TLFEELGLYY
Sbjct  181   SALSRLQSNRPLRELREVAKGVTKQIGGSMHEIAAKVDEYARGLISGSGATLFEELGLYY  240

Query  1495  IGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPAT  1316
             IGPVDGHNIDDL +IL+EVK TK TGPVLIHVVTEKGRGYPYAEKAADKYHGV KFDPAT
Sbjct  241   IGPVDGHNIDDLTTILREVKGTKITGPVLIHVVTEKGRGYPYAEKAADKYHGVVKFDPAT  300

Query  1315  GKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGI  1136
             GKQFK+SA T+SYT YFAEALIAEAEAD+D+VAIHAAMGGGTGLN F+RRFPSRCFDVGI
Sbjct  301   GKQFKSSAPTRSYTQYFAEALIAEAEADEDVVAIHAAMGGGTGLNYFERRFPSRCFDVGI  360

Query  1135  AEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDG  956
             AEQH VTFAAGLACEG+KPFCAIYSSF+QR YDQVVHDVDLQKLPVRFA+DRAGLVG+DG
Sbjct  361   AEQHAVTFAAGLACEGIKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFALDRAGLVGADG  420

Query  955   PTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlpp  776
             PTHCGAFDV +MACLPNMVVMAPSDEAELFHMVATAAA+DDRPSC RYPRGNG+GV LP 
Sbjct  421   PTHCGAFDVAYMACLPNMVVMAPSDEAELFHMVATAAAVDDRPSCFRYPRGNGIGVDLPA  480

Query  775   gnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDH  596
              NKG PLE+G+GRI++EGERVAL+GYGTAV+SC+SAA+LL + GL +TVADARFCKPLD 
Sbjct  481   KNKGVPLEIGKGRIVVEGERVALLGYGTAVRSCISAASLLASHGLMLTVADARFCKPLDR  540

Query  595   ALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPA  416
              L+RSLAKSHEV+ITVEEGSIGGFGSHVAQFMALDGLLDG LKWRP+VLPDRYIDHG+PA
Sbjct  541   GLVRSLAKSHEVLITVEEGSIGGFGSHVAQFMALDGLLDGKLKWRPIVLPDRYIDHGSPA  600

Query  415   DQLAEAGLTPSHIAATVFNILGKAREAL  332
             DQ+ EAGLTP+HIAATVFNILGKAREAL
Sbjct  601   DQVMEAGLTPAHIAATVFNILGKAREAL  628



>pir||D71420 hypothetical protein - Arabidopsis thaliana
Length=703

 Score =  1103 bits (2853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/702 (80%), Positives = 604/702 (86%), Gaps = 58/702 (8%)
 Frame = -2

Query  2350  KPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRS  2171
             KP+  ++  R + V ASLA+K EYYS RPPTPLLDTINYPIHMKNLSVKEL QL++ELRS
Sbjct  30    KPNNNSHSNRRAKVCASLAEKGEYYSNRPPTPLLDTINYPIHMKNLSVKELKQLSDELRS  89

Query  2170  DVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPT  1991
             DVIFNVSKTGGHLGSSLGVVELTVALHY+FN PQDKILWDVGHQSYPHKILTGRR KMPT
Sbjct  90    DVIFNVSKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMPT  149

Query  1990  IRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGL--------GMAVGRDLKGRKNNVIAV  1835
             +RQTNGL+GFTKR ESE+DCFGTGHSSTTISAGL        GMAVGRDLKG+ NNV+AV
Sbjct  150   MRQTNGLSGFTKRGESEHDCFGTGHSSTTISAGLGNTINHSFGMAVGRDLKGKNNNVVAV  209

Query  1834  IGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQ  1655
             IGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP PPVGALSSALSRLQ
Sbjct  210   IGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPSPPVGALSSALSRLQ  269

Query  1654  SNRPLRELREVAK----------GVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELG  1505
             SN  LRELREVAK          G+TKQIGGPMH+LAAKVDEYARGMISG+GS+LFEELG
Sbjct  270   SNPALRELREVAKASLLHFFSRMGMTKQIGGPMHQLAAKVDEYARGMISGTGSSLFEELG  329

Query  1504  LYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHG---VT  1334
             LYYIGPVDGHNIDDLV+IL+EVKST+TTGPVLIHVVTEKGRGYPYAE+A DKYHG   V 
Sbjct  330   LYYIGPVDGHNIDDLVAILKEVKSTRTTGPVLIHVVTEKGRGYPYAERADDKYHGKTSVV  389

Query  1333  KFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSR  1154
             KFDPATG+QFK + KTQSYTTYFAEAL+AEAE DKD+VAIHAAMGGGTGLNLFQRRFP+R
Sbjct  390   KFDPATGRQFKTTNKTQSYTTYFAEALVAEAEVDKDVVAIHAAMGGGTGLNLFQRRFPTR  449

Query  1153  CFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAG  974
             CFDVGIAEQH                              VVHDVDLQKLPVRFAMDRAG
Sbjct  450   CFDVGIAEQHA-----------------------------VVHDVDLQKLPVRFAMDRAG  480

Query  973   LVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngv  794
             LVG+DGPTHCGAFDVTFMACLPNM+VMAPSDEA+LF+MVATA AIDDRPSC RYPRGNG+
Sbjct  481   LVGADGPTHCGAFDVTFMACLPNMIVMAPSDEADLFNMVATAVAIDDRPSCFRYPRGNGI  540

Query  793   gvvlppgnkGTPLE--------VGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLR  638
             GV LPPGNKG P+E        +G+GRIL EGERVAL+GYG+AVQSCL AA +LE RGL 
Sbjct  541   GVALPPGNKGVPIEKISLGVFQIGKGRILKEGERVALLGYGSAVQSCLGAAVMLEERGLN  600

Query  637   VTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRP  458
             VTVADARFCKPLD ALIRSLAKSHEV+ITVEEGSIGGFGSHV QF+ALDGLLDG LKWRP
Sbjct  601   VTVADARFCKPLDRALIRSLAKSHEVLITVEEGSIGGFGSHVVQFLALDGLLDGKLKWRP  660

Query  457   LVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             +VLPDRYIDHGAPADQLAEAGL PSHIAAT  N++G  REAL
Sbjct  661   MVLPDRYIDHGAPADQLAEAGLMPSHIAATALNLIGAPREAL  702



>ref|XP_004486296.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase, 
chloroplastic-like [Cicer arietinum]
Length=675

 Score =  1086 bits (2808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/718 (78%), Positives = 613/718 (85%), Gaps = 48/718 (7%)
 Frame = -2

Query  2470  LCTC-ALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLA  2294
             +CT   LP  LS+   S        S+  +  +DL  H   + +Q+  +K+S GV ASL+
Sbjct  4     MCTLFTLPLHLSQTTVSRRTTSLASSNYQWGAADLLCHPHHRLNQV--RKKSFGVYASLS  61

Query  2293  DKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGV  2114
             +  EY+SQRPPTPLLDTINYPIHMKNLS KEL QLA+ELRSDVIFNVSKTGGHLGS+LGV
Sbjct  62    EMGEYHSQRPPTPLLDTINYPIHMKNLSTKELKQLADELRSDVIFNVSKTGGHLGSNLGV  121

Query  2113  VELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYD  1934
             VELT+ALHYVFNAP+DKILWDVGHQSYPHKILTGRR++M T+RQT+GL GFTKRSESE+D
Sbjct  122   VELTIALHYVFNAPKDKILWDVGHQSYPHKILTGRRKEMHTLRQTDGLCGFTKRSESEFD  181

Query  1933  CFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIV  1754
             CFGTGHSSTTISAGLGMAVGRDLKG KNNV+A+IGDGAMTAGQAYEAMNNAGYLDSDMIV
Sbjct  182   CFGTGHSSTTISAGLGMAVGRDLKGEKNNVVAIIGDGAMTAGQAYEAMNNAGYLDSDMIV  241

Query  1753  ILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELA  1574
             ILNDNKQVSLPTA LDGPIPPVGALSSALSRLQSN                         
Sbjct  242   ILNDNKQVSLPTANLDGPIPPVGALSSALSRLQSN-------------------------  276

Query  1573  AKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVT  1394
                     GMISGSGSTLFEELGLYYIGPVDGHNIDDLV+IL+EVKSTKTTGPVLIHVVT
Sbjct  277   -------SGMISGSGSTLFEELGLYYIGPVDGHNIDDLVAILKEVKSTKTTGPVLIHVVT  329

Query  1393  EKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAI  1214
             EKGRGYPYAEKAADKYHGVTKFDP+TGKQFKA A TQSYTTYFAEALIAEAEADK+IV I
Sbjct  330   EKGRGYPYAEKAADKYHGVTKFDPSTGKQFKAKAPTQSYTTYFAEALIAEAEADKNIVGI  389

Query  1213  HAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQ  1034
             HAAMGGGTG+NLF RRFP+RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSFMQRAYDQ
Sbjct  390   HAAMGGGTGMNLFLRRFPARCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYDQ  449

Query  1033  VVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVA  854
             VVHDVDLQKLPVRFAMDRAGLVG+DGPTH G+FDVTFMACLPNMVVMAPSDE ELFHMVA
Sbjct  450   VVHDVDLQKLPVRFAMDRAGLVGADGPTHSGSFDVTFMACLPNMVVMAPSDEVELFHMVA  509

Query  853   TAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCL  674
             TAAAI+DRPSC RYPRGNG+GV LP GNKGTPLE+G+GR             G+AVQ+CL
Sbjct  510   TAAAINDRPSCFRYPRGNGIGVELPKGNKGTPLEIGKGR-------------GSAVQNCL  556

Query  673   SAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMAL  494
             +AA+LLE  GL VTVADARFCKPLD +LIRSLAKSHEV+ITVEEGSIGGFGSHV QFMAL
Sbjct  557   AAASLLEHHGLHVTVADARFCKPLDRSLIRSLAKSHEVLITVEEGSIGGFGSHVVQFMAL  616

Query  493   DGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             DGLLDGNLKWRP+VLPD YIDHG+P DQ+  AGLTPSHIA+TVFNILG+ R+ LE+M+
Sbjct  617   DGLLDGNLKWRPMVLPDIYIDHGSPDDQMNLAGLTPSHIASTVFNILGQKRKGLEVMS  674



>gb|KFK39451.1| hypothetical protein AALP_AA3G246700 [Arabis alpina]
Length=628

 Score =  1078 bits (2787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/624 (86%), Positives = 582/624 (93%), Gaps = 0/624 (0%)
 Frame = -2

Query  2203  ELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHK  2024
             EL  LA+ELR+DVIFNVS+TGGHLGS+LGVVELTVALHY+F+ PQDKILWDVGHQSYPHK
Sbjct  2     ELKVLADELRNDVIFNVSETGGHLGSNLGVVELTVALHYIFSTPQDKILWDVGHQSYPHK  61

Query  2023  ILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNV  1844
             ILTGRR KM T+RQTNGL+GFTKR ESE+D FGTGHSSTTISAGLGMAVGRDLKGR NNV
Sbjct  62    ILTGRRGKMKTLRQTNGLSGFTKRGESEHDSFGTGHSSTTISAGLGMAVGRDLKGRNNNV  121

Query  1843  IAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALS  1664
             +AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTA LDGP PPVGALSSALS
Sbjct  122   VAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTANLDGPTPPVGALSSALS  181

Query  1663  RLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPV  1484
             +LQSNRPLRELREVAKG+TKQIGG MH LA+KVDEYARGMISG+GSTLFEELGLYYIGPV
Sbjct  182   KLQSNRPLRELREVAKGMTKQIGGRMHRLASKVDEYARGMISGTGSTLFEELGLYYIGPV  241

Query  1483  DGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQF  1304
             DGHNIDDLVSIL+EVKSTKT GPVLIHVVTEKGRGYPYAEKA DKYHGV KFDPATGKQF
Sbjct  242   DGHNIDDLVSILKEVKSTKTIGPVLIHVVTEKGRGYPYAEKADDKYHGVVKFDPATGKQF  301

Query  1303  KASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQH  1124
             K+  KT+SYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLF+ RFP+RCFDVGIAEQH
Sbjct  302   KSIGKTKSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFESRFPTRCFDVGIAEQH  361

Query  1123  GVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHC  944
              VTFAAGLACEGLKPFCAIYSSFMQR +DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHC
Sbjct  362   AVTFAAGLACEGLKPFCAIYSSFMQRTFDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHC  421

Query  943   GAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkG  764
             GAFDVTFMACLPNM+VMAP+DEAELF+MVATAAAIDDRPSC RYPR NG GV LPPGNKG
Sbjct  422   GAFDVTFMACLPNMIVMAPADEAELFNMVATAAAIDDRPSCFRYPRRNGTGVSLPPGNKG  481

Query  763   TPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIR  584
              PL++G+GRIL EGERVAL+GYGTAVQ+CL AA +L+ RGL++TV DA FCKPLD +LIR
Sbjct  482   VPLQIGKGRILKEGERVALLGYGTAVQNCLEAATILDERGLKITVVDAIFCKPLDVSLIR  541

Query  583   SLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLA  404
             +LAKSHEV+ITVEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPD+YI+HG+P  QLA
Sbjct  542   NLAKSHEVLITVEEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDQYIEHGSPLHQLA  601

Query  403   EAGLTPSHIAATVFNILGKAREAL  332
             EAGLT SHIAAT  N++   REAL
Sbjct  602   EAGLTASHIAATALNLIRTPREAL  625



>gb|AAB88295.1| CLA1 transketolase-like protein [Oryza sativa]
Length=594

 Score =  1075 bits (2781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/594 (89%), Positives = 562/594 (95%), Gaps = 0/594 (0%)
 Frame = -2

Query  2239  NYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKI  2060
             NYPIHMKNLS+KEL QLA+ELRSDVIF+VSKTGGHLGSSLGVVELTVALHYVFN PQDKI
Sbjct  1     NYPIHMKNLSLKELQQLADELRSDVIFHVSKTGGHLGSSLGVVELTVALHYVFNTPQDKI  60

Query  2059  LWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMA  1880
             LWDVGHQSYPHKILTGRR+KMPT+RQTNGL+GFTKRSESEYD FGTGHSSTTISA LGMA
Sbjct  61    LWDVGHQSYPHKILTGRRDKMPTMRQTNGLSGFTKRSESEYDSFGTGHSSTTISAALGMA  120

Query  1879  VGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP  1700
             VGRDLKG KNNV+AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP
Sbjct  121   VGRDLKGGKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP  180

Query  1699  IPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTL  1520
              PPVGALSSALS+LQS+RPLRELREVAKGVTKQIGG +HELAAKVDEYARGMISGSGSTL
Sbjct  181   APPVGALSSALSKLQSSRPLRELREVAKGVTKQIGGSVHELAAKVDEYARGMISGSGSTL  240

Query  1519  FEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHG  1340
             FEELGLYYIGPVDGHNIDDL++IL+EVKSTKTTGPVLIHVVTEKGRGYPYAE+AADKYHG
Sbjct  241   FEELGLYYIGPVDGHNIDDLITILREVKSTKTTGPVLIHVVTEKGRGYPYAERAADKYHG  300

Query  1339  VTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFP  1160
             V KFDPATGKQFK+ AKT SYT YFAEALIAEAE D  +VAIHAAMGGGTGLN F RRFP
Sbjct  301   VAKFDPATGKQFKSPAKTLSYTNYFAEALIAEAEQDNRVVAIHAAMGGGTGLNYFLRRFP  360

Query  1159  SRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDR  980
             +RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDR
Sbjct  361   NRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDR  420

Query  979   AGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgn  800
             AGLVG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAEL HMVATAAAIDDRPSC RYPRGN
Sbjct  421   AGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELCHMVATAAAIDDRPSCFRYPRGN  480

Query  799   gvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADA  620
             G+GV LPP  KG PLEVG+GR+L+EGERVAL+GYG+AVQ CL+AA+L+E  GL+VTVADA
Sbjct  481   GIGVPLPPNYKGVPLEVGKGRVLLEGERVALLGYGSAVQYCLAAASLVERHGLKVTVADA  540

Query  619   RFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRP  458
             RFCKPLD  LIR LA SHEV++TVEEGSIGGFGSHVAQFMALDGLLDG LKWRP
Sbjct  541   RFCKPLDQTLIRRLASSHEVLLTVEEGSIGGFGSHVAQFMALDGLLDGKLKWRP  594



>ref|XP_002965644.1| 1-deoxy-D-xylulose-5-phosphate synthase [Selaginella moellendorffii]
 gb|EFJ33064.1| 1-deoxy-D-xylulose-5-phosphate synthase [Selaginella moellendorffii]
Length=636

 Score =  1066 bits (2758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/633 (82%), Positives = 576/633 (91%), Gaps = 0/633 (0%)
 Frame = -2

Query  2224  MKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVG  2045
             MKNL V +L QLA ELR++ IF+VSKTGGHLGSSLGVVELTVALH+VFN P+DKILWDVG
Sbjct  1     MKNLGVSDLEQLAEELRNETIFSVSKTGGHLGSSLGVVELTVALHHVFNTPEDKILWDVG  60

Query  2044  HQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDL  1865
             HQ+YPHKILTGRR +M T+RQT+G+ GFTKRSESEYD FG GHSSTTISAGLGMAV RDL
Sbjct  61    HQTYPHKILTGRRSRMHTLRQTDGICGFTKRSESEYDPFGAGHSSTTISAGLGMAVARDL  120

Query  1864  KGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVG  1685
             +G+KNNVIAVIGDGAMTAGQAYEAMNNAGYLD++MIVILNDNKQVSLPTATLDGP PPVG
Sbjct  121   QGKKNNVIAVIGDGAMTAGQAYEAMNNAGYLDTNMIVILNDNKQVSLPTATLDGPAPPVG  180

Query  1684  ALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELG  1505
             ALSSALSRLQS++ LRELREVAKGVTKQIGG MH+LAAKVDEYARGMISG+G+T FEELG
Sbjct  181   ALSSALSRLQSSKKLRELREVAKGVTKQIGGHMHQLAAKVDEYARGMISGTGATFFEELG  240

Query  1504  LYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFD  1325
             LYYIGPVDGH IDDL++IL+EVK+ +T GPVLIHVVTEKG GYPYAE+AADKYHGV KFD
Sbjct  241   LYYIGPVDGHRIDDLITILKEVKAAETIGPVLIHVVTEKGHGYPYAERAADKYHGVVKFD  300

Query  1324  PATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFD  1145
             PATGKQ K    T++YTTYFAE+L+AEA+ D+ IVAIHAAMGGGTGLN+FQ++FP RCFD
Sbjct  301   PATGKQQKGKPATKAYTTYFAESLVAEAQKDESIVAIHAAMGGGTGLNIFQKQFPERCFD  360

Query  1144  VGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG  965
             VGIAEQH VTFAAGLA EG+KPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG
Sbjct  361   VGIAEQHAVTFAAGLASEGIKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVG  420

Query  964   SDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvv  785
             +DGPTHCGAFDVT+MACLPNMVVMAP+DEAEL HM+ATAAAIDDRPSC RYPRGNG+G +
Sbjct  421   ADGPTHCGAFDVTYMACLPNMVVMAPADEAELMHMIATAAAIDDRPSCFRYPRGNGIGAL  480

Query  784   lppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKP  605
             LP GNKGTP+E+G+GRIL+EG RVAL+GYGT VQ+CL A  LL+  GL VTVADARFCKP
Sbjct  481   LPAGNKGTPVEIGKGRILVEGSRVALLGYGTMVQNCLGARNLLQEHGLSVTVADARFCKP  540

Query  604   LDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHG  425
             LD  L+R LAK HEV+ITVEEGSIGGFGSHV  F+ALDGLLDG LKWRP+VLPDRYIDHG
Sbjct  541   LDQQLVRQLAKEHEVLITVEEGSIGGFGSHVVHFLALDGLLDGKLKWRPIVLPDRYIDHG  600

Query  424   APADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             +P DQ+AEAGLT SHIAAT  ++LGK REAL +
Sbjct  601   SPQDQMAEAGLTSSHIAATALSMLGKTREALHL  633



>gb|AAL32062.1|AF443590_1 deoxy-D-xylulose-5-phosphate synthase [Morinda citrifolia]
Length=722

 Score =  1057 bits (2734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/723 (72%), Positives = 601/723 (83%), Gaps = 8/723 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL   A PG+LSR++ S+  K     S W  G+DL L F+ + +Q+   K S  V+ASL
Sbjct  1     MALNAFAFPGNLSRVLVSNSIKQSLLHSNWLCGTDLQLQFECQNNQV--MKNSRRVRASL  58

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVK------ELNQLANELRSDVIFNVSKTGGH  2135
             +++ EYYSQRPPTPLLDTINYPIHMKNLS K      EL QLA+ELRSD+IFNVSKTGGH
Sbjct  59    SERGEYYSQRPPTPLLDTINYPIHMKNLSTKSHYLIQELKQLADELRSDIIFNVSKTGGH  118

Query  2134  LGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTK  1955
             LGSSLGVVELTVALHY FN PQDKI+WDVGHQ+YPHKILTGRR KM TIRQT G+AGF K
Sbjct  119   LGSSLGVVELTVALHYAFNCPQDKIVWDVGHQAYPHKILTGRRSKMQTIRQTYGIAGFPK  178

Query  1954  RSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGY  1775
             R ES YD FG GHSST+ISAGLGMAVGRDL G+ NNVI+VIGDGAMTAGQAYEAMNNAG+
Sbjct  179   RDESVYDAFGAGHSSTSISAGLGMAVGRDLLGKNNNVISVIGDGAMTAGQAYEAMNNAGF  238

Query  1774  LDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIG  1595
             LD+++IVILNDNKQVSLPT TLDGP  PVGALSSAL++LQ++   R+LRE AK +TKQIG
Sbjct  239   LDANLIVILNDNKQVSLPTGTLDGPATPVGALSSALTKLQASPKFRQLREAAKSITKQIG  298

Query  1594  GPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGP  1415
                HE+AAKVDEYARG+IS SGST FEELGLYYIGPVDGHNI+DL++I  +VK+    GP
Sbjct  299   PQAHEVAAKVDEYARGLISASGSTFFEELGLYYIGPVDGHNIEDLITIFDKVKTMPAPGP  358

Query  1414  VLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEA  1235
             VLIH+VTEKG+GYP AE AAD+ HGV KFD A+GKQFK+ + T SYT YFAEALI EAE 
Sbjct  359   VLIHIVTEKGKGYPPAEAAADRMHGVVKFDVASGKQFKSKSPTLSYTQYFAEALIKEAEI  418

Query  1234  DKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSF  1055
             D  IVAIHAAMGGGTGLN FQ+ FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF
Sbjct  419   DNKIVAIHAAMGGGTGLNYFQKIFPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSF  478

Query  1054  MQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEA  875
             +QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +MACL NM+VMAP+DEA
Sbjct  479   LQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLSNMIVMAPADEA  538

Query  874   ELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYG  695
             EL HMVATAA IDDRP C R+PRGNG+G  LPP NKG  + +G+GRIL EG RVA++GYG
Sbjct  539   ELMHMVATAATIDDRPCCFRFPRGNGIGAKLPPDNKGNLIGIGKGRILTEGSRVAIIGYG  598

Query  694   TAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSH  515
               VQ CL AA +L+   ++ T+ADARFCKPLD  LI+ LAK HE++ITVEEGSIGGFGSH
Sbjct  599   AIVQQCLGAAEMLKLHNIKPTIADARFCKPLDGELIKRLAKEHEILITVEEGSIGGFGSH  658

Query  514   VAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREA  335
             V+ F++L GLLDG +K R +VLPDRYIDHG+PADQ+ +AGL+  HI ATV ++LGK +EA
Sbjct  659   VSHFLSLSGLLDGPIKLRSMVLPDRYIDHGSPADQIEQAGLSSRHICATVLSLLGKPKEA  718

Query  334   LEI  326
             L++
Sbjct  719   LQL  721



>gb|KDO74970.1| hypothetical protein CISIN_1g004923mg [Citrus sinensis]
Length=563

 Score =  1047 bits (2708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/560 (92%), Positives = 547/560 (98%), Gaps = 0/560 (0%)
 Frame = -2

Query  1999  MPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGA  1820
             M T+RQT+GL+GFTKRSESEYDCFGTGHSST+ISAGLGMAVGRDLKGRKNNV+AVIGDGA
Sbjct  1     MHTMRQTDGLSGFTKRSESEYDCFGTGHSSTSISAGLGMAVGRDLKGRKNNVVAVIGDGA  60

Query  1819  MTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPL  1640
             MTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPL
Sbjct  61    MTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPL  120

Query  1639  RELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL  1460
             RELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHN+DDL
Sbjct  121   RELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNVDDL  180

Query  1459  VSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQS  1280
             V+IL+EVK+TKTTGPVLIHVVTEKGRGYPYAEKAADKYHGV KFDPATGKQFK+SA+TQS
Sbjct  181   VAILEEVKNTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVAKFDPATGKQFKSSARTQS  240

Query  1279  YTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGL  1100
             YTTYFAEALIAEAE DKD+VAIHAAMGGGTGLNLF RRFP+RCFDVGIAEQH VTFAAGL
Sbjct  241   YTTYFAEALIAEAEVDKDVVAIHAAMGGGTGLNLFLRRFPTRCFDVGIAEQHAVTFAAGL  300

Query  1099  ACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFM  920
             ACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVTFM
Sbjct  301   ACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTFM  360

Query  919   ACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRG  740
             ACLPNMVVMAPSDEAELFHMVATAAAIDDRPSC RYPRGNG+GV LPPGNKG PLEVG+G
Sbjct  361   ACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCFRYPRGNGIGVELPPGNKGIPLEVGKG  420

Query  739   RILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEV  560
             RIL+EGERVAL+GYGTAVQSCL+A+ALLE+ GLR+TVADARFCKPLDHALIRSLAKSHEV
Sbjct  421   RILIEGERVALLGYGTAVQSCLAASALLESNGLRLTVADARFCKPLDHALIRSLAKSHEV  480

Query  559   MITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSH  380
             +ITVEEGSIGGFGSHV QF+A DGLLDG +KWRPLVLPDRYIDHG+PADQLA+AGLTPSH
Sbjct  481   LITVEEGSIGGFGSHVVQFLAQDGLLDGTVKWRPLVLPDRYIDHGSPADQLAQAGLTPSH  540

Query  379   IAATVFNILGKAREALEIMT  320
             IAATVFNILG+ REALEIM+
Sbjct  541   IAATVFNILGQTREALEIMS  560



>gb|ACJ67020.1| 1-deoxy-D-xylulose 5-phosphate synthase type II [Pinus taeda]
Length=740

 Score =  1045 bits (2701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/668 (74%), Positives = 580/668 (87%), Gaps = 2/668 (0%)
 Frame = -2

Query  2329  KKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVS  2150
             K ++      +A K  + +++PPTPLLDT+NYP+H+KNLS+++L QLA E+R++++F V+
Sbjct  69    KGKNVKAAVEIASKSGFPAEKPPTPLLDTVNYPVHLKNLSIQDLEQLATEIRAELVFGVA  128

Query  2149  KTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGL  1970
             KTGGHL ++LGVV+LTVALHYVFN P DKI+WDVGHQSYP+KILTGRR KM T+RQT+G+
Sbjct  129   KTGGHLSANLGVVDLTVALHYVFNTPHDKIVWDVGHQSYPYKILTGRRSKMSTLRQTSGI  188

Query  1969  AGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAM  1790
             AGF +R ESE+D FG GHSST+ISA +GMAVGRDL G+ N+VI VIGDGAMTAGQAYEAM
Sbjct  189   AGFPRRVESEHDAFGAGHSSTSISAAVGMAVGRDLLGKHNHVIGVIGDGAMTAGQAYEAM  248

Query  1789  NNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGV  1610
             NNAG+LDS+MI+ILNDNKQVSLPTA LDGPIPPVGALSSALS+LQS++PLRELREVAKGV
Sbjct  249   NNAGFLDSNMIIILNDNKQVSLPTANLDGPIPPVGALSSALSKLQSSKPLRELREVAKGV  308

Query  1609  TKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKST  1430
             TKQ+G PMHELAAKVDEYARGMISGS S+LF+ELGLYYIGPVDGHNI+D+V+IL+++KS 
Sbjct  309   TKQLGAPMHELAAKVDEYARGMISGSRSSLFDELGLYYIGPVDGHNIEDMVTILEKIKSM  368

Query  1429  KTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALI  1250
               TGPVLIH+VTEKG+GYP AE+AADK HGV KFDP TGKQFK+ +   SYT YFAEALI
Sbjct  369   PATGPVLIHLVTEKGKGYPPAEEAADKLHGVVKFDPVTGKQFKSKSSVLSYTQYFAEALI  428

Query  1249  AEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCA  1070
             AEAE D  IVAIHAAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCA
Sbjct  429   AEAEVDSKIVAIHAAMGGGTGLNYFQKKFPERCFDVGIAEQHAVTFAAGLATEGLKPFCA  488

Query  1069  IYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMA  890
             IYS+F+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDV +MACLPNM+VMA
Sbjct  489   IYSTFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVAYMACLPNMIVMA  548

Query  889   PSDEAELFHMVATAAAIDDRPSCLRY-prgngvgvvlppgnkGTPLEVGRGRILMEGERV  713
             PSDE EL H+VATAAAIDDRPSC R+          LP  NKG PLE+G+GRIL+EG RV
Sbjct  549   PSDEVELMHIVATAAAIDDRPSCFRFPRGNGVGLSNLPLNNKGVPLEIGKGRILVEGTRV  608

Query  712   ALVGYGTAVQSCLSAAALL-ETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGS  536
             A++G+GT +Q+CL+A  +L E  G+ VT+ADARFCKPLD  LI+ LAK HE+++TVEEGS
Sbjct  609   AILGFGTIIQNCLAAGKILNEQAGISVTIADARFCKPLDGDLIKRLAKEHEILLTVEEGS  668

Query  535   IGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNI  356
             IGGFGSHV+ F+AL+GLLDG LKWR +VLPDRYIDHGAP DQ+ EAGLTP HIAAT+ ++
Sbjct  669   IGGFGSHVSHFLALNGLLDGKLKWRAMVLPDRYIDHGAPKDQIEEAGLTPEHIAATIMSL  728

Query  355   LGKAREAL  332
             LGK  +AL
Sbjct  729   LGKPHDAL  736



>ref|XP_006378083.1| hypothetical protein POPTR_0010s01910g [Populus trichocarpa]
 gb|ERP55880.1| hypothetical protein POPTR_0010s01910g [Populus trichocarpa]
Length=582

 Score =  1043 bits (2697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/576 (91%), Positives = 554/576 (96%), Gaps = 0/576 (0%)
 Frame = -2

Query  2047  GHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRD  1868
             G QSYPHKILTGRR+KM TIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRD
Sbjct  6     GLQSYPHKILTGRRDKMHTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRD  65

Query  1867  LKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPV  1688
             LKG  N V+AVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTA LDGPIPPV
Sbjct  66    LKGGTNKVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTANLDGPIPPV  125

Query  1687  GALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEEL  1508
             GALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEEL
Sbjct  126   GALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEEL  185

Query  1507  GLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKF  1328
             GLYYIGPVDGHNIDDL++IL+EVKSTKTTGPVLIHVVTEKGRGYP+AE+AADKYHGV KF
Sbjct  186   GLYYIGPVDGHNIDDLIAILKEVKSTKTTGPVLIHVVTEKGRGYPFAERAADKYHGVAKF  245

Query  1327  DPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCF  1148
             DPATGKQFKAS  TQSYTTYFAEAL AEAEADKDIVAIHAAMGGGTGLNLF RRFP+RCF
Sbjct  246   DPATGKQFKASPSTQSYTTYFAEALTAEAEADKDIVAIHAAMGGGTGLNLFLRRFPTRCF  305

Query  1147  DVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLV  968
             DVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QRAYDQVVHDVDLQKLPVRFAMDRAGLV
Sbjct  306   DVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRAYDQVVHDVDLQKLPVRFAMDRAGLV  365

Query  967   GSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgv  788
             G+DGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATA AIDDRPSC RYPRGNGVGV
Sbjct  366   GADGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATATAIDDRPSCFRYPRGNGVGV  425

Query  787   vlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCK  608
              LPPGNKG PLEVG+GR+L+EGERVAL+GYGTAVQSCL+AA+L+E  G+R+TVADARFCK
Sbjct  426   QLPPGNKGVPLEVGKGRMLIEGERVALLGYGTAVQSCLAAASLVERHGIRLTVADARFCK  485

Query  607   PLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDH  428
             PLDHALIRSLAKSHE++ITVEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYIDH
Sbjct  486   PLDHALIRSLAKSHEILITVEEGSIGGFGSHVVQFLALDGLLDGKLKWRPVVLPDRYIDH  545

Query  427   GAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             G+PADQL EAGLTPSHIAATVF+ILG+ REALEIM+
Sbjct  546   GSPADQLVEAGLTPSHIAATVFSILGQRREALEIMS  581



>ref|XP_010933574.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Elaeis guineensis]
Length=709

 Score =  1035 bits (2677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/656 (76%), Positives = 577/656 (88%), Gaps = 0/656 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++P TPLLDTINYPIHMKNLS ++L QLA ELR+DV++ +SKTGGHL +SLGVV
Sbjct  54    KIDFSGEKPATPLLDTINYPIHMKNLSTEDLEQLAAELRADVVYTISKTGGHLSASLGVV  113

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P+DKI+WDVGHQ+YPHKILTGRR KM TIRQT+GLAGF KR ES YD 
Sbjct  114   ELTVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRGKMHTIRQTSGLAGFPKRDESIYDA  173

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+KN+VI+VIGDGAMTAGQAYEAMNN+GYLDS++IV+
Sbjct  174   FGAGHSSTSISAGLGMAVARDLLGKKNHVISVIGDGAMTAGQAYEAMNNSGYLDSNLIVV  233

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTAT+DGP PPVGALS AL++LQS+   R+LRE AK +TKQIGGP HE+A+
Sbjct  234   LNDNKQVSLPTATIDGPAPPVGALSKALTKLQSSTKFRKLREAAKTITKQIGGPTHEVAS  293

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGS+LFEELGLYYIGPVDGHN++DLV+I Q+VK+    GPVLIH+VTE
Sbjct  294   KVDEYARGMISASGSSLFEELGLYYIGPVDGHNVEDLVTIFQKVKAMPAPGPVLIHIVTE  353

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE A DK HGV KFDP+TGKQFK  +   SYT YFAE+LI EAE+D  IVAIH
Sbjct  354   KGKGYPPAEAAPDKMHGVVKFDPSTGKQFKTKSPILSYTQYFAESLIKEAESDNKIVAIH  413

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  414   AAMGGGTGLNYFQKKFPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  473

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD+T+MACLPNM+VMAPSDEAEL HMVAT
Sbjct  474   VHDVDLQKLPVRFALDRAGLVGADGPTHCGAFDITYMACLPNMIVMAPSDEAELMHMVAT  533

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSCLR+PRGNGVGV LPP NKGTPLE+G+GRILMEG RVA++GYG+ VQ+C+ 
Sbjct  534   AAAIDDRPSCLRFPRGNGVGVDLPPNNKGTPLEIGKGRILMEGNRVAILGYGSIVQTCMK  593

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA  L    + +TVADARFCKPLD  L+R LA  HE+++T+EEGSIGGFGSHVA +++L 
Sbjct  594   AADSLRNHDIYITVADARFCKPLDTELVRRLASEHEILVTIEEGSIGGFGSHVAHYLSLS  653

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             GL+DGNLK R +VLPDRYIDHG+P DQ+ EAGL+  HIAATV ++LG+A+EAL+IM
Sbjct  654   GLMDGNLKLRSMVLPDRYIDHGSPQDQIEEAGLSSKHIAATVLSLLGRAKEALQIM  709



>emb|CDP02935.1| unnamed protein product [Coffea canephora]
Length=730

 Score =  1035 bits (2675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/674 (74%), Positives = 582/674 (86%), Gaps = 3/674 (0%)
 Frame = -2

Query  2344  SQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDV  2165
             S +  K R  G Q  + +   +   +P TP+LDTINYP+HMKNLSV+EL +LA+ELR ++
Sbjct  58    SDVLVKTRQDGQQKRILN---FSGAKPKTPILDTINYPVHMKNLSVEELEKLADELREEI  114

Query  2164  IFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIR  1985
             ++ VSK GGHL +SLGV ELTVALH+VFN P DKI+WDVGHQ+YPHKILTGRR +M TIR
Sbjct  115   VYTVSKIGGHLSASLGVAELTVALHHVFNTPDDKIIWDVGHQTYPHKILTGRRSRMHTIR  174

Query  1984  QTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQ  1805
             QT GLAGF KR ES +D FG GHSST+ISAGLGMAVGRDL G+ N+VI+VIGDGAMTAGQ
Sbjct  175   QTFGLAGFPKRDESAHDAFGAGHSSTSISAGLGMAVGRDLVGKDNHVISVIGDGAMTAGQ  234

Query  1804  AYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELRE  1625
             AYEAMNNAG+LDS++I+ILNDNKQVSLPTATLDGP PPVGALS AL++LQS+R  R+LRE
Sbjct  235   AYEAMNNAGFLDSNLIIILNDNKQVSLPTATLDGPAPPVGALSKALTKLQSSRKFRQLRE  294

Query  1624  VAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQ  1445
              AKGVTKQ+GG  HELAAKVD   RGM+SGSG+ LFEELGLYYIGPVDGHN++DLV I +
Sbjct  295   AAKGVTKQLGGKTHELAAKVDSAVRGMVSGSGAPLFEELGLYYIGPVDGHNMEDLVYIFK  354

Query  1444  EVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYF  1265
             +VKS    GPVLIH++TEKG+GY  AE AADK HGV KFDP TGKQFK+S+KT++YTTYF
Sbjct  355   KVKSMPAPGPVLIHIITEKGKGYTPAEVAADKMHGVVKFDPQTGKQFKSSSKTKAYTTYF  414

Query  1264  AEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGL  1085
             AE+L+AEAE D+ IVAIHAAMGGGTGLN+FQ+RFP RCFDVGIAEQH VTFAAGLA EGL
Sbjct  415   AESLVAEAEQDEKIVAIHAAMGGGTGLNIFQKRFPERCFDVGIAEQHAVTFAAGLATEGL  474

Query  1084  KPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPN  905
             KPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD T+MACLPN
Sbjct  475   KPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDTTYMACLPN  534

Query  904   MVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILME  725
             MVVMAP+DEAEL HM+ATAA IDDRPSC RYPRGNG+G  LPP NKGTPLE+G+GRIL E
Sbjct  535   MVVMAPADEAELMHMIATAAVIDDRPSCFRYPRGNGIGAALPPNNKGTPLEIGKGRILRE  594

Query  724   GERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVE  545
             G RVA++GYGT VQ+CL+AA +L+  G+  TVADARFCKPLD  LIR L + HEV++TVE
Sbjct  595   GTRVAILGYGTIVQNCLAAAQVLQAVGVSATVADARFCKPLDGKLIRELVQEHEVLLTVE  654

Query  544   EGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATV  365
             EGSIGGFGSHV+ F+ L+GLLDGNLKWR ++LPDRYIDHGAPADQ+ EAGLTP HIAATV
Sbjct  655   EGSIGGFGSHVSHFLGLNGLLDGNLKWRAMMLPDRYIDHGAPADQIEEAGLTPKHIAATV  714

Query  364   FNILGKAREALEIM  323
              +++G+ +E+L ++
Sbjct  715   LSLIGEHKESLHLI  728



>gb|ABS50520.1| 1-deoxy-D-xylulose 5-phosphate synthase type II [Picea abies]
Length=746

 Score =  1033 bits (2672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/648 (77%), Positives = 571/648 (88%), Gaps = 0/648 (0%)
 Frame = -2

Query  2272  QRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVAL  2093
             ++PPTPLLDTINYPIHMKN ++KEL QLA ELR ++IF+V++TGGHL +SLGVV+LTVAL
Sbjct  89    EKPPTPLLDTINYPIHMKNFNIKELRQLAKELREEIIFSVAETGGHLSASLGVVDLTVAL  148

Query  2092  HYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHS  1913
             HYVFN P DK++WDVGHQSYPHKILTGRR KM T+RQT+GLAGF +R ESE+D FG GHS
Sbjct  149   HYVFNTPHDKVVWDVGHQSYPHKILTGRRSKMGTMRQTSGLAGFPRRVESEHDAFGVGHS  208

Query  1912  STTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQ  1733
             ST+ISA +GMAVGRDL G+ N+VIAVIGDGAMTAGQAYEA+NNAG+LDS+MI+ILNDNKQ
Sbjct  209   STSISAAIGMAVGRDLLGKHNHVIAVIGDGAMTAGQAYEALNNAGFLDSNMIIILNDNKQ  268

Query  1732  VSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYA  1553
             VSLPTAT+DGP PPVGALSSAL RLQ+++  R+LREVAK +T QIGG  H+LAAKVD+YA
Sbjct  269   VSLPTATIDGPAPPVGALSSALCRLQASKKFRQLREVAKDITHQIGGATHQLAAKVDDYA  328

Query  1552  RGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYP  1373
             RGM S  GS LFEELGLYYIGPVDGHNI DLV+IL+ VKS  T GPVLIHVVTEKG+GYP
Sbjct  329   RGMFSAPGSALFEELGLYYIGPVDGHNIQDLVAILENVKSMPTPGPVLIHVVTEKGKGYP  388

Query  1372  YAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGG  1193
              AEKAADK HGV KFDPATGKQFK  + T SYT YFAE L+AEAE D+ IVAIHAAMGGG
Sbjct  389   PAEKAADKLHGVVKFDPATGKQFKPKSSTLSYTQYFAEGLMAEAERDEKIVAIHAAMGGG  448

Query  1192  TGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDL  1013
             TGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDL
Sbjct  449   TGLNYFQKRFPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDL  508

Query  1012  QKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDD  833
             QKLPVRFA+DRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAEL HMVAT+AAIDD
Sbjct  509   QKLPVRFALDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELMHMVATSAAIDD  568

Query  832   RPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLE  653
             RPSC R+PRGNGVGV LPP NKGTPL++G+GRIL EG R+A++GYG+ VQ+CL+A  +L 
Sbjct  569   RPSCFRFPRGNGVGVPLPPNNKGTPLKIGKGRILAEGTRIAILGYGSIVQNCLAAREMLA  628

Query  652   TRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGN  473
              +G+ VTVADARFCKPLD  LIR L K HE+++TVEEGSIGGFGSHV+ F+AL GL DG 
Sbjct  629   QQGISVTVADARFCKPLDGDLIRRLVKEHEILVTVEEGSIGGFGSHVSHFLALHGLFDGK  688

Query  472   LKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALE  329
             LKWRP+VLPDRYIDHG+P DQ+ EAGL+  HIAATV +++GK + AL+
Sbjct  689   LKWRPMVLPDRYIDHGSPKDQIEEAGLSSRHIAATVMSLIGKPQNALQ  736



>gb|AAS89342.1| 1-deoxy-D-xylulose-5-phosphate synthase [Taxus x media]
Length=742

 Score =  1030 bits (2663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/655 (76%), Positives = 571/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K EY  ++PPTPLLDTINYP HMKNL+V++L QLA ELR ++IF VSKTGGHL +SLGVV
Sbjct  87    KIEYTGEKPPTPLLDTINYPKHMKNLNVQDLKQLAKELREEIIFGVSKTGGHLSASLGVV  146

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             +LTVALHYVFN PQDKI+WDVGHQSYPHKILTGRR  M +IRQT+G+AGF KR+ESE+D 
Sbjct  147   DLTVALHYVFNTPQDKIVWDVGHQSYPHKILTGRRSNMSSIRQTSGIAGFPKRAESEHDA  206

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISA LGMA GRDL G  N+ IAVIGDGAMTAGQAYEAMNNAG+LDS++I+I
Sbjct  207   FGAGHSSTSISAALGMAAGRDLLGLPNHCIAVIGDGAMTAGQAYEAMNNAGFLDSNLIII  266

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTAT+DGP PPVGALS ALS++Q+++  R LRE AK +T+QIGGP HE+AA
Sbjct  267   LNDNKQVSLPTATVDGPAPPVGALSKALSKIQASKKFRLLREAAKDITQQIGGPTHEIAA  326

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS   STL EELGLYYIGPVDGH+I DLV+IL+ VK+    GPVLIHVVTE
Sbjct  327   KVDEYARGMISAPRSTLLEELGLYYIGPVDGHSIQDLVAILENVKAMPAPGPVLIHVVTE  386

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AEKAAD+ HGV KFDP+TGKQFKA + T SYT YFAE LIAEAE D  IV IH
Sbjct  387   KGKGYPPAEKAADRLHGVVKFDPSTGKQFKAKSPTLSYTQYFAEGLIAEAEKDDKIVGIH  446

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN+FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  447   AAMGGGTGLNIFQKRFPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  506

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNM+VMAP DEAEL HMVAT
Sbjct  507   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMIVMAPCDEAELIHMVAT  566

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+GV LPP NKGTP+E+G+GRIL EG RVA++G+G+ +Q+CL 
Sbjct  567   AAAIDDRPSCFRFPRGNGIGVPLPPNNKGTPVEIGKGRILAEGTRVAILGFGSIIQNCLG  626

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             A  +LE +G+ VTVADARFCKPLD  L+R L K HE++ITVEEGS+GGFGSHV+ F+AL+
Sbjct  627   AREMLEKQGISVTVADARFCKPLDGDLLRRLVKEHEILITVEEGSVGGFGSHVSHFLALN  686

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             GLLDG LKWRP+VLPDRYI+HGAP DQ+ EAGL+  HIAATV +++GK + A ++
Sbjct  687   GLLDGKLKWRPMVLPDRYIEHGAPKDQMDEAGLSSRHIAATVMSLMGKPQAAFDL  741



>ref|XP_002533688.1| 1-deoxyxylulose-5-phosphate synthase, putative [Ricinus communis]
 gb|EEF28696.1| 1-deoxyxylulose-5-phosphate synthase, putative [Ricinus communis]
Length=728

 Score =  1026 bits (2654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/655 (75%), Positives = 572/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
              +   +P TP+LDT+NYPIHM NLSV++L  LA+ELR ++++ VSKTGGHL SSLGV EL
Sbjct  73    NFSGTKPATPVLDTVNYPIHMNNLSVQDLEVLADELREEIVYVVSKTGGHLSSSLGVAEL  132

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TVALH+VFN P D+I+WDVGHQ+YPHKILTGRR KM +IRQT GLAGF KR ESE+D FG
Sbjct  133   TVALHHVFNTPDDRIIWDVGHQAYPHKILTGRRSKMSSIRQTFGLAGFPKRDESEHDAFG  192

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAVGRDL G+ N+VIAVIGDGAMTAGQAYEAMNNAGYLDS++I+ILN
Sbjct  193   AGHSSTSISAGLGMAVGRDLVGKNNHVIAVIGDGAMTAGQAYEAMNNAGYLDSNLIIILN  252

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DNKQVSLPTAT+DGP PPVGALS AL++LQS+R +R+LRE AKG+TKQIGG  HE+AAKV
Sbjct  253   DNKQVSLPTATVDGPAPPVGALSKALTKLQSSRKIRQLREAAKGITKQIGGQTHEIAAKV  312

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             D Y RGM +GSG++LFEELGLYYIGPVDGH+++DLV+IL++VKS    GPVLIHV+TEKG
Sbjct  313   DTYVRGMAAGSGASLFEELGLYYIGPVDGHSVEDLVTILKKVKSLPAPGPVLIHVITEKG  372

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GY  AE AADK HGV KFDP +GKQ K+ + T+SYT YFAE+LIAEAE D  IVAIHAA
Sbjct  373   KGYSPAEVAADKMHGVVKFDPTSGKQLKSKSNTKSYTQYFAESLIAEAEQDDKIVAIHAA  432

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLNLFQ++FP +CFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  433   MGGGTGLNLFQKQFPEKCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVH  492

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFA+DRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAPSDE EL HMVATAA
Sbjct  493   DVDLQKLPVRFAIDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDETELMHMVATAA  552

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC RYPRGNG+G +LPP NKGTPLE+G+GRIL EG RVAL+GYGT VQSCL+AA
Sbjct  553   AIDDRPSCFRYPRGNGIGTILPPNNKGTPLEIGKGRILREGSRVALLGYGTMVQSCLAAA  612

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              LL+   +  TVADARFCKPLD  L+R LA+ HE++ITVEEGSIGGFGSHVA F+ L+GL
Sbjct  613   DLLKKFNITATVADARFCKPLDGQLVRQLAQEHEILITVEEGSIGGFGSHVANFLCLNGL  672

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGNLKWRP++LPDRYIDHG+  DQ+ EAGL+  HIAATV +++G  +++L ++ 
Sbjct  673   LDGNLKWRPMMLPDRYIDHGSQTDQIEEAGLSSKHIAATVVSLIGGQKDSLHLLN  727



>gb|AID55339.1| 1-deoxy-D-xylulose-5-phosphate synthase [Actinidia chinensis]
Length=726

 Score =  1026 bits (2653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/655 (75%), Positives = 568/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
             ++   +P TPLLDTINYPIHMKNLS++EL QLA+ELR D+++ VSKTGGHL SSLGV EL
Sbjct  71    QFSGDKPFTPLLDTINYPIHMKNLSIEELEQLADELREDIVYTVSKTGGHLSSSLGVAEL  130

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TVALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +MPTIRQT GLAGF KR ES +D FG
Sbjct  131   TVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMPTIRQTCGLAGFPKRDESVHDAFG  190

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAVGRDL G+ N+V+AVIGDGAMTAGQAYEAMNNAGY+D+++I+ILN
Sbjct  191   AGHSSTSISAGLGMAVGRDLLGKNNHVVAVIGDGAMTAGQAYEAMNNAGYVDTNLIIILN  250

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DN QVSLPTAT+DGP PPVGALS AL+ LQS+R  R+LRE AKG+TKQ+G   HE+AA+V
Sbjct  251   DNAQVSLPTATVDGPAPPVGALSRALTHLQSSRKFRQLREAAKGITKQMGSQTHEIAARV  310

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             D Y RGM++ SG++LFEELGLYYIGPVDGHN+ DLV IL++VK+    GPVLIH++TEKG
Sbjct  311   DTYVRGMVASSGASLFEELGLYYIGPVDGHNVQDLVHILKKVKAMPAPGPVLIHIITEKG  370

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GY  AE AADK HGV KFDP TGKQ K   KT SYT YFAE+LIAEAE+D+ IVAIHAA
Sbjct  371   KGYSPAEIAADKMHGVVKFDPKTGKQMKTKTKTHSYTQYFAESLIAEAESDEKIVAIHAA  430

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLNLFQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  431   MGGGTGLNLFQKQFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVH  490

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD TFMACLPNMVVMAPS E+EL HMVATAA
Sbjct  491   DVDLQKLPVRFAMDRAGLVGADGPTHCGAFDTTFMACLPNMVVMAPSCESELMHMVATAA  550

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC RYPRGNG+G +LPP NKG PLEVGRGRIL EG RVA++GYGT VQ+CL+AA
Sbjct  551   AIDDRPSCFRYPRGNGIGSILPPNNKGIPLEVGRGRILREGSRVAILGYGTVVQNCLAAA  610

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              LL+  G+  TVADARFCKPLD  LIR LA+ HEV+ITVEEGSIGGF SHV+ F+ L+GL
Sbjct  611   QLLQVLGISTTVADARFCKPLDGNLIRQLAQEHEVLITVEEGSIGGFCSHVSHFLGLNGL  670

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGNLKWR ++LPDRYIDHGA  DQ+ EAGLT  HIA TV +++GK++E+L ++ 
Sbjct  671   LDGNLKWRAMILPDRYIDHGAQGDQIEEAGLTSKHIAGTVLSLIGKSKESLHLIN  725



>gb|AIY22671.1| 1-seoxy-D-xylulose 5-phosphate synthase 1 [Pinus kesiya var. 
langbianensis]
Length=740

 Score =  1023 bits (2646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/668 (72%), Positives = 578/668 (87%), Gaps = 2/668 (0%)
 Frame = -2

Query  2329  KKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVS  2150
             K ++      +A K  + +++PPTPLLDT+NYP+H+KNLS+++L QLA E+R++++F V+
Sbjct  69    KGKNVKAAVEVASKSGFPAEKPPTPLLDTVNYPVHLKNLSIQDLEQLATEIRAELVFGVA  128

Query  2149  KTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGL  1970
             KTGGHLG SLGVV+LTVALH+VF++P+DKI+WDVGHQSYPHKILTGRR KM TIRQT+GL
Sbjct  129   KTGGHLGGSLGVVDLTVALHHVFDSPEDKIIWDVGHQSYPHKILTGRRSKMHTIRQTSGL  188

Query  1969  AGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAM  1790
             AGF KR ES+YD FG GHSST+ISAGLGMAVGRDL  +KN+V+AVIGDGAMTAGQAYEAM
Sbjct  189   AGFPKRDESKYDAFGAGHSSTSISAGLGMAVGRDLLKKKNHVVAVIGDGAMTAGQAYEAM  248

Query  1789  NNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGV  1610
             NN+GYL+S++I+ILNDNKQVSLPTATLDG  PPVGAL+ AL++LQS++ LR+LRE AKG+
Sbjct  249   NNSGYLESNLIIILNDNKQVSLPTATLDGAAPPVGALTRALTKLQSSKKLRKLREAAKGL  308

Query  1609  TKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKST  1430
             TKQIGGP HE+A+KVD+YARG+IS +GS+LF+ELGLYYIGPVDGHNI+D+V+IL+++KS 
Sbjct  309   TKQIGGPTHEVASKVDKYARGLISPAGSSLFDELGLYYIGPVDGHNIEDMVTILEKIKSM  368

Query  1429  KTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALI  1250
               TGPVLIH+VTEKG+GYP AE+AADK HGV KFDP TGKQFK+ +   SYT YFAEALI
Sbjct  369   PATGPVLIHLVTEKGKGYPPAEEAADKLHGVVKFDPVTGKQFKSKSSVLSYTQYFAEALI  428

Query  1249  AEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCA  1070
             AEAE D  IV IHAAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCA
Sbjct  429   AEAEVDSKIVGIHAAMGGGTGLNYFQKKFPERCFDVGIAEQHAVTFAAGLATEGLKPFCA  488

Query  1069  IYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMA  890
             IYS+F+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDV +MACLPNM+VMA
Sbjct  489   IYSTFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVAYMACLPNMIVMA  548

Query  889   PSDEAELFHMVATAAAIDDRPSCLRY-prgngvgvvlppgnkGTPLEVGRGRILMEGERV  713
             PSDE EL H+VATAAAIDDRP C R+          LP  NKG PLE+G+GRIL+EG RV
Sbjct  549   PSDEVELMHIVATAAAIDDRPCCFRFPRGNGVGLSNLPLNNKGVPLEIGKGRILVEGTRV  608

Query  712   ALVGYGTAVQSCLSAAALL-ETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGS  536
             A++G+GT +Q+CL+A  +L E  G+ VT+ADARFCKPLD  LI+ LAK HE+++TVEEGS
Sbjct  609   AILGFGTIIQNCLAAGKILNEQAGISVTIADARFCKPLDGDLIKRLAKEHEILLTVEEGS  668

Query  535   IGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNI  356
             IGGFGSHV+ F+AL+GLLDG LKWR +VLPDRYIDHGAP DQ+ EAGLTP HIAAT+ ++
Sbjct  669   IGGFGSHVSHFLALNGLLDGKLKWRAMVLPDRYIDHGAPKDQIEEAGLTPEHIAATIMSL  728

Query  355   LGKAREAL  332
             LGK  +AL
Sbjct  729   LGKPHDAL  736



>ref|XP_008236345.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic isoform X1 [Prunus mume]
Length=715

 Score =  1023 bits (2646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/707 (71%), Positives = 585/707 (83%), Gaps = 12/707 (2%)
 Frame = -2

Query  2413  KPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLADKD-----------EYYSQR  2267
             +P P+ S   +  +  L+   +  Q+  K  S+G      D+            +Y  ++
Sbjct  9     RPNPYLSPCLNTPNPRLYHSCRKQQLCLKA-SAGNADGEEDRKLIRKGKEGWNIDYSGEK  67

Query  2266  PPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHY  2087
             P TPLLDTINYP HMKNLS ++L QLA ELR D++++VS++GGHL SSLGVVEL VALH+
Sbjct  68    PGTPLLDTINYPAHMKNLSTEDLEQLAAELRVDIVYSVSQSGGHLSSSLGVVELAVALHH  127

Query  2086  VFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSST  1907
             VFN P DKI+WDVGHQ+YPHKILTGRR KM TIR+T+GLAGF KR ES YD FG GHSST
Sbjct  128   VFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRKTSGLAGFPKRDESVYDAFGAGHSST  187

Query  1906  TISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVS  1727
             +ISAGLGMAV RDL G+ NN+I+VIGDGAMTAGQAYEAMNNAG+LDS++IVILNDNKQVS
Sbjct  188   SISAGLGMAVARDLLGKNNNIISVIGDGAMTAGQAYEAMNNAGFLDSNLIVILNDNKQVS  247

Query  1726  LPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARG  1547
             LPTATLDGP  PVGALS AL++LQS+   R+LRE AK +TKQIGG  H++AAKVDEYARG
Sbjct  248   LPTATLDGPAMPVGALSGALTKLQSSTQFRKLREAAKSITKQIGGQTHQVAAKVDEYARG  307

Query  1546  MISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYA  1367
             MIS SGSTLFEELGLYYIGPVDGHN+ DLV+I Q VK+    GPVLIH++TEKG+GYP A
Sbjct  308   MISASGSTLFEELGLYYIGPVDGHNVSDLVTIFQRVKAMPAPGPVLIHIMTEKGKGYPPA  367

Query  1366  EKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTG  1187
             E AADK HGV KFDP TG+QFK  + T SYT YFAE+LI EAE D+ +VAIHAAMGGGTG
Sbjct  368   EAAADKMHGVVKFDPRTGQQFKTKSSTLSYTQYFAESLIKEAEIDEKVVAIHAAMGGGTG  427

Query  1186  LNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQK  1007
             LN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDLQK
Sbjct  428   LNYFQKRFPDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQVVHDVDLQK  487

Query  1006  LPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRP  827
             LPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVATAAAIDDRP
Sbjct  488   LPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVATAAAIDDRP  547

Query  826   SCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETR  647
             SC R+PRGNG+G +LP  NKGTPLE+G+GRILMEG RVA++GYG+ VQ C+ AA++L+TR
Sbjct  548   SCFRFPRGNGIGSLLPANNKGTPLEIGKGRILMEGSRVAILGYGSIVQQCVEAASMLQTR  607

Query  646   GLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLK  467
              + VTVADARFCKPLD  LI+ LAK HE++ITVEEGSIGGFGSHV+ F++L G+LDG LK
Sbjct  608   DISVTVADARFCKPLDTDLIKQLAKEHEILITVEEGSIGGFGSHVSHFLSLSGILDGPLK  667

Query  466   WRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
              R +VLPDRYIDHGAP DQL EAGL+  HI+ATV ++LG+ +EAL  
Sbjct  668   LRAMVLPDRYIDHGAPQDQLEEAGLSSRHISATVLSLLGRPKEALRF  714



>gb|ABK35283.1| deoxyxylulose-5-phosphate synthase [Adonis aestivalis var. palaestina]
Length=717

 Score =  1023 bits (2646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/653 (75%), Positives = 570/653 (87%), Gaps = 0/653 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
             EY  ++P TPLLDTINYP HMKNL+ +EL QLA ELR+D++ +VSKTGGHL SSLGVVEL
Sbjct  60    EYTKEKPQTPLLDTINYPPHMKNLNTQELEQLAAELRADIVHSVSKTGGHLSSSLGVVEL  119

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             +VALH+VF+ P+DKI+WDVGHQ+YPHKILTGRR KM TIRQT+GLAGF KR ES++D FG
Sbjct  120   SVALHHVFSTPEDKIIWDVGHQAYPHKILTGRRSKMHTIRQTSGLAGFPKRDESDHDAFG  179

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAVGRDL G+ N+VI+VIGDGAMTAGQAYEAMNNAG+LDS++IV+LN
Sbjct  180   AGHSSTSISAGLGMAVGRDLLGKSNHVISVIGDGAMTAGQAYEAMNNAGFLDSNLIVVLN  239

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DNKQVSLPTATLDGP  PVGALSSALS+LQ++   R+LRE AK VTKQIGG   E+AAKV
Sbjct  240   DNKQVSLPTATLDGPATPVGALSSALSKLQASSKFRKLREAAKKVTKQIGGQTQEIAAKV  299

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             DEYARGM+S  GSTLFEELGLYYIGPVDGHN++DLV+I ++VK+    GPVL+H+VTEKG
Sbjct  300   DEYARGMMSAQGSTLFEELGLYYIGPVDGHNVEDLVTIFEKVKALPAPGPVLVHIVTEKG  359

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GYP AE AAD+ HGV KFDP TGKQFK+ A T SYT YFAEALI EAE D  IVAIHAA
Sbjct  360   KGYPPAEAAADRMHGVVKFDPETGKQFKSKAPTLSYTQYFAEALIKEAEVDSKIVAIHAA  419

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLN FQ++FP R FDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  420   MGGGTGLNFFQKKFPERTFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVH  479

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD+T+MACLPNM+VMAPSDE+EL HMVATAA
Sbjct  480   DVDLQKLPVRFAVDRAGLVGADGPTHCGAFDITYMACLPNMIVMAPSDESELIHMVATAA  539

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC R+PRGNG+GV LP   KGTP+E+G+GRILMEG RVA++GYG+ VQ C+ AA
Sbjct  540   AIDDRPSCFRFPRGNGIGVELPLNLKGTPVEIGKGRILMEGTRVAILGYGSIVQQCVDAA  599

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              +L++R + VTVADARFCKPLD  LIR LAK HE +IT+EEGSIGGFGSHVA F++L GL
Sbjct  600   HMLKSRDIAVTVADARFCKPLDTELIRRLAKEHEYLITIEEGSIGGFGSHVAHFLSLSGL  659

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             LDGNLK R + LPDRYIDHGAP DQ+ EAGL+  HI+ATV ++LG+++EALE 
Sbjct  660   LDGNLKLRAMALPDRYIDHGAPQDQIEEAGLSSWHISATVLSLLGRSKEALEF  712



>gb|ACN39837.1| unknown [Picea sitchensis]
Length=740

 Score =  1023 bits (2645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/668 (72%), Positives = 578/668 (87%), Gaps = 2/668 (0%)
 Frame = -2

Query  2329  KKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVS  2150
             K ++      +A K ++ +++PPTPLLDTINYP+H+KNLSV++L QLA E+R++++F VS
Sbjct  69    KMKNVRAAVEIAPKKDFSAEKPPTPLLDTINYPVHLKNLSVQDLEQLATEIRAELVFGVS  128

Query  2149  KTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGL  1970
             KTGGHLG SLGVV+LTVALH+VF++P+D+I+WDVGHQSYPHKILTGRR KM TIRQT+GL
Sbjct  129   KTGGHLGGSLGVVDLTVALHHVFDSPEDRIIWDVGHQSYPHKILTGRRSKMHTIRQTSGL  188

Query  1969  AGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAM  1790
             AGF KR ES+YD FG GHSST+ISAGLGMAVGRDL  + N+V+AVIGDGAMTAGQAYEAM
Sbjct  189   AGFPKRDESKYDAFGAGHSSTSISAGLGMAVGRDLLRKSNHVVAVIGDGAMTAGQAYEAM  248

Query  1789  NNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGV  1610
             NN+GYL+S++I+ILNDNKQVSLPTATLDG  PPVGAL+ AL++LQS++ LR+LRE AKG+
Sbjct  249   NNSGYLESNLIIILNDNKQVSLPTATLDGAAPPVGALTRALTKLQSSKKLRKLREAAKGL  308

Query  1609  TKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKST  1430
             TKQIGG  HE+A+KVD+Y RG+I+ + S+LFEELGLYYIGPVDGHNI+D+V+IL+++KS 
Sbjct  309   TKQIGGQTHEMASKVDKYTRGIINPAASSLFEELGLYYIGPVDGHNIEDMVTILEKIKSM  368

Query  1429  KTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALI  1250
               +GPVLIH+VTEKG+GYP AE+AADK HGV KFDPATGKQFK+ +   SYT YFAE+LI
Sbjct  369   PDSGPVLIHLVTEKGKGYPPAEEAADKLHGVVKFDPATGKQFKSKSSVLSYTQYFAESLI  428

Query  1249  AEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCA  1070
             AEAE D  IVAIHAAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCA
Sbjct  429   AEAEVDSKIVAIHAAMGGGTGLNYFQKKFPERCFDVGIAEQHAVTFAAGLATEGLKPFCA  488

Query  1069  IYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMA  890
             IYS+F+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDV +MACLPNMVVMA
Sbjct  489   IYSTFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVAYMACLPNMVVMA  548

Query  889   PSDEAELFHMVATAAAIDDRPSCLRY-prgngvgvvlppgnkGTPLEVGRGRILMEGERV  713
             PSDE EL HMVATAAAIDDRPSC R+          LP  NKG PLE+GRGRIL+EG RV
Sbjct  549   PSDEVELMHMVATAAAIDDRPSCFRFPRGNGVGLSNLPLNNKGLPLEIGRGRILVEGTRV  608

Query  712   ALVGYGTAVQSCLSAAALL-ETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGS  536
             A++G+GT +Q+CL+A  +L E  G+ VT+ADARFCKPLD  LI+ LAK HE+++TVEEGS
Sbjct  609   AILGFGTIIQNCLAAGKMLNEQAGISVTIADARFCKPLDGDLIKRLAKEHEILLTVEEGS  668

Query  535   IGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNI  356
             IGGFGSHV+ F+AL+GLLDG LKWR +VLPDRYIDHGAP DQ+ EAGL+P HIAAT+ ++
Sbjct  669   IGGFGSHVSHFLALNGLLDGKLKWRAMVLPDRYIDHGAPKDQIEEAGLSPKHIAATIMSL  728

Query  355   LGKAREAL  332
             LGK  +AL
Sbjct  729   LGKPHDAL  736



>gb|ABF18929.1| putative 1-deoxy-D-xylulose 5-phosphate synthase [Hevea brasiliensis]
Length=711

 Score =  1023 bits (2645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/655 (76%), Positives = 569/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++PPTPLLDTINYP+H KNLS ++L QLA ELR+D++++VSKTGGHL SSLGVV
Sbjct  56    KIDFSGEKPPTPLLDTINYPVHTKNLSTQDLEQLAAELRADIVYSVSKTGGHLSSSLGVV  115

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL VALH+VF+ P DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR ES YD 
Sbjct  116   ELAVALHHVFSTPDDKIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKRDESVYDA  175

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ NNVI+VIGDGAMTAGQAYEAMNNAG+LD+++IVI
Sbjct  176   FGAGHSSTSISAGLGMAVARDLLGKNNNVISVIGDGAMTAGQAYEAMNNAGFLDANLIVI  235

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL+++Q++   R+LRE AK +TKQIGG  H++AA
Sbjct  236   LNDNKQVSLPTATLDGPATPVGALSSALAKIQASTQFRKLREAAKSITKQIGGKTHQVAA  295

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHNI+DLV+I Q+VK+    GPVLIH+VTE
Sbjct  296   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNIEDLVTIFQKVKAMPAPGPVLIHIVTE  355

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFD  TGKQFK  + T SYT YFAEALI EAE D  IVAIH
Sbjct  356   KGKGYPPAEAAADKMHGVVKFDVQTGKQFKPKSPTLSYTQYFAEALIKEAETDNKIVAIH  415

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  416   AAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  475

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+ +MACLPNMVVMAPSDEAEL HMVAT
Sbjct  476   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDIAYMACLPNMVVMAPSDEAELMHMVAT  535

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G  LPP NKGTPLE+G+GRILMEG RVA++GYG+ VQ C+ 
Sbjct  536   AAAIDDRPSCFRFPRGNGIGAALPPNNKGTPLEIGKGRILMEGNRVAILGYGSIVQQCVE  595

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA++L T+G+ VTVADARFCKPLD  LIR LAK HE +ITVEEGSIGGF SHV+ F++L 
Sbjct  596   AASMLRTQGISVTVADARFCKPLDTDLIRQLAKEHEFLITVEEGSIGGFSSHVSHFLSLS  655

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG LK R +VLPDRYIDHG+P DQ+ EAG++ +HI ATV ++LGK +EAL+ 
Sbjct  656   GILDGPLKLRAMVLPDRYIDHGSPQDQIQEAGISSNHITATVLSLLGKPKEALQF  710



>ref|XP_008236351.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic isoform X2 [Prunus mume]
Length=714

 Score =  1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/653 (76%), Positives = 567/653 (87%), Gaps = 0/653 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
             +Y  ++P TPLLDTINYP HMKNLS ++L QLA ELR D++++VS++GGHL SSLGVVEL
Sbjct  61    DYSGEKPGTPLLDTINYPAHMKNLSTEDLEQLAAELRVDIVYSVSQSGGHLSSSLGVVEL  120

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
              VALH+VFN P DKI+WDVGHQ+YPHKILTGRR KM TIR+T+GLAGF KR ES YD FG
Sbjct  121   AVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRKTSGLAGFPKRDESVYDAFG  180

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAV RDL G+ NN+I+VIGDGAMTAGQAYEAMNNAG+LDS++IVILN
Sbjct  181   AGHSSTSISAGLGMAVARDLLGKNNNIISVIGDGAMTAGQAYEAMNNAGFLDSNLIVILN  240

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DNKQVSLPTATLDGP  PVGALS AL++LQS+   R+LRE AK +TKQIGG  H++AAKV
Sbjct  241   DNKQVSLPTATLDGPAMPVGALSGALTKLQSSTQFRKLREAAKSITKQIGGQTHQVAAKV  300

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             DEYARGMIS SGSTLFEELGLYYIGPVDGHN+ DLV+I Q VK+    GPVLIH++TEKG
Sbjct  301   DEYARGMISASGSTLFEELGLYYIGPVDGHNVSDLVTIFQRVKAMPAPGPVLIHIMTEKG  360

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GYP AE AADK HGV KFDP TG+QFK  + T SYT YFAE+LI EAE D+ +VAIHAA
Sbjct  361   KGYPPAEAAADKMHGVVKFDPRTGQQFKTKSSTLSYTQYFAESLIKEAEIDEKVVAIHAA  420

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  421   MGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQVVH  480

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVATAA
Sbjct  481   DVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVATAA  540

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC R+PRGNG+G +LP  NKGTPLE+G+GRILMEG RVA++GYG+ VQ C+ AA
Sbjct  541   AIDDRPSCFRFPRGNGIGSLLPANNKGTPLEIGKGRILMEGSRVAILGYGSIVQQCVEAA  600

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
             ++L+TR + VTVADARFCKPLD  LI+ LAK HE++ITVEEGSIGGFGSHV+ F++L G+
Sbjct  601   SMLQTRDISVTVADARFCKPLDTDLIKQLAKEHEILITVEEGSIGGFGSHVSHFLSLSGI  660

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             LDG LK R +VLPDRYIDHGAP DQL EAGL+  HI+ATV ++LG+ +EAL  
Sbjct  661   LDGPLKLRAMVLPDRYIDHGAPQDQLEEAGLSSRHISATVLSLLGRPKEALRF  713



>ref|XP_002532384.1| 1-deoxyxylulose-5-phosphate synthase, putative [Ricinus communis]
 gb|EEF29996.1| 1-deoxyxylulose-5-phosphate synthase, putative [Ricinus communis]
Length=714

 Score =  1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/655 (76%), Positives = 571/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K E+  ++P TPLLDTINYP+HMKNLSV++L QLA ELR+D++ +VSKTGGHL SSLGVV
Sbjct  59    KIEFSKEKPATPLLDTINYPVHMKNLSVQDLEQLAAELRADIVHSVSKTGGHLSSSLGVV  118

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL+VALH+VFN P DKI+WDVGHQ+YPHKILTGRR KM T+R+T+GLAGF KR ES +D 
Sbjct  119   ELSVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTMRKTSGLAGFPKRDESVHDA  178

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ N+VI+VIGDGAMTAGQAYEAMNNAGYLDS++IVI
Sbjct  179   FGAGHSSTSISAGLGMAVARDLLGKNNHVISVIGDGAMTAGQAYEAMNNAGYLDSNLIVI  238

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL+++Q++   R+LRE AK +TKQIGG  H++AA
Sbjct  239   LNDNKQVSLPTATLDGPATPVGALSSALTKIQASTKFRKLREAAKSITKQIGGQTHQVAA  298

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGH+I+DLV+I Q+VK+    GPVLIH+VTE
Sbjct  299   KVDEYARGMISASGSTLFEELGLYYIGPVDGHSIEDLVTIFQKVKAMPAPGPVLIHIVTE  358

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFD  TGKQFK  + T SYT YFAEALI EAE D  IVAIH
Sbjct  359   KGKGYPPAEAAADKMHGVVKFDVETGKQFKQKSSTLSYTQYFAEALIKEAEVDNKIVAIH  418

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  419   AAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  478

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVAT
Sbjct  479   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVAT  538

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+GV LPP NKGT LE+G+GRILMEG RVA++GYG+ VQ C+ 
Sbjct  539   AAAIDDRPSCFRFPRGNGIGVALPPNNKGTTLEIGKGRILMEGNRVAILGYGSIVQQCVE  598

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA +L TR + VTVADARFCKPLD  LIR LAK HE +ITVEEGSIGGF SHV+ F++L+
Sbjct  599   AAGMLRTRDIYVTVADARFCKPLDTDLIRRLAKEHEFLITVEEGSIGGFCSHVSHFLSLN  658

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG LK R +VLPDRYIDHG+P DQ+ EAGL+ +HIAATV ++LGK +EAL+ 
Sbjct  659   GILDGPLKLRSMVLPDRYIDHGSPLDQIQEAGLSSNHIAATVLSLLGKPKEALQF  713



>gb|ACC54554.1| putative 1-D-deoxyxylulose 5-phosphate synthase type 2 [Pinus 
densiflora]
Length=740

 Score =  1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/668 (72%), Positives = 577/668 (86%), Gaps = 2/668 (0%)
 Frame = -2

Query  2329  KKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVS  2150
             K ++      +A K  + +++PPTPLLDT+NYP+H+KNLS+++L QLA E+R++++F V+
Sbjct  69    KGKNVKAAVEVASKSGFPAEKPPTPLLDTVNYPVHLKNLSIQDLEQLATEIRAELVFGVA  128

Query  2149  KTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGL  1970
             KTGGHLG SLGVV+LTVALH+VF++P+DKI+WDVGHQSYPHKILTGRR KM TIRQT+GL
Sbjct  129   KTGGHLGGSLGVVDLTVALHHVFDSPEDKIIWDVGHQSYPHKILTGRRSKMHTIRQTSGL  188

Query  1969  AGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAM  1790
             AGF KR ES+YD FG GHSST+ISAGLGMAVGRDL  +KN+V+AVIGDGAMTAGQAYEAM
Sbjct  189   AGFPKRDESKYDAFGAGHSSTSISAGLGMAVGRDLLKKKNHVVAVIGDGAMTAGQAYEAM  248

Query  1789  NNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGV  1610
             NN+GYL+S++I+ILNDNKQVSLPTATLDG  PPVGAL+ AL++LQS++ LR+LRE AKG+
Sbjct  249   NNSGYLESNLIIILNDNKQVSLPTATLDGAAPPVGALTRALTKLQSSKKLRKLREAAKGL  308

Query  1609  TKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKST  1430
             TKQIGGP HE+A+KVD+YARG+IS +GS+LF+ELGLYYIGPVDGHNI+D+V+IL+++KS 
Sbjct  309   TKQIGGPTHEVASKVDKYARGLISPAGSSLFDELGLYYIGPVDGHNIEDMVTILEKIKSM  368

Query  1429  KTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALI  1250
               TGPVLIH+VTEKG+GYP AE+AADK HGV KFDP TGKQFK+ +   SYT YFAEALI
Sbjct  369   PATGPVLIHLVTEKGKGYPPAEEAADKLHGVVKFDPVTGKQFKSKSSVLSYTQYFAEALI  428

Query  1249  AEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCA  1070
             AEAE D  IV IHAAMGGGTGLN FQ++FP RC DVGIAEQH VTFAAGLA EGLKPFCA
Sbjct  429   AEAEVDSKIVGIHAAMGGGTGLNFFQKKFPERCLDVGIAEQHAVTFAAGLATEGLKPFCA  488

Query  1069  IYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMA  890
             IYS+F+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDV +MACLPNM+VMA
Sbjct  489   IYSTFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVAYMACLPNMIVMA  548

Query  889   PSDEAELFHMVATAAAIDDRPSCLRY-prgngvgvvlppgnkGTPLEVGRGRILMEGERV  713
             PSDE EL H+VATAAAIDDRP C R+          LP  NKG PLE+G+GRIL+EG RV
Sbjct  549   PSDEVELMHIVATAAAIDDRPCCFRFPRGNGVGLSNLPLNNKGVPLEIGKGRILVEGTRV  608

Query  712   ALVGYGTAVQSCLSAAALL-ETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGS  536
             A++G+GT +Q+CL+A  +L E  G+ VT+ADARFCKPLD  LI+ LAK HE+++TVEEGS
Sbjct  609   AILGFGTIIQNCLAAGKILNEQAGISVTIADARFCKPLDGDLIKRLAKEHEILLTVEEGS  668

Query  535   IGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNI  356
             IGGFGSHV+ F+AL+GLLDG LKWR +VLPDRYIDHGAP DQ+ EAGLTP HIAAT+ ++
Sbjct  669   IGGFGSHVSHFLALNGLLDGKLKWRAMVLPDRYIDHGAPKDQIEEAGLTPEHIAATIMSL  728

Query  355   LGKAREAL  332
             LGK  +AL
Sbjct  729   LGKPHDAL  736



>gb|ABS50519.1| 1-deoxy-D-xylulose 5-phosphate synthase type II [Picea abies]
Length=740

 Score =  1022 bits (2643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/668 (72%), Positives = 578/668 (87%), Gaps = 2/668 (0%)
 Frame = -2

Query  2329  KKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVS  2150
             K ++      +A K ++ +++PPTPLLDTINYP+H+KNLSV++L QLA E+R++++F VS
Sbjct  69    KMKNVRAAVEIAPKKDFSAEKPPTPLLDTINYPVHLKNLSVQDLEQLATEIRAELVFGVS  128

Query  2149  KTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGL  1970
             KTGGHLG SLGVV+LTVALH+VF++P+D+I+WDVGHQSYPHKILTGRR KM TIRQT+GL
Sbjct  129   KTGGHLGGSLGVVDLTVALHHVFDSPEDRIIWDVGHQSYPHKILTGRRSKMHTIRQTSGL  188

Query  1969  AGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAM  1790
             AGF KR ES+YD FG GHSST+ISAGLGMAVGRDL  + N+V+AVIGDGAMTAGQAYEAM
Sbjct  189   AGFPKRDESKYDAFGAGHSSTSISAGLGMAVGRDLLRKSNHVVAVIGDGAMTAGQAYEAM  248

Query  1789  NNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGV  1610
             NN+GYL+S++I+ILNDNKQVSLPTATLDG  PPVGAL+ AL++LQS++ +R+LRE AKG+
Sbjct  249   NNSGYLESNLIIILNDNKQVSLPTATLDGAAPPVGALTRALTKLQSSKKIRKLREAAKGL  308

Query  1609  TKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKST  1430
             TKQIGG  HE+A+KVD+Y RG+I+ + S+LFEELGLYYIGPVDGHNI+D+V+IL+++KS 
Sbjct  309   TKQIGGQTHEMASKVDKYTRGIINPAASSLFEELGLYYIGPVDGHNIEDMVTILEKIKSM  368

Query  1429  KTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALI  1250
               +GPVLIH+VTEKG+GYP AE+AADK HGV KFDPATGKQFK+ +   SYT YFAE+LI
Sbjct  369   PDSGPVLIHLVTEKGKGYPPAEEAADKLHGVVKFDPATGKQFKSKSSVLSYTQYFAESLI  428

Query  1249  AEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCA  1070
             AEAE D  IVAIHAAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCA
Sbjct  429   AEAEVDSKIVAIHAAMGGGTGLNYFQKKFPERCFDVGIAEQHAVTFAAGLATEGLKPFCA  488

Query  1069  IYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMA  890
             IYS+F+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDV +MACLPNMVVMA
Sbjct  489   IYSTFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVAYMACLPNMVVMA  548

Query  889   PSDEAELFHMVATAAAIDDRPSCLRY-prgngvgvvlppgnkGTPLEVGRGRILMEGERV  713
             PSDE EL HMVATAAAIDDRPSC R+          LP  NKG PLE+GRGRIL+EG RV
Sbjct  549   PSDEVELMHMVATAAAIDDRPSCFRFPRGNGVGLSNLPLNNKGLPLEIGRGRILVEGTRV  608

Query  712   ALVGYGTAVQSCLSAAALL-ETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGS  536
             A++G+GT +Q+CL+A  +L E  G+ VT+ADARFCKPLD  LI+ LAK HE+++TVEEGS
Sbjct  609   AILGFGTIIQNCLAAGKMLNEQAGISVTIADARFCKPLDGDLIKRLAKEHEILLTVEEGS  668

Query  535   IGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNI  356
             IGGFGSHV+ F+AL+GLLDG LKWR +VLPDRYIDHGAP DQ+ EAGL+P HIAAT+ ++
Sbjct  669   IGGFGSHVSHFLALNGLLDGKLKWRAMVLPDRYIDHGAPKDQIEEAGLSPKHIAATIMSL  728

Query  355   LGKAREAL  332
             LGK  +AL
Sbjct  729   LGKPHDAL  736



>ref|XP_008810947.1| PREDICTED: LOW QUALITY PROTEIN: probable 1-deoxy-D-xylulose-5-phosphate 
synthase 2, chloroplastic [Phoenix dactylifera]
Length=666

 Score =  1021 bits (2640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/656 (75%), Positives = 574/656 (88%), Gaps = 0/656 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++ S++P TPLLDTINYPIHMKNLS ++L QLA ELR+D+++ ++KTGGHL +SLGVV
Sbjct  11    KIDFSSEKPATPLLDTINYPIHMKNLSAEDLEQLAAELRADIVYTLAKTGGHLSASLGVV  70

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIRQT+GLAGF KR ES YD 
Sbjct  71    ELTVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRARMHTIRQTSGLAGFPKRDESIYDA  130

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+KN+VI+VIGDGAMTAGQAYEAMNN+GYLDS++IV+
Sbjct  131   FGAGHSSTSISAGLGMAVARDLLGKKNHVISVIGDGAMTAGQAYEAMNNSGYLDSNLIVV  190

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALS AL++LQ++   R+LRE AK +T+QIGG  HE+AA
Sbjct  191   LNDNKQVSLPTATLDGPATPVGALSKALTKLQASNKFRKLREAAKTITRQIGGSTHEVAA  250

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGS+LFEELGLYYIGPVDGHN++DLV+I Q+VK+    GPVL+H+VTE
Sbjct  251   KVDEYARGMISASGSSLFEELGLYYIGPVDGHNVEDLVTIFQKVKAMPAPGPVLVHIVTE  310

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE A DK HGV KF+P+TGKQFK  +   SYT YFAE+LI EAEAD  IVAIH
Sbjct  311   KGKGYPPAEAAPDKMHGVVKFEPSTGKQFKTKSPVLSYTQYFAESLIKEAEADSKIVAIH  370

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  371   AAMGGGTGLNYFQKKFPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  430

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFDVT+MACLPNM++MAPSDE+EL HMVAT
Sbjct  431   VHDVDLQKLPVRFALDRAGLVGADGPTHCGAFDVTYMACLPNMILMAPSDESELMHMVAT  490

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSCLR+PRGNGVGV LPPGNKGTPLE+G+GRILMEG RVA++GYG+ VQ+C+ 
Sbjct  491   AAAIDDRPSCLRFPRGNGVGVALPPGNKGTPLEIGKGRILMEGSRVAILGYGSIVQTCIK  550

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA  L    +  TVADARFCKPLD  L+R LA  HE++ITVEEGSIGGFGSHVA F++L 
Sbjct  551   AADSLRNHDIYTTVADARFCKPLDTELVRRLANEHEILITVEEGSIGGFGSHVAHFLSLS  610

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
              LLDG+LK R +VLPDRYIDHG+P DQ+ EAGL+  HIAATV ++LG+A+EAL+ M
Sbjct  611   SLLDGHLKLRSMVLPDRYIDHGSPQDQIEEAGLSSRHIAATVLSLLGRAKEALQTM  666



>ref|XP_007156461.1| hypothetical protein PHAVU_003G287900g [Phaseolus vulgaris]
 gb|ESW28455.1| hypothetical protein PHAVU_003G287900g [Phaseolus vulgaris]
Length=711

 Score =  1021 bits (2640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/670 (74%), Positives = 576/670 (86%), Gaps = 7/670 (1%)
 Frame = -2

Query  2320  SSGVQASLADKDE------YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIF  2159
             S  V+ ++  KD+      Y  ++P TPLLDT+N+PIHMKNLS ++L QLA ELR+D++ 
Sbjct  39    SGDVEKTIIRKDKDGWKINYSGEKPQTPLLDTVNHPIHMKNLSTQDLEQLAAELRADIVH  98

Query  2158  NVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQT  1979
             +VS TGGHL SSLGVVEL+VALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIR+T
Sbjct  99    SVSNTGGHLSSSLGVVELSVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRKT  158

Query  1978  NGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAY  1799
             +GLAGF KR ES +D FG GHSST+ISAGLGMAV RDL G+KN++I+VIGDGA+TAGQAY
Sbjct  159   SGLAGFPKRDESVHDAFGVGHSSTSISAGLGMAVARDLLGKKNSIISVIGDGALTAGQAY  218

Query  1798  EAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVA  1619
             EAMNNAG+LDS+MIVILNDNKQVSLPTATLDGP  PVGALSS LS++Q++   R+LRE A
Sbjct  219   EAMNNAGFLDSNMIVILNDNKQVSLPTATLDGPATPVGALSSTLSKIQASTEFRQLREAA  278

Query  1618  KGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEV  1439
             K +TKQIGG  H++AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNI+DLV+I Q+V
Sbjct  279   KSITKQIGGQTHQVAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIEDLVTIFQKV  338

Query  1438  KSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAE  1259
             K+    GPVLIH+VTEKG+GYP AEKAAD+ HGV KFDP TG+QFK  + T SYT YFAE
Sbjct  339   KAIPAPGPVLIHIVTEKGKGYPPAEKAADRMHGVVKFDPKTGQQFKTKSPTLSYTQYFAE  398

Query  1258  ALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKP  1079
             +LI EAE D  IV IHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKP
Sbjct  399   SLIKEAEIDNKIVGIHAAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLAAEGLKP  458

Query  1078  FCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMV  899
             FCAIYSSF+QR YDQVVHDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD+T+MACLPNMV
Sbjct  459   FCAIYSSFLQRGYDQVVHDVDLQKLPVRFALDRAGLVGADGPTHCGAFDITYMACLPNMV  518

Query  898   VMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGE  719
             VMAPSDEAEL HMVATAA IDDRPSC R+PRGNG+G  LP  NKGTPLE+G+GRILMEG 
Sbjct  519   VMAPSDEAELMHMVATAATIDDRPSCFRFPRGNGIGATLPLNNKGTPLEIGKGRILMEGS  578

Query  718   RVALVGYGTAVQSCLSAAALL-ETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEE  542
             RVA++GYG+ VQ C+ A+ LL E  G+ VTVADARFCKPLD  LIR LAK HE++ITVEE
Sbjct  579   RVAILGYGSVVQQCMHASELLKEEVGVNVTVADARFCKPLDTDLIRLLAKEHEILITVEE  638

Query  541   GSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVF  362
             GSIGGFGSHV+QF++L G+LDG LKWR ++LPDRYIDHG+P DQ+ EAGL+  HIAATV 
Sbjct  639   GSIGGFGSHVSQFLSLSGILDGPLKWRAMMLPDRYIDHGSPQDQVEEAGLSSKHIAATVL  698

Query  361   NILGKAREAL  332
             ++L + +EAL
Sbjct  699   SLLKRPKEAL  708



>gb|AAR95699.1| putative 1-D-deoxyxylulose 5-phosphate synthase [Ginkgo biloba]
Length=738

 Score =  1020 bits (2637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/665 (74%), Positives = 586/665 (88%), Gaps = 2/665 (0%)
 Frame = -2

Query  2320  SSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTG  2141
             ++GV+  +  K ++  ++P TPLLDTINYPIHMKNLSV++L QLA+ELR++++F VSKTG
Sbjct  74    TAGVE--VGGKIDFSGEKPATPLLDTINYPIHMKNLSVEDLRQLASELRAEIVFGVSKTG  131

Query  2140  GHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGF  1961
             GHLG+SLGVV+LTVALH+VFN P+D+I+WDVGHQ+YPHKILTGRR +M TIRQT+GLAGF
Sbjct  132   GHLGASLGVVDLTVALHHVFNTPEDRIIWDVGHQAYPHKILTGRRSRMHTIRQTSGLAGF  191

Query  1960  TKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNA  1781
              KR ESE+D FG GHSST+ISAGLGMAVGRDL G++N+V+AVIGDGAMTAGQAYEAMNN+
Sbjct  192   PKRDESEHDAFGAGHSSTSISAGLGMAVGRDLLGKRNHVVAVIGDGAMTAGQAYEAMNNS  251

Query  1780  GYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQ  1601
             GYLDS+MI+ILNDNKQVSLPTATLDG  PPVGALSSAL++ QS++ LR+LRE AK +TKQ
Sbjct  252   GYLDSNMIIILNDNKQVSLPTATLDGAAPPVGALSSALTKPQSSKKLRKLREAAKSLTKQ  311

Query  1600  IGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTT  1421
             IGG  HE+A+KVDEYARGMIS +GS+LFEELGLYYIGPVDGHN++D+V+IL +VKS    
Sbjct  312   IGGQTHEIASKVDEYARGMISPAGSSLFEELGLYYIGPVDGHNMEDMVTILDKVKSMPAP  371

Query  1420  GPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEA  1241
             GPVLIH+VT+KG+GYP AEKAADK HGV  FDPATGKQFK+ + T SYT YFA+ALIAEA
Sbjct  372   GPVLIHLVTDKGKGYPPAEKAADKLHGVVNFDPATGKQFKSKSSTLSYTQYFADALIAEA  431

Query  1240  EADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYS  1061
             E D  IVAIHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAG+A EGLKPFCAIYS
Sbjct  432   EEDSKIVAIHAAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGMATEGLKPFCAIYS  491

Query  1060  SFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSD  881
             +F+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSD
Sbjct  492   TFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSD  551

Query  880   EAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVG  701
             EAEL HM+ATAAAIDDRPSC R+PRGNGVGV LPPGN+G PLE+G+G IL EG RVA++G
Sbjct  552   EAELMHMIATAAAIDDRPSCFRFPRGNGVGVPLPPGNRGIPLEIGKGCILQEGSRVAILG  611

Query  700   YGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFG  521
              G  VQ+C++A  LL+   + +T+ADARFCKPLD  LIR LAK HE+++TVEEG+IGGFG
Sbjct  612   CGAIVQNCVAARMLLKEHDISITIADARFCKPLDGDLIRQLAKEHEILVTVEEGAIGGFG  671

Query  520   SHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAR  341
             SHV  F+AL+GLLDGNLKWR +VLPDRYI+HG+P DQ+ EAGL+  HIA+TV + LG+  
Sbjct  672   SHVPHFLALNGLLDGNLKWRAMVLPDRYIEHGSPKDQIEEAGLSSRHIASTVMSPLGRPH  731

Query  340   EALEI  326
             +AL++
Sbjct  732   DALQL  736



>gb|EEC81653.1| hypothetical protein OsI_25196 [Oryza sativa Indica Group]
Length=713

 Score =  1019 bits (2635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/660 (76%), Positives = 567/660 (86%), Gaps = 0/660 (0%)
 Frame = -2

Query  2305  ASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGS  2126
             AS A K +Y  ++P TPLLDT+NYP+HMKNLS  EL QLA ELR++++  VSKTGGHL S
Sbjct  53    ASGAWKIDYSGEKPATPLLDTVNYPVHMKNLSTPELEQLAAELRAEIVHTVSKTGGHLSS  112

Query  2125  SLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSE  1946
             SLGVVEL VALH+VF+ P+DKI+WDVGHQ+YPHKILTGRR +M TIRQT+GLAGF KR E
Sbjct  113   SLGVVELAVALHHVFDTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRQTSGLAGFPKRDE  172

Query  1945  SEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDS  1766
             S +D FG GHSST+ISA LGMAV RDL G+KN+VI+VIGDGAMTAGQAYEAMNN+GYLDS
Sbjct  173   SAHDAFGAGHSSTSISAALGMAVARDLLGKKNHVISVIGDGAMTAGQAYEAMNNSGYLDS  232

Query  1765  DMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM  1586
             +MIV+LNDNKQVSLPTATLDGP  PVGALS AL++LQS+  LR LRE AK VTKQIGG  
Sbjct  233   NMIVVLNDNKQVSLPTATLDGPATPVGALSKALTKLQSSTKLRRLREAAKTVTKQIGGQA  292

Query  1585  HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLI  1406
             HE+AAKVDEYARGM+S SGSTLFEELGLYYIGPVDGH++DDLV+I  +VKS    GPVL+
Sbjct  293   HEVAAKVDEYARGMVSASGSTLFEELGLYYIGPVDGHSVDDLVAIFNKVKSMPAPGPVLV  352

Query  1405  HVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKD  1226
             H+VTEKG+GYP AE AAD+ HGV KFDP TG+QFK+   T SYT YFAEALI EAEAD  
Sbjct  353   HIVTEKGKGYPPAEAAADRMHGVVKFDPTTGRQFKSKCSTLSYTQYFAEALIREAEADDK  412

Query  1225  IVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQR  1046
             +V IHAAMGGGTGLN F +RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR
Sbjct  413   VVGIHAAMGGGTGLNYFHKRFPERCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQR  472

Query  1045  AYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELF  866
              YDQVVHDVDLQ+LPVRFAMDRAGLVG+DGPTHCGAFDV +MACLPNMVVMAP+DEAEL 
Sbjct  473   GYDQVVHDVDLQRLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPADEAELM  532

Query  865   HMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAV  686
             HMVATAAAIDDRPSC R+PRGNG+G VLPP +KGTPLEVG+GR+L+ G RVAL+GYGT V
Sbjct  533   HMVATAAAIDDRPSCFRFPRGNGIGAVLPPNHKGTPLEVGKGRVLVGGNRVALLGYGTMV  592

Query  685   QSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQ  506
             Q+C+ AA  L+  G+ VTVADARFCKPLD  LIR LA  HEV++TVEEGSIGGFGSHVA 
Sbjct  593   QACMKAAEALKEHGIYVTVADARFCKPLDTGLIRELAAEHEVLVTVEEGSIGGFGSHVAH  652

Query  505   FMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             +++L GLLDG LK R + LPDRYIDHGAP DQL EAGLTP HIAATV ++LG+  EAL++
Sbjct  653   YLSLSGLLDGPLKLRSMFLPDRYIDHGAPVDQLEEAGLTPRHIAATVLSLLGRPMEALQL  712



>ref|XP_006406262.1| hypothetical protein EUTSA_v10020205mg [Eutrema salsugineum]
 gb|ESQ47715.1| hypothetical protein EUTSA_v10020205mg [Eutrema salsugineum]
Length=679

 Score =  1019 bits (2634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/673 (77%), Positives = 581/673 (86%), Gaps = 37/673 (5%)
 Frame = -2

Query  2350  KPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRS  2171
             + S I+  K  + V  SL +K EY S RPPTP+LDTIN+PIHMKNLS+KEL  L++ELRS
Sbjct  41    RRSTISLSKIRTRVNGSLVEKGEYDSIRPPTPILDTINHPIHMKNLSIKELKVLSDELRS  100

Query  2170  DVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPT  1991
             D+IF+VSKTGGHLGS+LGVVELTVALHY+FN P DKILWDVGHQ     ILTGRREKM T
Sbjct  101   DIIFHVSKTGGHLGSNLGVVELTVALHYIFNTPHDKILWDVGHQ-----ILTGRREKMKT  155

Query  1990  IRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTA  1811
             +RQTNGL+GFTKR ESE+D FGTGHSSTTISAGLGMAVGRDLKGR NNV+AVIGDGAMTA
Sbjct  156   LRQTNGLSGFTKRGESEHDSFGTGHSSTTISAGLGMAVGRDLKGRNNNVVAVIGDGAMTA  215

Query  1810  GQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLREL  1631
             GQAYEAMNNAGY+DSDMIVILN+NKQVSLPTA LDGP PPVGALSSALS+LQ  RPLREL
Sbjct  216   GQAYEAMNNAGYIDSDMIVILNENKQVSLPTANLDGPTPPVGALSSALSKLQPKRPLREL  275

Query  1630  REVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSI  1451
             RE AKGVTK+IGG MH+LA+KVDEYAR +ISG+GSTLFEELGLYYIGPVDGH+IDDLV+I
Sbjct  276   REAAKGVTKKIGGSMHQLASKVDEYARRVISGTGSTLFEELGLYYIGPVDGHDIDDLVTI  335

Query  1450  LQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTT  1271
             L+EVK T+T GPVL+                      V KFDPATGKQFK   +TQSY+T
Sbjct  336   LKEVKRTRTIGPVLL----------------------VVKFDPATGKQFKNIGETQSYST  373

Query  1270  YFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACE  1091
             YFAEALIAEAE DK++VAIHAAMGGGTGLNLFQRRFP+RCFDVGIAEQH VTFAAGLACE
Sbjct  374   YFAEALIAEAEEDKNVVAIHAAMGGGTGLNLFQRRFPTRCFDVGIAEQHAVTFAAGLACE  433

Query  1090  GLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACL  911
             GLKPFCAI SSFMQRAYDQVVHDVDLQKLPVRFA+DRAGL           FDV FMACL
Sbjct  434   GLKPFCAINSSFMQRAYDQVVHDVDLQKLPVRFAIDRAGL----------HFDVMFMACL  483

Query  910   PNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRIL  731
             PNM+VMAPSDEAELF+MVATAAAIDDRPSC RYPR NG+GV LP GNKG PL++G+GRIL
Sbjct  484   PNMIVMAPSDEAELFNMVATAAAIDDRPSCFRYPRRNGIGVSLPHGNKGVPLQIGKGRIL  543

Query  730   MEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMIT  551
              EGERVAL+GYG+A+Q+CL A+++L+ RGL++TVADARFCKPLD ALIR+LAKSHE++IT
Sbjct  544   REGERVALLGYGSAIQNCLEASSILDKRGLKITVADARFCKPLDIALIRNLAKSHELLIT  603

Query  550   VEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAA  371
             VEEGSIGGFGSHV QF+ALDGLLDG LKWRP+VLPDRYI+HG+P DQLAEAGLT SHIAA
Sbjct  604   VEEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIEHGSPLDQLAEAGLTASHIAA  663

Query  370   TVFNILGKAREAL  332
             TV N++G  REAL
Sbjct  664   TVLNLIGTPREAL  676



>ref|NP_001059086.1| Os07g0190000 [Oryza sativa Japonica Group]
 sp|Q6YU51.1|DXS2_ORYSJ RecName: Full=Probable 1-deoxy-D-xylulose-5-phosphate synthase 
2, chloroplastic; Short=1-deoxyxylulose-5-phosphate synthase; 
Short=DXP synthase; Short=DXPS; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAC84616.1| putative 1-deoxyxylulose 5-phosphate synthase [Oryza sativa Japonica 
Group]
 dbj|BAD31023.1| putative 1-deoxyxylulose 5-phosphate synthase [Oryza sativa Japonica 
Group]
 dbj|BAF21000.1| Os07g0190000 [Oryza sativa Japonica Group]
 dbj|BAG94824.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66718.1| hypothetical protein OsJ_23394 [Oryza sativa Japonica Group]
Length=713

 Score =  1019 bits (2634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/660 (76%), Positives = 567/660 (86%), Gaps = 0/660 (0%)
 Frame = -2

Query  2305  ASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGS  2126
             AS A K +Y  ++P TPLLDT+NYP+HMKNLS  EL QLA ELR++++  VSKTGGHL S
Sbjct  53    ASGAWKIDYSGEKPATPLLDTVNYPVHMKNLSTPELEQLAAELRAEIVHTVSKTGGHLSS  112

Query  2125  SLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSE  1946
             SLGVVEL VALH+VF+ P+DKI+WDVGHQ+YPHKILTGRR +M TIRQT+GLAGF KR E
Sbjct  113   SLGVVELAVALHHVFDTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRQTSGLAGFPKRDE  172

Query  1945  SEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDS  1766
             S +D FG GHSST+ISA LGMAV RDL G+KN+VI+VIGDGAMTAGQAYEAMNN+GYLDS
Sbjct  173   SAHDAFGAGHSSTSISAALGMAVARDLLGKKNHVISVIGDGAMTAGQAYEAMNNSGYLDS  232

Query  1765  DMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM  1586
             +MIV+LNDNKQVSLPTATLDGP  PVGALS AL++LQS+  LR LRE AK VTKQIGG  
Sbjct  233   NMIVVLNDNKQVSLPTATLDGPATPVGALSKALTKLQSSTKLRRLREAAKTVTKQIGGQA  292

Query  1585  HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLI  1406
             HE+AAKVDEYARGM+S SGSTLFEELGLYYIGPVDGH++DDLV+I  +VKS    GPVL+
Sbjct  293   HEVAAKVDEYARGMVSASGSTLFEELGLYYIGPVDGHSVDDLVAIFNKVKSMPAPGPVLV  352

Query  1405  HVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKD  1226
             H+VTEKG+GYP AE AAD+ HGV KFDP TG+QFK+   T SYT YFAEALI EAEAD  
Sbjct  353   HIVTEKGKGYPPAEAAADRMHGVVKFDPTTGRQFKSKCSTLSYTQYFAEALIREAEADDK  412

Query  1225  IVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQR  1046
             +V IHAAMGGGTGLN F +RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR
Sbjct  413   VVGIHAAMGGGTGLNYFHKRFPERCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQR  472

Query  1045  AYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELF  866
              YDQVVHDVDLQ+LPVRFAMDRAGLVG+DGPTHCGAFDV +MACLPNMVVMAP+DEAEL 
Sbjct  473   GYDQVVHDVDLQRLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPADEAELM  532

Query  865   HMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAV  686
             HMVATAAAIDDRPSC R+PRGNG+G VLPP +KGTPLEVG+GR+L+ G RVAL+GYGT V
Sbjct  533   HMVATAAAIDDRPSCFRFPRGNGIGAVLPPNHKGTPLEVGKGRVLVGGNRVALLGYGTMV  592

Query  685   QSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQ  506
             Q+C+ AA  L+  G+ VTVADARFCKPLD  LIR LA  HEV++TVEEGSIGGFGSHVA 
Sbjct  593   QACMKAAEALKEHGIYVTVADARFCKPLDTGLIRELAAEHEVLVTVEEGSIGGFGSHVAH  652

Query  505   FMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             +++L GLLDG LK R + LPDRYIDHGAP DQL EAGLTP HIAATV ++LG+  EAL++
Sbjct  653   YLSLSGLLDGPLKLRSMFLPDRYIDHGAPVDQLEEAGLTPRHIAATVLSLLGRPLEALQL  712



>dbj|BAF98289.1| 1-deoxy-D-xylulose 5-phosphate synthase [Hevea brasiliensis]
Length=711

 Score =  1018 bits (2633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/655 (75%), Positives = 568/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++PPTPLLDTINYP+H KNLS ++L QLA ELR+D++++VSKTGGHL SSLGVV
Sbjct  56    KIDFSGEKPPTPLLDTINYPVHTKNLSTQDLEQLAAELRADIVYSVSKTGGHLSSSLGVV  115

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL VALH+VF+ P DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR ES YD 
Sbjct  116   ELAVALHHVFSTPDDKIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKRDESVYDA  175

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ NNVI+VIGDGAMTAGQA+EAMNNAG+LD+++IVI
Sbjct  176   FGAGHSSTSISAGLGMAVARDLLGKNNNVISVIGDGAMTAGQAHEAMNNAGFLDANLIVI  235

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL+++Q++   R+LRE AK +TKQIGG  H++AA
Sbjct  236   LNDNKQVSLPTATLDGPATPVGALSSALAKIQASTQFRKLREAAKSITKQIGGKTHQVAA  295

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHNI+DLV+I Q+VK+    GPVLIH+VTE
Sbjct  296   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNIEDLVTIFQKVKAMPAPGPVLIHIVTE  355

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFD  TGKQFK  + T SYT YFAEALI EAE D  IVAIH
Sbjct  356   KGKGYPPAEAAADKMHGVVKFDVQTGKQFKPKSPTLSYTQYFAEALIKEAETDNKIVAIH  415

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  416   AAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  475

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+ +MACLPNMVVMAPSDEAEL HMVAT
Sbjct  476   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDIAYMACLPNMVVMAPSDEAELMHMVAT  535

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G  LPP NKGTPLE+G+GRILMEG RVA++GYG+ VQ C+ 
Sbjct  536   AAAIDDRPSCFRFPRGNGIGAALPPNNKGTPLEIGKGRILMEGNRVAILGYGSIVQQCVE  595

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA++L T+G+ VTVADARFCKPLD  LIR LAK HE +ITVEEGSIGGF SHV+ F++L 
Sbjct  596   AASMLRTQGISVTVADARFCKPLDTDLIRQLAKEHEFLITVEEGSIGGFSSHVSHFLSLS  655

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+L G LK R +VLPDRYIDHG+P DQ+ EAG++ +HI ATV ++LGK +EAL+ 
Sbjct  656   GILAGPLKLRAMVLPDRYIDHGSPQDQIQEAGISSNHITATVLSLLGKPKEALQF  710



>gb|KDP29794.1| hypothetical protein JCGZ_18729 [Jatropha curcas]
Length=709

 Score =  1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/655 (75%), Positives = 571/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++PPTPLLDT+NYP+HMKNLS ++L QLA ELR+D++++VSKTGGHL +SLGVV
Sbjct  54    KIDFSGEKPPTPLLDTVNYPVHMKNLSPQDLEQLAAELRADIVYSVSKTGGHLSASLGVV  113

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P+D+I+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR ES YD 
Sbjct  114   ELTVALHHVFNTPEDRIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKRDESIYDA  173

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAVGRDL G+ NNVI+VIGDGAMTAGQAYEAMNNAG+LD+++IVI
Sbjct  174   FGAGHSSTSISAGLGMAVGRDLLGKNNNVISVIGDGAMTAGQAYEAMNNAGFLDANLIVI  233

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSS L++LQ++   R+LRE AK +TKQIGG  +++AA
Sbjct  234   LNDNKQVSLPTATLDGPATPVGALSSTLTKLQASTKFRKLREAAKNITKQIGGQTYQVAA  293

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHN++DLV+I Q+VK+    GPVLIH+VTE
Sbjct  294   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNVEDLVTIFQKVKAMPAQGPVLIHIVTE  353

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV K+D  TGKQFK  + T SYT YFAEALI EAE D  IVAIH
Sbjct  354   KGKGYPPAEAAADKMHGVVKYDVPTGKQFKPKSPTLSYTQYFAEALIKEAEIDNKIVAIH  413

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  414   AAMGGGTGLNYFQKKFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  473

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVAT
Sbjct  474   VHDVDLQKLPVRFALDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELVHMVAT  533

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G  LPP NKGTPLE+G+GRILMEG  VA++GYG+ V+ C+ 
Sbjct  534   AAAIDDRPSCFRFPRGNGIGAALPPNNKGTPLEIGKGRILMEGNSVAILGYGSIVRQCVE  593

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA  L TR + VTVADARFCKPLD  LIR L + HE++ITVEEGSIGGF SHV+ F++L 
Sbjct  594   AANKLRTRDISVTVADARFCKPLDTDLIRRLTREHEILITVEEGSIGGFCSHVSHFLSLS  653

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG+LK R +VLPDRYIDHG+P DQ+ EAGL+ +HIAATV ++LGK +EAL+ 
Sbjct  654   GILDGDLKLRSMVLPDRYIDHGSPQDQIQEAGLSSNHIAATVLSLLGKPKEALQF  708



>ref|XP_007156460.1| hypothetical protein PHAVU_003G287800g [Phaseolus vulgaris]
 gb|ESW28454.1| hypothetical protein PHAVU_003G287800g [Phaseolus vulgaris]
Length=711

 Score =  1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/670 (74%), Positives = 575/670 (86%), Gaps = 7/670 (1%)
 Frame = -2

Query  2320  SSGVQASLADKDE------YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIF  2159
             S  V+ ++  KD+      Y  ++P TPLLDT+N+PIHMKNLS ++L QLA ELR+D++ 
Sbjct  39    SGDVEKTIIKKDKDGWKINYSGEKPQTPLLDTVNHPIHMKNLSTQDLEQLAAELRADIVH  98

Query  2158  NVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQT  1979
             +VS TGGHL SSLGVVEL+VALH+VF+ P+DKI+WDVGHQ+YPHKILTGRR +M TIR+T
Sbjct  99    SVSNTGGHLSSSLGVVELSVALHHVFDTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRKT  158

Query  1978  NGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAY  1799
             +GLAGF KR ES +D FG GHSST+ISAGLGMAV RDL G+KN++I+VIGDGA+TAGQAY
Sbjct  159   SGLAGFPKRDESVHDAFGVGHSSTSISAGLGMAVARDLLGKKNSIISVIGDGALTAGQAY  218

Query  1798  EAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVA  1619
             EAMNNAG+LDS+MIVILNDNKQVSLPTATLDGP  PVGALSS LS++Q++   R+LRE A
Sbjct  219   EAMNNAGFLDSNMIVILNDNKQVSLPTATLDGPATPVGALSSTLSKIQASTEFRQLREAA  278

Query  1618  KGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEV  1439
             K +TKQIGG  H++AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNI+DLV+I Q+V
Sbjct  279   KSITKQIGGQTHQVAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIEDLVTIFQKV  338

Query  1438  KSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAE  1259
             K+    GPVLIH+VTEKG+GYP AEKAAD+ HGV KFDP TG+QFK  + T SYT YFAE
Sbjct  339   KTIPAPGPVLIHIVTEKGKGYPPAEKAADRMHGVVKFDPKTGQQFKTKSPTLSYTQYFAE  398

Query  1258  ALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKP  1079
             +LI EAE D  IV IHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKP
Sbjct  399   SLIKEAEIDNKIVGIHAAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLAAEGLKP  458

Query  1078  FCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMV  899
             FCAIYSSF+QR YDQVVHDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD+T+MACLPNMV
Sbjct  459   FCAIYSSFLQRGYDQVVHDVDLQKLPVRFALDRAGLVGADGPTHCGAFDITYMACLPNMV  518

Query  898   VMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGE  719
             VMAPSDEAEL HMVATAA IDDRPSC R+PRGNG+G  LP  NKGTPLE+G+GRIL EG 
Sbjct  519   VMAPSDEAELMHMVATAATIDDRPSCFRFPRGNGIGATLPLNNKGTPLEIGKGRILTEGS  578

Query  718   RVALVGYGTAVQSCLSAAALL-ETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEE  542
             RVA++GYG+ VQ C+ A+ LL E  G+ VTVADARFCKPLD  LIR LAK HE++ITVEE
Sbjct  579   RVAILGYGSVVQQCMHASELLKEEVGVNVTVADARFCKPLDIDLIRLLAKEHEILITVEE  638

Query  541   GSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVF  362
             GSIGGFGSHV+QF++L G+LDG LKWR ++LPDRYIDHGAP DQ+ EAGL+  HIAATV 
Sbjct  639   GSIGGFGSHVSQFLSLSGILDGPLKWRAMMLPDRYIDHGAPQDQVEEAGLSSKHIAATVM  698

Query  361   NILGKAREAL  332
             ++L + +EAL
Sbjct  699   SLLKRPKEAL  708



>ref|XP_004289517.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=714

 Score =  1018 bits (2631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/655 (75%), Positives = 569/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K EY +++P TPLLDTINYP HMKNLS ++L QLA ELR D++ +VS+TGGHL SSLGVV
Sbjct  59    KIEYTAEKPATPLLDTINYPAHMKNLSTQDLKQLAAELRMDIVHSVSQTGGHLSSSLGVV  118

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL+VALH+VF+ P DKI+WDVGHQ+YPHKILTGRR KM T+R+T+GLAGF KR ES +D 
Sbjct  119   ELSVALHHVFSTPDDKIIWDVGHQAYPHKILTGRRPKMHTMRKTSGLAGFPKRDESVHDA  178

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ NN+I+VIGDGAMTAGQAYEAMNNAGYLDS++IVI
Sbjct  179   FGVGHSSTSISAGLGMAVARDLLGKNNNIISVIGDGAMTAGQAYEAMNNAGYLDSNLIVI  238

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL++LQ++   R+LRE AK +TKQIGG  HE+AA
Sbjct  239   LNDNKQVSLPTATLDGPATPVGALSSALTKLQASTQFRKLREAAKSITKQIGGQTHEVAA  298

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHN++DLV+ILQ VK+    GPVLIH++TE
Sbjct  299   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNVEDLVNILQRVKAMPAPGPVLIHIMTE  358

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AAD+ HGV KFDP TGKQFK  + T SYT YFAE+LI EAE D+ IVAIH
Sbjct  359   KGKGYPPAEAAADRMHGVVKFDPPTGKQFKTKSPTLSYTQYFAESLIKEAETDEKIVAIH  418

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  419   AAMGGGTGLNYFQKKFPDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  478

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVAT
Sbjct  479   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVAT  538

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AA IDDRPSC R+PRGNG+G VLP  NKGT +E+G+GRILMEG RVA++GYG+ VQ C+ 
Sbjct  539   AAVIDDRPSCFRFPRGNGIGAVLPAHNKGTAIEIGKGRILMEGSRVAILGYGSIVQQCVG  598

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA +L+TR + VTVADARFCKPLD  LI+ LAK HE++ITVEEGSIGGFGSHV+ +++L 
Sbjct  599   AANMLKTRDISVTVADARFCKPLDTELIKQLAKEHEILITVEEGSIGGFGSHVSHYLSLS  658

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG LK R +VLPDRYIDHGAP DQL EAGL+   I+ATV ++LG+ +EAL+ 
Sbjct  659   GILDGPLKLRAMVLPDRYIDHGAPQDQLEEAGLSSRQISATVLSLLGRPKEALQF  713



>ref|XP_008450188.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Cucumis melo]
 ref|XP_008450189.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Cucumis melo]
Length=721

 Score =  1017 bits (2630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/670 (74%), Positives = 579/670 (86%), Gaps = 7/670 (1%)
 Frame = -2

Query  2320  SSGVQASLADKD------EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIF  2159
             ++G   +L DK+      +Y  ++P TPLLDT+N+PIHMKNLSV++L QLA ELR++++F
Sbjct  40    TNGEGKNLPDKEKDGLTIDYSGEKPATPLLDTVNFPIHMKNLSVQDLEQLAAELRAEIVF  99

Query  2158  NVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQT  1979
             +VSKTGGHL +SLGVVEL VALH+VFN P DKI+WDVGHQ+YPHKILTGRR +M T+RQT
Sbjct  100   SVSKTGGHLSASLGVVELAVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSRMHTLRQT  159

Query  1978  NGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAY  1799
             +GLAGF KR ES +D FG GHSST+ISAGLGMAVGRDL G+KN+VI+VIGDGAMTAGQAY
Sbjct  160   SGLAGFPKRDESIHDAFGAGHSSTSISAGLGMAVGRDLLGKKNSVISVIGDGAMTAGQAY  219

Query  1798  EAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVA  1619
             EAMNNAGYLD++MIVILNDNKQVSLPTATLDGP  PVGALSSAL++LQ++   R+LRE A
Sbjct  220   EAMNNAGYLDTNMIVILNDNKQVSLPTATLDGPATPVGALSSALTKLQASTQFRKLREAA  279

Query  1618  KGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEV  1439
             K +TKQIG   H +AAKVDEYARGMISGSGST FEELGLYYIGPVDGHN+ DLV+IL +V
Sbjct  280   KTITKQIGKQTHGVAAKVDEYARGMISGSGSTFFEELGLYYIGPVDGHNVGDLVTILDKV  339

Query  1438  KSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAE  1259
             KS    GPVLIH++TEKG+GYP AE AADK HGV KFDP TGKQFK  + T SYT YFAE
Sbjct  340   KSMPAPGPVLIHILTEKGKGYPPAEAAADKMHGVVKFDPKTGKQFKTKSPTLSYTQYFAE  399

Query  1258  ALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKP  1079
             +LI EAE D  IVAIHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EG+KP
Sbjct  400   SLIKEAELDDKIVAIHAAMGGGTGLNYFQKRFPQRCFDVGIAEQHAVTFAAGLATEGIKP  459

Query  1078  FCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMV  899
             FCAIYSSF+QR +DQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNM+
Sbjct  460   FCAIYSSFLQRGFDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMI  519

Query  898   VMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGE  719
             VMAP+DEAEL HMVATAAAIDDRPSC R+PRGNG+GVV+PP  KGTP+E+G+GRILMEG 
Sbjct  520   VMAPADEAELIHMVATAAAIDDRPSCFRFPRGNGIGVVVPPNFKGTPIEIGKGRILMEGT  579

Query  718   RVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEG  539
             RVA++GYG+ VQ C+ A+ LL+TRG+  TVADARFCKPLD  LIR LAK HE++ITVEEG
Sbjct  580   RVAILGYGSIVQQCVEASELLKTRGIAPTVADARFCKPLDTQLIRQLAKEHEILITVEEG  639

Query  538   SIGGFGSHVAQFMALDGLLDGN-LKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVF  362
             SIGGFGSHV+ F++L G+LD + LK R +VLPDRYIDHGAP DQ+ EAGL+  HIAATV 
Sbjct  640   SIGGFGSHVSYFLSLAGILDQHRLKLRSMVLPDRYIDHGAPRDQMEEAGLSSEHIAATVL  699

Query  361   NILGKAREAL  332
              ++G+++EAL
Sbjct  700   TLMGRSKEAL  709



>ref|XP_009364805.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic isoform X2 [Pyrus x bretschneideri]
Length=713

 Score =  1016 bits (2627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/653 (75%), Positives = 565/653 (87%), Gaps = 0/653 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++P TPLLDT+NYP HMKNLS ++L QLA ELR D++++VS++GGHL SSLGVV
Sbjct  58    KIDFSGEKPGTPLLDTVNYPAHMKNLSTEDLEQLAAELRVDIVYSVSQSGGHLSSSLGVV  117

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P DKI+WDVGHQ+YPHKILTGRR KM TIR+T+GLAGF KR ES YD 
Sbjct  118   ELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRKTSGLAGFPKRDESAYDA  177

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ NN+I+VIGDGAMTAGQAYEAMNNAGYLDS++IVI
Sbjct  178   FGAGHSSTSISAGLGMAVARDLLGKNNNIISVIGDGAMTAGQAYEAMNNAGYLDSNLIVI  237

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL+RLQ++   R+LRE AK +TKQIGG  HE+AA
Sbjct  238   LNDNKQVSLPTATLDGPAKPVGALSSALTRLQASTQFRKLREAAKSITKQIGGQTHEVAA  297

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEY RGMIS SGSTLFEELGLYYIGPVDGHN+ DLV+I Q VK+    GPVLIH++TE
Sbjct  298   KVDEYTRGMISASGSTLFEELGLYYIGPVDGHNVADLVTIFQRVKAMPAPGPVLIHIMTE  357

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFDP TGKQFK  + T SYT YFAE+LI EAE D  IVAIH
Sbjct  358   KGKGYPPAEAAADKMHGVVKFDPQTGKQFKTKSPTLSYTQYFAESLIKEAEIDDKIVAIH  417

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  418   AAMGGGTGLNYFQKKFPDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  477

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             +HDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL +MVAT
Sbjct  478   IHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMNMVAT  537

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G +LP  NKGT LEVG+GRIL+EG RVA++GYG+ VQ C+ 
Sbjct  538   AAAIDDRPSCFRFPRGNGIGALLPANNKGTALEVGKGRILIEGSRVAILGYGSIVQQCVK  597

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA  L+TR + VTVADARFCKPLD  LI+ LA+ HE++ITVEEGSIGGFGSHV+ F++L 
Sbjct  598   AANNLKTRDISVTVADARFCKPLDTELIKQLARDHEILITVEEGSIGGFGSHVSHFLSLS  657

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             G+LDG LK R +VLPDRYIDHGAP DQL EAGL+  HI+ATV ++LG+ +EAL
Sbjct  658   GILDGPLKLRAMVLPDRYIDHGAPQDQLEEAGLSSRHISATVLSLLGRPKEAL  710



>ref|XP_009364804.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic isoform X1 [Pyrus x bretschneideri]
Length=718

 Score =  1016 bits (2627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/659 (75%), Positives = 566/659 (86%), Gaps = 0/659 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++P TPLLDT+NYP HMKNLS ++L QLA ELR D++++VS++GGHL SSLGVV
Sbjct  58    KIDFSGEKPGTPLLDTVNYPAHMKNLSTEDLEQLAAELRVDIVYSVSQSGGHLSSSLGVV  117

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P DKI+WDVGHQ+YPHKILTGRR KM TIR+T+GLAGF KR ES YD 
Sbjct  118   ELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRKTSGLAGFPKRDESAYDA  177

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ NN+I+VIGDGAMTAGQAYEAMNNAGYLDS++IVI
Sbjct  178   FGAGHSSTSISAGLGMAVARDLLGKNNNIISVIGDGAMTAGQAYEAMNNAGYLDSNLIVI  237

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL+RLQ++   R+LRE AK +TKQIGG  HE+AA
Sbjct  238   LNDNKQVSLPTATLDGPAKPVGALSSALTRLQASTQFRKLREAAKSITKQIGGQTHEVAA  297

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEY RGMIS SGSTLFEELGLYYIGPVDGHN+ DLV+I Q VK+    GPVLIH++TE
Sbjct  298   KVDEYTRGMISASGSTLFEELGLYYIGPVDGHNVADLVTIFQRVKAMPAPGPVLIHIMTE  357

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFDP TGKQFK  + T SYT YFAE+LI EAE D  IVAIH
Sbjct  358   KGKGYPPAEAAADKMHGVVKFDPQTGKQFKTKSPTLSYTQYFAESLIKEAEIDDKIVAIH  417

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  418   AAMGGGTGLNYFQKKFPDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  477

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             +HDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL +MVAT
Sbjct  478   IHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMNMVAT  537

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G +LP  NKGT LEVG+GRIL+EG RVA++GYG+ VQ C+ 
Sbjct  538   AAAIDDRPSCFRFPRGNGIGALLPANNKGTALEVGKGRILIEGSRVAILGYGSIVQQCVK  597

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA  L+TR + VTVADARFCKPLD  LI+ LA+ HE++ITVEEGSIGGFGSHV+ F++L 
Sbjct  598   AANNLKTRDISVTVADARFCKPLDTELIKQLARDHEILITVEEGSIGGFGSHVSHFLSLS  657

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT*R  314
             G+LDG LK R +VLPDRYIDHGAP DQL EAGL+  HI+ATV ++LG+ +EAL     R
Sbjct  658   GILDGPLKLRAMVLPDRYIDHGAPQDQLEEAGLSSRHISATVLSLLGRPKEALHFKNER  716



>ref|XP_006466336.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic-like [Citrus sinensis]
Length=716

 Score =  1016 bits (2626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/655 (75%), Positives = 568/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++PPTPLLDTINYPIHMKNLS ++L QLA ELR+D++ +VSKTGGHL ++LGVV
Sbjct  62    KIDFSEEKPPTPLLDTINYPIHMKNLSTEDLEQLAAELRADIVNSVSKTGGHLSANLGVV  121

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELT+ALH VFN P DKI+WDVGHQ+Y HKILTGRR +M T+R+T+GLAGF KR ES +D 
Sbjct  122   ELTLALHRVFNTPDDKIIWDVGHQAYVHKILTGRRSRMNTMRKTSGLAGFPKREESVHDA  181

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RD+ G+ NNVI+VIGDGAMTAGQAYEAMNNAG+LD+++IV+
Sbjct  182   FGAGHSSTSISAGLGMAVARDILGKNNNVISVIGDGAMTAGQAYEAMNNAGFLDANLIVV  241

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSALS+LQ++   R+LRE AK +TKQIGG  HE+AA
Sbjct  242   LNDNKQVSLPTATLDGPATPVGALSSALSKLQASTNFRKLREAAKSITKQIGGQTHEVAA  301

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARG+IS SGST FEELGLYYIGPVDGHN++DLV+I Q VK   T GPVLIHVVTE
Sbjct  302   KVDEYARGLISASGSTFFEELGLYYIGPVDGHNVEDLVTIFQRVKEMPTPGPVLIHVVTE  361

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AAD+ HGV KFDP TGKQFK  + T +YT YFAE+LI EAE D  IVAIH
Sbjct  362   KGKGYPPAEAAADRMHGVVKFDPKTGKQFKTKSPTLTYTQYFAESLIKEAETDDKIVAIH  421

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EG+KPFCAIYSSF+QR YDQV
Sbjct  422   AAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLASEGVKPFCAIYSSFLQRGYDQV  481

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFM+CLPNMVVMAPSDEAEL HMVAT
Sbjct  482   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMSCLPNMVVMAPSDEAELMHMVAT  541

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AA IDDRPSC R+PRGNG+G VLPP NKGTPLE+G+GRILMEG+RVA++GYG+ VQ C+ 
Sbjct  542   AAVIDDRPSCFRFPRGNGIGAVLPPNNKGTPLEIGKGRILMEGDRVAILGYGSIVQQCVL  601

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA +L+++ + VTVADARFCKPLD  LIR LA  HE++ITVEEGS+GGFGSHV  F+ L 
Sbjct  602   AANMLKSQDISVTVADARFCKPLDTDLIRQLANEHEILITVEEGSVGGFGSHVCHFLTLS  661

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG LK R +VLPDRYIDHG+PADQL E+GL+  HI+ATV ++LG+ +EAL I
Sbjct  662   GILDGPLKLRSMVLPDRYIDHGSPADQLEESGLSSRHISATVLSLLGRPKEALLI  716



>ref|XP_008338474.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic isoform X2 [Malus domestica]
Length=713

 Score =  1015 bits (2624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/653 (75%), Positives = 565/653 (87%), Gaps = 0/653 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++P TPLLDT+NYP HMKNLS ++L QLA ELR D++++VS++GGHL SSLGVV
Sbjct  58    KIDFSGEKPGTPLLDTVNYPAHMKNLSTEDLEQLAAELRVDIVYSVSQSGGHLSSSLGVV  117

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P DKI+WDVGHQ+YPHKILTGRR K+ TIR+T+GLAGF KR ES YD 
Sbjct  118   ELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKIHTIRKTSGLAGFPKRDESVYDA  177

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ N +I+VIGDGAMTAGQAYEAMNNAGYLDS++IVI
Sbjct  178   FGAGHSSTSISAGLGMAVARDLLGKNNTIISVIGDGAMTAGQAYEAMNNAGYLDSNLIVI  237

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL++LQ++   R+LRE AK +TKQIGG  HE+AA
Sbjct  238   LNDNKQVSLPTATLDGPAKPVGALSSALTKLQASTQFRKLREXAKSITKQIGGQTHEVAA  297

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHN+ DLV+I Q VK+    GPVLIH++TE
Sbjct  298   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNVADLVTIFQRVKAMPAPGPVLIHIMTE  357

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFDP TGKQFK  + T SYT YFAE+LI EAE D  IVAIH
Sbjct  358   KGKGYPPAEAAADKMHGVVKFDPQTGKQFKTKSPTLSYTQYFAESLIKEAEIDDKIVAIH  417

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  418   AAMGGGTGLNYFQKKFPDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  477

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             +HDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL +MVAT
Sbjct  478   IHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMNMVAT  537

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G +LP  NKGT LEVG+GRILMEG RVA++GYG+ VQ C+ 
Sbjct  538   AAAIDDRPSCFRFPRGNGIGALLPANNKGTALEVGKGRILMEGSRVAILGYGSIVQQCVK  597

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA  L+TR + VTVADARFCKPLD  LI+ LAK HE++ITVEEGSIGGFGSHV+ F++L 
Sbjct  598   AANNLKTRDISVTVADARFCKPLDTELIKQLAKEHEILITVEEGSIGGFGSHVSXFLSLS  657

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             G+LDG LK R +VLPDRYIDHGAP DQL EAGL+  HI+ATV ++LG+ +EAL
Sbjct  658   GILDGPLKLRAMVLPDRYIDHGAPQDQLEEAGLSSRHISATVLSLLGRPKEAL  710



>gb|KDO60529.1| hypothetical protein CISIN_1g003948mg [Citrus sinensis]
Length=784

 Score =  1014 bits (2623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/655 (75%), Positives = 567/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++PPTPLLDTINYPIHMKNLS ++L QLA ELR+D++ +VSKTGGHL ++LGVV
Sbjct  130   KIDFSEEKPPTPLLDTINYPIHMKNLSTEDLEQLAAELRADIVNSVSKTGGHLSANLGVV  189

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELT+ALH VFN P DKI+WDVGHQ+Y HKILTGRR +M T+R+T+GLAGF KR ES +D 
Sbjct  190   ELTLALHRVFNTPDDKIIWDVGHQAYVHKILTGRRSRMNTMRKTSGLAGFPKREESVHDA  249

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RD+ G+ NNVI+VIGDGAMTAGQAYEAMNNAG+LD+++IV+
Sbjct  250   FGAGHSSTSISAGLGMAVARDILGKNNNVISVIGDGAMTAGQAYEAMNNAGFLDANLIVV  309

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSALS+LQ++   R+LRE AK +TKQIGG  HE+AA
Sbjct  310   LNDNKQVSLPTATLDGPATPVGALSSALSKLQASTNFRKLREAAKSITKQIGGQTHEVAA  369

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARG+IS SGST FEELGLYYIGPVDGHN++DLV+I Q VK     GPVLIHVVTE
Sbjct  370   KVDEYARGLISASGSTFFEELGLYYIGPVDGHNVEDLVTIFQRVKEMPAPGPVLIHVVTE  429

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AAD+ HGV KFDP TGKQFK  + T +YT YFAE+LI EAE D  IVAIH
Sbjct  430   KGKGYPPAEAAADRMHGVVKFDPKTGKQFKTKSPTLTYTQYFAESLIKEAETDDKIVAIH  489

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EG+KPFCAIYSSF+QR YDQV
Sbjct  490   AAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLASEGVKPFCAIYSSFLQRGYDQV  549

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVTFM+CLPNMVVMAPSDEAEL HMVAT
Sbjct  550   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTFMSCLPNMVVMAPSDEAELMHMVAT  609

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AA IDDRPSC R+PRGNG+G VLPP NKGTPLE+G+GRILMEG+RVA++GYG+ VQ C+ 
Sbjct  610   AAVIDDRPSCFRFPRGNGIGAVLPPNNKGTPLEIGKGRILMEGDRVAILGYGSIVQQCVL  669

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA +L+++ + VTVADARFCKPLD  LIR LA  HE++ITVEEGS+GGFGSHV  F+ L 
Sbjct  670   AANMLKSQDISVTVADARFCKPLDTDLIRQLANEHEILITVEEGSVGGFGSHVCHFLTLS  729

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG LK R +VLPDRYIDHG+PADQL E+GL+  HI+ATV ++LG+ +EAL I
Sbjct  730   GILDGPLKLRSMVLPDRYIDHGSPADQLEESGLSSRHISATVLSLLGRPKEALLI  784



>gb|ABI35993.1| 1-deoxy-D-xylulose 5-phosphate synthase 2 [Catharanthus roseus]
Length=740

 Score =  1014 bits (2623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/654 (75%), Positives = 564/654 (86%), Gaps = 1/654 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
              +   +P TP+LDTINYP HMKNLS++EL QLA+ELR +++++V+KTGGHL SSLGV EL
Sbjct  86    NFSGDKPFTPILDTINYPTHMKNLSLQELQQLADELREEIVYSVAKTGGHLSSSLGVAEL  145

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TVALH+VF  P DKI+WDVGHQ+Y HKILTGRR KM T+RQT GLAGF KR ES +D FG
Sbjct  146   TVALHHVFETPNDKIIWDVGHQTYGHKILTGRRSKMHTMRQTCGLAGFPKRDESAHDAFG  205

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMA+GRDL G+KN+VI VIGDGAMTAGQAYEAMNNAGYLDS++I+ILN
Sbjct  206   VGHSSTSISAGLGMAIGRDLLGKKNHVITVIGDGAMTAGQAYEAMNNAGYLDSNLIIILN  265

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DNKQVSLPTAT+DGP PP GALS+AL+RLQS+R  R LRE AKGVTKQ+GG +HE+AAKV
Sbjct  266   DNKQVSLPTATIDGPAPPTGALSNALTRLQSSRKFRLLREAAKGVTKQLGGQVHEMAAKV  325

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             D Y RGM S   S LFE+LG+YYIGP+DGHN++DLV IL++VKS   TGPVLIH++TEKG
Sbjct  326   DTYMRGMNSQRAS-LFEDLGMYYIGPLDGHNMEDLVDILEKVKSVPATGPVLIHIITEKG  384

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GYP AE AADK HGV KF+P TGKQFK+ +KT+SYT YFAE+LI+EA  D  I+AIHAA
Sbjct  385   KGYPPAEAAADKMHGVVKFEPMTGKQFKSRSKTKSYTNYFAESLISEAREDDKIIAIHAA  444

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLNLFQ+ FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  445   MGGGTGLNLFQKHFPERCFDVGIAEQHAVTFAAGLASEGLKPFCAIYSSFLQRGYDQVVH  504

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQK+PVRFAMDRAGLVG+DGPTHCG FD TFMACLPNMVVMAPSDE EL HMVATAA
Sbjct  505   DVDLQKIPVRFAMDRAGLVGADGPTHCGTFDTTFMACLPNMVVMAPSDETELMHMVATAA  564

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC RYPRGNG+G +LPP NKG PL++G+GRIL+EG RVA++GYG  VQ+CL AA
Sbjct  565   AIDDRPSCFRYPRGNGIGAILPPNNKGAPLQIGKGRILLEGTRVAILGYGAMVQNCLMAA  624

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              LLE  G+  TV DARFCKPLD  LIR LA+ HEV+ITVEEGSIGGFGSHVAQF+AL+GL
Sbjct  625   QLLEINGISATVVDARFCKPLDGDLIRKLAQQHEVLITVEEGSIGGFGSHVAQFLALNGL  684

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             LDGNLKWR ++LPDRYIDHGA  DQ+ EAGLTP HIA TVF++L K +  L+++
Sbjct  685   LDGNLKWRAMMLPDRYIDHGAQNDQIEEAGLTPKHIAGTVFSLLSKNKNTLQVL  738



>ref|XP_006426247.1| hypothetical protein CICLE_v10024949mg [Citrus clementina]
 gb|ESR39487.1| hypothetical protein CICLE_v10024949mg [Citrus clementina]
Length=764

 Score =  1014 bits (2623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/655 (75%), Positives = 567/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++PPTPLLDTINYPIHMKNLS ++L QLA ELR+D++ +VSKTGGHL ++LGVV
Sbjct  110   KIDFSEEKPPTPLLDTINYPIHMKNLSKEDLEQLAAELRADIVNSVSKTGGHLSANLGVV  169

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELT+ALH VFN P DKI+WDVGHQ+Y HKILTGRR +M T+R+T+GLAGF KR ES +D 
Sbjct  170   ELTLALHRVFNTPDDKIIWDVGHQAYVHKILTGRRSRMNTMRKTSGLAGFPKREESVHDA  229

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RD+ G+ NNVI+VIGDGAMTAGQAYEAMNNAG+LDS++IV+
Sbjct  230   FGAGHSSTSISAGLGMAVARDILGKNNNVISVIGDGAMTAGQAYEAMNNAGFLDSNLIVV  289

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSALS+LQ++   R+LRE AK +TKQIGG  HE+AA
Sbjct  290   LNDNKQVSLPTATLDGPATPVGALSSALSKLQASANFRKLREAAKSITKQIGGQTHEVAA  349

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARG+IS SGST FEELGLYYIGPVDGHN++DLV+I Q VK     GPVLIHVVTE
Sbjct  350   KVDEYARGLISASGSTFFEELGLYYIGPVDGHNVEDLVTIFQRVKEMPAPGPVLIHVVTE  409

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AAD+ HGV KFDP TGKQFK  + T SYT YFAE+LI EAE D  IVAIH
Sbjct  410   KGKGYPPAEAAADRMHGVVKFDPKTGKQFKTKSPTLSYTQYFAESLITEAETDDKIVAIH  469

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EG+KPFCAIYSSF+QR YDQV
Sbjct  470   AAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLASEGVKPFCAIYSSFLQRGYDQV  529

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+TFM+CLPNMVVMAPSDEAEL HMVAT
Sbjct  530   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITFMSCLPNMVVMAPSDEAELMHMVAT  589

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AA IDDRPSC R+PRGNG+G VLPP NKGTPLE+G+GRILMEG+RVA++GYG+ VQ C+ 
Sbjct  590   AAVIDDRPSCFRFPRGNGIGAVLPPNNKGTPLEIGKGRILMEGDRVAILGYGSVVQQCVL  649

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA +L+++ + VTVADARFCKPLD  LIR LA  HE++ITVEEGS+GGFGSHV  F+ L 
Sbjct  650   AANMLKSQDISVTVADARFCKPLDTDLIRQLANEHEILITVEEGSVGGFGSHVCHFLTLS  709

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG LK R +VLPDRYIDHG+PADQL E+GL+  HI+ATV ++LG+ +EAL I
Sbjct  710   GILDGPLKLRSMVLPDRYIDHGSPADQLEESGLSSRHISATVLSLLGRPKEALLI  764



>ref|XP_008338473.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic isoform X1 [Malus domestica]
Length=718

 Score =  1014 bits (2622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/659 (75%), Positives = 566/659 (86%), Gaps = 0/659 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++P TPLLDT+NYP HMKNLS ++L QLA ELR D++++VS++GGHL SSLGVV
Sbjct  58    KIDFSGEKPGTPLLDTVNYPAHMKNLSTEDLEQLAAELRVDIVYSVSQSGGHLSSSLGVV  117

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P DKI+WDVGHQ+YPHKILTGRR K+ TIR+T+GLAGF KR ES YD 
Sbjct  118   ELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKIHTIRKTSGLAGFPKRDESVYDA  177

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ N +I+VIGDGAMTAGQAYEAMNNAGYLDS++IVI
Sbjct  178   FGAGHSSTSISAGLGMAVARDLLGKNNTIISVIGDGAMTAGQAYEAMNNAGYLDSNLIVI  237

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL++LQ++   R+LRE AK +TKQIGG  HE+AA
Sbjct  238   LNDNKQVSLPTATLDGPAKPVGALSSALTKLQASTQFRKLREXAKSITKQIGGQTHEVAA  297

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHN+ DLV+I Q VK+    GPVLIH++TE
Sbjct  298   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNVADLVTIFQRVKAMPAPGPVLIHIMTE  357

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFDP TGKQFK  + T SYT YFAE+LI EAE D  IVAIH
Sbjct  358   KGKGYPPAEAAADKMHGVVKFDPQTGKQFKTKSPTLSYTQYFAESLIKEAEIDDKIVAIH  417

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  418   AAMGGGTGLNYFQKKFPDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  477

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             +HDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL +MVAT
Sbjct  478   IHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMNMVAT  537

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G +LP  NKGT LEVG+GRILMEG RVA++GYG+ VQ C+ 
Sbjct  538   AAAIDDRPSCFRFPRGNGIGALLPANNKGTALEVGKGRILMEGSRVAILGYGSIVQQCVK  597

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA  L+TR + VTVADARFCKPLD  LI+ LAK HE++ITVEEGSIGGFGSHV+ F++L 
Sbjct  598   AANNLKTRDISVTVADARFCKPLDTELIKQLAKEHEILITVEEGSIGGFGSHVSXFLSLS  657

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT*R  314
             G+LDG LK R +VLPDRYIDHGAP DQL EAGL+  HI+ATV ++LG+ +EAL     R
Sbjct  658   GILDGPLKLRAMVLPDRYIDHGAPQDQLEEAGLSSRHISATVLSLLGRPKEALHFKNER  716



>ref|XP_002266925.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Vitis vinifera]
 emb|CBI40852.3| unnamed protein product [Vitis vinifera]
Length=718

 Score =  1013 bits (2620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/655 (75%), Positives = 570/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K E+  ++PPTPLLDTINYP+HMKNLS ++L QLA ELR+D++ +VSKTGGHL SSLGVV
Sbjct  59    KIEFTGEKPPTPLLDTINYPVHMKNLSTQDLEQLAAELRADIVQSVSKTGGHLSSSLGVV  118

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR ES +D 
Sbjct  119   ELTVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKREESVHDA  178

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAVGRDL G+ N+V+AVIGDGAMTAGQAYEAMNNAGYLD++MI+I
Sbjct  179   FGVGHSSTSISAGLGMAVGRDLLGKTNSVVAVIGDGAMTAGQAYEAMNNAGYLDTNMIII  238

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALS  L++LQS+   R+LRE AK +TKQ+GG   E+AA
Sbjct  239   LNDNKQVSLPTATLDGPAIPVGALSRTLTKLQSSTKFRKLREAAKSITKQLGGQTFEVAA  298

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARG++S SGSTLFEELGLYYIGPVDGHN+DDLV I Q+VK+    GPVLIH+VTE
Sbjct  299   KVDEYARGLLSASGSTLFEELGLYYIGPVDGHNVDDLVGIFQKVKAMPAPGPVLIHIVTE  358

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AAD+ HGV KFDP +G+QFK+ + T  YT YFAE+LI EA+ D  IVAIH
Sbjct  359   KGKGYPPAEAAADRMHGVVKFDPKSGQQFKSKSPTLPYTRYFAESLIGEAKVDDKIVAIH  418

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  419   AAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  478

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             +HDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVAT
Sbjct  479   IHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVAT  538

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G VLPP NKGTPLE+G+GRIL EG RVAL+GYG+ VQ C+ 
Sbjct  539   AAAIDDRPSCFRFPRGNGIGAVLPPDNKGTPLEIGKGRILAEGHRVALLGYGSIVQQCVE  598

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA++L ++ + VTV DARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHV+ F+ L+
Sbjct  599   AASILRSQNIFVTVVDARFCKPLDGDLIRRLAKEHEILITVEEGSIGGFGSHVSHFLCLN  658

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G++DG LK R +VLPDRYIDHG+P DQ+ EAGL+  HI+ATV ++LG+ +EAL +
Sbjct  659   GIMDGPLKLRAMVLPDRYIDHGSPEDQIQEAGLSSKHISATVLSLLGRQKEALTL  713



>ref|XP_008392765.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Malus domestica]
Length=714

 Score =  1013 bits (2619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/655 (75%), Positives = 564/655 (86%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K +Y  ++P TPLLDT+NYP HMKNLS ++L QLA E+R D++++VS++GGHL SSLGVV
Sbjct  59    KIDYSGEQPGTPLLDTVNYPAHMKNLSTEDLEQLAAEMRVDIVYSVSQSGGHLSSSLGVV  118

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL VALH+VFN P DKI+WDVGHQ+YPHKILTGRR KM TIR+T+GLAGF KR ES YD 
Sbjct  119   ELAVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRKTSGLAGFPKRDESVYDA  178

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ NN+I+VIGDGAMTAGQAYEAMNNAGYLDS++IVI
Sbjct  179   FGAGHSSTSISAGLGMAVARDLLGKNNNIISVIGDGAMTAGQAYEAMNNAGYLDSNLIVI  238

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL++LQ++   R+LRE AKG+TK++GG  HE+AA
Sbjct  239   LNDNKQVSLPTATLDGPATPVGALSSALTKLQASTQFRKLREAAKGITKKMGGQTHEVAA  298

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHN+ DLV+I Q VK+    GPVLIH++TE
Sbjct  299   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNVADLVTIFQRVKAMPAPGPVLIHIMTE  358

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFDP TGKQFK  + T SYT YFAE+LI EAE D  IVAIH
Sbjct  359   KGKGYPPAEAAADKMHGVVKFDPKTGKQFKTKSPTLSYTQYFAESLIKEAEIDDKIVAIH  418

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+ FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  419   AAMGGGTGLNYFQKTFPDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  478

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             +HDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL +MVAT
Sbjct  479   IHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMNMVAT  538

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G +LP  NKGTPLEVG+GR LMEG RVA++GYG+ VQ C+ 
Sbjct  539   AAAIDDRPSCFRFPRGNGIGALLPVNNKGTPLEVGKGRJLMEGSRVAILGYGSIVQQCVE  598

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA  L+TR + VTVADARFCKPLD  LI+ LA+ HE++ITVEEGSIGGFGSHV+ F++L 
Sbjct  599   AANKLKTRDIHVTVADARFCKPLDSKLIKQLAREHEILITVEEGSIGGFGSHVSHFLSLS  658

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG LK R +VLPDRYIDHGA  DQL EAGL+  HI+ATV  +LG+ +EAL+ 
Sbjct  659   GILDGPLKLRAMVLPDRYIDHGAXQDQLEEAGLSSRHISATVLFLLGRPKEALQF  713



>gb|AHB79076.1| 1-deoxy-D-xylulose-5-phosphate synthase [Houttuynia cordata]
Length=723

 Score =  1013 bits (2619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/710 (70%), Positives = 588/710 (83%), Gaps = 11/710 (2%)
 Frame = -2

Query  2419  LQKPRPFSSQWFHGSDLHLHFQQKP---------SQINYKKRSSGVQASLADKDE--YYS  2273
              Q   P SS   + +     +QQ P         +   Y+K     +A    K E  +  
Sbjct  13    FQPTSPCSSHKINSNAFFFTWQQVPVIRGCCWQGALSRYEKLVVMSKAQEKPKTELDFSG  72

Query  2272  QRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVAL  2093
             ++P TP+LDTINYPIHMKNLSV+EL +LANELR ++++ VSKTGGHL +SLG  EL+VAL
Sbjct  73    EKPSTPILDTINYPIHMKNLSVEELEKLANELRVEIVYTVSKTGGHLSASLGTAELSVAL  132

Query  2092  HYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHS  1913
             H+VFNAP+D+I+WDVGHQ+Y HKILTGRR +M TIRQT+GLAGF KR ES YD FG GHS
Sbjct  133   HHVFNAPEDRIIWDVGHQTYGHKILTGRRSRMHTIRQTSGLAGFPKRDESVYDAFGAGHS  192

Query  1912  STTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQ  1733
             ST+ISAGLGMAVGRDL+G+ N+VIAVIGDGAMTAGQAYEAMNNAGYLDS++I++LNDN+Q
Sbjct  193   STSISAGLGMAVGRDLQGKANHVIAVIGDGAMTAGQAYEAMNNAGYLDSNLIIVLNDNRQ  252

Query  1732  VSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYA  1553
             VSLPTAT+DGP PPVGALS AL+RLQ++   R+LRE AKG+TKQIGG   E+AAKVD+YA
Sbjct  253   VSLPTATMDGPAPPVGALSKALTRLQASTKFRQLREAAKGITKQIGGSAQEVAAKVDQYA  312

Query  1552  RGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYP  1373
             RGM+S  G++LFEELGLYYIGPVDGH+I+DLV I + VKS    GPVLIH+VTEKG+GY 
Sbjct  313   RGMMSAPGASLFEELGLYYIGPVDGHSIEDLVHIFKNVKSMPAPGPVLIHIVTEKGKGYA  372

Query  1372  YAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGG  1193
              AE A D+ HGV KFDP +GKQ KA   T SYT YFAE+LIAEA+ D  +VAIHAAMGGG
Sbjct  373   PAEAAPDRMHGVVKFDPKSGKQMKAKTLTLSYTQYFAESLIAEAQTDDKVVAIHAAMGGG  432

Query  1192  TGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDL  1013
             TGLNLFQ++FP RCFDVGIAEQH VTFAAG+A EGLKPFCAIYSSF+QR YDQVVHDVDL
Sbjct  433   TGLNLFQKQFPERCFDVGIAEQHAVTFAAGMAAEGLKPFCAIYSSFLQRGYDQVVHDVDL  492

Query  1012  QKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDD  833
             QKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAP DEAEL HMVATAAAIDD
Sbjct  493   QKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPCDEAELMHMVATAAAIDD  552

Query  832   RPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLE  653
             RPSC RYPRGNG+GV LPP NKGTPLEVG+GR+L EG RVA++G+G+ VQSCL+A+ LLE
Sbjct  553   RPSCFRYPRGNGIGVPLPPNNKGTPLEVGKGRVLKEGIRVAILGFGSIVQSCLAASNLLE  612

Query  652   TRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGN  473
               G+ VTVADARFCKPLD  LIR LA  HE+++T EEGSIGGFGSHV+ F+AL+GLLDGN
Sbjct  613   EIGVSVTVADARFCKPLDSELIRRLATEHEILLTAEEGSIGGFGSHVSHFLALNGLLDGN  672

Query  472   LKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             LKWR ++LPDRYIDHG+P DQ+ EAGL+ +HIAATV +++G+ ++AL  +
Sbjct  673   LKWRAMMLPDRYIDHGSPKDQIEEAGLSSNHIAATVLSLVGENKDALRFL  722



>gb|KDP43804.1| hypothetical protein JCGZ_23012 [Jatropha curcas]
Length=719

 Score =  1013 bits (2618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/655 (74%), Positives = 568/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
              +   +P TP+LDTINYPIHM NLSV+EL  LA+E+R ++++ VSKTGGHL SSLGV +L
Sbjct  64    NFSGTKPSTPILDTINYPIHMNNLSVQELETLADEIREEIVYTVSKTGGHLSSSLGVADL  123

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TVALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIRQT GLAGF KR ESE+D FG
Sbjct  124   TVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRQTFGLAGFPKRDESEHDAFG  183

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAVGRDL G+ N+VIAVIGDGAMTAGQAYEAMNNAGYLDS++I+ILN
Sbjct  184   AGHSSTSISAGLGMAVGRDLVGKNNHVIAVIGDGAMTAGQAYEAMNNAGYLDSNLIIILN  243

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DNKQVSLPTAT+DGP PPVGALS AL++L S+R +R+LRE AKG+TKQIGG  HELAAKV
Sbjct  244   DNKQVSLPTATVDGPAPPVGALSKALTKLHSSRKVRQLREAAKGITKQIGGQTHELAAKV  303

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             D Y RG+   + + LFEELGLYYIGPVDGH+I+DLV+ILQ+VKS    GPVLIH +TEKG
Sbjct  304   DSYVRGLGGATNACLFEELGLYYIGPVDGHSIEDLVTILQKVKSLPAPGPVLIHCITEKG  363

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GY  AE AADK HGV KFDP +GKQ K+ + T+SYT YFAE+LIAEA+ D  +VAIHAA
Sbjct  364   KGYSPAEIAADKMHGVVKFDPVSGKQLKSKSNTKSYTQYFAESLIAEAKNDDKVVAIHAA  423

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLNLFQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  424   MGGGTGLNLFQKQFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVH  483

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFA+DRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAPSDE EL HM+ATAA
Sbjct  484   DVDLQKLPVRFAIDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDETELMHMIATAA  543

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC RYPRGNG+G VLPP NKGTPLE+G+GRIL EG RVA++GYGT VQ+CL+AA
Sbjct  544   AIDDRPSCFRYPRGNGIGTVLPPNNKGTPLEIGKGRILREGSRVAILGYGTVVQNCLAAA  603

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              LL+  G+  TVADARFCKPLD  LIR LA+ HE++ITVEEGSIGGFGSHV+ F++L+GL
Sbjct  604   DLLQKMGISATVADARFCKPLDGNLIRQLAQEHEILITVEEGSIGGFGSHVSNFLSLNGL  663

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDG+LKWRP++LPDRYIDHG+  DQ+ EAGL+  HIA TV +++G  +++L ++ 
Sbjct  664   LDGHLKWRPMMLPDRYIDHGSQTDQIEEAGLSSKHIAGTVVSLIGGQKDSLHLLN  718



>ref|XP_003533424.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic-like [Glycine max]
 gb|KHN38888.1| Putative 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Glycine soja]
Length=712

 Score =  1013 bits (2618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/697 (72%), Positives = 575/697 (82%), Gaps = 15/697 (2%)
 Frame = -2

Query  2377  SDLHLHFQQKPSQINYKKRSSGVQASLADKDE---------------YYSQRPPTPLLDT  2243
             S L  H    P+    K+      AS  D DE               + SQ+P TPLLDT
Sbjct  13    SILPFHQNSSPNHGRIKQLCVRASASSLDDDEDRTVVRKEKDGWKIKFSSQKPATPLLDT  72

Query  2242  INYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDK  2063
             INYP HMKNLS+++L QLA ELR+DV+ +VS TGGHL SSLGVVELTVALH+VFN P+DK
Sbjct  73    INYPAHMKNLSLQDLEQLAAELRADVVHSVSNTGGHLSSSLGVVELTVALHHVFNTPEDK  132

Query  2062  ILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGM  1883
             I+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR ES YD FGTGHSST+ISAGLGM
Sbjct  133   IIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKREESVYDVFGTGHSSTSISAGLGM  192

Query  1882  AVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDG  1703
             AV RDL G+KN++++VIGDGAMTAGQAYEAMNNAG+LDS+MI+ILNDNKQVSLPTAT+DG
Sbjct  193   AVARDLLGKKNSIVSVIGDGAMTAGQAYEAMNNAGFLDSNMIIILNDNKQVSLPTATIDG  252

Query  1702  PIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGST  1523
             P  PVGALSSALS++Q++   R+LRE AKG+TKQIGG  H+LAAKVDEYARGMISGSGST
Sbjct  253   PATPVGALSSALSKIQASTKFRKLREAAKGITKQIGGTTHQLAAKVDEYARGMISGSGST  312

Query  1522  LFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYH  1343
             LFEELGLYYIGPVDGHNI+DLV+IL++VK     GP LIHVVTEKG+GYP AE AADK H
Sbjct  313   LFEELGLYYIGPVDGHNIEDLVTILEKVKEMPAPGPTLIHVVTEKGKGYPPAEVAADKMH  372

Query  1342  GVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRF  1163
             GV KF P +G Q K  + T +YT YFAE+LI EAE D  IVAIHAAMGGGTGLN F +RF
Sbjct  373   GVVKFVPTSGHQLKPKSSTLTYTQYFAESLIKEAEIDNKIVAIHAAMGGGTGLNYFHKRF  432

Query  1162  PSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMD  983
             P RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMD
Sbjct  433   PDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMD  492

Query  982   RAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprg  803
             RAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVATAAAIDDRPSC R+PRG
Sbjct  493   RAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVATAAAIDDRPSCFRFPRG  552

Query  802   ngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVAD  623
             NG+G  LP  NKGTPLE+G+GRIL +G RVA++GYG+ VQ CL AA +L+   + VTVAD
Sbjct  553   NGIGASLPLNNKGTPLEIGKGRILRQGSRVAILGYGSVVQQCLQAAQMLKPLDISVTVAD  612

Query  622   ARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPD  443
             ARFCKPLD  LI+ L K HE ++TVEEGSIGGFGSHV+ F+++ GLLDG LKWRP++LPD
Sbjct  613   ARFCKPLDTDLIKLLGKEHEFLLTVEEGSIGGFGSHVSHFLSIVGLLDGPLKWRPMMLPD  672

Query  442   RYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             RYI+HG+P DQ  EAGL+  +IAATV ++L + +EAL
Sbjct  673   RYIEHGSPQDQTEEAGLSSKNIAATVLSLLERPKEAL  709



>ref|XP_009364235.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Pyrus x bretschneideri]
Length=714

 Score =  1012 bits (2616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/655 (75%), Positives = 565/655 (86%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K +Y  ++P TPLLDT+ YP HMKNLS ++L QLA ELR D++++VS++GGHL SSLGVV
Sbjct  59    KIDYSGEKPGTPLLDTVKYPAHMKNLSTEDLEQLAAELRVDIVYSVSQSGGHLSSSLGVV  118

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL VALH+VFN P DKI+WDVGHQ+YPHKILTGRR KM T+R+T+GLAGF KR ES YD 
Sbjct  119   ELAVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTVRKTSGLAGFPKRDESVYDA  178

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ NN+I+VIGDGAMTAGQAYEAMNNAGYLDS++IVI
Sbjct  179   FGAGHSSTSISAGLGMAVARDLLGKNNNIISVIGDGAMTAGQAYEAMNNAGYLDSNLIVI  238

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL++LQ++   R+LRE AK +TK+IGG  HE+AA
Sbjct  239   LNDNKQVSLPTATLDGPATPVGALSSALTKLQASTQFRKLREAAKSITKKIGGQTHEVAA  298

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHN+ DLV+I Q VK+    GPVLIH++TE
Sbjct  299   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNVADLVTIFQRVKAMPAPGPVLIHIMTE  358

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFDP TGKQF+  + T SYT YFAE+LI EAE D  IVAIH
Sbjct  359   KGKGYPPAEAAADKMHGVVKFDPKTGKQFETKSPTLSYTQYFAESLIKEAEIDDKIVAIH  418

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  419   AAMGGGTGLNYFQKKFPDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  478

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             +HDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL +MVAT
Sbjct  479   IHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMNMVAT  538

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G +LP  NKGTPLEVG+GRILMEG RVA++GYG+ VQ C+ 
Sbjct  539   AAAIDDRPSCFRFPRGNGIGALLPVNNKGTPLEVGKGRILMEGSRVAILGYGSIVQQCVE  598

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA  L+TR + VTVADARFCKPLD  LI+ LA+ HE++ITVEEGSIGGFGSHV+ F++L 
Sbjct  599   AANKLKTRDIHVTVADARFCKPLDTELIKQLAREHEILITVEEGSIGGFGSHVSHFLSLS  658

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG LK R +VLPD YIDHGAP DQL EAGL+  HI+ATV ++LG+ +EAL+ 
Sbjct  659   GILDGPLKLRAMVLPDTYIDHGAPQDQLEEAGLSSRHISATVLSLLGRPKEALQF  713



>gb|AHI62962.1| 1-deoxy-D-xylulose-5-phosphate synthase [Aquilaria sinensis]
Length=712

 Score =  1012 bits (2616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/655 (75%), Positives = 571/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++P TPLLDTINYPIHMKNLS ++L QLA ELR+D++ +VSKTGGHL SSLGV+
Sbjct  57    KIDFSGEKPHTPLLDTINYPIHMKNLSTQDLEQLAAELRADIVHSVSKTGGHLSSSLGVI  116

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL+VALH+VFNAP DKI+WDVGHQ+YPHKILTGRR KM TIR+T+GLAGF KR ES YD 
Sbjct  117   ELSVALHHVFNAPDDKIIWDVGHQAYPHKILTGRRSKMHTIRKTSGLAGFPKRDESVYDA  176

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+KNNVIAVIGDGAMTAGQAYEAMNNAG+LDS++I +
Sbjct  177   FGAGHSSTSISAGLGMAVARDLLGKKNNVIAVIGDGAMTAGQAYEAMNNAGFLDSNLIAV  236

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTAT+DGP  PVGALS AL++LQ++   R+LRE AK +TKQI    HE+AA
Sbjct  237   LNDNKQVSLPTATVDGPATPVGALSGALAKLQASTNFRKLREAAKSLTKQISRDAHEVAA  296

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGH+I+DLV+I ++VK+    GPVLIH+VTE
Sbjct  297   KVDEYARGMISASGSTLFEELGLYYIGPVDGHDIEDLVTIFEKVKAMPAPGPVLIHIVTE  356

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GY  AE AADK HGV KF+P+TG+QFK  + T +YT YFA++LI EAEAD+ IVAIH
Sbjct  357   KGKGYSPAEAAADKMHGVVKFNPSTGQQFKNKSTTVTYTQYFADSLIKEAEADEKIVAIH  416

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  417   AAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  476

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             +HDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVAT
Sbjct  477   IHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVAT  536

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNGVGV LP  NKGTPLE+G+GRIL EG RVA++GYG+ VQ C+ 
Sbjct  537   AAAIDDRPSCFRFPRGNGVGVELPLNNKGTPLEIGKGRILTEGNRVAILGYGSIVQRCME  596

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA++L +R + VTVADARFCKPLD  LIR LA  HE++ITVEEGSIGGFGSHV+ F++L 
Sbjct  597   AASMLRSRDVYVTVADARFCKPLDTDLIRQLAAEHEILITVEEGSIGGFGSHVSHFLSLT  656

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG LK R ++LPDRYIDHG+PADQ+ EAGL+  HI+ATV ++LG+ +EAL+ 
Sbjct  657   GILDGPLKLRAMMLPDRYIDHGSPADQMEEAGLSSRHISATVLSLLGRQKEALQF  711



>ref|XP_011099963.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Sesamum indicum]
Length=712

 Score =  1011 bits (2615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/655 (75%), Positives = 562/655 (86%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++P TPLLDTINYP+HMKNLS K+L QLA ELR+++++ VSKTGGHL SSLGVV
Sbjct  57    KIDFSGEKPHTPLLDTINYPLHMKNLSTKDLEQLAAELRAEIVYAVSKTGGHLSSSLGVV  116

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P DKI+WDVGHQ+Y HKILTGRR +M T+R+T+GLAGF KR ES YD 
Sbjct  117   ELTVALHHVFNTPDDKIIWDVGHQTYGHKILTGRRSRMHTMRKTSGLAGFPKRDESIYDA  176

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+KNNV++VIGDGAMTAGQAYEAMNNAG+LD+++IV+
Sbjct  177   FGAGHSSTSISAGLGMAVARDLLGKKNNVVSVIGDGAMTAGQAYEAMNNAGFLDTNLIVV  236

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSALS+LQ++   R+LRE AK +TKQIG   HE+AA
Sbjct  237   LNDNKQVSLPTATLDGPATPVGALSSALSKLQASPKFRQLREAAKSITKQIGPQAHEVAA  296

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHNIDDLV+I ++VK+    GPVLIH+VTE
Sbjct  297   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNIDDLVAIFEKVKAMPAPGPVLIHIVTE  356

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AAD+ HGV KFDP TGKQ K  + T SYT YFAE+LI EAEAD  +VAIH
Sbjct  357   KGKGYPPAEAAADRMHGVVKFDPPTGKQIKTKSPTLSYTQYFAESLIKEAEADSRVVAIH  416

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLACEGLKPFC IYSSF+QR YDQV
Sbjct  417   AAMGGGTGLNYFQKRFPERCFDVGIAEQHAVTFAAGLACEGLKPFCTIYSSFLQRGYDQV  476

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +MACLPNMVVMAPSDEAEL HMVAT
Sbjct  477   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPSDEAELMHMVAT  536

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AA IDDRPSC R+PRGNGVG VLP  NKGTPLE+G+GRIL EG RVA++GYG  VQ CL 
Sbjct  537   AAVIDDRPSCFRFPRGNGVGAVLPTNNKGTPLEIGKGRILTEGSRVAILGYGAIVQQCLG  596

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA +L++  +  TVADARFCKPLD  L+R LAK HE++ITVEEGSIGGFGSHV  F+ L+
Sbjct  597   AAEMLKSHNISATVADARFCKPLDTDLVRRLAKEHEILITVEEGSIGGFGSHVCHFLTLN  656

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG LK R +VLPDRYIDHGAPADQL  AGL+  HI  TV +++G+  EAL++
Sbjct  657   GILDGRLKLRSMVLPDRYIDHGAPADQLEAAGLSSRHICGTVLSLMGRPMEALKL  711



>gb|AFU93069.1| chloroplast 1-deoxy-D-xylulose-5-phosphate synthase [Eucommia 
ulmoides]
Length=713

 Score =  1011 bits (2613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/688 (72%), Positives = 577/688 (84%), Gaps = 9/688 (1%)
 Frame = -2

Query  2362  HFQQKP--SQINYKKRSSGVQASLADKDE-------YYSQRPPTPLLDTINYPIHMKNLS  2210
             HF QK   ++ +  K   G +  L  + E       +  ++PPTPLLDTIN+P+HMKNLS
Sbjct  25    HFPQKQFFARASVSKSDGGDEGKLMIRKENDGWKIDFSGEKPPTPLLDTINFPVHMKNLS  84

Query  2209  VKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYP  2030
             V++L QLA ELR+D+++ V+K GGHL +SLGVV+L VALH+VFN P DKI+WDVGHQ+YP
Sbjct  85    VQDLEQLAAELRADIVYTVAKIGGHLSASLGVVDLAVALHHVFNTPDDKIIWDVGHQAYP  144

Query  2029  HKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKN  1850
             HKILTGRR +M TIR+T+GLAGF KR ES YD FG GHSST+ISAGLGMA+ RDL G+ N
Sbjct  145   HKILTGRRSRMHTIRKTSGLAGFPKRDESTYDAFGAGHSSTSISAGLGMAIARDLLGKNN  204

Query  1849  NVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSA  1670
             NVI+VIGDGAMTAGQAYEA+NNAG+LDS++IV+LNDNKQVSLPTAT+DGP  PVGALSSA
Sbjct  205   NVISVIGDGAMTAGQAYEALNNAGFLDSNLIVVLNDNKQVSLPTATIDGPATPVGALSSA  264

Query  1669  LSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIG  1490
             LS+LQ++   R+LRE AK +TKQIG   HE+AAKVDEYARGM S +GSTLFEELGLYYIG
Sbjct  265   LSKLQASPKFRQLREAAKTITKQIGPQAHEVAAKVDEYARGMFSATGSTLFEELGLYYIG  324

Query  1489  PVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGK  1310
             PVDGHNI+DLV+I Q+VK     GPVLIH+VTEKG+GYP AE A DK HGV KFDPATGK
Sbjct  325   PVDGHNIEDLVTIFQKVKEMPAPGPVLIHIVTEKGKGYPPAESAPDKMHGVVKFDPATGK  384

Query  1309  QFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAE  1130
             QFK  A T SYT YFAE+LI EAEAD  IVAIHAAMGGGTGLN FQ+RFP RCFDVGIAE
Sbjct  385   QFKVKAPTLSYTQYFAESLIKEAEADSKIVAIHAAMGGGTGLNYFQKRFPDRCFDVGIAE  444

Query  1129  QHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPT  950
             QH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPT
Sbjct  445   QHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPT  504

Query  949   HCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgn  770
             HCGAFD+ +MACLPNMVVMAP+DEAEL HMVATAA IDDRPSC R+PRGNGVG VLP  N
Sbjct  505   HCGAFDIAYMACLPNMVVMAPADEAELMHMVATAAVIDDRPSCFRFPRGNGVGAVLPLNN  564

Query  769   kGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHAL  590
             KGTP+E+G+GRIL+EG RVA++GYG+ VQ CL AAALL+ R + VTVADARFCKPLD  L
Sbjct  565   KGTPMEIGKGRILIEGSRVAILGYGSIVQQCLGAAALLKDRNVSVTVADARFCKPLDADL  624

Query  589   IRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQ  410
             I+ L   HE+++TVEEGS+GGFGSHV+ F++L+G+LDG LK R +VLPDRYIDHG+P DQ
Sbjct  625   IKRLTHEHEILLTVEEGSVGGFGSHVSHFLSLNGILDGPLKLRAMVLPDRYIDHGSPQDQ  684

Query  409   LAEAGLTPSHIAATVFNILGKAREALEI  326
             + EAGL+  HI  T+ ++LG+ +EAL++
Sbjct  685   IEEAGLSSRHICGTILSLLGRPKEALQL  712



>ref|XP_008351725.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Malus domestica]
Length=714

 Score =  1010 bits (2612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/655 (75%), Positives = 563/655 (86%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K +Y  ++P TPLLDT+NYP HMKNLS ++L QLA E+R D++++VS++GGHL SSLGVV
Sbjct  59    KIDYSGEQPGTPLLDTVNYPAHMKNLSTEDLEQLAAEMRVDIVYSVSQSGGHLSSSLGVV  118

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL VALH+VFN P DKI+WDVGHQ+YPHKILTGRR KM TIR+T+GLAGF KR ES YD 
Sbjct  119   ELAVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRKTSGLAGFPKRDESVYDA  178

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ NN+I+VIGDGAMTAGQAYEAMNNAGYLDS++IVI
Sbjct  179   FGAGHSSTSISAGLGMAVARDLLGKNNNIISVIGDGAMTAGQAYEAMNNAGYLDSNLIVI  238

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL++LQ++   R+LRE AK +TK++GG  HE+AA
Sbjct  239   LNDNKQVSLPTATLDGPATPVGALSSALTKLQASTQFRKLREAAKSITKKMGGQTHEVAA  298

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHN+ DLV+I Q VK+    GPVLIH++TE
Sbjct  299   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNVADLVTIFQRVKAMPAPGPVLIHIMTE  358

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFDP TGKQFK  + T SYT YFAE+LI EAE D  IVAIH
Sbjct  359   KGKGYPPAEAAADKMHGVVKFDPKTGKQFKTKSPTLSYTQYFAESLIKEAEIDDKIVAIH  418

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+ FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  419   AAMGGGTGLNYFQKTFPDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  478

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             +HDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL +MVAT
Sbjct  479   IHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMNMVAT  538

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G +LP  NKGTPLEVG+GR LMEG RVA++GYG+ VQ C+ 
Sbjct  539   AAAIDDRPSCFRFPRGNGIGALLPVNNKGTPLEVGKGRJLMEGSRVAILGYGSIVQQCVE  598

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA  L+TR + VTVADARFCKPLD  LI+ LA+ HE++ITVEEGSIGGFGSHV+ F++L 
Sbjct  599   AANKLKTRDIHVTVADARFCKPLDSKLIKQLAREHEILITVEEGSIGGFGSHVSHFLSLS  658

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG LK R +VLPDRYIDHGA  DQL EAGL+  HI+ATV  +LG+ +EAL+ 
Sbjct  659   GILDGPLKLRAMVLPDRYIDHGAQQDQLEEAGLSSRHISATVLFLLGRPKEALQF  713



>ref|XP_006381844.1| hypothetical protein POPTR_0006s18750g [Populus trichocarpa]
 gb|ERP59641.1| hypothetical protein POPTR_0006s18750g [Populus trichocarpa]
Length=713

 Score =  1010 bits (2611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/653 (75%), Positives = 559/653 (86%), Gaps = 0/653 (0%)
 Frame = -2

Query  2281  YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELT  2102
             +   +P TP+LDTIN+PIHMKNLSV+EL+ L +ELR ++++ VSKTGGHL SSLGV ELT
Sbjct  59    FTGNKPSTPVLDTINHPIHMKNLSVQELDNLVDELREEIVYTVSKTGGHLSSSLGVAELT  118

Query  2101  VALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGT  1922
             VALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIRQT GLAGF KR ESE+D FG 
Sbjct  119   VALHHVFNTPEDKIIWDVGHQTYPHKILTGRRSRMHTIRQTFGLAGFPKREESEHDAFGA  178

Query  1921  GHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILND  1742
             GHSST+ISA LGMAVGRDL G+ N+VIAVIGDGAMTAGQAYEAMNNAGYLDS++I+ILND
Sbjct  179   GHSSTSISAALGMAVGRDLLGKDNHVIAVIGDGAMTAGQAYEAMNNAGYLDSNLIIILND  238

Query  1741  NKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVD  1562
             N+QVSLPTAT+DGP PPVGALS AL+RL S+R  R+LRE AKG+TKQIGG   E+AAKVD
Sbjct  239   NRQVSLPTATVDGPAPPVGALSRALTRLHSSRKFRQLREAAKGITKQIGGQTQEIAAKVD  298

Query  1561  EYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGR  1382
              Y RGM   SG+ LFEELGLYYIGPVDGHN++DLV +L++VK+    GPVLIHV+TEKG+
Sbjct  299   SYMRGMTGASGACLFEELGLYYIGPVDGHNVEDLVDLLKKVKAMPAPGPVLIHVITEKGK  358

Query  1381  GYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAM  1202
             GY  AE AADK HGV KFD  TGKQ K+ + T SYT YFAE+LIAEAE D  IVAIHAAM
Sbjct  359   GYTPAEVAADKMHGVVKFDTKTGKQLKSKSNTLSYTQYFAESLIAEAEKDDKIVAIHAAM  418

Query  1201  GGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHD  1022
             GGGTGLNLFQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHD
Sbjct  419   GGGTGLNLFQKRFPYRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHD  478

Query  1021  VDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAA  842
             VDLQKLPVRFA+DRAGLVG+DGPTHCGAFD TFMA LPNMVVMAPSDE EL HMVATAAA
Sbjct  479   VDLQKLPVRFALDRAGLVGADGPTHCGAFDTTFMASLPNMVVMAPSDETELIHMVATAAA  538

Query  841   IDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAA  662
             IDDRPSCLRYPRGNG+G ++PP NKGTPLEVG+GR+L EG RVA++GYGT VQSC+ AA 
Sbjct  539   IDDRPSCLRYPRGNGIGSIIPPNNKGTPLEVGKGRVLREGSRVAILGYGTIVQSCMQAAK  598

Query  661   LLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLL  482
             LLE  G+  TVADARFCKPLD  LIR LA+ HEV+ITVEEGSIGGF SHV+ F++L+GLL
Sbjct  599   LLEETGISATVADARFCKPLDGELIRQLAQEHEVLITVEEGSIGGFSSHVSHFLSLNGLL  658

Query  481   DGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             DGN+KWRP++LPDRYIDHG+  DQ+ EAGL+P HIA+T  +++G    +L   
Sbjct  659   DGNIKWRPMMLPDRYIDHGSQTDQIEEAGLSPKHIASTAMSLVGGYTNSLHFF  711



>ref|XP_004134268.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic-like [Cucumis sativus]
 gb|KGN56311.1| hypothetical protein Csa_3G114510 [Cucumis sativus]
Length=721

 Score =  1010 bits (2611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/654 (74%), Positives = 572/654 (87%), Gaps = 1/654 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K +Y  ++P TPLLDT+N+PIHMKNLS+++L +LA ELR++++F+VSKTGGHL +SLGVV
Sbjct  56    KIDYSGEKPATPLLDTVNFPIHMKNLSMQDLEKLAAELRAEIVFSVSKTGGHLSASLGVV  115

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL VALH+VFN P DKI+WDVGHQ+YPHKILTGRR +M T+RQT+GLAGF KR ES +D 
Sbjct  116   ELAVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSRMHTLRQTSGLAGFPKRDESIHDA  175

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAVGRDL G+KN+VI+VIGDGAMTAGQAYEAMNNAGYLD++MIVI
Sbjct  176   FGAGHSSTSISAGLGMAVGRDLLGKKNSVISVIGDGAMTAGQAYEAMNNAGYLDTNMIVI  235

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL++LQ++   R+LRE AK +TKQIG   H +AA
Sbjct  236   LNDNKQVSLPTATLDGPATPVGALSSALTKLQASTQFRKLREAAKTITKQIGKQTHGVAA  295

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMISGSGST FEELGLYYIGPVDGHN+ DLV+IL++VKS    GPVLIH++TE
Sbjct  296   KVDEYARGMISGSGSTFFEELGLYYIGPVDGHNVGDLVTILEKVKSMPAPGPVLIHILTE  355

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFDP TGKQFK  + T SYT YFAE+LI EAE D  IVAIH
Sbjct  356   KGKGYPPAEAAADKMHGVVKFDPKTGKQFKTKSPTLSYTQYFAESLIKEAELDDKIVAIH  415

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EG+KPFCAIYSSF+QR +DQV
Sbjct  416   AAMGGGTGLNYFQKKFPQRCFDVGIAEQHAVTFAAGLATEGIKPFCAIYSSFLQRGFDQV  475

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNM+VMAP+DEAEL HMVAT
Sbjct  476   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMIVMAPADEAELIHMVAT  535

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AA IDDRPSC R+PRGNG+GVV+PP  KGTP+E+G+GRI+MEG RVA++GYG+ VQ C+ 
Sbjct  536   AAEIDDRPSCFRFPRGNGIGVVVPPNFKGTPIEIGKGRIVMEGTRVAILGYGSIVQQCVE  595

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             A+ LL+TRG+  TVADARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHV+ F+++ 
Sbjct  596   ASELLKTRGITPTVADARFCKPLDTQLIRQLAKEHEILITVEEGSIGGFGSHVSYFLSVT  655

Query  490   GLLDG-NLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             G+LD  +LK R +VLPDRYIDHG+P DQ+ EAGL+  HIAATV  ++G+++EAL
Sbjct  656   GILDQHHLKLRSMVLPDRYIDHGSPGDQMEEAGLSSEHIAATVLTLMGRSKEAL  709



>ref|XP_002459484.1| hypothetical protein SORBIDRAFT_02g005380 [Sorghum bicolor]
 gb|EER96005.1| hypothetical protein SORBIDRAFT_02g005380 [Sorghum bicolor]
Length=730

 Score =  1008 bits (2606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/649 (76%), Positives = 564/649 (87%), Gaps = 0/649 (0%)
 Frame = -2

Query  2272  QRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVAL  2093
             ++P TPLLDT+NYP+HMKNLS  EL QLA ELR++++  VSKTGGHL SSLGVVEL+VAL
Sbjct  81    EKPATPLLDTVNYPLHMKNLSTSELEQLAAELRAEIVHTVSKTGGHLSSSLGVVELSVAL  140

Query  2092  HYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHS  1913
             H+VF+ P DKI+WDVGHQ+Y HKILTGRR +M TIRQT+GLAGF KR ES +D FG GHS
Sbjct  141   HHVFDTPDDKIIWDVGHQAYGHKILTGRRSRMHTIRQTSGLAGFPKRDESAHDAFGVGHS  200

Query  1912  STTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQ  1733
             ST+ISA LGMAV RDL GRKN+V++VIGDGAMTAGQAYEAMNN+G+LD++MIV+LNDNKQ
Sbjct  201   STSISAALGMAVARDLLGRKNHVVSVIGDGAMTAGQAYEAMNNSGFLDANMIVVLNDNKQ  260

Query  1732  VSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYA  1553
             VSLPTATLDGP  PVGALS AL++LQS+   R LRE AK VTKQIGGP HE+AAKVDEYA
Sbjct  261   VSLPTATLDGPSKPVGALSRALTKLQSSTKFRRLREAAKSVTKQIGGPTHEVAAKVDEYA  320

Query  1552  RGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYP  1373
             RGM+S SGS+LFEELGLYYIGPVDGH+++DLV+I ++VKS    GPVLIHVVTEKG+GYP
Sbjct  321   RGMMSASGSSLFEELGLYYIGPVDGHSVEDLVTIFEKVKSMPAPGPVLIHVVTEKGKGYP  380

Query  1372  YAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGG  1193
              AE AAD+ HGV KF+P+TGKQ K+ + T SYT YFAE+LI EA+AD  +VAIHAAMGGG
Sbjct  381   PAEAAADRMHGVVKFEPSTGKQLKSKSSTLSYTQYFAESLIREADADDKVVAIHAAMGGG  440

Query  1192  TGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDL  1013
             TGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDL
Sbjct  441   TGLNYFQKRFPERCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQVVHDVDL  500

Query  1012  QKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDD  833
             Q+LPVRFA+DRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAP+DEAEL HMVATAAAIDD
Sbjct  501   QRLPVRFALDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPADEAELMHMVATAAAIDD  560

Query  832   RPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLE  653
             RPSC R+PRGNGVG VLP GNKGTP+EVGRGR+L+ G RVAL+GYGT VQ+CL AA  L+
Sbjct  561   RPSCFRFPRGNGVGAVLPAGNKGTPMEVGRGRVLVGGNRVALLGYGTMVQACLKAAEALK  620

Query  652   TRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGN  473
              + + VTVADARFCKPLD  LIR LA  HEV+IT EEGSIGGFGSHVA +++L GLLDG 
Sbjct  621   EQDVYVTVADARFCKPLDTGLIRELAAEHEVLITAEEGSIGGFGSHVAHYLSLTGLLDGP  680

Query  472   LKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             LK R + LPDRYIDHGAP DQ+ EAGLTP HIAATV ++LG+  EA+++
Sbjct  681   LKLRSMFLPDRYIDHGAPQDQMEEAGLTPRHIAATVLSLLGRPMEAMQL  729



>gb|AJB84617.1| 1-deoxy-D-xylulose-5-phosphate synthase [Camellia sinensis]
Length=733

 Score =  1008 bits (2605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/655 (74%), Positives = 565/655 (86%), Gaps = 1/655 (0%)
 Frame = -2

Query  2281  YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELT  2102
             +  ++P TP+LDTINYPIHMKNLS++EL +LA+ELR ++++ VSKTGGHL SSLGV ELT
Sbjct  78    FSGEKPSTPILDTINYPIHMKNLSLEELEKLADELREEIVYTVSKTGGHLSSSLGVAELT  137

Query  2101  VALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGT  1922
             VALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIRQT GLAGF KR ES +D FG 
Sbjct  138   VALHHVFNTPEDKIIWDVGHQTYPHKILTGRRSRMHTIRQTCGLAGFPKREESVHDAFGA  197

Query  1921  GHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILND  1742
             GHSST+ISAGLGMAVGRDL  + N+VIAVIGDGAMTAGQAYEAMNNAGYLD+++I+ILND
Sbjct  198   GHSSTSISAGLGMAVGRDLVRKNNHVIAVIGDGAMTAGQAYEAMNNAGYLDTNLIIILND  257

Query  1741  NKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM-HELAAKV  1565
             N QVSLPTAT+DGP  PVGALS AL+RLQS+R  R+LRE AKG+TKQ+ G   HE+AAK+
Sbjct  258   NAQVSLPTATVDGPASPVGALSKALTRLQSSRKFRQLREAAKGMTKQLMGSQGHEIAAKM  317

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             D Y RGM+ GSG++LFEELGLYYIGPVDGHN++DLV IL++VKS    GPVLIH++TEKG
Sbjct  318   DSYMRGMVGGSGASLFEELGLYYIGPVDGHNVEDLVHILKDVKSLPAPGPVLIHILTEKG  377

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GY  AE AADK HGV KF+P +GKQ K  +KT+SYT YFAE+LIAEAE D+ IVAIHAA
Sbjct  378   KGYAPAEVAADKMHGVVKFEPKSGKQLKTKSKTKSYTQYFAESLIAEAEKDEKIVAIHAA  437

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLNLFQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFC IYSSF+QR YDQV H
Sbjct  438   MGGGTGLNLFQKRFPERCFDVGIAEQHAVTFAAGLATEGLKPFCTIYSSFLQRGYDQVAH  497

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD TFMACLPNMVVMAPS E EL HMV+TAA
Sbjct  498   DVDLQKLPVRFALDRAGLVGADGPTHCGAFDTTFMACLPNMVVMAPSCETELMHMVSTAA  557

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC RYPRGNG+G +LPP NKGTPLEVGRGR++ EG RVA++GYGT VQ+C+ AA
Sbjct  558   AIDDRPSCFRYPRGNGIGSILPPNNKGTPLEVGRGRVIREGSRVAILGYGTIVQNCVEAA  617

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              LL+  G+ +TVADARFCKPLD  LIR LAK HEV+IT EEGSIGGF SHV+ F+ L+GL
Sbjct  618   KLLQMLGISITVADARFCKPLDGNLIRRLAKDHEVLITAEEGSIGGFSSHVSHFLGLNGL  677

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDGNLKWR ++LPDRYIDHG+ ADQ+ EAGLT  HIAATV +++G+ +E L ++ 
Sbjct  678   LDGNLKWRAMILPDRYIDHGSQADQIEEAGLTSKHIAATVLSLIGETKENLHLLN  732



>ref|XP_009590491.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Nicotiana tomentosiformis]
Length=713

 Score =  1008 bits (2605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/677 (73%), Positives = 576/677 (85%), Gaps = 4/677 (1%)
 Frame = -2

Query  2344  SQINYKKRSSGVQASLADKD----EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANEL  2177
             + +N  +  +G   +  +KD    ++  ++P TP LDTINYP+HMKNLS  +L QLA E+
Sbjct  36    ASLNGSEEHNGKIVTKKEKDSWQIDFSGEKPTTPFLDTINYPMHMKNLSKLDLEQLAAEV  95

Query  2176  RSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKM  1997
             R++++++V+KTGGHL SSLGVV+LTVALH+VF+ P DKI+WDVGHQ+Y HKILTGRR KM
Sbjct  96    RAEIVYSVAKTGGHLSSSLGVVDLTVALHHVFDTPDDKIIWDVGHQAYAHKILTGRRSKM  155

Query  1996  PTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAM  1817
              TIR+T+GLA F KR ES YD FG GHSST+ISAGLGMAVGRDL G+ N+VI+VIGDGAM
Sbjct  156   HTIRKTSGLAPFPKRDESVYDAFGAGHSSTSISAGLGMAVGRDLLGKNNHVISVIGDGAM  215

Query  1816  TAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLR  1637
             TAGQAYEAMNNAG+LD+++IVILNDN+QVSLPTATLDGP  PVGALSSALS+LQ++   R
Sbjct  216   TAGQAYEAMNNAGFLDANLIVILNDNEQVSLPTATLDGPATPVGALSSALSKLQASTKFR  275

Query  1636  ELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLV  1457
             +LRE AK +TKQIG   HE+AAKVDEYARGMIS SGSTLFEELGLYYIGPVDGHNI+DL+
Sbjct  276   QLREAAKSITKQIGPQAHEVAAKVDEYARGMISASGSTLFEELGLYYIGPVDGHNIEDLI  335

Query  1456  SILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSY  1277
             +IL++VKS    GPVLIH+VTEKG+GYP AE AADK HGV +FDP TGKQFKA + T SY
Sbjct  336   TILKKVKSMPAPGPVLIHIVTEKGKGYPPAEAAADKMHGVVQFDPKTGKQFKAKSSTLSY  395

Query  1276  TTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLA  1097
             T YFAE+LI EAE D  IVAIHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA
Sbjct  396   TQYFAESLIKEAEVDNKIVAIHAAMGGGTGLNYFQKRFPERCFDVGIAEQHAVTFAAGLA  455

Query  1096  CEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMA  917
              EGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +MA
Sbjct  456   TEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMA  515

Query  916   CLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGR  737
             CLPNMVVMAPSDEAEL HMVATAAAIDDRPSC R+PRGNGVG +LPP NKG P+EVG+GR
Sbjct  516   CLPNMVVMAPSDEAELMHMVATAAAIDDRPSCFRFPRGNGVGALLPPNNKGIPIEVGKGR  575

Query  736   ILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVM  557
             IL EGERVA++GYG+ VQ CL AA +L T  +RVTVADARFCKPLD  LIR LAK HE++
Sbjct  576   ILREGERVAILGYGSIVQQCLGAADILNTHNVRVTVADARFCKPLDADLIRRLAKEHEIL  635

Query  556   ITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHI  377
             ITVEEGSIGGFGSHV+ F++L+ +LDG LK R +VLPDRYIDHG+P DQ+  AGL+  HI
Sbjct  636   ITVEEGSIGGFGSHVSHFLSLNSILDGPLKLRSMVLPDRYIDHGSPLDQIEAAGLSSRHI  695

Query  376   AATVFNILGKAREALEI  326
             +ATV  +LG+ +EAL +
Sbjct  696   SATVLTLLGRPKEALVV  712



>ref|XP_009402142.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=707

 Score =  1008 bits (2605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/651 (74%), Positives = 569/651 (87%), Gaps = 0/651 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
             ++  ++PPTPLLDTINYPIHMKNLSV++L QLA ELR++++F VSKTGGHL +SLGVVEL
Sbjct  54    DFSGEKPPTPLLDTINYPIHMKNLSVQDLEQLAAELRAEIVFTVSKTGGHLSASLGVVEL  113

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             +VALH+VF+ P+DKI+WDVGHQ+Y HKILTGRR +M T+RQT+G+AGF +R ES YD FG
Sbjct  114   SVALHHVFDTPEDKIIWDVGHQAYTHKILTGRRSRMHTVRQTSGIAGFPRRDESIYDAFG  173

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAV RD+ G+KN+VI+VIGDGAMTAGQAYEAMNN+GYL+S++IV+LN
Sbjct  174   AGHSSTSISAGLGMAVARDMLGKKNHVISVIGDGAMTAGQAYEAMNNSGYLNSNLIVVLN  233

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DN+QVSLPTATLDGP  PVGALS AL+RLQ++   R+LRE AK +TKQIGGP HE+AAKV
Sbjct  234   DNRQVSLPTATLDGPATPVGALSKALTRLQASTKFRKLREAAKSITKQIGGPTHEVAAKV  293

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             DE+ARG+IS +GS+LFEELGLYYIGPVDGHN++DLV+I Q+VKS    GPVLIH+VTEKG
Sbjct  294   DEFARGLISANGSSLFEELGLYYIGPVDGHNLEDLVTIFQDVKSMPAPGPVLIHIVTEKG  353

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GYP AE A DK HGV KFDP+TGKQ K  + T+SYT YFAEALI EAEAD  +VAIHAA
Sbjct  354   KGYPPAEAAPDKMHGVVKFDPSTGKQLKPKSPTRSYTQYFAEALIKEAEADNKVVAIHAA  413

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  414   MGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVH  473

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQK+PVRFA+DRAGLVG+DGPTHCGAFD+T+MACLPNM+VMAP+DEAEL HMVATAA
Sbjct  474   DVDLQKIPVRFALDRAGLVGADGPTHCGAFDITYMACLPNMIVMAPADEAELMHMVATAA  533

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC R+PRGNGVGV LPP NKG+PLE+G+GR+LMEG+R A++GYG+ V +CL AA
Sbjct  534   AIDDRPSCFRFPRGNGVGVALPPDNKGSPLEIGKGRVLMEGDRAAILGYGSTVNTCLKAA  593

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
               L    +  TVADARFCKPLD  LIRSL K H+++ITVEEGSIGGFGSHVA F++L GL
Sbjct  594   DTLRAHAVFATVADARFCKPLDVKLIRSLVKEHDILITVEEGSIGGFGSHVAHFLSLSGL  653

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             LDG LK R +VLPDRYIDHG+P DQ+  AGL+  H+AATV ++LG+ +EAL
Sbjct  654   LDGQLKLRSMVLPDRYIDHGSPQDQIEAAGLSSRHVAATVLSLLGRRKEAL  704



>gb|ACI43010.1| 1-deoxy-D-xylulose 5-phosphate synthase [Stevia rebaudiana]
Length=715

 Score =  1008 bits (2605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/706 (70%), Positives = 582/706 (82%), Gaps = 22/706 (3%)
 Frame = -2

Query  2380  GSDLHLH-----FQQKPSQINYKKRSSGVQASLADKD-----------------EYYSQR  2267
             GS ++LH     ++  PS   + ++   ++AS  + D                 E+  ++
Sbjct  5     GSTMNLHLTSSPYKTVPSLCKFTRKQFRLKASATNPDAEDGKMMFKNDKPNLKVEFAGEK  64

Query  2266  PPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHY  2087
             P TPLLDTINYP+HMKNL+ ++L QLA ELR D++++V+ TGGHL SSLGVVEL+VALH+
Sbjct  65    PVTPLLDTINYPVHMKNLTTQDLEQLAAELRQDIVYSVANTGGHLSSSLGVVELSVALHH  124

Query  2086  VFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSST  1907
             VFN P DKI+WDVGHQ+YPHKILTGRR KM TIR+T+GLAGF KR ES +D FG GHSST
Sbjct  125   VFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRKTSGLAGFPKRDESAHDAFGAGHSST  184

Query  1906  TISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVS  1727
             +ISAGLGMAVGRDL G+ NNVI+VIGDGAMTAG+AYEA+NNAG+LDS++IV+LNDNKQVS
Sbjct  185   SISAGLGMAVGRDLLGKTNNVISVIGDGAMTAGRAYEAINNAGFLDSNLIVVLNDNKQVS  244

Query  1726  LPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARG  1547
             LPTATLDGP  PVGALS ALS+LQ++   R+LRE AK +TKQIG   HE+AAKVDEYARG
Sbjct  245   LPTATLDGPATPVGALSGALSKLQASTKFRKLREAAKSITKQIGPQAHEVAAKVDEYARG  304

Query  1546  MISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYA  1367
             MIS SGSTLFEELGLYYIGPVDGHN++DLV+I ++VKS    GPVLIH+VTEKG+GYP A
Sbjct  305   MISASGSTLFEELGLYYIGPVDGHNVEDLVNIFEKVKSMPAPGPVLIHIVTEKGKGYPPA  364

Query  1366  EKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTG  1187
             E AAD+ HGV KFD  TGKQFK  + T SYT YFAE+LI EAEAD  IVAIHAAMGGGTG
Sbjct  365   EAAADRMHGVVKFDVPTGKQFKTKSPTLSYTQYFAESLIKEAEADNKIVAIHAAMGGGTG  424

Query  1186  LNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQK  1007
             LN FQ++ P RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDLQK
Sbjct  425   LNYFQKKCPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQK  484

Query  1006  LPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRP  827
             LPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAP+DEAEL HMVATAAAIDDRP
Sbjct  485   LPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPADEAELMHMVATAAAIDDRP  544

Query  826   SCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETR  647
             SC R+PRGNG+G  LPP NKG P+EVG+GRIL+EG RVA++GYG+ VQ CL AA+LL+  
Sbjct  545   SCFRFPRGNGIGAPLPPNNKGIPIEVGKGRILLEGTRVAILGYGSIVQECLGAASLLQAH  604

Query  646   GLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLK  467
              +  TVADARFCKPLD  LIR LA  HEV++TVEEGSIGGFGSHVA F++L+GLLDG LK
Sbjct  605   NVSATVADARFCKPLDTGLIRRLANEHEVLLTVEEGSIGGFGSHVAHFLSLNGLLDGKLK  664

Query  466   WRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALE  329
              R + LPD+YIDHGAP DQL EAGL+  HI +++ ++LGK +EAL+
Sbjct  665   LRAMTLPDKYIDHGAPQDQLEEAGLSSKHICSSLLSLLGKPKEALQ  710



>emb|CAA09804.2| 1-deoxyxylulose 5-phosphate synthase [Catharanthus roseus]
Length=716

 Score =  1008 bits (2605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/671 (73%), Positives = 574/671 (86%), Gaps = 6/671 (1%)
 Frame = -2

Query  2338  INYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIF  2159
             I+ KK   G       K ++  ++PPTPLLDTINYP+HMKNLS  +L QLA ELR+++++
Sbjct  51    ISIKKEKDGW------KIDFSGEKPPTPLLDTINYPVHMKNLSAHDLEQLAAELRAEIVY  104

Query  2158  NVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQT  1979
             +V+KTGGHL +SLGVV+LTVALH+VFN P+D+I+WDVGHQ+YPHKILTGRR KM TIRQT
Sbjct  105   SVAKTGGHLSASLGVVDLTVALHHVFNTPEDRIIWDVGHQAYPHKILTGRRSKMHTIRQT  164

Query  1978  NGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAY  1799
             +GLAGF KR ES YD FG GHSST+ISAGLGMAV RD+ G+ NNVI+VIGDGAMTAGQAY
Sbjct  165   SGLAGFPKRDESIYDAFGAGHSSTSISAGLGMAVARDILGKNNNVISVIGDGAMTAGQAY  224

Query  1798  EAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVA  1619
             EAMNNAG+LD+++IV+LNDNKQVSLPTATLDGP  PVGALSSALS+LQ++   R+LRE A
Sbjct  225   EAMNNAGFLDANLIVVLNDNKQVSLPTATLDGPATPVGALSSALSKLQASPKFRQLREAA  284

Query  1618  KGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEV  1439
             K +TKQIG   HE+AAKVDEYARGM+S +GSTLFEELGLYYIGPVDGH+I+DLV+I Q+V
Sbjct  285   KSITKQIGPQAHEVAAKVDEYARGMLSATGSTLFEELGLYYIGPVDGHSIEDLVTIFQKV  344

Query  1438  KSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAE  1259
             K+    GPVLIH+VTEKG+GYP AE AADK HGV KFDP TGKQFK+ + T SYT YFAE
Sbjct  345   KAMPAPGPVLIHIVTEKGKGYPPAEVAADKMHGVVKFDPKTGKQFKSKSPTLSYTQYFAE  404

Query  1258  ALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKP  1079
             +LI EAE D  I+AIHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKP
Sbjct  405   SLIKEAEIDNKIIAIHAAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKP  464

Query  1078  FCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMV  899
             FCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +MACLPNM+
Sbjct  465   FCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMI  524

Query  898   VMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGE  719
             VMAPSDEAEL HMVATAA IDDRP C R+PRGNG+GV LPP NKGTPLE+G+GRIL+EG 
Sbjct  525   VMAPSDEAELMHMVATAAKIDDRPCCFRFPRGNGIGVALPPNNKGTPLEIGKGRILVEGS  584

Query  718   RVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEG  539
             RVA++GYG+ VQ CL AA +L++  +  TVADA+FCKPLD  LI++LAK HE++ITVEEG
Sbjct  585   RVAILGYGSIVQQCLGAAEMLKSHNVSPTVADAKFCKPLDGDLIKTLAKEHEILITVEEG  644

Query  538   SIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFN  359
             SIGGFGSHV  F++L G+LDG +K R L LPDRYIDHGAP DQ+ EAGL+  HI AT+ +
Sbjct  645   SIGGFGSHVTHFLSLTGILDGPIKVRSLFLPDRYIDHGAPVDQIEEAGLSSRHICATILS  704

Query  358   ILGKAREALEI  326
             +LGK +EAL++
Sbjct  705   LLGKPKEALKL  715



>ref|XP_004955719.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic-like [Setaria italica]
Length=721

 Score =  1008 bits (2605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/655 (75%), Positives = 564/655 (86%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++P TPLLDT+NYP HMKNL+  EL QLA ELR++V+  VSKTGGHL SSLGVV
Sbjct  66    KVDFSGEKPATPLLDTVNYPAHMKNLTTLELEQLAAELRAEVVHTVSKTGGHLSSSLGVV  125

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL VALH+VF+ P DKI+WDVGHQ+YPHKILTGRR +M T+RQT+GLAGF KR ES +D 
Sbjct  126   ELAVALHHVFDTPDDKIIWDVGHQAYPHKILTGRRSRMHTLRQTSGLAGFPKRDESPHDA  185

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISA LGMAV RDL GR N+VI+VIGDGAMTAGQAYEAMNN+GYLD++MIV+
Sbjct  186   FGAGHSSTSISAALGMAVARDLLGRNNHVISVIGDGAMTAGQAYEAMNNSGYLDANMIVV  245

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALS AL+RLQS+  LR LRE AK VTKQIGGP H++AA
Sbjct  246   LNDNKQVSLPTATLDGPSKPVGALSRALTRLQSSTKLRRLREAAKAVTKQIGGPAHDVAA  305

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHN++DLV+I ++VK+    GPVLIH+VTE
Sbjct  306   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNVEDLVTIFEKVKAMPAPGPVLIHIVTE  365

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AAD+ HGV KFDPATG+QFK+ + T  YT YFAE+LI EAEAD  +VAIH
Sbjct  366   KGKGYPPAEAAADRMHGVVKFDPATGRQFKSKSPTLPYTQYFAESLIREAEADDKVVAIH  425

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  426   AAMGGGTGLNHFQKRFPERCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  485

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQ+LPVRFA+DRAGLVG+DGPTHCGAFDV +MACLPNMVVMAP+DE+EL HMVAT
Sbjct  486   VHDVDLQRLPVRFALDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPADESELMHMVAT  545

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             A AIDDRPSC R+PRGNG+G  LPPGNKG+PLE+G+GR+L+ G RVAL+GYG+ VQ+CL 
Sbjct  546   ATAIDDRPSCFRFPRGNGIGAALPPGNKGSPLEIGKGRVLVGGNRVALLGYGSMVQACLK  605

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA  L+   + +TVADARFCKPLD  LIR LA  HEV+IT EEGSIGGFGSHVA +++L 
Sbjct  606   AAEALKEHNVYITVADARFCKPLDTGLIRELAAEHEVLITAEEGSIGGFGSHVAHYLSLA  665

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             GLLDGNLK R + LPDRYIDHGAP DQ+ EAGLTP HIAATV ++LG+  EA+++
Sbjct  666   GLLDGNLKLRSMFLPDRYIDHGAPQDQMEEAGLTPRHIAATVLSLLGRPLEAMQL  720



>ref|XP_010113452.1| putative 1-deoxy-D-xylulose-5-phosphate synthase [Morus notabilis]
 gb|EXC35479.1| putative 1-deoxy-D-xylulose-5-phosphate synthase [Morus notabilis]
Length=714

 Score =  1007 bits (2604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/656 (75%), Positives = 563/656 (86%), Gaps = 0/656 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K +Y  ++P TPLLD+INYP+HMKNLS ++L QLA ELR+D++  VSK GGHL SSLGVV
Sbjct  59    KIDYSGEKPATPLLDSINYPVHMKNLSTQDLEQLAAELRADIVHTVSKIGGHLSSSLGVV  118

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P+DKI+WDVGHQ+YPHKILTGRR  M TIR+T+GLAGF KR ES +D 
Sbjct  119   ELTVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSLMHTIRKTSGLAGFPKREESIHDA  178

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL  +KN+VI+VIGDGAMTAG AYEAMNNAG+LD++MI++
Sbjct  179   FGAGHSSTSISAGLGMAVARDLLQKKNHVISVIGDGAMTAGMAYEAMNNAGFLDTNMIIV  238

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSALS++Q++   R+LRE AK +TKQIGG  HE+AA
Sbjct  239   LNDNKQVSLPTATLDGPASPVGALSSALSKIQASTEFRKLREAAKTITKQIGGQAHEVAA  298

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELG+YYIGPVDGHN++DLV+I + VK+T   GPVLIH+VTE
Sbjct  299   KVDEYARGMISASGSTLFEELGIYYIGPVDGHNVEDLVTIFERVKATPAPGPVLIHIVTE  358

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE A DK HGV KF+P TGKQFK  A T SYT YFAEALI EAE D+ IV IH
Sbjct  359   KGKGYPPAEAAPDKMHGVVKFEPRTGKQFKPKAATLSYTQYFAEALIKEAEVDERIVGIH  418

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  419   AAMGGGTGLNYFQKRFPERCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  478

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
              HDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFDVT+MACLPNM+VMAPSDEAEL HMVAT
Sbjct  479   AHDVDLQKLPVRFALDRAGLVGADGPTHCGAFDVTYMACLPNMIVMAPSDEAELMHMVAT  538

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G VLPP NKGT LE+G+GRIL EG  VA++GYG  VQ C+ 
Sbjct  539   AAAIDDRPSCFRFPRGNGIGAVLPPNNKGTVLEIGKGRILTEGSGVAILGYGAIVQQCME  598

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA LL+TR + +TVADARFCKPLD  LIR L K HE++ITVEEG+IGGFGSHV+ F++L 
Sbjct  599   AANLLKTRDIAITVADARFCKPLDADLIRQLVKEHEILITVEEGAIGGFGSHVSHFLSLS  658

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             GLLDG LK R +VLPDRYIDHGAP DQ+ EAGL+  HI+ATV ++LGK +EAL  M
Sbjct  659   GLLDGPLKLRSMVLPDRYIDHGAPQDQIEEAGLSSKHISATVLSLLGKPKEALSFM  714



>gb|ACF84835.1| unknown [Zea mays]
Length=564

 Score =  1006 bits (2602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/559 (89%), Positives = 530/559 (95%), Gaps = 0/559 (0%)
 Frame = -2

Query  1999  MPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGA  1820
             MPT+RQTNGLAGFTKR+ESEYD FGTGHSSTTISA LGMAVGRDLKG KNNV+AVIGDGA
Sbjct  1     MPTMRQTNGLAGFTKRAESEYDSFGTGHSSTTISAALGMAVGRDLKGGKNNVVAVIGDGA  60

Query  1819  MTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPL  1640
             MTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGP+PPVGALSSALS+LQS+RPL
Sbjct  61    MTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPVPPVGALSSALSKLQSSRPL  120

Query  1639  RELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDL  1460
             RELREVAKGVTKQIGG +HELAAKVDEYARGMISG GS+LFEELGLYYIGPVDGHNIDDL
Sbjct  121   RELREVAKGVTKQIGGSVHELAAKVDEYARGMISGPGSSLFEELGLYYIGPVDGHNIDDL  180

Query  1459  VSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQS  1280
             ++IL +VKSTKTTGPVLIHVVTEKGRGYPYAE+AADKYHGV KFDPATGKQFK+ AKT S
Sbjct  181   ITILNDVKSTKTTGPVLIHVVTEKGRGYPYAERAADKYHGVAKFDPATGKQFKSPAKTLS  240

Query  1279  YTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGL  1100
             YT YFAEALIAEAE D  IVAIHAAMGGGTGLN F RRFPSRCFDVGIAEQH VTFAAGL
Sbjct  241   YTNYFAEALIAEAEQDSKIVAIHAAMGGGTGLNYFLRRFPSRCFDVGIAEQHAVTFAAGL  300

Query  1099  ACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFM  920
             ACEGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +M
Sbjct  301   ACEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYM  360

Query  919   ACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRG  740
             ACLPNMVVMAPSDEAEL HMVATAAAIDDRPSC RYPRGNGVGV LPP  KGTPLEVG+G
Sbjct  361   ACLPNMVVMAPSDEAELCHMVATAAAIDDRPSCFRYPRGNGVGVPLPPNYKGTPLEVGKG  420

Query  739   RILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEV  560
             RIL+EG+RVAL+GYG+AVQ CL+AA+L++  GL+VTVADARFCKPLDHALIRSLAKSHEV
Sbjct  421   RILLEGDRVALLGYGSAVQYCLTAASLVQRHGLKVTVADARFCKPLDHALIRSLAKSHEV  480

Query  559   MITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSH  380
             +ITVEEGSIGGFGSHVAQFMALDGLLDG LKWRPLVLPDRYIDHG+PADQLAEAGLTPSH
Sbjct  481   LITVEEGSIGGFGSHVAQFMALDGLLDGKLKWRPLVLPDRYIDHGSPADQLAEAGLTPSH  540

Query  379   IAATVFNILGKAREALEIM  323
             IAA+VFNILG+ REAL IM
Sbjct  541   IAASVFNILGQNREALAIM  559



>ref|XP_003530592.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic-like [Glycine max]
Length=714

 Score =  1006 bits (2600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/653 (74%), Positives = 564/653 (86%), Gaps = 0/653 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K  Y  ++P TPLLDT+N+PIHMKNLS ++L QLA ELR+D++ +VS TGGHL SSLGVV
Sbjct  59    KINYSGEKPATPLLDTVNHPIHMKNLSTQDLEQLAAELRADIVHSVSDTGGHLSSSLGVV  118

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL+VALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIR+++GLAGF KR ES +D 
Sbjct  119   ELSVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRKSSGLAGFPKRDESVHDA  178

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ N++I+VIGDGA+TAGQAYEAMNNAG+LDS+MIV+
Sbjct  179   FGVGHSSTSISAGLGMAVARDLLGKNNSIISVIGDGALTAGQAYEAMNNAGFLDSNMIVV  238

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSALS++Q++   R+LRE AK +TKQIGG  H++AA
Sbjct  239   LNDNKQVSLPTATLDGPATPVGALSSALSKIQASSEFRKLREAAKTITKQIGGQTHQVAA  298

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHNI+DLV+I ++VK+    GPVLIHVVTE
Sbjct  299   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNIEDLVTIFEKVKAMPAPGPVLIHVVTE  358

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AEKAAD+ HGV KFDP TG+QFKA   T SYT YFAE+LI EAE DK IVAIH
Sbjct  359   KGKGYPPAEKAADRMHGVVKFDPKTGQQFKAKTSTLSYTQYFAESLIKEAENDKKIVAIH  418

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN F +RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  419   AAMGGGTGLNYFHKRFPKRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  478

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+ +MACLPNMVVMAPSDEAEL HMVAT
Sbjct  479   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDIAYMACLPNMVVMAPSDEAELMHMVAT  538

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G  LP  NKGT LE+G+GRIL+EG RVA++GYG+ VQ C  
Sbjct  539   AAAIDDRPSCFRFPRGNGIGATLPLNNKGTSLEIGKGRILVEGSRVAILGYGSVVQQCRQ  598

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             A+ +L+  G+ VTVADARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHV+QF++L 
Sbjct  599   ASEMLKELGIDVTVADARFCKPLDTGLIRLLAKEHEILITVEEGSIGGFGSHVSQFLSLS  658

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             G+LDG LKWR ++LPDRYI+HG+P  Q+ EAGL+   IAATV +++ +  EAL
Sbjct  659   GILDGPLKWRAMMLPDRYIEHGSPQVQIEEAGLSSKQIAATVLSLMERPNEAL  711



>dbj|BAJ98888.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=714

 Score =  1006 bits (2600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/657 (74%), Positives = 561/657 (85%), Gaps = 0/657 (0%)
 Frame = -2

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             A K EY S +P TPLLDTINYP+HMKNLS  +L QL+ ELR +++  VSKTGGHL +SLG
Sbjct  57    AWKIEYSSDKPETPLLDTINYPVHMKNLSTTDLEQLSAELRQEIVHTVSKTGGHLSASLG  116

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVEL+VALH+VF+ P+DKI+WDVGHQSYPHKILTGRR +M TIR+T+GLAGF KR ES +
Sbjct  117   VVELSVALHHVFDTPEDKIIWDVGHQSYPHKILTGRRSRMHTIRKTSGLAGFPKRDESAH  176

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             D FG GHSST+ISA LGMAV RDL+G+KN+VI+VIGDGAMTAGQAYEAMNN+G+LDS+MI
Sbjct  177   DAFGVGHSSTSISAALGMAVARDLQGKKNHVISVIGDGAMTAGQAYEAMNNSGFLDSNMI  236

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             V+LNDNKQVSLPTATLDGP  PVGALS AL++LQS+   R LRE AK +TKQIGG  HE+
Sbjct  237   VVLNDNKQVSLPTATLDGPSKPVGALSKALTKLQSSTKFRRLREAAKTITKQIGGSTHEV  296

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMIS SGSTLFEELGLYYIGPVDGH+++DLV+I ++VKS    GPVLIH+V
Sbjct  297   AAKVDEYARGMISASGSTLFEELGLYYIGPVDGHSLEDLVTIFEKVKSMPAPGPVLIHIV  356

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKG+GYP AE AADK HGV KFDP TGKQFK  + T SYT YFAE+LI EAE D  +VA
Sbjct  357   TEKGKGYPPAEAAADKMHGVVKFDPTTGKQFKTKSPTLSYTQYFAESLIREAEGDDKVVA  416

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EG+KPFCAIYSSF+QR YD
Sbjct  417   IHAAMGGGTGLNYFQKRFPERCFDVGIAEQHAVTFAAGLAAEGMKPFCAIYSSFLQRGYD  476

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQ+LPVRFA+DRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAP+DEAEL HMV
Sbjct  477   QVVHDVDLQRLPVRFALDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPADEAELMHMV  536

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATA AIDDRPSC R+PRGNGVG VLP  N+GTP+EVG+GR+L+ G RVALVGYGT VQ+C
Sbjct  537   ATANAIDDRPSCFRFPRGNGVGAVLPLNNRGTPIEVGKGRVLVRGNRVALVGYGTMVQAC  596

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L AA  L+   L +TV DARFCKPLD  LIR LA  HE++IT EEGSIGGFGSHVA +++
Sbjct  597   LKAAEALKEHDLSITVVDARFCKPLDTELIRELAAEHEILITAEEGSIGGFGSHVAHYLS  656

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             L+GLLDG LK R + LPDRYIDHGA  DQ+  AGLTP HIAATV +++G+  EAL +
Sbjct  657   LNGLLDGPLKLRSMFLPDRYIDHGAADDQMEAAGLTPRHIAATVLSLVGRPLEALHL  713



>ref|XP_011012653.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Populus euphratica]
Length=713

 Score =  1005 bits (2599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/695 (71%), Positives = 567/695 (82%), Gaps = 16/695 (2%)
 Frame = -2

Query  2359  FQQKPSQINYKKRSSGVQASLADKD----------------EYYSQRPPTPLLDTINYPI  2228
                +P+  N  K +  +QASL +                   +   +P TP+LDTINYPI
Sbjct  17    LSSQPTFTNLSKFNGVIQASLDNNSRDQLNRYRETKQKRSLNFTGNKPSTPVLDTINYPI  76

Query  2227  HMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDV  2048
             HMKNLSV+EL++L +ELR +V++ VSKTGGHL SSLGV ELTVALH+VFN P+DKI+WDV
Sbjct  77    HMKNLSVQELDKLVDELREEVVYTVSKTGGHLSSSLGVAELTVALHHVFNTPEDKIIWDV  136

Query  2047  GHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRD  1868
             GHQ+YPHKILTGRR KM TIRQT GLAGF KR ESE+D FG GHSST+ISA LGMAVGRD
Sbjct  137   GHQTYPHKILTGRRSKMHTIRQTFGLAGFPKREESEHDAFGAGHSSTSISAALGMAVGRD  196

Query  1867  LKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPV  1688
             L G+ N+VIAVIGDGAMTAGQAYEAMNNAGYLDS++I+ILNDN+QVSLPTAT+DGP PPV
Sbjct  197   LLGKDNHVIAVIGDGAMTAGQAYEAMNNAGYLDSNLIIILNDNRQVSLPTATVDGPAPPV  256

Query  1687  GALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEEL  1508
             GALS  L+RL S+R  R LRE AKG+TKQIGG   E+AAKVD Y RGM   SG+ LFEEL
Sbjct  257   GALSRTLTRLHSSRKFRRLREAAKGITKQIGGQTQEIAAKVDSYMRGMTGASGACLFEEL  316

Query  1507  GLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKF  1328
             GLYYIGPVDGH+++DLV IL++VK+    GPVLIHV+TEKG+GY  AE AADK HGV KF
Sbjct  317   GLYYIGPVDGHDVEDLVDILKKVKALPAPGPVLIHVITEKGKGYTPAEVAADKMHGVVKF  376

Query  1327  DPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCF  1148
             D  TGKQ K+ + T SYT YFAE+LIAEAE D  IVAIHAAMGGGTGLNLFQ+RFP RCF
Sbjct  377   DTKTGKQLKSKSNTLSYTKYFAESLIAEAEKDDKIVAIHAAMGGGTGLNLFQKRFPYRCF  436

Query  1147  DVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLV  968
             DVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFA+DRAGLV
Sbjct  437   DVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFALDRAGLV  496

Query  967   GSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgv  788
             G+DGPTHCGAFD TFMA LPNMVVMAPSDE EL HMVATAAAIDDRPSC RYPRGNG+G 
Sbjct  497   GADGPTHCGAFDTTFMASLPNMVVMAPSDETELMHMVATAAAIDDRPSCFRYPRGNGIGS  556

Query  787   vlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCK  608
             ++PP NKGTPLEVG+GR+L EG RVA++GYGT VQSC+ AA LLE  G+  TVADARFCK
Sbjct  557   IIPPNNKGTPLEVGKGRVLREGSRVAILGYGTIVQSCMQAAKLLEETGISATVADARFCK  616

Query  607   PLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDH  428
             PLD  LIR LA+ HEV+ITVEEGSIGGF SHV+ F++L+GLLDGN+KWR ++LPDRYIDH
Sbjct  617   PLDGELIRQLAQEHEVLITVEEGSIGGFSSHVSHFLSLNGLLDGNIKWRSMMLPDRYIDH  676

Query  427   GAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             G+  DQ+ EAGL+P HIA+T   ++G    +L   
Sbjct  677   GSQTDQIEEAGLSPKHIASTAMLLVGGYTNSLHFF  711



>gb|KHN24127.1| Putative 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Glycine soja]
Length=714

 Score =  1005 bits (2599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/653 (74%), Positives = 564/653 (86%), Gaps = 0/653 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K  Y  ++P TPLLDT+N+PIHMKNLS ++L QLA ELR+D++ +VS TGGHL SSLGVV
Sbjct  59    KINYSGEKPATPLLDTVNHPIHMKNLSTQDLEQLAAELRADIVHSVSDTGGHLSSSLGVV  118

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL+VALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIR+++GLAGF KR ES +D 
Sbjct  119   ELSVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRKSSGLAGFPKRDESVHDA  178

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ N++I+VIGDGA+TAGQAYEAMNNAG+LDS+MIV+
Sbjct  179   FGVGHSSTSISAGLGMAVARDLLGKNNSIISVIGDGALTAGQAYEAMNNAGFLDSNMIVV  238

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSALS++Q++   R+LRE AK +TKQIGG  H++AA
Sbjct  239   LNDNKQVSLPTATLDGPATPVGALSSALSKIQASSEFRKLREAAKTITKQIGGQTHQVAA  298

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHNI+DLV+I ++VK+    GPVLIHVVTE
Sbjct  299   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNIEDLVTIFEKVKAMPAPGPVLIHVVTE  358

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AEKAAD+ HGV KFDP TG+QFKA   T SYT YFAE+LI EAE DK IVAIH
Sbjct  359   KGKGYPPAEKAADRMHGVVKFDPKTGQQFKAKTSTLSYTQYFAESLIKEAENDKKIVAIH  418

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN F +RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  419   AAMGGGTGLNYFHKRFPKRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  478

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+ +MACLPNMVVMAPSDEAEL HMVAT
Sbjct  479   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDIAYMACLPNMVVMAPSDEAELMHMVAT  538

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G  LP  NKGT LE+G+GRIL+EG RVA++GYG+ VQ C  
Sbjct  539   AAAIDDRPSCFRFPRGNGIGATLPLNNKGTSLEIGKGRILVEGSRVAILGYGSVVQQCRQ  598

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             A+ +L+  G+ VTVADARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHV+QF++L 
Sbjct  599   ASEMLKELGIDVTVADARFCKPLDTGLIRLLAKEHEILITVEEGSIGGFGSHVSQFLSLS  658

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             G+LDG LKWR ++LPDRYI+HG+P  Q+ EAGL+   IAATV +++ +  EAL
Sbjct  659   GILDGPLKWRAMMLPDRYIEHGSPQVQIEEAGLSSKQIAATVLSLMERPNEAL  711



>dbj|BAE79547.1| 1-deoxyxylulose 5-phosphate synthase [Chrysanthemum x morifolium]
Length=669

 Score =  1005 bits (2598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/654 (74%), Positives = 563/654 (86%), Gaps = 0/654 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K +Y  ++P TPLLDTIN+P+HMKNLS ++L QLA ELR D++++V+ TGGHL SSLGVV
Sbjct  11    KIDYTGEKPMTPLLDTINFPVHMKNLSTQDLEQLAAELRVDIVYSVANTGGHLSSSLGVV  70

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL VALH+VFN P D+I+WDVGHQ+YPHKILTGRR KM T+R+T+GLAGF KR ES +D 
Sbjct  71    ELAVALHHVFNTPDDRIIWDVGHQAYPHKILTGRRSKMNTMRKTSGLAGFPKRDESVHDA  130

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAVGRDL G+ NNVI+VIGDGAMTAGQAYEAMNNAG+LDS++IV+
Sbjct  131   FGAGHSSTSISAGLGMAVGRDLLGKNNNVISVIGDGAMTAGQAYEAMNNAGFLDSNLIVV  190

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSS L++LQ++   R+LRE AK +TKQIG   HE+AA
Sbjct  191   LNDNKQVSLPTATLDGPATPVGALSSTLAKLQASPKFRKLREAAKSITKQIGPQAHEVAA  250

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHN++DLV+I ++VKS    GPVLIH+VTE
Sbjct  251   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNVEDLVTIFEKVKSMPAPGPVLIHIVTE  310

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+G+P AE AAD+ HGV KFD  TGKQFK  + T SYT YFAEALI EAE D  +VAIH
Sbjct  311   KGKGHPPAEAAADRMHGVVKFDVGTGKQFKTKSPTLSYTQYFAEALIKEAEVDNKVVAIH  370

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  371   AAMGGGTGLNYFQKKFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  430

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAEL +MVAT
Sbjct  431   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELINMVAT  490

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+GV LP  NKG P+EVG+GRIL+EG RVA++GYG+ VQ CL 
Sbjct  491   AAAIDDRPSCFRFPRGNGIGVPLPLNNKGVPIEVGKGRILLEGTRVAILGYGSIVQQCLG  550

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA+LL+   +  TVADARFCKPLD  LI+ LA  HEV++TVEEGSIGGFGSHVA F++L+
Sbjct  551   AASLLQAHNISATVADARFCKPLDAELIKRLANEHEVLLTVEEGSIGGFGSHVAHFLSLN  610

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALE  329
             GLLDG LK R + LPDRYIDHGAP DQL EAGL+  HI +T+ ++LGK +EAL+
Sbjct  611   GLLDGKLKLRAMTLPDRYIDHGAPQDQLEEAGLSSKHICSTLLSLLGKPKEALQ  664



>emb|CAD22155.2| 1-deoxy-D-xylulose 5-phosphate synthase [Stevia rebaudiana]
Length=715

 Score =  1005 bits (2598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/706 (70%), Positives = 581/706 (82%), Gaps = 22/706 (3%)
 Frame = -2

Query  2380  GSDLHLH-----FQQKPSQINYKKRSSGVQASLADKD-----------------EYYSQR  2267
             GS ++LH     ++  PS   + ++   ++AS  + D                 E+  ++
Sbjct  5     GSTMNLHLTSSPYKTVPSLCKFTRKQFRLKASATNPDAEDGKMMFKNDKPNLKVEFAGEK  64

Query  2266  PPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHY  2087
             P TPLLDTINYP+HMKNL+ ++L QLA ELR D++++V+ TGGHL SSLGVVEL+VALH+
Sbjct  65    PVTPLLDTINYPVHMKNLTTQDLEQLAAELRQDIVYSVANTGGHLSSSLGVVELSVALHH  124

Query  2086  VFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSST  1907
             VFN P DKI+WDVGHQ+YPHKILTGRR KM TIR+T+GLAGF KR ES +D FG GHSST
Sbjct  125   VFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRKTSGLAGFPKRDESAHDAFGAGHSST  184

Query  1906  TISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVS  1727
             +ISAGLGMAVGRDL G+ NNVI+VIGDGAMTAG+AYEA+NNAG+LDS++IV+LNDNKQVS
Sbjct  185   SISAGLGMAVGRDLLGKTNNVISVIGDGAMTAGRAYEAINNAGFLDSNLIVVLNDNKQVS  244

Query  1726  LPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARG  1547
             LPTATLDGP  PVGALS ALS+LQ++   R+LRE AK +TKQIG   HE+AAKVDEYARG
Sbjct  245   LPTATLDGPATPVGALSGALSKLQASTKFRKLREAAKSITKQIGPQAHEVAAKVDEYARG  304

Query  1546  MISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYA  1367
             MIS SGSTLFEELGLYYIGPVDGHN++DLV+I ++VKS    GPVLIH+VTEKG+GYP A
Sbjct  305   MISASGSTLFEELGLYYIGPVDGHNVEDLVNIFEKVKSMPAPGPVLIHIVTEKGKGYPPA  364

Query  1366  EKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTG  1187
             E AAD+ HGV KFD  TGKQFK  + T SYT YFAE+LI EAEAD  IVAIHAAMGGGTG
Sbjct  365   EAAADRMHGVVKFDVPTGKQFKTKSPTLSYTQYFAESLIKEAEADNKIVAIHAAMGGGTG  424

Query  1186  LNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQK  1007
             LN FQ++ P RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDLQK
Sbjct  425   LNYFQKKCPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQK  484

Query  1006  LPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRP  827
             LPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAP+DEAEL HMVATAAAIDDRP
Sbjct  485   LPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPADEAELMHMVATAAAIDDRP  544

Query  826   SCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETR  647
             SC R+PRGNG+G  LPP NKG P+EVG+GRIL+EG RVA++GYG+ VQ CL AA+LL+  
Sbjct  545   SCFRFPRGNGIGAPLPPNNKGIPIEVGKGRILLEGTRVAILGYGSIVQECLGAASLLQAH  604

Query  646   GLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLK  467
              +  TVADARFCKPLD  LIR LA  HEV++TVEEGSIGGFGSHVA F++++GLLDG LK
Sbjct  605   NVSATVADARFCKPLDTGLIRRLANEHEVLLTVEEGSIGGFGSHVAHFLSINGLLDGKLK  664

Query  466   WRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALE  329
              R + LPD+YIDHGAP DQL E GL+  HI +++ ++LGK +EAL+
Sbjct  665   LRAMTLPDKYIDHGAPQDQLEETGLSSKHICSSLLSLLGKPKEALQ  710



>gb|AIX87516.1| 1-deoxy-D-xylulose 5-phosphate-synthase 2 [Lycium ruthenicum]
Length=712

 Score =  1004 bits (2596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/653 (74%), Positives = 566/653 (87%), Gaps = 0/653 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
             ++   +PPTP LDTINYP+HMKNLS  +L  LA ELR++++++V+KTGGHL SSLGVV+L
Sbjct  59    DFSGDKPPTPFLDTINYPMHMKNLSKLDLEHLAAELRAEIVYSVAKTGGHLSSSLGVVDL  118

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TVALH+VF+ P+DKI+WDVGHQ+Y HKILTGRR KM TIR+T+GLA F KR ES YD FG
Sbjct  119   TVALHHVFDTPEDKIIWDVGHQAYAHKILTGRRSKMHTIRKTSGLAPFPKRDESVYDAFG  178

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAV RDL G+ N+VI++IGDG+MTAGQAYEA+NNAG+LDS++IVILN
Sbjct  179   AGHSSTSISAGLGMAVARDLLGKNNHVISIIGDGSMTAGQAYEALNNAGFLDSNLIVILN  238

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DN+QVSLPTATLDGP  PVGALSSALS+LQ++R  R+LRE AK +TKQIG   HE+AAKV
Sbjct  239   DNEQVSLPTATLDGPATPVGALSSALSKLQASRKFRQLREAAKSITKQIGPQAHEVAAKV  298

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             DEYARGMIS SGSTLFEELGLYYIGPVDGHNI+DL++ILQ+VKS    GPVLIH+VTEKG
Sbjct  299   DEYARGMISASGSTLFEELGLYYIGPVDGHNIEDLINILQKVKSMPAPGPVLIHIVTEKG  358

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GYP AE AADK HGV +FDP TGKQFKA + T SYT YFAE+LI EAE D  IVAIHAA
Sbjct  359   KGYPPAEAAADKMHGVAQFDPKTGKQFKAKSPTLSYTQYFAESLIKEAENDDKIVAIHAA  418

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGL+ EGLKPFCAIYSSF+QR YDQVVH
Sbjct  419   MGGGTGLNYFQKRFPERCFDVGIAEQHAVTFAAGLSTEGLKPFCAIYSSFLQRGYDQVVH  478

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +MACLPNM+VMAPSDEAEL HMVATAA
Sbjct  479   DVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMIVMAPSDEAELMHMVATAA  538

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC R+PRGNG+G VLP  NKG P+EVG+GRIL EGERVA++GYG+ VQ CL AA
Sbjct  539   AIDDRPSCFRFPRGNGIGAVLPQNNKGIPIEVGKGRILREGERVAILGYGSIVQQCLGAA  598

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              +L++  +R+TVADARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHVA F++L+ +
Sbjct  599   DILQSHNVRITVADARFCKPLDADLIRRLAKEHEILITVEEGSIGGFGSHVAHFLSLNSI  658

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             LDG LK R +VLPDRYIDHG+P DQ+  AGL+  HI+AT+  +LG+ +EA+ +
Sbjct  659   LDGPLKLRSMVLPDRYIDHGSPLDQIEAAGLSSRHISATILTLLGRPKEAMVV  711



>gb|AID51428.1| 1-deoxy-D-xylulose 5-phosphate synthase [Astragalus membranaceus]
Length=713

 Score =  1004 bits (2595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/658 (74%), Positives = 565/658 (86%), Gaps = 4/658 (1%)
 Frame = -2

Query  2293  DKDE----YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGS  2126
             +KDE    Y +++P TPLLDT+NYP+HMKNLS ++L QLA ELR+D++ +VS TGGHL S
Sbjct  53    EKDEWKINYSAEKPETPLLDTVNYPVHMKNLSTQDLEQLAAELRADIVHSVSNTGGHLSS  112

Query  2125  SLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSE  1946
             SLGVVELTVALH+VFN P DKI+WDVGHQ+YPHKILTGRR KM +IR+T+GLAGF KR E
Sbjct  113   SLGVVELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHSIRKTSGLAGFPKRDE  172

Query  1945  SEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDS  1766
             S YD FG GHSST+ISAGLGMAV RDL G+ N+VI+VIGDGAMTAGQAYEAMNNAG+LD+
Sbjct  173   SIYDAFGVGHSSTSISAGLGMAVARDLLGKNNSVISVIGDGAMTAGQAYEAMNNAGFLDA  232

Query  1765  DMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM  1586
             ++IVILNDN+QVSLPTATLDGP  PVGALSS LS++Q++   R+LRE AK  TKQIGG  
Sbjct  233   NLIVILNDNRQVSLPTATLDGPATPVGALSSTLSKIQASTQFRKLREAAKTFTKQIGGQT  292

Query  1585  HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLI  1406
             H++AAKVDEYARGMIS SGS+LFEELGLYYIGPVDGHNI+DLVSI ++VK     GPVLI
Sbjct  293   HQVAAKVDEYARGMISASGSSLFEELGLYYIGPVDGHNIEDLVSIFEKVKGMPAPGPVLI  352

Query  1405  HVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKD  1226
             H+VTEKG+GYP AE+AADK HGV KFDP TG QFK  + T S T YFAE+LI EAE D  
Sbjct  353   HIVTEKGKGYPPAERAADKMHGVVKFDPKTGHQFKPKSSTLSNTQYFAESLIKEAEMDNK  412

Query  1225  IVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQR  1046
             IVAIHAAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR
Sbjct  413   IVAIHAAMGGGTGLNYFQKKFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQR  472

Query  1045  AYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELF  866
              YDQVVHDVDLQK+PVRFA+DRAG+VG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL 
Sbjct  473   GYDQVVHDVDLQKIPVRFALDRAGMVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELM  532

Query  865   HMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAV  686
             HMVATAAAIDDRPSC R+PRGNG+GV LP  NKGTPLE+G+GRIL EG+RVA++GYG  V
Sbjct  533   HMVATAAAIDDRPSCFRFPRGNGIGVDLPLNNKGTPLEIGKGRILREGDRVAILGYGCMV  592

Query  685   QSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQ  506
             Q C  AA +L+T G+ VTVADARFCKPLD  LI+ LAK HE++ITVEEGSIGGFGSHV+Q
Sbjct  593   QQCQQAAEMLKTLGIYVTVADARFCKPLDTGLIKLLAKEHEILITVEEGSIGGFGSHVSQ  652

Query  505   FMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             F++L G+LDG LKWR + LPDRYI+HG+P DQ+ +AGL+  HI ATV  +L + +EAL
Sbjct  653   FLSLAGILDGPLKWRAMNLPDRYIEHGSPKDQIEQAGLSSKHIVATVLTLLKRPKEAL  710



>ref|XP_003530591.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic-like [Glycine max]
 gb|KHN24128.1| Putative 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Glycine soja]
Length=714

 Score =  1004 bits (2595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/653 (74%), Positives = 566/653 (87%), Gaps = 0/653 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K  Y  ++P TPLLDT+N+PIHMKNLS ++L QLA ELR+D++ +VS+TGGHL SSLGVV
Sbjct  59    KINYSGEKPATPLLDTVNHPIHMKNLSTQDLEQLAAELRADIVHSVSETGGHLSSSLGVV  118

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL+VALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR ES +D 
Sbjct  119   ELSVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKRDESVHDA  178

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ N++I+VIGDGA+TAGQAYEAMNNAG+LDS+MIV+
Sbjct  179   FGVGHSSTSISAGLGMAVARDLLGKNNSIISVIGDGALTAGQAYEAMNNAGFLDSNMIVV  238

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSALS++Q++   R+LRE AK +TKQIGG  H++AA
Sbjct  239   LNDNKQVSLPTATLDGPATPVGALSSALSKIQASSEFRKLREAAKTITKQIGGQTHQVAA  298

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHNI+DLV+I ++VK+    GPVLIHVVTE
Sbjct  299   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNIEDLVTIFEKVKAMPAPGPVLIHVVTE  358

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AEKAAD+ HGV KFDP TG Q KA + T SYT YFAE+LI EAE D  IVAIH
Sbjct  359   KGKGYPPAEKAADRMHGVVKFDPKTGHQLKAKSSTLSYTQYFAESLIKEAEIDNKIVAIH  418

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  419   AAMGGGTGLNYFQKKFPERCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  478

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD+T+M+CLPNMVVMAPSDE EL HMVAT
Sbjct  479   VHDVDLQKLPVRFALDRAGLVGADGPTHCGAFDITYMSCLPNMVVMAPSDETELMHMVAT  538

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G  LP  NKGTPLE+G+GRIL+EG RVA++GYG+ VQ C  
Sbjct  539   AAAIDDRPSCFRFPRGNGIGATLPLNNKGTPLEIGKGRILVEGSRVAILGYGSVVQQCRQ  598

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             A+ +L+  G+ VTVADARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHV+QF++L 
Sbjct  599   ASEMLKELGIDVTVADARFCKPLDTGLIRLLAKEHEILITVEEGSIGGFGSHVSQFLSLS  658

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             G+LDG LKWR ++LPDRYI+HG+P  Q+ EAGL+   IAATV +++ + ++AL
Sbjct  659   GILDGPLKWRAMMLPDRYIEHGSPQVQIEEAGLSSKQIAATVLSLMERPKQAL  711



>ref|XP_006380580.1| hypothetical protein POPTR_0007s09490g [Populus trichocarpa]
 gb|ERP58377.1| hypothetical protein POPTR_0007s09490g [Populus trichocarpa]
Length=692

 Score =  1003 bits (2593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/647 (75%), Positives = 562/647 (87%), Gaps = 0/647 (0%)
 Frame = -2

Query  2272  QRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVAL  2093
             ++P TPLLDTI+YP HM NLS ++L QLA+ELR+D++++V+KTGGHL SSLGVVEL+VAL
Sbjct  42    EKPSTPLLDTIDYPFHMDNLSTQDLEQLASELRADIVYSVAKTGGHLSSSLGVVELSVAL  101

Query  2092  HYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHS  1913
             H+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR ES YD FG GHS
Sbjct  102   HHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKRDESVYDAFGAGHS  161

Query  1912  STTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQ  1733
             ST+ISAGLGMAV RDL G+ N+VI+VIGDGAMTAGQAYEAMNNAG+LDS++IVILNDNKQ
Sbjct  162   STSISAGLGMAVARDLLGKSNHVISVIGDGAMTAGQAYEAMNNAGFLDSNLIVILNDNKQ  221

Query  1732  VSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYA  1553
             VSLPTATLDGP  PVGALSS L++LQ++   R+L E AKG+TKQI G  H++AAKVDEYA
Sbjct  222   VSLPTATLDGPATPVGALSSTLTKLQASAKFRKLHEAAKGITKQIDGQTHQVAAKVDEYA  281

Query  1552  RGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYP  1373
             RGMIS SGSTLFEELGLYYIGPVDGH+I+DLV+I Q VK+    GPVLIH++TEKG+GYP
Sbjct  282   RGMISASGSTLFEELGLYYIGPVDGHSIEDLVTIFQNVKAMPAPGPVLIHIITEKGKGYP  341

Query  1372  YAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGG  1193
              AE AADK HGV KFD  +G+QFK  + T SYT YFAE+LI EAE D  IVAIHAAMGGG
Sbjct  342   PAEAAADKMHGVVKFDVKSGQQFKLKSSTLSYTRYFAESLIKEAEVDNKIVAIHAAMGGG  401

Query  1192  TGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDL  1013
             TGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDL
Sbjct  402   TGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDL  461

Query  1012  QKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDD  833
             QKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVATAAAIDD
Sbjct  462   QKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVATAAAIDD  521

Query  832   RPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLE  653
             RPSC R+PRGNG+G VLPP NKG  LE+G+GRILMEG RVA++GYG+ VQ C  AA++L 
Sbjct  522   RPSCFRFPRGNGIGTVLPPNNKGIALEIGKGRILMEGNRVAIMGYGSIVQQCAEAASMLR  581

Query  652   TRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGN  473
             T+ + VTVADARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHV+ F++  G+LDG 
Sbjct  582   TQDISVTVADARFCKPLDTNLIRQLAKEHEILITVEEGSIGGFGSHVSHFLSSTGILDGP  641

Query  472   LKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             LK R +VLPDRYIDHG+P DQ+ EAGL+ +HI ATV ++LGK +EAL
Sbjct  642   LKLRAMVLPDRYIDHGSPQDQIQEAGLSSNHITATVLSMLGKPKEAL  688



>ref|XP_006353153.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic-like [Solanum tuberosum]
Length=720

 Score =  1003 bits (2593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/691 (71%), Positives = 577/691 (84%), Gaps = 17/691 (2%)
 Frame = -2

Query  2347  PSQINYKKRSSGVQASLADKDE-----------------YYSQRPPTPLLDTINYPIHMK  2219
             P   N+ +++  V+AS+   DE                 +  ++PPTP LDT+NYP HMK
Sbjct  23    PRFYNFTRKTFLVKASVNGSDEINGKMVRKEEKVGLQIDFSGEKPPTPFLDTVNYPKHMK  82

Query  2218  NLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQ  2039
             NLS  +L QLA E+R++++++V+KTGGHL SSLGVVELTVALH+VF+ P+DKI+WDVGHQ
Sbjct  83    NLSKMDLEQLAAEVRAEIVYSVAKTGGHLSSSLGVVELTVALHHVFDTPEDKIIWDVGHQ  142

Query  2038  SYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKG  1859
             +Y HKILTGRR KM T+R+T+GLA F KR ES YD FG GHSST+ISAGLGMAV RDL G
Sbjct  143   AYAHKILTGRRSKMHTMRKTSGLAPFPKRDESAYDAFGAGHSSTSISAGLGMAVARDLLG  202

Query  1858  RKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGAL  1679
               N+VI+VIGDGAMTAGQAYEAMNNAG+LDS++IVILNDNKQVSLPTATLDGP  PVGAL
Sbjct  203   NNNHVISVIGDGAMTAGQAYEAMNNAGFLDSNLIVILNDNKQVSLPTATLDGPATPVGAL  262

Query  1678  SSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLY  1499
             SSALS++Q++R  R+LRE AK +TKQIG   HE+AAKVDEYARGM+S SGSTLFEELGLY
Sbjct  263   SSALSKIQASRKFRQLREAAKSITKQIGPQTHEVAAKVDEYARGMLSASGSTLFEELGLY  322

Query  1498  YIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPA  1319
             YIGPVDGHNI+DL++IL++VK+    GPVLIH+VTEKG+GY  AE A DK HGV +FDP 
Sbjct  323   YIGPVDGHNIEDLITILKKVKAMPAPGPVLIHIVTEKGKGYLPAEAADDKMHGVAQFDPK  382

Query  1318  TGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVG  1139
             TGKQFKA + T SYT YFAE+LI EAE DK IVAIHAAMGGGTGLN FQ++FP RCFDVG
Sbjct  383   TGKQFKAKSPTLSYTQYFAESLIKEAENDKKIVAIHAAMGGGTGLNYFQKQFPERCFDVG  442

Query  1138  IAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSD  959
             IAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG+D
Sbjct  443   IAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGAD  502

Query  958   GPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlp  779
             GPTHCGAFDVT+MACLPNMVVMAPSDEAEL HMVATAAAIDDRPSC R+PRGNG+G VLP
Sbjct  503   GPTHCGAFDVTYMACLPNMVVMAPSDEAELMHMVATAAAIDDRPSCFRFPRGNGIGAVLP  562

Query  778   pgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLD  599
               NKG P+EVG+GRIL EGERVA++GYG+ VQ CL AA +L +  +RVTVADARFCKPLD
Sbjct  563   LNNKGIPIEVGKGRILREGERVAILGYGSIVQQCLGAADILNSHDVRVTVADARFCKPLD  622

Query  598   HALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAP  419
               LI+ LAK HE++ITVEEGSIGGFGSHV+ F++L+ +LDG LK R ++LPDRYIDHG+P
Sbjct  623   ADLIKRLAKEHEILITVEEGSIGGFGSHVSHFLSLNSILDGPLKLRSMLLPDRYIDHGSP  682

Query  418   ADQLAEAGLTPSHIAATVFNILGKAREALEI  326
              DQ+ EAGL+  HI ATV  +LG+ +EA+ +
Sbjct  683   VDQIEEAGLSSRHICATVLTLLGRPQEAMVV  713



>ref|XP_009400868.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=707

 Score =  1002 bits (2591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/655 (74%), Positives = 563/655 (86%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K +Y  ++P TPLLD+INYPIHMKNLS ++L QL+ ELR++++F V+KTGGHL SSLGVV
Sbjct  52    KIDYSGEKPATPLLDSINYPIHMKNLSTRDLEQLSAELRAEIVFAVAKTGGHLSSSLGVV  111

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL VALH+VF+AP+DKI+WDVGHQ+YPHKILTGRR +M TIRQT GLAGF KR ES YD 
Sbjct  112   ELAVALHHVFDAPEDKIIWDVGHQAYPHKILTGRRSRMNTIRQTAGLAGFPKRDESIYDA  171

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+KN+VI+VIGDGAMTAGQAYEAMNNAGYLDS++I++
Sbjct  172   FGAGHSSTSISAGLGMAVARDLLGKKNHVISVIGDGAMTAGQAYEAMNNAGYLDSNLIIV  231

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALS AL++LQS+  LR+LRE AK +TKQIGG  H++AA
Sbjct  232   LNDNKQVSLPTATLDGPATPVGALSKALTKLQSSTKLRKLREAAKNITKQIGGQTHDIAA  291

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGM+S +G +LFEELGLYYIGPVDGH+++DLV+I ++VKS    GPVLIH+VTE
Sbjct  292   KVDEYARGMMSATGYSLFEELGLYYIGPVDGHDVEDLVTIFEKVKSLPAPGPVLIHIVTE  351

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFDP TGKQFK+ + T SYT YFAE LI EA+ D  IVA+H
Sbjct  352   KGKGYPPAESAADKMHGVVKFDPKTGKQFKSKSSTLSYTQYFAETLIKEAQVDDKIVAVH  411

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMG GTGLN FQ +FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  412   AAMGSGTGLNYFQHKFPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  471

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQK+PVRFA+DRAGLVG+DGPTHCGAFD+ +MACLPNM+VMAP+DEAEL HM+AT
Sbjct  472   VHDVDLQKIPVRFALDRAGLVGADGPTHCGAFDIVYMACLPNMIVMAPADEAELMHMIAT  531

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNGVGV LPP NKGTPLE+G+GR+LMEG RVA++GYG+ VQ+CL 
Sbjct  532   AAAIDDRPSCFRFPRGNGVGVALPPNNKGTPLEIGKGRVLMEGNRVAILGYGSIVQTCLK  591

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA  L + G+  TVADARFCKPLD  LIR LA  HE++ITVEEGSIGGFGSHV  F+ L 
Sbjct  592   AADSLRSHGIFPTVADARFCKPLDVELIRRLANEHEILITVEEGSIGGFGSHVTHFLGLS  651

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             GLLD N+K R +VLPDRYIDHG+P DQ   AGL+  HIAATV ++LG+ +EAL +
Sbjct  652   GLLDKNIKLRSMVLPDRYIDHGSPQDQFEVAGLSSRHIAATVLSLLGRRKEALHL  706



>gb|EYU30922.1| hypothetical protein MIMGU_mgv1a002082mg [Erythranthe guttata]
Length=718

 Score =  1002 bits (2591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/655 (74%), Positives = 564/655 (86%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++P TP+LDTINYP+HMKNLS K+L QLA ELR+++++ V+KTGGHL SSLGVV
Sbjct  63    KIDFSGEKPATPVLDTINYPVHMKNLSTKDLEQLAAELRAEIVYTVAKTGGHLSSSLGVV  122

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P D+I+WDVGHQ+Y HKILTGRR KM TIR+T+GLAGF KR ES YD 
Sbjct  123   ELTVALHHVFNCPDDRIIWDVGHQAYGHKILTGRRSKMHTIRKTSGLAGFPKRDESVYDA  182

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAVGRDL G+KNNV++VIGDGAMTAGQAYEAMNNAG+LDS++IVI
Sbjct  183   FGAGHSSTSISAGLGMAVGRDLLGKKNNVVSVIGDGAMTAGQAYEAMNNAGFLDSNLIVI  242

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL++LQ++   R+LRE AK +TKQIG   HE+AA
Sbjct  243   LNDNKQVSLPTATLDGPATPVGALSSALTKLQASPKFRQLREAAKSITKQIGPQAHEVAA  302

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGM+S  GSTLFEELGLYYIGPVDGHN++DLV+I ++VKS    GPVLIH+VTE
Sbjct  303   KVDEYARGMLSAPGSTLFEELGLYYIGPVDGHNVNDLVTIFEKVKSMPAPGPVLIHIVTE  362

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AAD+ HGV KFD  TGKQ K  + T SYT YFAE+LI EAE D  IVAIH
Sbjct  363   KGKGYPPAEAAADRMHGVVKFDTNTGKQNKVKSSTLSYTQYFAESLIKEAEIDSKIVAIH  422

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  423   AAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  482

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV FMACLPNMVVMAPSDEAEL HM+AT
Sbjct  483   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAFMACLPNMVVMAPSDEAELMHMIAT  542

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             +AAIDDRPSC R+PRGNGVG  LPP NKG PLE+GRGRIL+EG +VA++GYG  VQ CL 
Sbjct  543   SAAIDDRPSCFRFPRGNGVGAALPPSNKGIPLEIGRGRILVEGSKVAILGYGAIVQQCLG  602

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA +L++  + +TVADARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHV+ F++L+
Sbjct  603   AAEMLKSHNVSITVADARFCKPLDTELIRRLAKEHEILITVEEGSIGGFGSHVSHFLSLN  662

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG+LK R +VLPD+YIDHGAP DQ+  AGL+  HI  TV ++LG+  +AL++
Sbjct  663   GILDGHLKLRSMVLPDKYIDHGAPQDQIEAAGLSSRHICGTVLSLLGRPIDALKL  717



>ref|XP_003557443.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Brachypodium distachyon]
Length=713

 Score =  1002 bits (2591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/672 (72%), Positives = 571/672 (85%), Gaps = 0/672 (0%)
 Frame = -2

Query  2341  QINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVI  2162
             ++  +K  +   A    K +Y  ++P TPLLDTIN+P+HMKNLS  +L QL++ELR++++
Sbjct  41    KVMMRKEPTVAAAPAPRKIDYSLEKPETPLLDTINFPVHMKNLSTPDLEQLSSELRAEIV  100

Query  2161  FNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQ  1982
               VSKTGGHL +SLGVVEL+VALH+VF+ P DKI+WDVGHQSYPHKILTGRR +M TIR+
Sbjct  101   HTVSKTGGHLSASLGVVELSVALHHVFDTPDDKIIWDVGHQSYPHKILTGRRSRMHTIRK  160

Query  1981  TNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQA  1802
             T+GLAGF KR ES +D FG GHSST+ISA LGMAV RDL+G+KN+VI+VIGDGAMTAGQA
Sbjct  161   TSGLAGFPKRDESAHDAFGAGHSSTSISAALGMAVARDLQGKKNHVISVIGDGAMTAGQA  220

Query  1801  YEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREV  1622
             YEAMNN+GYLDS+MIV+LNDNKQVSLPTAT+DGP  PVGALS AL++LQS+   R+LRE 
Sbjct  221   YEAMNNSGYLDSNMIVVLNDNKQVSLPTATMDGPAKPVGALSKALTKLQSSTKFRKLREA  280

Query  1621  AKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQE  1442
             AK +TKQIGG  HE+AAKVDEYARGMIS +GS+LFEELGLYYIGPVDGH+++DLV+I Q+
Sbjct  281   AKTITKQIGGSTHEVAAKVDEYARGMISATGSSLFEELGLYYIGPVDGHSLEDLVTIFQK  340

Query  1441  VKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFA  1262
             VKS    GPVLIH+VTEKG+GYP AE AADK HGV KFDP TGKQFK  + T SYT YFA
Sbjct  341   VKSMPAPGPVLIHIVTEKGKGYPPAEAAADKMHGVVKFDPVTGKQFKTKSPTLSYTQYFA  400

Query  1261  EALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLK  1082
             E+LI EAEAD+ +VAIHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAG+A EG+K
Sbjct  401   ESLIREAEADEKVVAIHAAMGGGTGLNYFQKRFPERCFDVGIAEQHAVTFAAGMAAEGMK  460

Query  1081  PFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNM  902
             PFCAIYSSF+QR YDQVVHDVDLQ+LPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPNM
Sbjct  461   PFCAIYSSFLQRGYDQVVHDVDLQRLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNM  520

Query  901   VVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEG  722
             VVMAP+DEAEL HMVATA AIDDRPSC R+PRGNGVG VLP  NKG  +++G+GR+L+ G
Sbjct  521   VVMAPADEAELMHMVATANAIDDRPSCFRFPRGNGVGAVLPANNKGIAVQIGKGRVLVGG  580

Query  721   ERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEE  542
              RVAL+GYGT VQ+C+ AA +L+   + VTVADARFCKPLD  LIR LA  HE++IT EE
Sbjct  581   NRVALLGYGTMVQACVKAAEMLKEHDVFVTVADARFCKPLDTQLIRDLAAEHEILITAEE  640

Query  541   GSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVF  362
             GSIGGFGSHVA ++ L GLLDG+LK R + LPDRYIDHGA  DQ+ EAGLTP HIAATV 
Sbjct  641   GSIGGFGSHVAHYLGLSGLLDGHLKLRSMFLPDRYIDHGAAEDQMEEAGLTPRHIAATVL  700

Query  361   NILGKAREALEI  326
             ++LG+  EAL++
Sbjct  701   SLLGRPLEALQL  712



>gb|AHF22384.1| 1-deoxy-D-xylulose-5-phosphate synthase [Dendrobium catenatum]
Length=727

 Score =  1002 bits (2590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/653 (74%), Positives = 565/653 (87%), Gaps = 0/653 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
             ++  ++P TPLLDTIN+PIHMKNLSV EL QLA ELR+++++ VSKTGGHL SSLGVVEL
Sbjct  74    DFTGEKPETPLLDTINFPIHMKNLSVHELEQLAAELRAEIVYTVSKTGGHLSSSLGVVEL  133

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
              VA+H+VF+AP D+I+WDVGHQ+YPHKILTGRR +M T+R+T+GLAGF KR ES YD FG
Sbjct  134   AVAIHHVFDAPDDRIIWDVGHQAYPHKILTGRRSRMLTMRKTSGLAGFPKREESIYDAFG  193

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAV RDL G++N VI+VIGDGAMTAGQAYEAMNN+G+LDS++I++LN
Sbjct  194   VGHSSTSISAGLGMAVARDLLGKQNQVISVIGDGAMTAGQAYEAMNNSGFLDSNLIIVLN  253

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DN+QVSLPTATLDGP  PVGALS ALS+LQ++  LR+LRE AK +TKQIGG  HE+AAKV
Sbjct  254   DNRQVSLPTATLDGPATPVGALSRALSKLQASTKLRKLREAAKSITKQIGGHAHEVAAKV  313

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             DEYARGMIS SGS+LFEELGLYYIGPV+GHNIDDLV+I ++VKS    GPVL+HVVTEKG
Sbjct  314   DEYARGMISASGSSLFEELGLYYIGPVNGHNIDDLVTIFEKVKSMPAPGPVLVHVVTEKG  373

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GYP AE AADK HGV KFD  TGKQ K    T SYT YFA++LI EAE D  IVAIHAA
Sbjct  374   KGYPPAEAAADKMHGVVKFDAKTGKQAKPKQATPSYTQYFADSLIREAEEDSKIVAIHAA  433

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  434   MGGGTGLNYFQKKFPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVH  493

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+ +MACLPNM+VMAP+DEAEL HMVATAA
Sbjct  494   DVDLQKLPVRFAMDRAGLVGADGPTHCGAFDIAYMACLPNMIVMAPADEAELMHMVATAA  553

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC R+PRGNGVGV LP  NKGTPLE+G+GRIL+EG R+A++GYG+ VQ+CL AA
Sbjct  554   AIDDRPSCFRFPRGNGVGVPLPIRNKGTPLEIGKGRILVEGTRIAILGYGSIVQNCLKAA  613

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
               L+   + +TVADARFCKPLD  LIR LA  HE +IT EEGSIGGFGSHV  F++LDGL
Sbjct  614   KSLKDHNVSITVADARFCKPLDVDLIRRLAIEHEFLITAEEGSIGGFGSHVTHFLSLDGL  673

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             LDG+LK R LVLPDRYIDHGAP DQ+ EAGL+ +HIAATV ++LG+ +EAL++
Sbjct  674   LDGHLKLRSLVLPDRYIDHGAPQDQIDEAGLSSNHIAATVLSLLGRPKEALQL  726



>ref|XP_007014110.1| 1-deoxy-D-xylulose-5-phosphate synthase [Theobroma cacao]
 gb|EOY31729.1| 1-deoxy-D-xylulose-5-phosphate synthase [Theobroma cacao]
Length=736

 Score =  1001 bits (2588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/655 (73%), Positives = 561/655 (86%), Gaps = 0/655 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
              +  ++P TP+LDTIN+PIHMKNLS++EL +LA+ELR +V++ VSKTGGHL SSLGVVEL
Sbjct  80    NFSGEKPSTPVLDTINHPIHMKNLSIEELRKLADELREEVVYTVSKTGGHLSSSLGVVEL  139

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TVALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIRQT GLAGF KR ES++D FG
Sbjct  140   TVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRQTWGLAGFPKREESKHDAFG  199

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAVGRDL G+ N+VIAVIGDGAMTAG AYEAMNNAGYLD+++I+ILN
Sbjct  200   AGHSSTSISAGLGMAVGRDLLGKNNHVIAVIGDGAMTAGMAYEAMNNAGYLDTNLIIILN  259

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DNKQVSLPTAT+DGP PPVGALS AL++L S+R  R+LRE AKG+TKQIGG  HE+AAK+
Sbjct  260   DNKQVSLPTATIDGPAPPVGALSEALTKLHSSRKFRQLREAAKGITKQIGGQTHEIAAKL  319

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             D Y RGM  GSG++LFEELGLYYIGPVDGHN++DLV +L ++KS    GPVLIH +TEKG
Sbjct  320   DSYMRGMAGGSGASLFEELGLYYIGPVDGHNVEDLVDVLNKIKSMPAPGPVLIHAITEKG  379

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GY  AE A DK HGV KFDP +GKQ K+  +T +YT YFAE+LIAEA  D  IV IHAA
Sbjct  380   KGYAPAEMAPDKMHGVVKFDPKSGKQLKSKPETLAYTQYFAESLIAEAGQDDKIVGIHAA  439

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLNLFQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR +DQV H
Sbjct  440   MGGGTGLNLFQKRFPDRCFDVGIAEQHAVTFAAGLASEGLKPFCAIYSSFLQRGFDQVAH  499

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD TFMACLPNMVVMAPS+E EL HMVATAA
Sbjct  500   DVDLQKLPVRFAIDRAGLVGADGPTHCGAFDTTFMACLPNMVVMAPSNETELMHMVATAA  559

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSCLRYPRGNG+G +LPP NKGTPLEVG+GR+L EG RVA++GYGT +QSC+ AA
Sbjct  560   AIDDRPSCLRYPRGNGIGSILPPNNKGTPLEVGKGRVLREGSRVAILGYGTIMQSCMKAA  619

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              LL+  G+  TVADARFCKP+D  L+R LA+ HE++IT EEGSIGGF +HV+ F+ L+GL
Sbjct  620   ELLQVNGISPTVADARFCKPIDEDLLRQLAQEHEILITAEEGSIGGFSTHVSHFLGLNGL  679

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDG LKWRP++LPDRYIDHG+  DQ+ EAGL+  HIAAT  ++LGK RE  +++ 
Sbjct  680   LDGKLKWRPMMLPDRYIDHGSQKDQIEEAGLSSKHIAATALSLLGKCREGFQLLN  734



>gb|AIZ68637.1| 1-deoxy-D-xylulose-5-phosphate synthase precursor [Eschenbachia 
blinii]
Length=729

 Score =  1001 bits (2587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/661 (72%), Positives = 572/661 (87%), Gaps = 0/661 (0%)
 Frame = -2

Query  2302  SLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSS  2123
             S+A   +Y  ++P TP+LDTINYP HMKNLSV+EL +LA+ELR ++++ VSKTGGHL SS
Sbjct  66    SVATNLKYSGEKPKTPILDTINYPKHMKNLSVEELERLADELREEIVYTVSKTGGHLSSS  125

Query  2122  LGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSES  1943
             LGVVELTV+LH+VFN P DKI+WDVGHQ+YPHKILTGRR +M T+RQT GLAGF KR ES
Sbjct  126   LGVVELTVSLHHVFNTPDDKIIWDVGHQAYPHKILTGRRSRMETMRQTCGLAGFPKRDES  185

Query  1942  EYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSD  1763
             ++D FG GHSST+ISAGLGMA+GRDL G+ N+VIAVIGDGAMTAGQAYEAMNNAGYLDS+
Sbjct  186   QHDAFGAGHSSTSISAGLGMAIGRDLLGKDNHVIAVIGDGAMTAGQAYEAMNNAGYLDSN  245

Query  1762  MIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMH  1583
             +I+ILNDN+QVSLPTATLDGP PPVGALS +L+RLQ++R +R+LREVAKGVTKQ+G   H
Sbjct  246   IIIILNDNRQVSLPTATLDGPAPPVGALSRSLTRLQTSRKVRQLREVAKGVTKQLGDKTH  305

Query  1582  ELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIH  1403
             E+AAK+D Y +GM+ G  ++LFEELGLYY+GPVDGHN++DLV +L ++KS  + GPV +H
Sbjct  306   EVAAKMDSYMKGMVGGQAASLFEELGLYYVGPVDGHNVEDLVHVLTKIKSMPSAGPVPVH  365

Query  1402  VVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDI  1223
             +VTEKG+GY  AE AADK HGV KF+  TGKQ K  AKT SYT YFA++L+ EAE D+ I
Sbjct  366   IVTEKGKGYHPAEIAADKMHGVVKFNTQTGKQVKVKAKTLSYTQYFADSLVVEAERDEKI  425

Query  1222  VAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRA  1043
             +AIHAAMGGGTGLN FQ+RFP+RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR 
Sbjct  426   IAIHAAMGGGTGLNTFQKRFPTRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRG  485

Query  1042  YDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFH  863
             YDQVVHDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD  FMACLPNMVVMAPS E+EL H
Sbjct  486   YDQVVHDVDLQKLPVRFAIDRAGLVGADGPTHCGAFDTAFMACLPNMVVMAPSCESELMH  545

Query  862   MVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQ  683
             MVATAAAIDDRPSC RYPRGNG+G +LPP NKGTP+E+GRGR+L EG RVAL+GYGT  Q
Sbjct  546   MVATAAAIDDRPSCFRYPRGNGIGSLLPPDNKGTPVEIGRGRVLREGSRVALLGYGTIAQ  605

Query  682   SCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQF  503
             SCL+A+ +L+  G+ VTVADARFCKPLD +LI+ LA  HEV+IT+EEGSIGGF SHV+ +
Sbjct  606   SCLAASEILQALGISVTVADARFCKPLDGSLIKQLANEHEVLITIEEGSIGGFSSHVSHY  665

Query  502   MALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             +AL+GLLDGNLKWR + LPDRYIDHGA ++Q+ EAGL+  HI+ATV +++G+ +++L ++
Sbjct  666   LALNGLLDGNLKWRAITLPDRYIDHGAQSNQIEEAGLSSKHISATVLSLIGENKDSLSLI  725

Query  322   T  320
              
Sbjct  726   N  726



>emb|CDP01586.1| unnamed protein product [Coffea canephora]
Length=715

 Score =  1001 bits (2587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/655 (74%), Positives = 566/655 (86%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++P TP+LDT+NYP HMKNLS+ +L QLA ELR++++  V+K GGHL +SLGVV
Sbjct  60    KIDFSGEKPATPVLDTVNYPAHMKNLSIHDLEQLAAELRAEIVHTVAKIGGHLSASLGVV  119

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P+D+I+WDVGHQ+YPHKILTGRR KM TIRQT+GLAGF KR ES YD 
Sbjct  120   ELTVALHHVFNTPEDRIIWDVGHQAYPHKILTGRRSKMHTIRQTSGLAGFPKRDESVYDA  179

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAVGRDL G+ NNVI+VIGDGAMTAGQAYEA+NNAG+LDS++IVI
Sbjct  180   FGAGHSSTSISAGLGMAVGRDLLGKNNNVISVIGDGAMTAGQAYEALNNAGFLDSNLIVI  239

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSS LS+LQ++   R+LRE AK +TKQIG   HE+AA
Sbjct  240   LNDNKQVSLPTATLDGPATPVGALSSCLSKLQASPKFRQLREAAKSITKQIGPQAHEVAA  299

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             K+DEYARGM++  GSTLFEELGLYYIGPVDGHN++DLV+I Q+VK     GPVLIH+VTE
Sbjct  300   KMDEYARGMVNAPGSTLFEELGLYYIGPVDGHNVEDLVTIFQKVKRMPAPGPVLIHLVTE  359

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFDP TGKQFK+ + T +YT YFAE+LI EAE DK IVAIH
Sbjct  360   KGKGYPPAEAAADKMHGVVKFDPETGKQFKSKSPTLTYTQYFAESLIKEAELDKKIVAIH  419

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+ FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  420   AAMGGGTGLNYFQKIFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  479

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +MACLPNMVVMAPSDEAEL HMVAT
Sbjct  480   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPSDEAELMHMVAT  539

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSCLR+PRGNGVG +LPP NKGTP+E+G+GRIL EG+RVA++GYG+ VQ CL 
Sbjct  540   AAAIDDRPSCLRFPRGNGVGAILPPNNKGTPIELGKGRILKEGDRVAILGYGSIVQECLG  599

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA +L++  +  TVADARFCKPLD  LI+ LAK HE+++TVEEGSIGGFGSHVA F++L 
Sbjct  600   AAEILKSHNILPTVADARFCKPLDGDLIKRLAKEHEILVTVEEGSIGGFGSHVAHFLSLT  659

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG +K R +VLPDRYIDHG+P DQL EAGL+  HI  TV ++LG+ +EAL++
Sbjct  660   GILDGPIKLRSMVLPDRYIDHGSPKDQLEEAGLSAKHICGTVLSLLGRPQEALQL  714



>ref|XP_011011178.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Populus euphratica]
Length=726

 Score =  1000 bits (2585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/647 (75%), Positives = 560/647 (87%), Gaps = 0/647 (0%)
 Frame = -2

Query  2272  QRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVAL  2093
             ++P TPLLDTI+YP HM NLS ++L QLA+ELR+D+++ V+KTGGHL SSLGVVEL+VAL
Sbjct  76    EKPSTPLLDTIDYPFHMDNLSTQDLEQLASELRADIVYGVAKTGGHLSSSLGVVELSVAL  135

Query  2092  HYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHS  1913
             H+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR ES YD FG GHS
Sbjct  136   HHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKRDESVYDAFGAGHS  195

Query  1912  STTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQ  1733
             ST+ISAGLGMAV RDL G+ N+VI+VIGDGAMTAGQAYEAMNNAG+LDS++IVILNDNKQ
Sbjct  196   STSISAGLGMAVARDLLGKSNHVISVIGDGAMTAGQAYEAMNNAGFLDSNLIVILNDNKQ  255

Query  1732  VSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYA  1553
             VSLPTATLDGP  PVGALSS L++LQ++   R+L E AKG+TKQI G  H++AAKVDE A
Sbjct  256   VSLPTATLDGPATPVGALSSTLTKLQASTKFRKLHEAAKGITKQIDGQTHQVAAKVDEDA  315

Query  1552  RGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYP  1373
             RGMIS SGSTLFEELGLYYIGPVDGH+I+DLV+I Q VK+    GPVLIH++TEKG+GYP
Sbjct  316   RGMISASGSTLFEELGLYYIGPVDGHSIEDLVTIFQNVKAMPAPGPVLIHIITEKGKGYP  375

Query  1372  YAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGG  1193
              AE AADK HGV KFD  +G+QFK  + T SYT YFAE+LI EAE D  IVAIHAAMGGG
Sbjct  376   PAEAAADKMHGVVKFDVKSGQQFKLKSSTLSYTQYFAESLIKEAEVDNKIVAIHAAMGGG  435

Query  1192  TGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDL  1013
             TGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDL
Sbjct  436   TGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDL  495

Query  1012  QKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDD  833
             QKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVATAAAIDD
Sbjct  496   QKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVATAAAIDD  555

Query  832   RPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLE  653
             RPSC R+PRGNG+G VLPP NKG  LE+G+GRILMEG RVA++GYG+ VQ C  AA++L 
Sbjct  556   RPSCFRFPRGNGIGTVLPPNNKGIALEIGKGRILMEGNRVAIMGYGSIVQQCAEAASMLR  615

Query  652   TRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGN  473
             T+ + VTVADARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHV+ F++  G+LDG 
Sbjct  616   TQDISVTVADARFCKPLDTNLIRQLAKEHEILITVEEGSIGGFGSHVSHFLSSTGILDGP  675

Query  472   LKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             LK R +VLPDRYIDHG+P DQ+ EAGLT +HI ATV ++LGK +EAL
Sbjct  676   LKLRTMVLPDRYIDHGSPQDQIQEAGLTSNHITATVLSMLGKPKEAL  722



>ref|XP_002271585.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Vitis vinifera]
 emb|CBI17766.3| unnamed protein product [Vitis vinifera]
Length=735

 Score =   998 bits (2580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/654 (73%), Positives = 560/654 (86%), Gaps = 0/654 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
              +  ++P TP+LDTINYPIH KNLS+ EL  LA ELR ++++ VSKTGGHL SSLGV EL
Sbjct  80    NFSGEKPSTPVLDTINYPIHTKNLSIGELETLAAELREEIVYTVSKTGGHLSSSLGVAEL  139

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             T+ALH+VFN P D+I+WDVGHQ+Y HKILTGRR +M TIRQT GLAGF KR ES YD FG
Sbjct  140   TIALHHVFNTPDDRIIWDVGHQAYAHKILTGRRSRMHTIRQTCGLAGFPKRDESIYDAFG  199

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAVGRDL G+ N+VI+VIGDGAMTAGQAYEAMNNAGYLDS++I+ILN
Sbjct  200   AGHSSTSISAGLGMAVGRDLLGKNNHVISVIGDGAMTAGQAYEAMNNAGYLDSNLIIILN  259

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DN QVSLPTAT+DGP PPVGALS AL+ LQS+R  R+LRE AKG TKQ+GG  HE+AAKV
Sbjct  260   DNGQVSLPTATVDGPAPPVGALSKALTNLQSSRKFRQLREAAKGFTKQVGGQAHEIAAKV  319

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             DEY RGM+ GS + LFEELGLYYIGPVDGHN++DLV IL++V++    GPVL+HV+TEKG
Sbjct  320   DEYMRGMVGGSNACLFEELGLYYIGPVDGHNVEDLVHILKKVRAMPAPGPVLVHVITEKG  379

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GY  AE AADK HGV KFD  +GKQ K  +KT+SYT YFAE+LIAEAE D++I+AIHAA
Sbjct  380   KGYAPAEVAADKMHGVVKFDAMSGKQLKTKSKTRSYTQYFAESLIAEAERDENIIAIHAA  439

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLNLFQ+ FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR +DQV H
Sbjct  440   MGGGTGLNLFQKHFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGFDQVAH  499

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD TFMACLPNMVVMAPS E+EL HMVATAA
Sbjct  500   DVDLQKLPVRFAMDRAGLVGADGPTHCGAFDTTFMACLPNMVVMAPSCESELMHMVATAA  559

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC RYPRGNG+G +LP  NKGTPLE+G+GR+L EG RVA++GYGT VQ+CL+A+
Sbjct  560   AIDDRPSCFRYPRGNGIGSILPQNNKGTPLEIGKGRVLKEGSRVAILGYGTVVQNCLAAS  619

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              LL+  G+  TVADARFCKPLD  LIR LA+ HEV+ITVEEGSIGGF SHV+ F+ L+GL
Sbjct  620   KLLQVLGVSTTVADARFCKPLDGDLIRQLAQEHEVLITVEEGSIGGFSSHVSHFLGLNGL  679

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             LDG LKWRP++LPDRYI+HG+  +Q+ EAGL+  HIAATV +++G+ +++L ++
Sbjct  680   LDGTLKWRPMMLPDRYINHGSQTEQVEEAGLSSRHIAATVLSLIGENKDSLHLL  733



>ref|XP_004250162.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Solanum lycopersicum]
Length=714

 Score =   998 bits (2580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/695 (70%), Positives = 577/695 (83%), Gaps = 17/695 (2%)
 Frame = -2

Query  2359  FQQKPSQINYKKRSSGVQASLADKDE-----------------YYSQRPPTPLLDTINYP  2231
             + + P   N+ K+   V+AS+   DE                 +  ++PPTP LDTINYP
Sbjct  19    YMKTPRFYNFTKKKFLVKASVNGSDEINGKIVRKEEKDSLQIDFSGEKPPTPFLDTINYP  78

Query  2230  IHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWD  2051
              HMKNLS  +L QLA ELR++++++V+KTGGHL SSLGVV+LTVALH+VF+ P+DKI+WD
Sbjct  79    KHMKNLSKMDLEQLAAELRAEIVYSVAKTGGHLSSSLGVVDLTVALHHVFDTPEDKIIWD  138

Query  2050  VGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGR  1871
             VGHQ+Y HKILTGRR KM T+R+T+GLA F KR ES +D FG GHSST+ISAGLGMAV R
Sbjct  139   VGHQAYAHKILTGRRSKMHTMRKTSGLAPFPKRDESVHDAFGAGHSSTSISAGLGMAVAR  198

Query  1870  DLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPP  1691
             DL G  N+VI+VIGDGAMTAGQAYEAMNNAG+LDS++IVILNDNKQVSLPTATLDGP  P
Sbjct  199   DLLGNNNHVISVIGDGAMTAGQAYEAMNNAGFLDSNLIVILNDNKQVSLPTATLDGPATP  258

Query  1690  VGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEE  1511
             VGALSSALS+LQ++   R+LRE AK +TKQIG   HE+AAKVDEYARGM+S SGSTLFEE
Sbjct  259   VGALSSALSKLQASLKFRQLREAAKTITKQIGPQAHEVAAKVDEYARGMLSASGSTLFEE  318

Query  1510  LGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTK  1331
             LGLYYIGPVDGHNI+DL++IL++VK+    GPVLIH+VTEKG+GY  AE A DK HGV +
Sbjct  319   LGLYYIGPVDGHNIEDLITILEKVKALPAPGPVLIHIVTEKGKGYLPAEAADDKMHGVAQ  378

Query  1330  FDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRC  1151
             FDP TGKQFKA + T +YT YFAE+LI EAE D  IVAIHAAMGGGTGLN FQ++FP RC
Sbjct  379   FDPKTGKQFKAKSPTLTYTQYFAESLIKEAENDNKIVAIHAAMGGGTGLNYFQKQFPERC  438

Query  1150  FDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGL  971
             FDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGL
Sbjct  439   FDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGL  498

Query  970   VGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvg  791
             VG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAEL HMVATAAAIDDRPSC R+PRGNG+G
Sbjct  499   VGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELMHMVATAAAIDDRPSCFRFPRGNGIG  558

Query  790   vvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFC  611
              +LP  NKG P+EVG+GRIL EGERVA++GYG+ +Q CL AA +L +  +RVTVADARFC
Sbjct  559   AILPLNNKGIPIEVGKGRILREGERVAILGYGSIIQQCLGAADILNSHDIRVTVADARFC  618

Query  610   KPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYID  431
             KPLD  LIRSLAK HE++ITVEEGSIGGFGSHV+ F++L+ +LDG LK R ++LPDRYID
Sbjct  619   KPLDADLIRSLAKEHEILITVEEGSIGGFGSHVSHFLSLNSILDGPLKLRSMLLPDRYID  678

Query  430   HGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             HG+P DQ+  AGL+  HI++TV  +LG+ +EA+ +
Sbjct  679   HGSPVDQIEAAGLSSRHISSTVLTLLGRPKEAMVV  713



>gb|AEZ55686.1| putative 1-deoxy-D-xylulose 5-phosphate synthase of [Salvia miltiorrhiza]
Length=713

 Score =   998 bits (2580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/653 (74%), Positives = 561/653 (86%), Gaps = 0/653 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
             ++  ++P TP+LDTIN+PIHMKNLS KEL QLA ELR +++  V+KTGGHL SSLGVVEL
Sbjct  60    DFSGEKPATPMLDTINHPIHMKNLSKKELEQLAAELRVEIVHTVAKTGGHLSSSLGVVEL  119

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TVALH+VFN P DK++WDVGHQ+Y HKILTGRR KM TIRQT+GLAGF KR ES +D FG
Sbjct  120   TVALHHVFNTPHDKLIWDVGHQAYGHKILTGRRSKMHTIRQTSGLAGFPKRDESVHDAFG  179

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAV RDL G+ N+V++VIGDGAMTAGQAYEAMNNAG+LDS++I++LN
Sbjct  180   VGHSSTSISAGLGMAVARDLLGKDNSVVSVIGDGAMTAGQAYEAMNNAGFLDSNLIIVLN  239

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DNKQVSLPTATLDGP  PVGALSSAL++LQ++   R+LRE AK +TKQIG   HE+AAKV
Sbjct  240   DNKQVSLPTATLDGPATPVGALSSALTKLQASPKFRQLREAAKSITKQIGPQAHEVAAKV  299

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             DEYARGM+S SGST FEELGLYYIGPVDGHNIDDLV+I Q+VKS    GPVLIH+VTEKG
Sbjct  300   DEYARGMLSASGSTFFEELGLYYIGPVDGHNIDDLVTIFQKVKSMPAPGPVLIHIVTEKG  359

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GYP AE AAD+ HGV KFDP TGKQ KA + T SYT YFAE+LI EAEAD  IVAIHAA
Sbjct  360   KGYPPAEAAADRMHGVVKFDPCTGKQNKAKSSTLSYTQYFAESLIREAEADSKIVAIHAA  419

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFC IYSSF+QR YDQVVH
Sbjct  420   MGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCTIYSSFLQRGYDQVVH  479

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFAMDRAGLVG+DGPTHCG+FDVT+MACLPNMVVMAPSDEAEL HMVATAA
Sbjct  480   DVDLQKLPVRFAMDRAGLVGADGPTHCGSFDVTYMACLPNMVVMAPSDEAELIHMVATAA  539

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC R+PRGNGVG  LP  NKGTP+E+G+GRI+MEG RVA++GYG AVQ C+ AA
Sbjct  540   AIDDRPSCFRFPRGNGVGAPLPYNNKGTPIEIGKGRIVMEGSRVAILGYGAAVQQCIGAA  599

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              +L++  +  T+ DARFCKPLD  LI  LAK HE++ITVEEGSIGGFGSHV+ F++L+GL
Sbjct  600   EMLKSYDIAPTLVDARFCKPLDTHLITRLAKEHEILITVEEGSIGGFGSHVSHFLSLNGL  659

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             LDG+LK R ++LPDRYI+HGAP DQ+ EAGLT  HI  TV +++G+  EAL++
Sbjct  660   LDGHLKLRSMMLPDRYIEHGAPQDQIEEAGLTSRHICGTVLSLVGRPMEALKL  712



>gb|AAT97962.1| putative 1-deoxy-D-xylulose 5-phosphate synthase 2 [Solanum habrochaites]
Length=714

 Score =   998 bits (2580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/695 (70%), Positives = 575/695 (83%), Gaps = 17/695 (2%)
 Frame = -2

Query  2359  FQQKPSQINYKKRSSGVQASLADKDE-----------------YYSQRPPTPLLDTINYP  2231
             + + P   N+ K+   V+AS+   DE                 +  ++PPTP LDTINYP
Sbjct  19    YMKTPRFYNFTKKKFLVKASVNGSDEINGKIVRKEEKDSLQIDFSGEKPPTPFLDTINYP  78

Query  2230  IHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWD  2051
              HMKNLS  +L QLA ELR++++++V+ TGGHL SSLGVV+LTVALH+VF+ P+DKI+WD
Sbjct  79    KHMKNLSKMDLEQLAAELRAEIVYSVANTGGHLSSSLGVVDLTVALHHVFDTPEDKIIWD  138

Query  2050  VGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGR  1871
             VGHQ+Y HKILTGRR KM T+R+T+GLA F KR ES +D FG GHSST+ISAGLGMAV R
Sbjct  139   VGHQAYAHKILTGRRSKMHTMRKTSGLAPFPKRDESAHDAFGAGHSSTSISAGLGMAVAR  198

Query  1870  DLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPP  1691
             DL G  N+VI+VIGDGAMTAGQAYEAMNNAG+LDS++IVILNDNKQVSLPTATLDGP  P
Sbjct  199   DLLGNNNHVISVIGDGAMTAGQAYEAMNNAGFLDSNLIVILNDNKQVSLPTATLDGPATP  258

Query  1690  VGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEE  1511
             VGALSSALS+LQ++   R+LRE AK +TKQIG   HE+AAKVDEYARGM+S SGSTLFEE
Sbjct  259   VGALSSALSKLQASLKFRQLREAAKTITKQIGPQAHEVAAKVDEYARGMLSASGSTLFEE  318

Query  1510  LGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTK  1331
             LGLYYIGPVDGHNI+DL++IL++VK     GPVLIH+VTEKG+GY  AE A DK HGV +
Sbjct  319   LGLYYIGPVDGHNIEDLITILEKVKEMPAPGPVLIHIVTEKGKGYLPAEAADDKMHGVAQ  378

Query  1330  FDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRC  1151
             FDP TGKQFKA + T SYT YFAE+LI EAE D  IVAIHAAMGGGTGLN FQ++FP RC
Sbjct  379   FDPKTGKQFKAKSPTLSYTRYFAESLIKEAENDNKIVAIHAAMGGGTGLNYFQKQFPERC  438

Query  1150  FDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGL  971
             FDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGL
Sbjct  439   FDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGL  498

Query  970   VGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvg  791
             VG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAEL HMVATAAAIDDRPSC R+PRGNG+G
Sbjct  499   VGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELMHMVATAAAIDDRPSCFRFPRGNGIG  558

Query  790   vvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFC  611
              +LP  NKG P+EVG+GRIL EGERVA++GYG+ +Q CL AA +L +  +RVTVADARFC
Sbjct  559   AILPLNNKGIPIEVGKGRILREGERVAILGYGSIIQQCLGAADILNSHNVRVTVADARFC  618

Query  610   KPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYID  431
             KPLD  LIRSLAK HE++ITVEEGSIGGFGSHV+ F++L+ +LDG LK R ++LPDRYID
Sbjct  619   KPLDADLIRSLAKEHEILITVEEGSIGGFGSHVSHFLSLNSILDGPLKLRSMLLPDRYID  678

Query  430   HGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             HG+P DQ+  AGL+  HI++TV  +LG+ +EA+ +
Sbjct  679   HGSPVDQIEAAGLSSRHISSTVLTLLGRPKEAMVV  713



>ref|XP_003552082.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic-like isoform X1 [Glycine max]
Length=714

 Score =   998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/653 (74%), Positives = 561/653 (86%), Gaps = 0/653 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K  Y  ++P T LLDTINYPIHMKNLS ++L QLA ELR+D++  VS TGGHL SSLGVV
Sbjct  59    KINYAGEKPATLLLDTINYPIHMKNLSTQDLEQLAAELRADIVHTVSNTGGHLSSSLGVV  118

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL VALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR ES +D 
Sbjct  119   ELAVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKRDESIHDA  178

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ N++I+VIGDGA+TAGQAYEAMNNAG+LDS+MIV+
Sbjct  179   FGVGHSSTSISAGLGMAVARDLLGKNNSIISVIGDGALTAGQAYEAMNNAGFLDSNMIVV  238

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSALS++Q++   R+LRE AK +TKQIG   H++AA
Sbjct  239   LNDNKQVSLPTATLDGPASPVGALSSALSKIQASAEFRKLREAAKSITKQIGKQTHQVAA  298

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARG+ISGS  T FEELGLYYIGPVDGH I+DLV+I ++VK+    GPVLIH VTE
Sbjct  299   KVDEYARGIISGSACTFFEELGLYYIGPVDGHKIEDLVTIFEKVKAMPAPGPVLIHCVTE  358

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AEKA+DK HGV KFDP TG+QFKA + T SYT YFAE+LI EAE DK IVAIH
Sbjct  359   KGKGYPPAEKASDKMHGVVKFDPKTGEQFKAKSSTLSYTQYFAESLIKEAENDKKIVAIH  418

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN F +RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  419   AAMGGGTGLNYFHKRFPERCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  478

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVAT
Sbjct  479   VHDVDLQKLPVRFALDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVAT  538

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G  LP  NKGTPLE+G+GRIL+EG R+A++GYG+ VQ C  
Sbjct  539   AAAIDDRPSCFRFPRGNGIGATLPLNNKGTPLEIGKGRILVEGSRIAILGYGSVVQQCRQ  598

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             A+ +L+  G+ VTVADARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHV+QF++L 
Sbjct  599   ASEMLKELGVDVTVADARFCKPLDTGLIRLLAKEHEILITVEEGSIGGFGSHVSQFLSLS  658

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             G+LDG LKWR ++LPDRYI+HG+P  Q+ +AGL+  HIAATV +++ + ++AL
Sbjct  659   GILDGPLKWRAMMLPDRYIEHGSPQAQVEDAGLSSKHIAATVLSLMERPKQAL  711



>gb|AIX87492.1| 1-deoxy-D-xylulose 5-phosphate-synthase 2 [Lycium barbarum]
Length=712

 Score =   997 bits (2578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/653 (74%), Positives = 562/653 (86%), Gaps = 0/653 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
             ++   +PPTP LDTINYP+HMKNLS  +L  LA ELR++++++V+KTGGHL SSLGVV+L
Sbjct  59    DFSGDKPPTPFLDTINYPMHMKNLSKLDLEHLAAELRAEIVYSVAKTGGHLSSSLGVVDL  118

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TVALH+VF+ P+DKI+WDVGHQ+Y HKILTGRR KM TIR+T+GLA F KR ES YD FG
Sbjct  119   TVALHHVFDTPEDKIIWDVGHQAYAHKILTGRRSKMHTIRKTSGLAPFPKRDESVYDAFG  178

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAV RDL G+ N+VI++IGDG+MTAGQAYEA+NNAG+LDS++IVILN
Sbjct  179   AGHSSTSISAGLGMAVARDLLGKNNHVISIIGDGSMTAGQAYEALNNAGFLDSNLIVILN  238

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DN+QVSLPTATLDGP  PVGALS ALS+LQ++R  R+LRE AK +TKQIG   HE+AAKV
Sbjct  239   DNEQVSLPTATLDGPATPVGALSGALSKLQASRKFRQLREAAKSITKQIGPQAHEVAAKV  298

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             DEYARGMIS SGSTLFEELGLYYIGPVDGHNI+DL+SILQ+VKS    GPVLIH+VTEKG
Sbjct  299   DEYARGMISASGSTLFEELGLYYIGPVDGHNIEDLISILQKVKSMPAPGPVLIHIVTEKG  358

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GYP AE AADK HGV +FDP TG+QFKA + T SYT YFAE+LI EAE D  IVAIHAA
Sbjct  359   KGYPPAEAAADKMHGVAQFDPKTGQQFKAKSPTLSYTQYFAESLIKEAENDDKIVAIHAA  418

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  419   MGGGTGLNYFQKRFPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVH  478

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +M CLPNMVVMAPSDEAEL HMVATAA
Sbjct  479   DVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMTCLPNMVVMAPSDEAELMHMVATAA  538

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AI DRPSC R+PRGNG+G VLP  NKG P+EVG+GRIL EGERVA++GYG+ VQ CL AA
Sbjct  539   AIHDRPSCFRFPRGNGIGAVLPQNNKGIPIEVGKGRILREGERVAILGYGSIVQQCLGAA  598

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              + ++  +R+TVADARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHVA F++L+ +
Sbjct  599   DISQSHNVRITVADARFCKPLDADLIRRLAKEHEILITVEEGSIGGFGSHVAHFLSLNSI  658

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             LDG LK R +VLPDRYIDHG+P DQ+  AGL+  HI+AT+  +LG+ +EA+ +
Sbjct  659   LDGPLKLRSMVLPDRYIDHGSPLDQIEAAGLSSRHISATILTLLGRPKEAMVV  711



>gb|KHG25453.1| putative 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Gossypium arboreum]
Length=666

 Score =   997 bits (2578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/652 (74%), Positives = 562/652 (86%), Gaps = 0/652 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++P TPLLDTINYP+HMKNLS +EL QLA E+R+D++  VSKTGGHL SSLGVV
Sbjct  11    KIDFSGKKPATPLLDTINYPLHMKNLSTRELEQLAAEVRADIVHTVSKTGGHLSSSLGVV  70

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELT+ALH+VF+ P DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR ES YD 
Sbjct  71    ELTIALHHVFDTPDDKIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKRDESVYDA  130

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL  +KNNVI+VIGDGAMTAG AYEAMNNAG+LDS++IV+
Sbjct  131   FGAGHSSTSISAGLGMAVARDLLKKKNNVISVIGDGAMTAGLAYEAMNNAGFLDSNLIVV  190

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATL GP  PVGAL+ AL+++Q++   R+LRE AKG+TKQIGG  HE+AA
Sbjct  191   LNDNKQVSLPTATLQGPATPVGALTRALTKIQASAEFRKLREKAKGLTKQIGGQTHEIAA  250

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGSTLFEELGLYYIGPVDGHNI+DLV++ ++VK+    GPVLIH+VTE
Sbjct  251   KVDEYARGMISASGSTLFEELGLYYIGPVDGHNIEDLVAMFEKVKAMPAPGPVLIHIVTE  310

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE A DK HGV  FD  TGKQFK+ + T SYT YFAE+LI EAEAD  IVAIH
Sbjct  311   KGKGYPPAEAAIDKMHGVVNFDMETGKQFKSKSSTLSYTQYFAESLIKEAEADDKIVAIH  370

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN F +RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  371   AAMGGGTGLNFFHKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  430

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL H VAT
Sbjct  431   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHTVAT  490

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+GVV+P   KGTPLE+G+GRI+MEG RVA++GYG+ VQ C+ 
Sbjct  491   AAAIDDRPSCFRFPRGNGLGVVIPHDYKGTPLEIGKGRIIMEGNRVAILGYGSIVQQCIE  550

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA +L ++ + +TVADARFCKPLD  LI+ LA  HE++ITVEEGSIGGFGSHV+ F++L 
Sbjct  551   AANMLRSQNIYITVADARFCKPLDRDLIKQLANEHEILITVEEGSIGGFGSHVSHFLSLT  610

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREA  335
             G+LDG LK R +VLPDRYIDHG+P DQ+ EAGL+  HI+ATV ++LG+ ++A
Sbjct  611   GILDGPLKLRAMVLPDRYIDHGSPQDQIEEAGLSSRHISATVQSMLGRPKQA  662



>emb|CAZ66649.1| 1-deoxy-D-xylulose 5-phosphate synthase 2 precursor [Solanum 
lycopersicum]
Length=714

 Score =   997 bits (2578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/695 (70%), Positives = 575/695 (83%), Gaps = 17/695 (2%)
 Frame = -2

Query  2359  FQQKPSQINYKKRSSGVQASLADKDE-----------------YYSQRPPTPLLDTINYP  2231
             + + P   N+ K+   V+AS+   DE                 +  ++PPTP LDTINYP
Sbjct  19    YMKTPRFYNFTKKKFLVKASVNGSDEINGKIVRKEEKDSLQIDFSGEKPPTPFLDTINYP  78

Query  2230  IHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWD  2051
              HMKNLS  +L QLA ELR++++++V+KTGGHL SSLGVV+LTVALH+VF+ P+DKI+WD
Sbjct  79    KHMKNLSKMDLEQLAAELRAEIVYSVAKTGGHLSSSLGVVDLTVALHHVFDTPEDKIIWD  138

Query  2050  VGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGR  1871
             VGHQ+Y HKILTGRR KM T+R+T+GLA F KR ES +D FG GHSST+ISAGLGMAV R
Sbjct  139   VGHQAYAHKILTGRRSKMHTMRKTSGLAPFPKRDESVHDAFGAGHSSTSISAGLGMAVAR  198

Query  1870  DLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPP  1691
             DL G  N+VI+VIGDGAMTAGQAYEAMNNAG+LDS++IVILNDNKQVSLPTATLDGP  P
Sbjct  199   DLLGNNNHVISVIGDGAMTAGQAYEAMNNAGFLDSNLIVILNDNKQVSLPTATLDGPATP  258

Query  1690  VGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEE  1511
             VGALSSALS+LQ++   R+LRE AK +TKQIG   HE+AAKVDEYARGM+S SGSTLFEE
Sbjct  259   VGALSSALSKLQASLKFRQLREAAKTITKQIGPQAHEVAAKVDEYARGMLSASGSTLFEE  318

Query  1510  LGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTK  1331
             LGLYYIGPVDGHNI+DL++IL++VK+    GPVLIH+VTEKG+GY  AE A DK HGV +
Sbjct  319   LGLYYIGPVDGHNIEDLITILEKVKALPAPGPVLIHIVTEKGKGYLPAEAADDKMHGVAQ  378

Query  1330  FDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRC  1151
             FDP TGKQFKA + T +YT YFAE+LI EAE D  IVAIHAAMGGGTGLN FQ++FP RC
Sbjct  379   FDPKTGKQFKAKSPTLTYTQYFAESLIKEAENDNKIVAIHAAMGGGTGLNYFQKQFPERC  438

Query  1150  FDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGL  971
             FDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGL
Sbjct  439   FDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGL  498

Query  970   VGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvg  791
             VG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAEL HMVATAAAIDDRPSC R+PRGNG+G
Sbjct  499   VGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELMHMVATAAAIDDRPSCFRFPRGNGIG  558

Query  790   vvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFC  611
              +L   NKG P+EVG+GRIL EGERVA++GYG+ +Q CL AA +L +  +RV VADARFC
Sbjct  559   AILSLNNKGIPIEVGKGRILREGERVAILGYGSIIQQCLGAADILNSHDIRVAVADARFC  618

Query  610   KPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYID  431
             KPLD  LIRSLAK HE++ITVEEGSIGGFGSHV+ F++L+ +LDG LK R ++LPDRYID
Sbjct  619   KPLDADLIRSLAKEHEILITVEEGSIGGFGSHVSHFLSLNSILDGPLKLRSMLLPDRYID  678

Query  430   HGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             HG+P DQ+  AGL+  HI++TV  +LG+ +EA+ +
Sbjct  679   HGSPVDQIEAAGLSSRHISSTVLTLLGRPKEAMVV  713



>ref|XP_006602444.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic-like isoform X2 [Glycine max]
Length=719

 Score =   997 bits (2577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/653 (74%), Positives = 561/653 (86%), Gaps = 0/653 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K  Y  ++P T LLDTINYPIHMKNLS ++L QLA ELR+D++  VS TGGHL SSLGVV
Sbjct  64    KINYAGEKPATLLLDTINYPIHMKNLSTQDLEQLAAELRADIVHTVSNTGGHLSSSLGVV  123

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL VALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR ES +D 
Sbjct  124   ELAVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKRDESIHDA  183

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ N++I+VIGDGA+TAGQAYEAMNNAG+LDS+MIV+
Sbjct  184   FGVGHSSTSISAGLGMAVARDLLGKNNSIISVIGDGALTAGQAYEAMNNAGFLDSNMIVV  243

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSALS++Q++   R+LRE AK +TKQIG   H++AA
Sbjct  244   LNDNKQVSLPTATLDGPASPVGALSSALSKIQASAEFRKLREAAKSITKQIGKQTHQVAA  303

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARG+ISGS  T FEELGLYYIGPVDGH I+DLV+I ++VK+    GPVLIH VTE
Sbjct  304   KVDEYARGIISGSACTFFEELGLYYIGPVDGHKIEDLVTIFEKVKAMPAPGPVLIHCVTE  363

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AEKA+DK HGV KFDP TG+QFKA + T SYT YFAE+LI EAE DK IVAIH
Sbjct  364   KGKGYPPAEKASDKMHGVVKFDPKTGEQFKAKSSTLSYTQYFAESLIKEAENDKKIVAIH  423

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN F +RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  424   AAMGGGTGLNYFHKRFPERCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  483

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVAT
Sbjct  484   VHDVDLQKLPVRFALDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVAT  543

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG+G  LP  NKGTPLE+G+GRIL+EG R+A++GYG+ VQ C  
Sbjct  544   AAAIDDRPSCFRFPRGNGIGATLPLNNKGTPLEIGKGRILVEGSRIAILGYGSVVQQCRQ  603

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             A+ +L+  G+ VTVADARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHV+QF++L 
Sbjct  604   ASEMLKELGVDVTVADARFCKPLDTGLIRLLAKEHEILITVEEGSIGGFGSHVSQFLSLS  663

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             G+LDG LKWR ++LPDRYI+HG+P  Q+ +AGL+  HIAATV +++ + ++AL
Sbjct  664   GILDGPLKWRAMMLPDRYIEHGSPQAQVEDAGLSSKHIAATVLSLMERPKQAL  716



>ref|XP_007047749.1| UDP-glucose pyrophosphorylase 3 isoform 1 [Theobroma cacao]
 gb|EOX91906.1| UDP-glucose pyrophosphorylase 3 isoform 1 [Theobroma cacao]
Length=711

 Score =   997 bits (2577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/655 (73%), Positives = 562/655 (86%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K +++ ++P TPLLD I YP+HMKNLS ++L QLA ELR+D++  VS+TGGHL SSLGVV
Sbjct  56    KIDFFGKKPATPLLDIIKYPVHMKNLSTRDLEQLAAELRADIVHTVSETGGHLSSSLGVV  115

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P+DKI+WDVGHQ+Y HKILTGRR +M TIR+T+GLAGF KR ES YD 
Sbjct  116   ELTVALHHVFNTPEDKIIWDVGHQAYAHKILTGRRSRMHTIRKTSGLAGFPKRDESVYDA  175

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+KNNV++VIGDGAMTAG A+EAMNNAG+LD+++IVI
Sbjct  176   FGAGHSSTSISAGLGMAVARDLLGKKNNVVSVIGDGAMTAGLAFEAMNNAGFLDANLIVI  235

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALS A +++Q++  LR+LRE AK + KQIG   HELAA
Sbjct  236   LNDNKQVSLPTATLDGPSTPVGALSRAFTKIQASTKLRKLREKAKDLAKQIGVQAHELAA  295

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             K+DEYARGMIS SGSTLFEELGLYYIGPV+GHNI+DLV I ++VK+    GPVLIH+VTE
Sbjct  296   KIDEYARGMISASGSTLFEELGLYYIGPVNGHNIEDLVLIFEKVKAMPAPGPVLIHIVTE  355

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE +ADK HGV KFD  TGKQFK  + T SYT YFAE+LI EAE D  IVAIH
Sbjct  356   KGKGYPPAEASADKMHGVVKFDTKTGKQFKPKSSTLSYTQYFAESLIKEAEDDDKIVAIH  415

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  416   AAMGGGTGLNFFQKRFPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  475

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVAT
Sbjct  476   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVAT  535

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNG GV LPP  KGTPLE+GRGRI+MEG RVA++GYG+ +Q C+ 
Sbjct  536   AAAIDDRPSCFRFPRGNGTGVALPPNYKGTPLEIGRGRIIMEGNRVAILGYGSIIQQCIE  595

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             AA +L ++ + +TVADARFCKPLD  LI+ LA  HE++ITVEEGSIGGFGSHV+ F++L 
Sbjct  596   AAHVLRSQDIYITVADARFCKPLDRDLIKQLAHEHEILITVEEGSIGGFGSHVSHFLSLT  655

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             G+LDG+LK R +VLPDRYIDHG+P DQ+ EAGL+  HIA TV ++LG+ +EAL+ 
Sbjct  656   GILDGSLKLRAMVLPDRYIDHGSPKDQIEEAGLSSRHIATTVLSMLGRPKEALQF  710



>ref|XP_010027965.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Eucalyptus grandis]
 gb|KCW54619.1| hypothetical protein EUGRSUZ_I00566 [Eucalyptus grandis]
Length=729

 Score =   995 bits (2573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/660 (73%), Positives = 568/660 (86%), Gaps = 4/660 (1%)
 Frame = -2

Query  2293  DKDEYY----SQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGS  2126
             +KD++Y      +P TPLLDT+NYP+HMKNLS  +L QLA ELR++++ +VSKTGGHL +
Sbjct  69    EKDKWYVDFSGDKPATPLLDTVNYPVHMKNLSPPDLEQLAAELRAEIVHSVSKTGGHLSA  128

Query  2125  SLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSE  1946
             SLGVVELTVALH VFNAP+DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR E
Sbjct  129   SLGVVELTVALHNVFNAPEDKIVWDVGHQTYPHKILTGRRTRMHTIRKTSGLAGFPKRDE  188

Query  1945  SEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDS  1766
             S YD FG GHSST+ISAGLGMAVGRDL G+ NNVIAVIGDGAMTAGQAYEAMNNAG+LDS
Sbjct  189   SVYDTFGVGHSSTSISAGLGMAVGRDLLGKNNNVIAVIGDGAMTAGQAYEAMNNAGFLDS  248

Query  1765  DMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM  1586
             ++IV+LNDNKQVSLPTATLDGP  PVGALSSAL++LQ++   R+LRE AK VTKQIGG  
Sbjct  249   NLIVVLNDNKQVSLPTATLDGPATPVGALSSALTKLQASTNFRKLREAAKSVTKQIGGST  308

Query  1585  HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLI  1406
             HE+AAKVDEYARG+IS SGST FEELGLYYIGPVDGH+++DLV+I Q+VK+    GPVLI
Sbjct  309   HEVAAKVDEYARGLISASGSTFFEELGLYYIGPVDGHSVEDLVTIFQKVKAMPAPGPVLI  368

Query  1405  HVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKD  1226
             H+VTEKG+GYP AE A+DK HGV KFDP TGKQFK  + T S+T YF E+LI EAE D  
Sbjct  369   HIVTEKGKGYPPAEAASDKMHGVVKFDPRTGKQFKTKSPTLSHTQYFVESLIKEAEDDNK  428

Query  1225  IVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQR  1046
             IVAIHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR
Sbjct  429   IVAIHAAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQR  488

Query  1045  AYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELF  866
              YDQVVHDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL 
Sbjct  489   GYDQVVHDVDLQKLPVRFALDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDEAELM  548

Query  865   HMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAV  686
             HMVATAA+IDDRPSC R+PRGNGVGV LPP NKG P+++G+GRIL EG RVA++GYG+ V
Sbjct  549   HMVATAASIDDRPSCFRFPRGNGVGVPLPPNNKGIPIKIGKGRILKEGSRVAILGYGSIV  608

Query  685   QSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQ  506
             Q C++AA +L++  + +T+ADARFCKPLD  LI  LA  HE++ITVEEGS+GGFGSHV+ 
Sbjct  609   QQCIAAANMLKSIDIDITIADARFCKPLDTDLITQLANHHEMLITVEEGSVGGFGSHVSH  668

Query  505   FMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             F++L G+LDG LK R +VLPDRYI+HGAP DQ+ +AGL+  HI AT+ ++LG+ +EA + 
Sbjct  669   FLSLSGILDGPLKLRAMVLPDRYIEHGAPQDQIEQAGLSSKHICATILSLLGRQKEAFQF  728



>gb|EPS72779.1| 1-deoxyxylulose 5-phosphate synthase, partial [Genlisea aurea]
Length=674

 Score =   995 bits (2573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/657 (74%), Positives = 564/657 (86%), Gaps = 2/657 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K  Y  ++P TPLLDTIN+PIHMKNLS+K+L QLA+ELR ++++ V++TGGHL SSLGVV
Sbjct  17    KISYSGEKPATPLLDTINFPIHMKNLSIKDLEQLASELREEIVYTVAQTGGHLSSSLGVV  76

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             ELTVALH+VFN P+D+++WDVGHQ+Y HKILTGRR +MPTIR+T+GLAGF KR ES YD 
Sbjct  77    ELTVALHHVFNTPEDRLVWDVGHQAYGHKILTGRRSRMPTIRKTSGLAGFPKREESNYDA  136

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAVGRDL G++NNVIAVIGDGAMTAGQAYEAMNNAG+LDS++IVI
Sbjct  137   FGVGHSSTSISAGLGMAVGRDLLGKENNVIAVIGDGAMTAGQAYEAMNNAGFLDSNLIVI  196

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALS+AL++LQ++   R LRE AK +TKQIG   HE+AA
Sbjct  197   LNDNKQVSLPTATLDGPAKPVGALSAALTKLQASPKFRLLREAAKNITKQIGSQTHEMAA  256

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             K DEYARGM+S SG+ LFEELGLYYIGPVDGHNIDDL+++L++VKS    GPVLIHVVTE
Sbjct  257   KADEYARGMLSASGAMLFEELGLYYIGPVDGHNIDDLITVLEKVKSMPAPGPVLIHVVTE  316

Query  1390  KGRGYPYAEKAADKYH-GVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAI  1214
             KG+GYP AE A D+ H GV KFDP+TGKQ K    T SYT YFA+ LI EAE+D  IVAI
Sbjct  317   KGKGYPPAEAAPDRMHAGVVKFDPSTGKQKKEKTPTLSYTQYFAQGLIKEAESDDKIVAI  376

Query  1213  HAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQ  1034
             HAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLACEGLKPFCAIYSSF+QR YDQ
Sbjct  377   HAAMGGGTGLNYFQKRFPERCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRGYDQ  436

Query  1033  VVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVA  854
             VVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDV +MACLPNMVVMAPSDE+EL HMVA
Sbjct  437   VVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPSDESELIHMVA  496

Query  853   TAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGER-VALVGYGTAVQSC  677
             TAAAIDDRPSC R+PRGNGVG VLPP NKGTPL++G+GR++MEG   VA++GYGT +Q C
Sbjct  497   TAAAIDDRPSCFRFPRGNGVGAVLPPDNKGTPLQIGKGRVVMEGNHGVAILGYGTMLQQC  556

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L AA +L   G+ VTVADARFCKPLD  L+R LAK H  +ITVEEGSIGGFGSHV  F++
Sbjct  557   LEAAEMLVAHGVTVTVADARFCKPLDTDLVRRLAKEHHTLITVEEGSIGGFGSHVCHFLS  616

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             L G+LDG LK+R +VLPDRYIDHGAPADQ+  AGL+  HI ATV +++G+  EA ++
Sbjct  617   LAGILDGPLKFRSMVLPDRYIDHGAPADQMEAAGLSSRHICATVLSLVGRPMEAFKL  673



>emb|CAC08458.1| 1-D-desoxyxylulose 5-phosphate synthase (DXS) [Narcissus pseudonarcissus]
Length=709

 Score =   994 bits (2571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/693 (70%), Positives = 570/693 (82%), Gaps = 5/693 (1%)
 Frame = -2

Query  2404  PFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIH  2225
             PFSS    G      F    S    +++ S  +     K  Y  ++P  PLLDTIN P H
Sbjct  21    PFSSSACRG-----QFHVGASGSEGERKLSVKKEKNTSKIVYSGEKPAVPLLDTINDPAH  75

Query  2224  MKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVG  2045
             MKNLS ++L QLA+ELR D++ +VSKTGGHL +SLGVV+LTV LH+VF+ P DKI+WDVG
Sbjct  76    MKNLSTQDLEQLASELRLDIVHSVSKTGGHLSASLGVVDLTVVLHHVFDTPDDKIIWDVG  135

Query  2044  HQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDL  1865
             HQ+Y HKILTGRR +M T+RQT+GLAGF KR ES +D FG GHSST+ISAGLGMAV RDL
Sbjct  136   HQAYAHKILTGRRSRMHTLRQTSGLAGFPKRDESVHDAFGAGHSSTSISAGLGMAVARDL  195

Query  1864  KGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVG  1685
              G+ N+VI+VIGDG MTAGQAYEAMNN GYLDS++IV+LNDNKQVSLPTATL+GP  PVG
Sbjct  196   LGKSNHVISVIGDGVMTAGQAYEAMNNVGYLDSNLIVVLNDNKQVSLPTATLNGPATPVG  255

Query  1684  ALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELG  1505
             ALS AL++LQ++   R+LRE AK +TKQIGG  HE+AAKVDEYARGMIS SG++LFEELG
Sbjct  256   ALSGALAKLQASAKFRQLREAAKCITKQIGGQAHEVAAKVDEYARGMISASGASLFEELG  315

Query  1504  LYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFD  1325
             LYYIGPVDGHN++DLV+I ++VK+  + GPVL+H+VTEKG+GYP AE AADK HGV KFD
Sbjct  316   LYYIGPVDGHNVEDLVAIFKKVKAMPSPGPVLVHIVTEKGKGYPPAEAAADKMHGVVKFD  375

Query  1324  PATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFD  1145
             P TGKQFK    T SYT YFAE+L+ EAE D+ IVAIHAAMGGGTGLN FQ++FP RCFD
Sbjct  376   PKTGKQFKTKFPTLSYTQYFAESLVKEAEVDEKIVAIHAAMGGGTGLNFFQKKFPDRCFD  435

Query  1144  VGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG  965
             VGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFA+DRAGLVG
Sbjct  436   VGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFALDRAGLVG  495

Query  964   SDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvv  785
             +DGPTHCGAFDVT+MACLPNM+VMAPSDEAEL HMVATAAAIDDRPSC R+PRGNGVGV 
Sbjct  496   ADGPTHCGAFDVTYMACLPNMIVMAPSDEAELMHMVATAAAIDDRPSCFRFPRGNGVGVA  555

Query  784   lppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKP  605
             LP   KGTPLE+G+GRILMEG++VA++GYG+ VQSCL AA  L  RG+  TVAD RFCKP
Sbjct  556   LPSDYKGTPLEIGKGRILMEGDKVAILGYGSIVQSCLKAAGSLRERGISATVADGRFCKP  615

Query  604   LDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHG  425
             LD  LIR L   HE++ITVEEGSIGGF SHV+ F++L+GLLDG+LK R +VLPDRYIDHG
Sbjct  616   LDSELIRRLVNEHEILITVEEGSIGGFASHVSHFLSLNGLLDGHLKLRSMVLPDRYIDHG  675

Query  424   APADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             AP DQ+ EAGL+  HIA TV ++LG+  EA ++
Sbjct  676   APKDQIEEAGLSSKHIAGTVLSLLGRPMEAFQL  708



>ref|XP_007208040.1| hypothetical protein PRUPE_ppa002778mg [Prunus persica]
 gb|EMJ09239.1| hypothetical protein PRUPE_ppa002778mg [Prunus persica]
Length=634

 Score =   993 bits (2568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/633 (76%), Positives = 550/633 (87%), Gaps = 0/633 (0%)
 Frame = -2

Query  2224  MKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVG  2045
             MKNLS ++L QLA ELR D++++VS++GGHL SSLGVVEL VALH+VFN P DKI+WDVG
Sbjct  1     MKNLSTEDLEQLAAELRVDIVYSVSQSGGHLSSSLGVVELAVALHHVFNTPDDKIIWDVG  60

Query  2044  HQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDL  1865
             HQ+YPHKILTGRR KM TIR+T+GLAGF KR ES YD FG GHSST+ISAGLGMAV RDL
Sbjct  61    HQAYPHKILTGRRSKMHTIRKTSGLAGFPKRDESVYDAFGAGHSSTSISAGLGMAVARDL  120

Query  1864  KGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVG  1685
              G+ NN+I+VIGDGAMTAGQAYEAMNNAG+LDS++IVILNDNKQVSLPTATLDGP  PVG
Sbjct  121   LGKNNNIISVIGDGAMTAGQAYEAMNNAGFLDSNLIVILNDNKQVSLPTATLDGPAMPVG  180

Query  1684  ALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELG  1505
             ALS AL++LQS+   R+LRE AK +TKQIGG  H++AAKVDEYARGMIS SGSTLFEELG
Sbjct  181   ALSGALTKLQSSTQFRKLREAAKSITKQIGGQTHQVAAKVDEYARGMISASGSTLFEELG  240

Query  1504  LYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFD  1325
             LYYIGPVDGHN+ DLV+I Q VK+    GPVLIH++TEKG+GYP AE AADK HGV KFD
Sbjct  241   LYYIGPVDGHNVSDLVTIFQRVKAMPAPGPVLIHIMTEKGKGYPPAEAAADKMHGVVKFD  300

Query  1324  PATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFD  1145
             P TG+QFK  + T SYT YFAE+LI EAE D  +VAIHAAMGGGTGLN FQ+RFP RCFD
Sbjct  301   PRTGQQFKTKSSTLSYTQYFAESLIKEAEIDDKVVAIHAAMGGGTGLNYFQKRFPDRCFD  360

Query  1144  VGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVG  965
             VGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVHDVDLQKLPVRFAMDRAGLVG
Sbjct  361   VGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVG  420

Query  964   SDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvv  785
             +DGPTHCGAFD+T+MACLPNMVVMAPSDEAEL HMVATAAAIDDRPSC R+PRGNG+G +
Sbjct  421   ADGPTHCGAFDITYMACLPNMVVMAPSDEAELMHMVATAAAIDDRPSCFRFPRGNGIGSL  480

Query  784   lppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKP  605
             LP  NKGTPLE+G+GRILMEG RVA++GYG+ VQ C+ AA++L+TR + VTVADARFCKP
Sbjct  481   LPANNKGTPLEIGKGRILMEGSRVAILGYGSIVQQCVEAASMLKTRDILVTVADARFCKP  540

Query  604   LDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHG  425
             LD  LI+ LAK HE++ITVEEGSIGGFGSHV+ F++L G+LDG LK R +VLPDRYIDHG
Sbjct  541   LDTDLIKQLAKEHEILITVEEGSIGGFGSHVSHFLSLSGILDGPLKLRAMVLPDRYIDHG  600

Query  424   APADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             AP DQL EAGL+  HI+ATV ++LG+ +EAL  
Sbjct  601   APQDQLEEAGLSSRHISATVLSLLGRPKEALRF  633



>gb|AGQ04154.1| 1-deoxy-D-xylulose 5-phosphate synthase [Lavandula angustifolia]
Length=725

 Score =   993 bits (2567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/654 (72%), Positives = 560/654 (86%), Gaps = 0/654 (0%)
 Frame = -2

Query  2281  YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELT  2102
             +  ++P TP+LDTIN+P HMKNLSV+EL +LA+ELR ++++ VSKTGGHL SSLGV ELT
Sbjct  69    FTGEKPSTPILDTINFPNHMKNLSVEELERLADELREEIVYTVSKTGGHLSSSLGVSELT  128

Query  2101  VALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGT  1922
             VALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIRQ+ GLAGF KR ES +D FG 
Sbjct  129   VALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMQTIRQSFGLAGFPKRDESAHDAFGA  188

Query  1921  GHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILND  1742
             GHSST+ISAGLGMAV RDL  + N+VI+VIGDGAMTAGQAYEAMNNAG+LDS++IV+LND
Sbjct  189   GHSSTSISAGLGMAVARDLLHKNNHVISVIGDGAMTAGQAYEAMNNAGFLDSNLIVVLND  248

Query  1741  NKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVD  1562
             NKQVSLPTAT+DGP PPVGALS AL+RLQ++R  R+LRE AKG+TKQ+G   HE+A+KVD
Sbjct  249   NKQVSLPTATVDGPAPPVGALSKALTRLQASRKFRQLREAAKGMTKQMGNQAHEIASKVD  308

Query  1561  EYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGR  1382
              Y +G     G++LFEELG+YYIGPVDGHN++DLV I ++VK     GPVLIH++TEKG+
Sbjct  309   TYLKGFAGKPGASLFEELGMYYIGPVDGHNVEDLVYIFKKVKEMPAPGPVLIHIITEKGK  368

Query  1381  GYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAM  1202
             GY  AE AADK HGV KFDP TGKQ K    T+SYT YFAE+L+AEAE D  +VAIHAAM
Sbjct  369   GYLPAEVAADKMHGVVKFDPTTGKQLKTKTSTKSYTQYFAESLVAEAEQDDKVVAIHAAM  428

Query  1201  GGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHD  1022
             GGGTGLN+FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFC IYSSF+QR YDQVVHD
Sbjct  429   GGGTGLNIFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCTIYSSFLQRGYDQVVHD  488

Query  1021  VDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAA  842
             VDLQKLPVRF MDRAGLVG+DGPTHCGAFD T+MACLPNMVVMAPSDEAEL HM+ATAA 
Sbjct  489   VDLQKLPVRFMMDRAGLVGADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMHMIATAAF  548

Query  841   IDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAA  662
             IDDRPSC+RYPRGNG+GV +PP NKGTPLEVG+GRIL EGERVA++G+GT VQ+C+ AA 
Sbjct  549   IDDRPSCVRYPRGNGIGVAIPPNNKGTPLEVGKGRILKEGERVAILGFGTIVQTCMEAAK  608

Query  661   LLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLL  482
             LL+ + + VTVADARFCKPLD  LIR LAK H+V+ITVEEGSIGGF +HV+ F++L+GLL
Sbjct  609   LLQEQDISVTVADARFCKPLDGDLIRKLAKEHQVLITVEEGSIGGFSAHVSHFLSLNGLL  668

Query  481   DGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             DGNLKWRP+VLPDRYIDHGA +DQ+ EAGL+  HIA TV +++G  +++L  + 
Sbjct  669   DGNLKWRPMVLPDRYIDHGAQSDQIEEAGLSAKHIAGTVMSLVGGGKDSLRFIN  722



>ref|XP_009768276.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Nicotiana sylvestris]
Length=713

 Score =   991 bits (2563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/651 (74%), Positives = 563/651 (86%), Gaps = 0/651 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
             ++  ++PPTP LDTINYP +MK LS  +L QLA E+R++++++V+KTGGHL SSLGVV+L
Sbjct  60    DFSGEKPPTPFLDTINYPKNMKILSKLDLEQLAAEVRAEIVYSVAKTGGHLSSSLGVVDL  119

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TVALH+VF+ P D+I+WDVGHQ+Y HKILTGRR KM TIR+T+GLA F KR ES YD FG
Sbjct  120   TVALHHVFDTPDDRIIWDVGHQAYAHKILTGRRSKMHTIRKTSGLAPFPKRDESIYDAFG  179

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAV RDL G+ N+VI+VIGDGAMTAGQAYEAMNNAG+LD+++IVILN
Sbjct  180   AGHSSTSISAGLGMAVARDLLGKNNHVISVIGDGAMTAGQAYEAMNNAGFLDTNLIVILN  239

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DN+QVSLPTATLDGP  PVGALSSALS++Q++   R+LRE AK +TKQIG   HE+AAKV
Sbjct  240   DNEQVSLPTATLDGPATPVGALSSALSKIQASTKFRQLRETAKSITKQIGPQAHEVAAKV  299

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             DEYARGMIS S STLFEELGLYYIGPVDGHNI+DL++IL++VKS    GPVLIH+VTEKG
Sbjct  300   DEYARGMISASCSTLFEELGLYYIGPVDGHNIEDLITILKKVKSMPAPGPVLIHIVTEKG  359

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GYP AE AADK HGV +FDP TGKQFKA + T SYT YFAE+LI EAE D  IVAIHAA
Sbjct  360   KGYPPAEAAADKMHGVAQFDPKTGKQFKAKSPTLSYTQYFAESLIKEAEVDNKIVAIHAA  419

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  420   MGGGTGLNYFQKQFPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVH  479

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAEL HMVATAA
Sbjct  480   DVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELMHMVATAA  539

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC R+PRGNGVG +LPP NKG P+EVG+GRIL EGER+A++GYG+ VQ CL AA
Sbjct  540   AIDDRPSCFRFPRGNGVGALLPPNNKGIPIEVGKGRILREGERIAILGYGSIVQQCLGAA  599

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              +L T  +RVTVADARFCKPLD  LI+ LAK HE++ITVEEGSIGGFGSHV+ F++++ +
Sbjct  600   DILNTHNVRVTVADARFCKPLDADLIKRLAKEHEILITVEEGSIGGFGSHVSHFLSVNSI  659

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             LDG LK R +VLPDRYIDHG+P DQ+  AGL+  HI+ATV  +LG+ +EAL
Sbjct  660   LDGPLKLRSMVLPDRYIDHGSPLDQIEAAGLSSRHISATVLTLLGRPKEAL  710



>gb|AAW28999.1| 1-deoxy-D-xylulose-5-phosphate synthase [Antirrhinum majus]
Length=733

 Score =   991 bits (2563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/678 (71%), Positives = 573/678 (85%), Gaps = 1/678 (0%)
 Frame = -2

Query  2353  QKPSQINYKKRS-SGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANEL  2177
             +K   IN  K + +G    +A    +  ++P TP+LDTINYPIHMKNLS++EL  LA+EL
Sbjct  54    EKSEIINVNKENLNGKNGRVARTLNFTGEKPSTPILDTINYPIHMKNLSLEELEILADEL  113

Query  2176  RSDVIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKM  1997
             R +++++VSKTGGHL SSLGV ELTVALH+VF+ P+DKI+WDVGHQ+YPHKILTGRR KM
Sbjct  114   REELVYSVSKTGGHLSSSLGVAELTVALHHVFSTPEDKIIWDVGHQAYPHKILTGRRSKM  173

Query  1996  PTIRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAM  1817
              T+R+T GLAGF KR ES +D FG GHSST+ISAGLGMAV RDL G  N+VI+VIGDGAM
Sbjct  174   HTMRKTFGLAGFPKREESVHDAFGAGHSSTSISAGLGMAVARDLLGNNNHVISVIGDGAM  233

Query  1816  TAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLR  1637
             TAGQAYEAMNNAGYLDS++I+ILNDNKQVSLPTAT+DGP PPVGAL+ AL+RLQ++R  R
Sbjct  234   TAGQAYEAMNNAGYLDSNLIIILNDNKQVSLPTATVDGPAPPVGALTKALTRLQTSRKFR  293

Query  1636  ELREVAKGVTKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLV  1457
             +LREVAK +TKQIG   HE+AAKVD + RG+    G+ LFEELG+YYIGPVDGH+I+DLV
Sbjct  294   QLREVAKELTKQIGTEAHEVAAKVDSFVRGVAGSPGACLFEELGIYYIGPVDGHSIEDLV  353

Query  1456  SILQEVKSTKTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSY  1277
              I +++K     GPV+IH++TEKG+GYP AE AADK HGV KFDP TG+Q K+ ++T SY
Sbjct  354   FIFKKIKEMPAPGPVMIHIITEKGKGYPPAEVAADKMHGVVKFDPRTGQQKKSKSETLSY  413

Query  1276  TTYFAEALIAEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLA  1097
             T YFAE+LIAEAE D  +VAIHAAMGGGTGLN+FQ+RFP R FDVGIAEQH VTFAAGLA
Sbjct  414   TQYFAESLIAEAEQDDKVVAIHAAMGGGTGLNIFQKRFPGRTFDVGIAEQHAVTFAAGLA  473

Query  1096  CEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMA  917
              EGLKPFCAIYSSF+QR YDQV HDVDLQKLPVRF MDRAGLVG+DGPTHCGAFD T+MA
Sbjct  474   TEGLKPFCAIYSSFLQRGYDQVAHDVDLQKLPVRFIMDRAGLVGADGPTHCGAFDTTYMA  533

Query  916   CLPNMVVMAPSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGR  737
             CLPNMVVMAPSDEAEL HM+ATAA IDDRPSCLRYPRGNG+G VLPP NKGTP+E+G+GR
Sbjct  534   CLPNMVVMAPSDEAELMHMIATAAIIDDRPSCLRYPRGNGIGAVLPPNNKGTPMEIGKGR  593

Query  736   ILMEGERVALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVM  557
             IL EG RVA++G+GT +Q+CL+AA LL+   + +TVADARFCKPLD  LIR L K HEV+
Sbjct  594   ILREGSRVAILGFGTIIQNCLAAADLLQEHRVSITVADARFCKPLDGDLIRQLVKEHEVL  653

Query  556   ITVEEGSIGGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHI  377
             IT+EEGSIGGF SHV+ F+ L+GLLDGNLKWR +VLPDRYIDHGA +DQ+ EAGL+P HI
Sbjct  654   ITIEEGSIGGFSSHVSHFLCLNGLLDGNLKWRAMVLPDRYIDHGAQSDQIEEAGLSPRHI  713

Query  376   AATVFNILGKAREALEIM  323
             AATV +++G+ +++L +M
Sbjct  714   AATVLSLIGEGKDSLHLM  731



>gb|EMS59126.1| putative 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic 
[Triticum urartu]
Length=807

 Score =   991 bits (2563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/677 (72%), Positives = 568/677 (84%), Gaps = 2/677 (0%)
 Frame = -2

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
             A K EY S++P TPLLDTINYP+HMKNLS  +L QL+ ELR++++  VSKTGGHL +SLG
Sbjct  56    AWKIEYSSEKPETPLLDTINYPVHMKNLSTTDLEQLSAELRAEIVHTVSKTGGHLSASLG  115

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVEL+VALH+VF+ P+DKI+WDVGHQ+YPHKILTGRR +M T+R+T+GLAGF KR ES +
Sbjct  116   VVELSVALHHVFDTPEDKIIWDVGHQAYPHKILTGRRSRMHTMRKTSGLAGFPKRDESAH  175

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             D FG GHSST+ISA LGMAV RDL+G+KN+VI+VIGDGAMTAGQAYEAMNN+G+LDS+MI
Sbjct  176   DAFGVGHSSTSISAALGMAVARDLQGKKNHVISVIGDGAMTAGQAYEAMNNSGFLDSNMI  235

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             V+LNDNKQVSLPTATLDGP  PVGALS AL++LQS+   R LRE AK +TKQIGG  HE+
Sbjct  236   VVLNDNKQVSLPTATLDGPSKPVGALSKALTKLQSSTKFRRLREAAKTITKQIGGSTHEV  295

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             AAKVDEYARGMIS SGSTLFEELGLYYIGPVDGH+++DLV+I ++VKS    GPVLIH+V
Sbjct  296   AAKVDEYARGMISASGSTLFEELGLYYIGPVDGHSLEDLVTIFEKVKSMPAPGPVLIHIV  355

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKG+GYP AE AADK HGV KFDP TGKQFK  + T SYT YFAE+LI EAE D  +VA
Sbjct  356   TEKGKGYPPAEAAADKMHGVVKFDPTTGKQFKTKSPTLSYTQYFAESLIREAEGDDKVVA  415

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EG+KPFCAIYSSF+QR YD
Sbjct  416   IHAAMGGGTGLNYFQKRFPERCFDVGIAEQHAVTFAAGLAAEGMKPFCAIYSSFLQRGYD  475

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQ+LPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAP+DEAEL HMV
Sbjct  476   QVVHDVDLQRLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPADEAELMHMV  535

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATA AIDDRPSC R+PRGNG+G VLP  N+GTP++VG+GR+L+ G RVAL+GYGT VQ+C
Sbjct  536   ATANAIDDRPSCFRFPRGNGIGAVLPLNNRGTPIQVGKGRVLVSGNRVALLGYGTMVQAC  595

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             L AA  L+   L +TV DARFCKPLD  LIR LA  HE++IT EEGSIGGFGSHVA +++
Sbjct  596   LKAAEALKEHDLFITVVDARFCKPLDTELIRELAAEHEILITAEEGSIGGFGSHVAHYLS  655

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT*  317
             L+GLLDG LK R + LPDRYIDHGA  DQ+  AGLTP HIAATV ++     + +  M  
Sbjct  656   LNGLLDGPLKLRSMFLPDRYIDHGAAEDQMEAAGLTPRHIAATVLSLCSACFDGIMGMDG  715

Query  316   R*THCNVVRNNFTNVKR  266
               +  +VVR  + N+ R
Sbjct  716   LASGVHVVR--WQNIPR  730



>gb|AAC33513.1| 1-deoxyxylulose-5-phosphate synthase [Mentha x piperita]
Length=724

 Score =   991 bits (2562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/654 (71%), Positives = 562/654 (86%), Gaps = 0/654 (0%)
 Frame = -2

Query  2281  YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELT  2102
             +  ++PP P+LDTINYP HMKNLSV+EL  LA+ELR ++++ VSKTGGHL SSLGV ELT
Sbjct  69    FTGEKPPIPILDTINYPNHMKNLSVEELANLADELREEIVYTVSKTGGHLSSSLGVSELT  128

Query  2101  VALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGT  1922
             VALH+VFN P DKI+WDVGHQ+YPHKILTGRR +M TIRQT GLAGF KR ES +D FG 
Sbjct  129   VALHHVFNTPDDKIIWDVGHQAYPHKILTGRRARMHTIRQTFGLAGFPKRDESAHDAFGA  188

Query  1921  GHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILND  1742
             GHSST+ISAGLGMAV RDL  + N+VI+VIGDGAMTAGQAYEA+NNAG+LDS++I++LND
Sbjct  189   GHSSTSISAGLGMAVARDLLQKNNHVISVIGDGAMTAGQAYEALNNAGFLDSNLIIVLND  248

Query  1741  NKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVD  1562
             NKQVSLPTAT+DGP PPVGALS AL++LQ++R  R+LRE AK +TKQ+G P HE+A+K+ 
Sbjct  249   NKQVSLPTATVDGPAPPVGALSKALTKLQASRKFRQLREAAKSMTKQMGAPAHEIASKLT  308

Query  1561  EYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGR  1382
             +Y +GM+   G++LFEELG+YYIGPVDGHN++DLV I ++VK     GPVLIH++TEKG+
Sbjct  309   QYVKGMMGKPGASLFEELGIYYIGPVDGHNVEDLVYIFKKVKEMPAPGPVLIHIITEKGK  368

Query  1381  GYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAM  1202
             GYP AE AADK HGV KFD  TGKQ K   KT+SYT YFAE+L+AEAE D  IVAIHAAM
Sbjct  369   GYPPAEIAADKMHGVVKFDAKTGKQMKTKNKTKSYTQYFAESLVAEAEHDDKIVAIHAAM  428

Query  1201  GGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHD  1022
             GGGTGLN+FQ++FP RCFDVGIAEQH VTFAAG+A EGLKPFCAIYSSF+QR YDQVVHD
Sbjct  429   GGGTGLNIFQKQFPDRCFDVGIAEQHAVTFAAGMAAEGLKPFCAIYSSFLQRGYDQVVHD  488

Query  1021  VDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAA  842
             VDLQKLPVRF MDRAG+VG+DGPTHCGAFD T+MACLPNMVVMAPSDEAEL +M+ATAA 
Sbjct  489   VDLQKLPVRFMMDRAGVVGADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMNMIATAAI  548

Query  841   IDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAA  662
             IDDRPSC+RYPRGNG+GV LP  NKGTPLE+G+GRIL EG +VA++G+GT VQ+C++AA 
Sbjct  549   IDDRPSCVRYPRGNGIGVALPSNNKGTPLEIGKGRILKEGSKVAILGFGTIVQNCMAAAN  608

Query  661   LLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLL  482
             LLE  G+ VTVADARFCKPLD  LI+ L + HEV+ITVEEGSIGGF +H++ F++L+GLL
Sbjct  609   LLEQHGISVTVADARFCKPLDGDLIKKLVQEHEVLITVEEGSIGGFSAHISHFLSLNGLL  668

Query  481   DGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             DGNLKWRP+VLPDRYIDHGA +DQ+ EAGL+P HIA TV +++G  +++L ++ 
Sbjct  669   DGNLKWRPMVLPDRYIDHGAQSDQIEEAGLSPKHIAGTVVSLIGGGKDSLHLIN  722



>gb|AFM78321.1| 1-D-deoxyxylulose 5-phosphate synthase 2 [Nicotiana tabacum]
Length=713

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/651 (74%), Positives = 563/651 (86%), Gaps = 0/651 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
             ++  ++PPTP LDTINYP +MK LS  +L QLA E+R++++++V+KTGGHL SSLGVV+L
Sbjct  60    DFSGEKPPTPFLDTINYPKNMKILSKLDLEQLAAEVRAEIVYSVAKTGGHLSSSLGVVDL  119

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TVALH+VF+ P D+I+WDVGHQ+Y HKILTGRR +M TIR+T+GLA F KR ES YD FG
Sbjct  120   TVALHHVFDTPDDRIIWDVGHQAYAHKILTGRRSRMHTIRKTSGLAPFPKRDESIYDAFG  179

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAV RDL G+ N+VI+VIGDGAMTAGQAYEAMNNAG+LD+++IVILN
Sbjct  180   AGHSSTSISAGLGMAVARDLLGKNNHVISVIGDGAMTAGQAYEAMNNAGFLDTNLIVILN  239

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DN+QVSLPTATLDGP  PVGALSSALS++Q++   R+LRE AK +TKQIG   HE+AAKV
Sbjct  240   DNEQVSLPTATLDGPATPVGALSSALSKIQASTKFRQLRETAKSITKQIGPQAHEVAAKV  299

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             DEYARGMIS S STLFEELGLYYIGPVDGHNI+DL++IL++VKS    GPVLIH+VTEKG
Sbjct  300   DEYARGMISASCSTLFEELGLYYIGPVDGHNIEDLITILKKVKSMPAPGPVLIHIVTEKG  359

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GYP AE AADK HGV +FDP TGKQFKA + T SYT YFAE+LI EAE D  IVAIHAA
Sbjct  360   KGYPPAEAAADKMHGVAQFDPKTGKQFKAKSPTLSYTQYFAESLIKEAEVDNKIVAIHAA  419

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  420   MGGGTGLNYFQKQFPERCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVH  479

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFAMDRAGLVG+DGPTHCGAFDVT+MACLPNMVVMAPSDEAEL HMVATAA
Sbjct  480   DVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELMHMVATAA  539

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC R+PRGNGVG +LPP NKG P+EVG+GRIL EGER+A++GYG+ VQ CL AA
Sbjct  540   AIDDRPSCFRFPRGNGVGALLPPNNKGIPIEVGKGRILREGERIAILGYGSIVQQCLGAA  599

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              +L T  +RVTVADARFCKPLD  LI+ LAK HE++ITVEEGSIGGFGSHV+ F++++ +
Sbjct  600   DILNTHNVRVTVADARFCKPLDADLIKRLAKEHEILITVEEGSIGGFGSHVSHFLSVNSI  659

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             LDG LK R +VLPDRYIDHG+P DQ+  AGL+  HI+ATV  +LG+ +EAL
Sbjct  660   LDGPLKLRSMVLPDRYIDHGSPLDQIEAAGLSSRHISATVLTLLGRPKEAL  710



>ref|XP_004509707.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic-like [Cicer arietinum]
 ref|XP_004517270.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic-like [Cicer arietinum]
Length=713

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/658 (73%), Positives = 564/658 (86%), Gaps = 4/658 (1%)
 Frame = -2

Query  2293  DKDE----YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGS  2126
             +KDE    + +Q+P TPLLDT+N+PIHMK+LS K+L QLA ELR+D++ +VS TGGHL S
Sbjct  53    EKDEWKINFSAQKPVTPLLDTVNHPIHMKSLSTKDLEQLAAELRADIVHSVSNTGGHLSS  112

Query  2125  SLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSE  1946
             SLGVVEL VALH+VFN P DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR E
Sbjct  113   SLGVVELAVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKRDE  172

Query  1945  SEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDS  1766
             S +D FG GHSST+ISAGLGMAV RDL G+ N+VI+VIGDGAMTAGQAYEAMNNAG+LD+
Sbjct  173   SAHDAFGVGHSSTSISAGLGMAVARDLLGKNNSVISVIGDGAMTAGQAYEAMNNAGFLDA  232

Query  1765  DMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM  1586
             ++IVILNDNKQVSLPTATLDGP  PVGALSS LS++Q++  +R+LREVAK  TKQIGG  
Sbjct  233   NLIVILNDNKQVSLPTATLDGPATPVGALSSTLSKIQASTQIRKLREVAKSFTKQIGGHT  292

Query  1585  HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLI  1406
             H++A+KVD+YARGMIS SGST+FEELGLYYIGPVDGHNI+DLV+IL++VKS    GPVLI
Sbjct  293   HQVASKVDKYARGMISASGSTIFEELGLYYIGPVDGHNIEDLVTILEKVKSMPAPGPVLI  352

Query  1405  HVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKD  1226
             HVVTEKG+GYP AE A+DK HGV KFDP TG QFK    T +YT YFAE+LI EAE D  
Sbjct  353   HVVTEKGKGYPPAEAASDKMHGVVKFDPKTGHQFKPKPTTLAYTQYFAESLIKEAEIDNK  412

Query  1225  IVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQR  1046
             IVAIHAAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR
Sbjct  413   IVAIHAAMGGGTGLNYFQKKFPDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQR  472

Query  1045  AYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELF  866
              YDQVVHDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD+T+MACLPNMVVMAPSDE EL 
Sbjct  473   GYDQVVHDVDLQKLPVRFAIDRAGLVGADGPTHCGAFDITYMACLPNMVVMAPSDETELM  532

Query  865   HMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAV  686
             HMVATAAAI+DRPSC R+PRGNG+G  LP  NKGTPLE+G+GRIL EG R+A++G+G  V
Sbjct  533   HMVATAAAINDRPSCFRFPRGNGIGSNLPLNNKGTPLEIGKGRILREGSRIAILGFGCIV  592

Query  685   QSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQ  506
             Q C  AA +L+T G+  T+ADARFCKPLD  LIR LA+ HE++ITVEEGSIGGFGSHV+Q
Sbjct  593   QQCQEAAEMLKTLGVYATIADARFCKPLDTDLIRLLAREHEILITVEEGSIGGFGSHVSQ  652

Query  505   FMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             F++L G+LDG LK R ++LPDRYI+HG+P DQ+ EAGL+  HIAATV ++L   +EAL
Sbjct  653   FLSLAGILDGPLKLRSMMLPDRYIEHGSPNDQMDEAGLSSKHIAATVLSLLEMPKEAL  710



>ref|XP_011069878.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Sesamum indicum]
Length=714

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/651 (73%), Positives = 561/651 (86%), Gaps = 0/651 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
              +   +P TP+LDTINYPIHMKNLS++EL +L++ELR ++++ VSKTGGHL SSLGV EL
Sbjct  64    NFSGDKPSTPVLDTINYPIHMKNLSLEELERLSDELREEIVYTVSKTGGHLSSSLGVSEL  123

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TVALH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIRQT+GLAGF KR ES +D FG
Sbjct  124   TVALHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRQTSGLAGFPKREESAHDAFG  183

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAV RDL G+ N+VI+VIGDGAMTAGQAYEAMNNAG+LDS++I++LN
Sbjct  184   VGHSSTSISAGLGMAVARDLLGKNNHVISVIGDGAMTAGQAYEAMNNAGFLDSNLIIVLN  243

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DNKQVSLPTAT DGP PPVGALS AL++LQ++R  R+LRE AK +TKQ+G   H +AAKV
Sbjct  244   DNKQVSLPTATADGPAPPVGALSKALTKLQASRKFRKLREAAKEMTKQMGDQAHVMAAKV  303

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             D Y RGM+   G+ LFEELG+YYIGPVDGH+I+DLV I ++VK     GPVLIHV+TEKG
Sbjct  304   DTYVRGMMGKPGACLFEELGIYYIGPVDGHSIEDLVYIFKKVKEMPAPGPVLIHVITEKG  363

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             RGYP AE AADK HGV KFDP TGKQ K+  KT SYT YFA++LIAEAE D+ I+AIHAA
Sbjct  364   RGYPPAEVAADKMHGVVKFDPKTGKQIKSKPKTLSYTQYFADSLIAEAEQDEKIIAIHAA  423

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLN+FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  424   MGGGTGLNIFQKRFPHRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVH  483

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRF MDRAGLVG+DGPTHCGAFD T+MACLPNMVVMAPSDEAEL HM+ATAA
Sbjct  484   DVDLQKLPVRFVMDRAGLVGADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMHMIATAA  543

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
              IDDRPSC+RYPRGNGVG VLPPGNKGTPLE+G+G++L  G RVA++G+GT  Q+CL+AA
Sbjct  544   TIDDRPSCIRYPRGNGVGAVLPPGNKGTPLEIGKGKVLRAGNRVAILGFGTITQNCLAAA  603

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              LL+  G+ VTVADARFCKPLD  LI+ LA+ HEV+ITVEEGSIGGF +HV+ F+ L+GL
Sbjct  604   ELLQHHGIYVTVADARFCKPLDGDLIKQLAQEHEVLITVEEGSIGGFSTHVSHFLCLNGL  663

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             LDGNLKWRP+ LPDRYIDHGA +DQ+ EAGL+P HIA TV +++G+ +++ 
Sbjct  664   LDGNLKWRPMTLPDRYIDHGAQSDQIDEAGLSPKHIAGTVLSLIGEGKDSF  714



>emb|CAD22531.1| 1-deoxy-D-xylulose 5-phosphate synthase 2 [Medicago truncatula]
 emb|CAN89180.1| 1-Deoxy-D-xylulose 5-phosphate synthase 2 precursor [Medicago 
truncatula]
 gb|KEH20100.1| 1-deoxy-D-xylulose-5-phosphate synthase [Medicago truncatula]
Length=711

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/715 (69%), Positives = 581/715 (81%), Gaps = 7/715 (1%)
 Frame = -2

Query  2476  MALCTCALPGDLSRLVGSDLQKPRPFSSQWFHGSDLHLHFQQKPSQINYKKRSSGVQASL  2297
             MAL +C L  + S L     + P P      HG      F    S  +  +R+   +   
Sbjct  1     MALSSCLLKPNHSLLQCHKFKAPNPN-----HG--FRNQFCVMASSSSDGERTIIRKEKD  53

Query  2296  ADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLG  2117
               K  + +++PPTPLLDT+N+P+HMKNL+ ++L QLA ELR+D++ +VS TGGHL SSLG
Sbjct  54    EWKINFSAEKPPTPLLDTVNFPVHMKNLTTEDLEQLAAELRADIVHSVSDTGGHLSSSLG  113

Query  2116  VVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEY  1937
             VVEL+VALH+VF+ P DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR ES +
Sbjct  114   VVELSVALHHVFDTPDDKIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKRDESVH  173

Query  1936  DCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMI  1757
             D FG GHSST+ISAGLGMAV RDL G+KN+VI+VIGDGAMTAGQAYEAMNNAG++DS++I
Sbjct  174   DAFGVGHSSTSISAGLGMAVARDLLGKKNSVISVIGDGAMTAGQAYEAMNNAGFIDSNLI  233

Query  1756  VILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHEL  1577
             VILNDNKQVSLPTATLDGP  PVGALSS LS++Q++R  R+LRE  K +TKQIGG  H +
Sbjct  234   VILNDNKQVSLPTATLDGPATPVGALSSTLSKIQASRKFRKLREATKNITKQIGGQTHLV  293

Query  1576  AAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVV  1397
             A+KVD+YAR  ISGSGS+LFEELG+YYIGP+DGHNI+DLV+I ++VK+    GPVLIH+V
Sbjct  294   ASKVDKYARDFISGSGSSLFEELGMYYIGPMDGHNIEDLVNIFEKVKAMPAPGPVLIHIV  353

Query  1396  TEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVA  1217
             TEKG+GYP A  AAD+ HGV KFDP TG QFK    T +YT YFA++LI EAE D  IVA
Sbjct  354   TEKGKGYPPALAAADRMHGVVKFDPKTGHQFKPKPSTLAYTQYFADSLIKEAEMDNKIVA  413

Query  1216  IHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYD  1037
             IHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YD
Sbjct  414   IHAAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYD  473

Query  1036  QVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMV  857
             QVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+TFMACLPNM+VMAPSDEAEL +MV
Sbjct  474   QVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITFMACLPNMIVMAPSDEAELMNMV  533

Query  856   ATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSC  677
             ATAAAIDDRPSC R+PRGNG+G  LP  NKGTPLE+G+GRIL+EG RVA++GYG  VQ C
Sbjct  534   ATAAAIDDRPSCFRFPRGNGIGANLPLNNKGTPLEIGKGRILLEGSRVAILGYGCMVQQC  593

Query  676   LSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMA  497
             + AA +L   G+ VTVADARFCKPLD  LIR LA+ HE++ITVEEGSIGGFGSHV+QF++
Sbjct  594   MKAAEMLRAVGVYVTVADARFCKPLDTDLIRLLAREHEILITVEEGSIGGFGSHVSQFLS  653

Query  496   LDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             L GLLDG LK R ++LPDRYIDHGAP DQ+ EAGL+  HI ATV ++L   +EAL
Sbjct  654   LAGLLDGPLKLRSMMLPDRYIDHGAPNDQIDEAGLSSKHILATVLSLLDMPKEAL  708



>ref|XP_004173040.1| PREDICTED: LOW QUALITY PROTEIN: probable 1-deoxy-D-xylulose-5-phosphate 
synthase 2, chloroplastic-like, partial [Cucumis 
sativus]
Length=694

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/639 (75%), Positives = 559/639 (87%), Gaps = 1/639 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K +Y  ++P TPLLDT+N+PIHMKNLS+++L +LA ELR++++F+VSKTGGHL +SLGVV
Sbjct  56    KIDYSGEKPATPLLDTVNFPIHMKNLSMQDLEKLAAELRAEIVFSVSKTGGHLSASLGVV  115

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL VALH+VFN P DKI+WDVGHQ+YPHKILTGRR +M T+RQT+GLAGF KR ES +D 
Sbjct  116   ELAVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSRMHTLRQTSGLAGFPKRDESIHDA  175

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAVGRDL G+KN+VI+VIGDGAMTAGQAYEAMNNAGYLD++MIVI
Sbjct  176   FGAGHSSTSISAGLGMAVGRDLLGKKNSVISVIGDGAMTAGQAYEAMNNAGYLDTNMIVI  235

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL++LQ++   R+LRE AK +TKQIG   H +AA
Sbjct  236   LNDNKQVSLPTATLDGPATPVGALSSALTKLQASTQFRKLREAAKTITKQIGKQTHGVAA  295

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMISGSGST FEELGLYYIGPVDGHN+ DLV+IL++VKS    GPVLIH++TE
Sbjct  296   KVDEYARGMISGSGSTFFEELGLYYIGPVDGHNVGDLVTILEKVKSMPAPGPVLIHILTE  355

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AADK HGV KFDP TGKQFK  + T SYT YFAE+LI EAE D  IVAIH
Sbjct  356   KGKGYPPAEAAADKMHGVVKFDPKTGKQFKTKSPTLSYTQYFAESLIKEAELDDKIVAIH  415

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EG+KPFCAIYSSF+QR +DQV
Sbjct  416   AAMGGGTGLNYFQKKFPQRCFDVGIAEQHAVTFAAGLATEGIKPFCAIYSSFLQRGFDQV  475

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+T+MACLPNM+VMAP+DEAEL HMVAT
Sbjct  476   VHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITYMACLPNMIVMAPADEAELIHMVAT  535

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AA IDDRPSC R+PRGNG+GVV+PP  KGTP+E+G+GRI+MEG RVA++GYG+ VQ C+ 
Sbjct  536   AAEIDDRPSCFRFPRGNGIGVVVPPNFKGTPIEIGKGRIVMEGTRVAILGYGSIVQQCVE  595

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             A+ LL+TRG+  TVADARFCKPLD  LIR LAK HE++ITVEEGSIGGFGSHV+ F+++ 
Sbjct  596   ASELLKTRGITPTVADARFCKPLDTQLIRQLAKEHEILITVEEGSIGGFGSHVSYFLSVT  655

Query  490   GLLDG-NLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHI  377
             G+LD  +LK R +VLPDRYIDHG+P DQ+ EAGL+  HI
Sbjct  656   GILDQHHLKLRSMVLPDRYIDHGSPGDQMEEAGLSSEHI  694



>emb|CAN89181.1| 1-Deoxy-D-xylulose 5-phosphate synthase 2 precursor [Medicago 
truncatula]
 gb|AET03367.2| 1-deoxy-D-xylulose-5-phosphate synthase [Medicago truncatula]
Length=710

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/658 (72%), Positives = 565/658 (86%), Gaps = 4/658 (1%)
 Frame = -2

Query  2293  DKDE----YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGS  2126
             +KDE    + +++PPTPLLDT+N+P+HMKNL+ ++L QLA ELR+D++ +VS TGGHL S
Sbjct  51    EKDEWKINFSAEKPPTPLLDTVNFPVHMKNLTTEDLEQLAAELRADIVHSVSDTGGHLSS  110

Query  2125  SLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSE  1946
             SLGVVEL+VALH+VF+ P DKI+WDVGHQ+YPHKILTGRR +M TIR+T+GLAGF KR E
Sbjct  111   SLGVVELSVALHHVFDTPDDKIIWDVGHQAYPHKILTGRRSRMHTIRKTSGLAGFPKRDE  170

Query  1945  SEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDS  1766
             S +D FG GHSST+ISAGLGMA+ RDL G+KN+VI+VIGDGAMTAGQAYEA+NNAG+LDS
Sbjct  171   SVHDAFGVGHSSTSISAGLGMAIARDLLGKKNSVISVIGDGAMTAGQAYEALNNAGFLDS  230

Query  1765  DMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPM  1586
             ++IVILNDNKQVSLPTATLDGP  PVGALSS LS++Q++R  R+LRE  K +TKQIGG  
Sbjct  231   NLIVILNDNKQVSLPTATLDGPATPVGALSSTLSKIQASRKFRKLREATKNITKQIGGQT  290

Query  1585  HELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLI  1406
             H +A+KVD+YAR  ISGSGS+LFEELG+YYIGP+DGHNI+DLV+I ++VK+T  +GPVLI
Sbjct  291   HLVASKVDKYARDFISGSGSSLFEELGMYYIGPMDGHNIEDLVNIFEKVKATPASGPVLI  350

Query  1405  HVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKD  1226
             H+VTEKG+GYP A  AAD+ HGV KFDP TG QFK    T +YT YFA++LI EAE D  
Sbjct  351   HIVTEKGKGYPPAVAAADRMHGVVKFDPKTGHQFKPKPSTLAYTQYFADSLIKEAEMDNK  410

Query  1225  IVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQR  1046
             IVAIHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYS+F+QR
Sbjct  411   IVAIHAAMGGGTGLNYFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSTFLQR  470

Query  1045  AYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELF  866
              YDQVVHDVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD+TFMACLPNM+VMAPSDEAEL 
Sbjct  471   GYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDITFMACLPNMIVMAPSDEAELM  530

Query  865   HMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAV  686
             +MVATAAAIDDRPSC R+PRGNG+G  LP  NKGTPLE+G+GRIL+EG RVA++GYG  V
Sbjct  531   NMVATAAAIDDRPSCFRFPRGNGIGADLPLHNKGTPLEIGKGRILLEGSRVAILGYGCMV  590

Query  685   QSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQ  506
             Q C+ AA +L   G+ VTV+DARFCKPLD  LIR LA+ HE++ITVEEGSIGGFGSHV+Q
Sbjct  591   QQCMKAAEMLRAVGVYVTVSDARFCKPLDTDLIRLLAREHEILITVEEGSIGGFGSHVSQ  650

Query  505   FMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREAL  332
             F++L GLLDG LK R ++LPDRYIDHGAP DQ+ EAGL+  HI ATV ++L   +EAL
Sbjct  651   FLSLAGLLDGPLKLRSMMLPDRYIDHGAPNDQIDEAGLSSKHILATVLSLLEMPKEAL  708



>ref|XP_008652152.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Zea mays]
 tpg|DAA59892.1| TPA: 1-deoxy-D-xylulose 5-phosphate synthase [Zea mays]
Length=727

 Score =   988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/656 (75%), Positives = 567/656 (86%), Gaps = 1/656 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++PPTPLLDT+NYP+HMKNLS+ EL QLA ELR++V+  VSKTGGHL SSLGVV
Sbjct  71    KIDFSGEKPPTPLLDTVNYPLHMKNLSILELEQLAAELRAEVVHTVSKTGGHLSSSLGVV  130

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL+VALH+VF+ P+DKI+WDVGHQ+YPHKILTGRR +M TIRQT+GLAGF KR ES +D 
Sbjct  131   ELSVALHHVFDTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRQTSGLAGFPKRDESAHDA  190

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISA LGMAV RDL GRKN+VI+VIGDGAMTAGQAYEAMNN+GYLD++MIV+
Sbjct  191   FGVGHSSTSISAALGMAVARDLLGRKNHVISVIGDGAMTAGQAYEAMNNSGYLDANMIVV  250

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALS AL++LQS+   R LRE AK VTKQIGGP HE+AA
Sbjct  251   LNDNKQVSLPTATLDGPSKPVGALSRALTKLQSSTKFRRLREAAKSVTKQIGGPTHEVAA  310

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGS+LFEELGLYYIGPVDGH ++DLV+I ++VKS    GPVLIH+VTE
Sbjct  311   KVDEYARGMISASGSSLFEELGLYYIGPVDGHCVEDLVTIFEKVKSMPAPGPVLIHIVTE  370

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE AAD+ HGV KF+PATG+Q K+ + T SYT YFAE+LI EAE+D+ +VAIH
Sbjct  371   KGKGYPPAEAAADRMHGVVKFEPATGRQLKSKSPTLSYTQYFAESLIREAESDEKVVAIH  430

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  431   AAMGGGTGLNYFQKRFPERCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQV  490

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQ+LPVRFA+DRAGLVG+DGPTHCGAFDV +MACLPNMVVMAP+DEAEL HMVAT
Sbjct  491   VHDVDLQRLPVRFALDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPADEAELMHMVAT  550

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGE-RVALVGYGTAVQSCL  674
             AAAIDDRPSC R+PRGNGVG  LPPGNKG  LEVGRGR+L+ G  RVAL+GYG  VQ+CL
Sbjct  551   AAAIDDRPSCFRFPRGNGVGAALPPGNKGVALEVGRGRVLVGGGTRVALLGYGAMVQACL  610

Query  673   SAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMAL  494
              AA  L+   + VTVADARFCKPLD ALIR LA  HEV+IT EEGSIGGFGSHVA +++L
Sbjct  611   KAAEALKEHDVYVTVADARFCKPLDTALIRELAAEHEVLITAEEGSIGGFGSHVAHYLSL  670

Query  493   DGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
              GLLDG LK R + LPDRYIDHGAP DQ+ EAGLTP HIAATV ++LG+  EA+++
Sbjct  671   TGLLDGPLKLRSMFLPDRYIDHGAPQDQIEEAGLTPRHIAATVLSLLGRPLEAMQL  726



>gb|ABP88135.1| 1-deoxy-D-xylulose 5-phosphate synthase [Zea mays]
Length=705

 Score =   987 bits (2551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/669 (74%), Positives = 573/669 (86%), Gaps = 1/669 (0%)
 Frame = -2

Query  2329  KKRSSGVQASLADKDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVS  2150
             K+ ++   +S   K ++  ++PPTPLLDT+NYP+HMKNLS+ EL QLA ELR++V+  VS
Sbjct  36    KEPAAAATSSGPWKIDFSGEKPPTPLLDTVNYPLHMKNLSILELEQLAAELRAEVVHTVS  95

Query  2149  KTGGHLGSSLGVVELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGL  1970
             KTGGHL SSLGVVEL+VALH+VF+ P+DKI+WDVGHQ+YPHKILTGRR +M TIRQT+GL
Sbjct  96    KTGGHLSSSLGVVELSVALHHVFDTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRQTSGL  155

Query  1969  AGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAM  1790
             AGF KR ES +D FG GHSST+ISA LGMAV RDL GRKN+VI+VIGDGAMTAGQAYEAM
Sbjct  156   AGFPKRDESAHDAFGVGHSSTSISAALGMAVARDLLGRKNHVISVIGDGAMTAGQAYEAM  215

Query  1789  NNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGV  1610
             NN+GYLD++MIV+LNDNKQVSLPTATLDGP  PVGALS AL++LQS+   R LRE AK V
Sbjct  216   NNSGYLDANMIVVLNDNKQVSLPTATLDGPSKPVGALSRALTKLQSSTKFRRLREAAKSV  275

Query  1609  TKQIGGPMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKST  1430
             TKQIGGP HE+AAKVDEYARGMIS SGS+LFEELGLYYIGPVDGH ++DLV+I ++VKS 
Sbjct  276   TKQIGGPTHEVAAKVDEYARGMISASGSSLFEELGLYYIGPVDGHCVEDLVTIFEKVKSM  335

Query  1429  KTTGPVLIHVVTEKGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALI  1250
                GPVLIH+VTEKG+GYP AE AAD+ HGV KF+PATG+Q K+ + T SYT YFAE+LI
Sbjct  336   PAPGPVLIHIVTEKGKGYPPAEAAADRMHGVVKFEPATGRQLKSKSPTLSYTQYFAESLI  395

Query  1249  AEAEADKDIVAIHAAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCA  1070
              EAE+D+ +VAIHAAMGGGTGLN FQ+RFP RCFDVGIAEQH VTFAAGLA EGLKPFCA
Sbjct  396   REAESDEKVVAIHAAMGGGTGLNYFQKRFPERCFDVGIAEQHAVTFAAGLAAEGLKPFCA  455

Query  1069  IYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMA  890
             IYSSF+QR YDQVVHDVDLQ+LPVRFA+DRAGLVG+DGPTHCGAFDV +MACLPNMVVMA
Sbjct  456   IYSSFLQRGYDQVVHDVDLQRLPVRFALDRAGLVGADGPTHCGAFDVAYMACLPNMVVMA  515

Query  889   PSDEAELFHMVATAAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGE-RV  713
             P+DEAEL HMVATAAAIDDRPSC R+PRGNGVG  LPPGNKG  LEVGRGR+L+ G  RV
Sbjct  516   PADEAELMHMVATAAAIDDRPSCFRFPRGNGVGAALPPGNKGVALEVGRGRVLVGGGTRV  575

Query  712   ALVGYGTAVQSCLSAAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSI  533
             AL+GYG  VQ+CL AA  L+   + VTVADARFCKPLD ALIR LA  HEV+IT EEGSI
Sbjct  576   ALLGYGAMVQACLKAAEALKEHDVYVTVADARFCKPLDTALIRELAAEHEVLITAEEGSI  635

Query  532   GGFGSHVAQFMALDGLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNIL  353
             GGFGSHVA +++L GLLDG LK R + LPDRYIDHGAP DQ+ EAGLTP HIAATV ++L
Sbjct  636   GGFGSHVAHYLSLTGLLDGPLKLRSMFLPDRYIDHGAPQDQIEEAGLTPRHIAATVLSLL  695

Query  352   GKAREALEI  326
             G+  EA+++
Sbjct  696   GRPLEAMQL  704



>ref|XP_006852893.1| hypothetical protein AMTR_s00033p00220630 [Amborella trichopoda]
 gb|ERN14360.1| hypothetical protein AMTR_s00033p00220630 [Amborella trichopoda]
Length=720

 Score =   986 bits (2549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/655 (74%), Positives = 568/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2290  KDEYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVV  2111
             K ++  ++P TPLLDTINYP HMKNLS ++L QLA ELR+++++ V+KTGGHL +SLGVV
Sbjct  65    KIDFSKEKPQTPLLDTINYPNHMKNLSAQDLEQLAAELRAEIVYTVAKTGGHLSASLGVV  124

Query  2110  ELTVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDC  1931
             EL+VALH+VF+ P D+I+WDVGHQ+YPHKILTGRR +M TIRQT+GLAGF KR ES +D 
Sbjct  125   ELSVALHHVFSTPDDRIIWDVGHQAYPHKILTGRRSRMHTIRQTSGLAGFPKRDESIHDA  184

Query  1930  FGTGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVI  1751
             FG GHSST+ISAGLGMAV RDL G+ N+VI+VIGDGAMTAGQAYEAMNN+GYLDS++I+I
Sbjct  185   FGAGHSSTSISAGLGMAVARDLLGKSNHVISVIGDGAMTAGQAYEAMNNSGYLDSNLIII  244

Query  1750  LNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAA  1571
             LNDNKQVSLPTATLDGP  PVGALSSAL+RLQ++   R LRE AK +TKQIGG  HE+AA
Sbjct  245   LNDNKQVSLPTATLDGPATPVGALSSALTRLQASTKFRMLREAAKSITKQIGGQTHEVAA  304

Query  1570  KVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTE  1391
             KVDEYARGMIS SGS+LFEELGLYYIGPVDGHNI+DL +I ++VK+    GPVLIH+VTE
Sbjct  305   KVDEYARGMISASGSSLFEELGLYYIGPVDGHNIEDLTTIFKKVKAMPAPGPVLIHIVTE  364

Query  1390  KGRGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIH  1211
             KG+GYP AE A DK HGV KF+P TGKQFK+ + T SYT YFAE+LIAEAE D  IVAIH
Sbjct  365   KGKGYPPAEAAPDKMHGVVKFEPKTGKQFKSKSPTLSYTQYFAESLIAEAERDNKIVAIH  424

Query  1210  AAMGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQV  1031
             AAMGGGTGLN FQ++FP RCFDVGIAEQH VTFAAGLA EGLKPFCAIYSSF+QR YDQV
Sbjct  425   AAMGGGTGLNFFQKKFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQV  484

Query  1030  VHDVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVAT  851
             VHDVDLQKLPVRFA+DRAGLVG+DGPTHCGAFD+ +MACLPNMVVMAPSDEAEL +MVAT
Sbjct  485   VHDVDLQKLPVRFALDRAGLVGADGPTHCGAFDIAYMACLPNMVVMAPSDEAELMNMVAT  544

Query  850   AAAIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLS  671
             AAAIDDRPSC R+PRGNGVG  +PP NKGTPL +G+GRILMEG RVA++G+G+ VQ+C+ 
Sbjct  545   AAAIDDRPSCFRFPRGNGVGATVPPNNKGTPLAIGKGRILMEGSRVAILGFGSIVQNCIG  604

Query  670   AAALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALD  491
             A+ LL+ +G+ VT+ADARFCKPLD  LIR LA+ HE+++TVEEGSIGGFGSHV+  ++LD
Sbjct  605   ASTLLKEQGINVTLADARFCKPLDFDLIRRLAREHEILVTVEEGSIGGFGSHVSHLLSLD  664

Query  490   GLLDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEI  326
             GLLDGNLK R +VLPDRYIDHG+P DQ+ EAGL+  HIAATV ++LG  +EA + 
Sbjct  665   GLLDGNLKLRAMVLPDRYIDHGSPQDQIEEAGLSSRHIAATVLSLLGMPKEAFQF  719



>emb|CBI17763.3| unnamed protein product [Vitis vinifera]
Length=690

 Score =   986 bits (2549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/653 (72%), Positives = 553/653 (85%), Gaps = 0/653 (0%)
 Frame = -2

Query  2281  YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELT  2102
             +  ++P TP+LDTINYPIHMKNLS+ EL  LA ELR ++++ VSKTGGHL SSLGV ELT
Sbjct  36    FSGEKPSTPVLDTINYPIHMKNLSIGELETLAAELREEIVYTVSKTGGHLSSSLGVAELT  95

Query  2101  VALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGT  1922
             +ALH+VF+ P+DKI+WDVGHQ+Y HKILTGRR +M TIRQT GLAGF KR ES YD FG 
Sbjct  96    IALHHVFDTPEDKIIWDVGHQAYAHKILTGRRSRMHTIRQTCGLAGFPKRDESIYDAFGA  155

Query  1921  GHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILND  1742
             GHSST+ISAGLGMA GRDL G+ NNVI+VIGDGAMTAGQAYEAMNNAGYLDS++I+ILND
Sbjct  156   GHSSTSISAGLGMAAGRDLLGKNNNVISVIGDGAMTAGQAYEAMNNAGYLDSNLIIILND  215

Query  1741  NKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVD  1562
             N QVSLPTAT+DGP PPVGALS AL+ LQS+R  R+LRE AKG TK +GG  HE+AAKVD
Sbjct  216   NGQVSLPTATVDGPAPPVGALSKALTNLQSSRKFRQLREAAKGFTKHVGGQAHEIAAKVD  275

Query  1561  EYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGR  1382
             EY RG++ GS + LFEELGL YIGPVDGHN++DLV IL +V+     GPVL+HV+TEKG+
Sbjct  276   EYMRGIVGGSHACLFEELGLSYIGPVDGHNVEDLVHILTKVRVMPAPGPVLVHVITEKGK  335

Query  1381  GYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAM  1202
             GY  AE AADK HGV KFD  +GKQ K  +KT S+T YFAE+LIAEAE D++IVAIHAAM
Sbjct  336   GYAPAEVAADKMHGVVKFDAMSGKQLKTKSKTLSHTQYFAESLIAEAERDENIVAIHAAM  395

Query  1201  GGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHD  1022
             GGGTGLNLFQ+RFP RCFDVGIAEQH VTFAAGL  EGLKPFCAIYSSF+QR +DQV HD
Sbjct  396   GGGTGLNLFQKRFPDRCFDVGIAEQHAVTFAAGLDTEGLKPFCAIYSSFLQRGFDQVAHD  455

Query  1021  VDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAA  842
             VDLQKLPVRFAMDRAGLVG+DGPTHCGAFD TFMACLPNMVVMAPS E+EL HMVATAAA
Sbjct  456   VDLQKLPVRFAMDRAGLVGADGPTHCGAFDTTFMACLPNMVVMAPSCESELMHMVATAAA  515

Query  841   IDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAA  662
             IDDRPSC RYP GNG+G +LP  NKGTPLE+G+GR+L EG RVA++GYGT VQ+CL+A  
Sbjct  516   IDDRPSCFRYPGGNGIGSILPQNNKGTPLEIGKGRVLKEGSRVAILGYGTIVQNCLAAGK  575

Query  661   LLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLL  482
             LL+  G+  TVADARFCKPLD  LIR LA+ HEV+ITVEEGSIGGF SHV+ F+ L+GLL
Sbjct  576   LLQVLGVSTTVADARFCKPLDGDLIRQLAQEHEVLITVEEGSIGGFSSHVSHFLGLNGLL  635

Query  481   DGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             DG LKWRP++LPDRYI+HG+  +Q  EAGL+  HIAATV +++G+ +++L ++
Sbjct  636   DGKLKWRPMMLPDRYINHGSQTEQFEEAGLSSRHIAATVLSVMGENKDSLHLL  688



>ref|XP_010656800.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Vitis vinifera]
Length=674

 Score =   986 bits (2548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/653 (72%), Positives = 553/653 (85%), Gaps = 0/653 (0%)
 Frame = -2

Query  2281  YYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVELT  2102
             +  ++P TP+LDTINYPIHMKNLS+ EL  LA ELR ++++ VSKTGGHL SSLGV ELT
Sbjct  20    FSGEKPSTPVLDTINYPIHMKNLSIGELETLAAELREEIVYTVSKTGGHLSSSLGVAELT  79

Query  2101  VALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFGT  1922
             +ALH+VF+ P+DKI+WDVGHQ+Y HKILTGRR +M TIRQT GLAGF KR ES YD FG 
Sbjct  80    IALHHVFDTPEDKIIWDVGHQAYAHKILTGRRSRMHTIRQTCGLAGFPKRDESIYDAFGA  139

Query  1921  GHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILND  1742
             GHSST+ISAGLGMA GRDL G+ NNVI+VIGDGAMTAGQAYEAMNNAGYLDS++I+ILND
Sbjct  140   GHSSTSISAGLGMAAGRDLLGKNNNVISVIGDGAMTAGQAYEAMNNAGYLDSNLIIILND  199

Query  1741  NKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKVD  1562
             N QVSLPTAT+DGP PPVGALS AL+ LQS+R  R+LRE AKG TK +GG  HE+AAKVD
Sbjct  200   NGQVSLPTATVDGPAPPVGALSKALTNLQSSRKFRQLREAAKGFTKHVGGQAHEIAAKVD  259

Query  1561  EYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKGR  1382
             EY RG++ GS + LFEELGL YIGPVDGHN++DLV IL +V+     GPVL+HV+TEKG+
Sbjct  260   EYMRGIVGGSHACLFEELGLSYIGPVDGHNVEDLVHILTKVRVMPAPGPVLVHVITEKGK  319

Query  1381  GYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAAM  1202
             GY  AE AADK HGV KFD  +GKQ K  +KT S+T YFAE+LIAEAE D++IVAIHAAM
Sbjct  320   GYAPAEVAADKMHGVVKFDAMSGKQLKTKSKTLSHTQYFAESLIAEAERDENIVAIHAAM  379

Query  1201  GGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHD  1022
             GGGTGLNLFQ+RFP RCFDVGIAEQH VTFAAGL  EGLKPFCAIYSSF+QR +DQV HD
Sbjct  380   GGGTGLNLFQKRFPDRCFDVGIAEQHAVTFAAGLDTEGLKPFCAIYSSFLQRGFDQVAHD  439

Query  1021  VDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAAA  842
             VDLQKLPVRFAMDRAGLVG+DGPTHCGAFD TFMACLPNMVVMAPS E+EL HMVATAAA
Sbjct  440   VDLQKLPVRFAMDRAGLVGADGPTHCGAFDTTFMACLPNMVVMAPSCESELMHMVATAAA  499

Query  841   IDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAAA  662
             IDDRPSC RYP GNG+G +LP  NKGTPLE+G+GR+L EG RVA++GYGT VQ+CL+A  
Sbjct  500   IDDRPSCFRYPGGNGIGSILPQNNKGTPLEIGKGRVLKEGSRVAILGYGTIVQNCLAAGK  559

Query  661   LLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGLL  482
             LL+  G+  TVADARFCKPLD  LIR LA+ HEV+ITVEEGSIGGF SHV+ F+ L+GLL
Sbjct  560   LLQVLGVSTTVADARFCKPLDGDLIRQLAQEHEVLITVEEGSIGGFSSHVSHFLGLNGLL  619

Query  481   DGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIM  323
             DG LKWRP++LPDRYI+HG+  +Q  EAGL+  HIAATV +++G+ +++L ++
Sbjct  620   DGKLKWRPMMLPDRYINHGSQTEQFEEAGLSSRHIAATVLSVMGENKDSLHLL  672



>gb|AAG10432.1| 1-deoxy-D-xylulose-5-phosphate synthase [Tagetes erecta]
Length=725

 Score =   984 bits (2544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/655 (72%), Positives = 558/655 (85%), Gaps = 0/655 (0%)
 Frame = -2

Query  2284  EYYSQRPPTPLLDTINYPIHMKNLSVKELNQLANELRSDVIFNVSKTGGHLGSSLGVVEL  2105
             +Y   +P TP+LDTINYPIHMKNL V+EL +LA+ELR ++++ VSKTGGHL SSLGVVEL
Sbjct  70    KYSGDKPKTPILDTINYPIHMKNLCVEELVKLADELREEIVYTVSKTGGHLSSSLGVVEL  129

Query  2104  TVALHYVFNAPQDKILWDVGHQSYPHKILTGRREKMPTIRQTNGLAGFTKRSESEYDCFG  1925
             TV+LH+VFN P+DKI+WDVGHQ+YPHKILTGRR +M TIRQT GLAGF KR ES +D FG
Sbjct  130   TVSLHHVFNTPEDKIIWDVGHQAYPHKILTGRRSRMRTIRQTFGLAGFPKRDESNHDAFG  189

Query  1924  TGHSSTTISAGLGMAVGRDLKGRKNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILN  1745
              GHSST+ISAGLGMAVGRDL G+ N+VIAVIGDGAMTAGQAYEAMNNAGYLDS++I++LN
Sbjct  190   AGHSSTSISAGLGMAVGRDLLGKNNHVIAVIGDGAMTAGQAYEAMNNAGYLDSNLIIVLN  249

Query  1744  DNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPLRELREVAKGVTKQIGGPMHELAAKV  1565
             DN+QVSLPTAT+DGP PPVGALS +L+RLQ+++  R+LRE AK VTKQ+G   HE+AAK+
Sbjct  250   DNRQVSLPTATIDGPAPPVGALSRSLTRLQTSQKFRQLREAAKEVTKQLGDKTHEVAAKM  309

Query  1564  DEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLVSILQEVKSTKTTGPVLIHVVTEKG  1385
             D   +GM+ G G+++FEELGLYY+GPVDGHN++DLV +  ++KS    GPVL+H+VTEKG
Sbjct  310   DSLVKGMVGGQGASMFEELGLYYVGPVDGHNLEDLVYVFDKIKSMTAPGPVLVHIVTEKG  369

Query  1384  RGYPYAEKAADKYHGVTKFDPATGKQFKASAKTQSYTTYFAEALIAEAEADKDIVAIHAA  1205
             +GYP AE AADK HGV KFD  TGKQ K   KT SYT YF ++L+AEA+ D  IVAIHAA
Sbjct  370   KGYPPAEVAADKMHGVVKFDTQTGKQKKNKTKTLSYTQYFVDSLVAEAKEDDKIVAIHAA  429

Query  1204  MGGGTGLNLFQRRFPSRCFDVGIAEQHGVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVH  1025
             MGGGTGLN FQ+ FP+RCFDVGIAEQH +TFAAGLA EGLKPFCAIYSSF+QR YDQVVH
Sbjct  430   MGGGTGLNTFQKEFPARCFDVGIAEQHAITFAAGLATEGLKPFCAIYSSFLQRGYDQVVH  489

Query  1024  DVDLQKLPVRFAMDRAGLVGSDGPTHCGAFDVTFMACLPNMVVMAPSDEAELFHMVATAA  845
             DVDLQKLPVRFAMDRAGLVG+DGPTHCGAFD TFMACLPNMVVMAPS EAEL +MVATA 
Sbjct  490   DVDLQKLPVRFAMDRAGLVGADGPTHCGAFDTTFMACLPNMVVMAPSCEAELMNMVATAV  549

Query  844   AIDDRPSCLRYprgngvgvvlppgnkGTPLEVGRGRILMEGERVALVGYGTAVQSCLSAA  665
             AIDDRPSC RYPRGNG+G +LP  NKGT +EVG GR++ EG RVAL+GYGT VQSCL+A+
Sbjct  550   AIDDRPSCFRYPRGNGIGSILPANNKGTLIEVGTGRVIKEGNRVALLGYGTIVQSCLAAS  609

Query  664   ALLETRGLRVTVADARFCKPLDHALIRSLAKSHEVMITVEEGSIGGFGSHVAQFMALDGL  485
              +L+  G+ VTVADARFCKPLD  LI+ LA  HEV+ITVEEGSIGGF SHV+ F+AL+GL
Sbjct  610   EVLKKIGISVTVADARFCKPLDGNLIKQLANEHEVLITVEEGSIGGFSSHVSHFLALNGL  669

Query  484   LDGNLKWRPLVLPDRYIDHGAPADQLAEAGLTPSHIAATVFNILGKAREALEIMT  320
             LDG+LKWR ++LPDRYI+HGA +DQ+ EAGL+  HIAATV +++G ++E L  + 
Sbjct  670   LDGHLKWRAMMLPDRYIEHGAQSDQIEEAGLSSKHIAATVLSLIGGSKETLHALN  724



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10140230264372