BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16995_g2_i1 len=1279 path=[2593:0-739 2592:740-779 25:780-1278]

Length=1279
                                                                      Score     E

ref|XP_010033723.1|  PREDICTED: uncharacterized protein LOC104422973    294   2e-93   
ref|XP_011012020.1|  PREDICTED: uncharacterized protein LOC105116386    293   4e-93   
ref|XP_007024667.1|  Uncharacterized protein TCM_029168                 292   1e-92   
ref|XP_011081526.1|  PREDICTED: uncharacterized protein LOC105164552    287   1e-90   
ref|XP_002304121.2|  hypothetical protein POPTR_0003s06620g             285   8e-90   Populus trichocarpa [western balsam poplar]
ref|XP_011036472.1|  PREDICTED: uncharacterized protein LOC105133976    281   2e-88   
ref|XP_006369124.1|  hypothetical protein POPTR_0001s16690g             279   3e-87   
emb|CDO97832.1|  unnamed protein product                                279   3e-87   
ref|XP_010654413.1|  PREDICTED: uncharacterized protein LOC100249...    278   4e-87   
ref|XP_011072657.1|  PREDICTED: uncharacterized protein LOC105157859    278   6e-87   
ref|XP_004252519.1|  PREDICTED: uncharacterized protein LOC101266104    278   8e-87   
ref|XP_008228169.1|  PREDICTED: uncharacterized protein LOC103327608    275   4e-86   
ref|XP_006361334.1|  PREDICTED: uncharacterized protein LOC102585440    273   3e-85   
ref|XP_009350860.1|  PREDICTED: uncharacterized protein LOC103942400    273   5e-85   
ref|XP_002272432.2|  PREDICTED: uncharacterized protein LOC100249...    267   5e-83   Vitis vinifera
ref|XP_009772866.1|  PREDICTED: uncharacterized protein LOC104223189    266   2e-82   
ref|XP_010685287.1|  PREDICTED: uncharacterized protein LOC104899...    264   1e-81   
ref|XP_004305759.1|  PREDICTED: uncharacterized protein LOC101312755    262   6e-81   
ref|XP_007135421.1|  hypothetical protein PHAVU_010G128000g             260   2e-80   
ref|XP_008462281.1|  PREDICTED: uncharacterized protein LOC103500...    260   3e-80   
ref|XP_008462282.1|  PREDICTED: uncharacterized protein LOC103500...    259   9e-80   
ref|XP_004141714.1|  PREDICTED: uncharacterized protein LOC101207004    258   1e-79   
gb|KDO64967.1|  hypothetical protein CISIN_1g040349mg                   256   2e-78   
ref|XP_004510522.1|  PREDICTED: uncharacterized protein LOC101501332    252   4e-77   
ref|XP_003529839.1|  PREDICTED: uncharacterized protein LOC100808146    252   5e-77   
gb|KHN01427.1|  hypothetical protein glysoja_009633                     251   1e-76   
ref|XP_010685288.1|  PREDICTED: uncharacterized protein LOC104899...    250   2e-76   
ref|XP_008342054.1|  PREDICTED: uncharacterized protein LOC103404866    248   6e-76   
ref|XP_007216439.1|  hypothetical protein PRUPE_ppa021925mg             248   9e-76   
ref|XP_009599830.1|  PREDICTED: uncharacterized protein LOC104095403    248   2e-75   
gb|KEH18489.1|  hypothetical protein MTR_8g021237                       246   5e-75   
ref|XP_003548367.1|  PREDICTED: uncharacterized protein LOC100811893    243   9e-74   
gb|KHN39614.1|  hypothetical protein glysoja_020692                     243   3e-73   
ref|XP_009778621.1|  PREDICTED: uncharacterized protein LOC104227935    235   4e-71   
gb|KDP40678.1|  hypothetical protein JCGZ_24677                         234   2e-70   
ref|XP_009607430.1|  PREDICTED: uncharacterized protein LOC104101650    237   5e-70   
ref|XP_007139074.1|  hypothetical protein PHAVU_009G262800g             234   8e-70   
ref|XP_010540190.1|  PREDICTED: uncharacterized protein LOC104814044    231   1e-68   
ref|XP_002888880.1|  hypothetical protein ARALYDRAFT_476382             229   4e-68   
emb|CBI35848.3|  unnamed protein product                                228   4e-68   
ref|XP_009104854.1|  PREDICTED: uncharacterized protein LOC103830789    229   5e-68   
ref|XP_002532726.1|  conserved hypothetical protein                     228   6e-68   Ricinus communis
gb|EYU21305.1|  hypothetical protein MIMGU_mgv1a024559mg                226   7e-67   
ref|XP_006390651.1|  hypothetical protein EUTSA_v10019851mg             226   1e-66   
ref|XP_010537630.1|  PREDICTED: uncharacterized protein LOC104812257    225   2e-66   
ref|XP_006302634.1|  hypothetical protein CARUB_v10020740mg             224   3e-66   
ref|XP_006426700.1|  hypothetical protein CICLE_v10027453mg             223   2e-65   
ref|XP_010415999.1|  PREDICTED: uncharacterized protein LOC104701933    221   5e-65   
ref|XP_006416708.1|  hypothetical protein EUTSA_v10009299mg             221   6e-65   
ref|XP_010428134.1|  PREDICTED: uncharacterized protein LOC104712...    220   2e-64   
ref|XP_010428135.1|  PREDICTED: uncharacterized protein LOC104712...    220   2e-64   
ref|NP_177393.2|  uncharacterized protein                               219   5e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KHN11347.1|  hypothetical protein glysoja_036044                     217   8e-64   
ref|XP_009105908.1|  PREDICTED: uncharacterized protein LOC103831755    217   2e-63   
ref|XP_010261786.1|  PREDICTED: uncharacterized protein LOC104600511    215   6e-63   
ref|XP_002892949.1|  hypothetical protein ARALYDRAFT_471945             215   2e-62   
ref|NP_173183.3|  uncharacterized protein                               213   8e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498086.1|  PREDICTED: uncharacterized protein LOC104775850    213   1e-61   
ref|XP_010459328.1|  PREDICTED: uncharacterized protein LOC104740...    213   2e-61   
ref|XP_009149192.1|  PREDICTED: uncharacterized protein LOC103872526    209   3e-60   
ref|XP_006605277.1|  PREDICTED: uncharacterized protein LOC100814844    206   2e-58   
ref|XP_010459327.1|  PREDICTED: uncharacterized protein LOC104740...    205   3e-58   
ref|XP_006577366.1|  PREDICTED: uncharacterized protein LOC100786825    203   4e-58   
emb|CDX96411.1|  BnaA07g30220D                                          202   2e-57   
ref|XP_010111989.1|  Nucleoside diphosphate kinase 6                    206   2e-57   
ref|XP_003627330.1|  hypothetical protein MTR_8g021200                  198   6e-57   
ref|XP_002277684.1|  PREDICTED: uncharacterized protein LOC100257848    196   1e-55   Vitis vinifera
ref|XP_010476888.1|  PREDICTED: glutamic acid-rich protein-like         196   3e-55   
ref|XP_009127937.1|  PREDICTED: uncharacterized protein LOC103852785    195   7e-55   
ref|XP_006305422.1|  hypothetical protein CARUB_v10009828mg             195   8e-55   
emb|CDY48301.1|  BnaC05g13550D                                          197   8e-55   
ref|XP_010531879.1|  PREDICTED: uncharacterized protein LOC104808...    192   4e-54   
gb|KHN16376.1|  hypothetical protein glysoja_033780                     192   2e-53   
ref|XP_010273857.1|  PREDICTED: uncharacterized protein LOC104609282    190   2e-53   
emb|CDY26247.1|  BnaA06g11700D                                          189   2e-52   
emb|CDX96771.1|  BnaA08g23140D                                          187   7e-52   
gb|AAG52588.1|AC016529_19  hypothetical protein; 22751-23787            186   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110412.1|  PREDICTED: uncharacterized protein LOC103835958    185   4e-51   
gb|AAF79489.1|AC022492_33  F1L3.5                                       184   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006836601.1|  hypothetical protein AMTR_s00131p00105060          183   1e-50   
emb|CDX83907.1|  BnaC08g17380D                                          182   3e-50   
ref|XP_010531878.1|  PREDICTED: uncharacterized protein LOC104808...    182   5e-50   
ref|XP_010939894.1|  PREDICTED: uncharacterized protein LOC105058613    181   7e-50   
emb|CDY03636.1|  BnaA02g16010D                                          178   5e-48   
emb|CDY53299.1|  BnaC02g46380D                                          176   7e-48   
gb|AAF97317.1|AC007843_20  Hypothetical protein                         171   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010937372.1|  PREDICTED: uncharacterized protein LOC105056767    176   2e-46   
ref|XP_010322990.1|  PREDICTED: uncharacterized protein LOC104648114    169   3e-46   
ref|XP_008786930.1|  PREDICTED: uncharacterized protein LOC103705093    171   6e-46   
ref|XP_002516251.1|  conserved hypothetical protein                     167   5e-45   Ricinus communis
ref|XP_008242324.1|  PREDICTED: uncharacterized protein LOC103340664    163   5e-43   
ref|XP_004959822.1|  PREDICTED: uncharacterized protein LOC101779024    162   8e-43   
gb|EYU45892.1|  hypothetical protein MIMGU_mgv1a017823mg                160   2e-42   
ref|XP_009406841.1|  PREDICTED: uncharacterized protein LOC103989647    157   2e-40   
ref|XP_009404177.1|  PREDICTED: uncharacterized protein LOC103987...    154   1e-39   
ref|XP_011039964.1|  PREDICTED: uncharacterized protein LOC105136356    153   1e-39   
ref|XP_004986912.1|  PREDICTED: uncharacterized protein LOC101771763    151   2e-38   
ref|XP_009597245.1|  PREDICTED: uncharacterized protein LOC104093219    150   2e-38   
ref|XP_009404176.1|  PREDICTED: uncharacterized protein LOC103987...    149   8e-38   
ref|XP_010917475.1|  PREDICTED: uncharacterized protein LOC105042073    147   2e-37   
ref|XP_009796965.1|  PREDICTED: uncharacterized protein LOC104243476    146   4e-37   
ref|XP_007012607.1|  Uncharacterized protein TCM_037503                 149   4e-37   
ref|XP_007203967.1|  hypothetical protein PRUPE_ppa023774mg             143   1e-35   
gb|AFW88086.1|  hypothetical protein ZEAMMB73_597563                    142   2e-35   
ref|XP_009337231.1|  PREDICTED: uncharacterized protein LOC103929730    140   6e-35   
ref|XP_006381603.1|  hypothetical protein POPTR_0006s14240g             141   6e-35   
ref|XP_011093842.1|  PREDICTED: uncharacterized protein LOC105173691    139   2e-34   
ref|XP_002465154.1|  hypothetical protein SORBIDRAFT_01g032860          139   3e-34   Sorghum bicolor [broomcorn]
emb|CDX68264.1|  BnaA07g23040D                                          138   4e-34   
ref|XP_006658811.1|  PREDICTED: uncharacterized protein LOC102708077    139   4e-34   
ref|XP_006597880.1|  PREDICTED: uncharacterized protein LOC102665474    138   5e-34   
ref|XP_007138640.1|  hypothetical protein PHAVU_009G225800g             138   7e-34   
ref|XP_003534954.2|  PREDICTED: uncharacterized protein LOC100775761    136   3e-33   
ref|XP_009390430.1|  PREDICTED: uncharacterized protein LOC103976829    135   5e-33   
gb|KHN12293.1|  hypothetical protein glysoja_026185                     133   3e-32   
ref|XP_008654146.1|  PREDICTED: uncharacterized protein LOC103634391    133   6e-32   
ref|NP_001060263.1|  Os07g0614400                                       133   8e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003559965.1|  PREDICTED: uncharacterized protein LOC100842803    132   1e-31   
ref|XP_010497648.1|  PREDICTED: uncharacterized protein LOC104775028    125   4e-31   
gb|EMT10978.1|  hypothetical protein F775_02087                         128   2e-29   
emb|CDX72918.1|  BnaC06g33660D                                          123   3e-29   
gb|EAZ04698.1|  hypothetical protein OsI_26858                          124   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_009389860.1|  PREDICTED: uncharacterized protein LOC103976393    122   2e-28   
ref|XP_008792891.1|  PREDICTED: uncharacterized protein LOC103709370    120   6e-28   
tpg|DAA63587.1|  TPA: hypothetical protein ZEAMMB73_189953              121   1e-27   
ref|XP_004161131.1|  PREDICTED: uncharacterized protein LOC101232294    119   3e-27   
gb|KHN42784.1|  hypothetical protein glysoja_038346                     116   2e-26   
gb|KCW79378.1|  hypothetical protein EUGRSUZ_C00791                     115   2e-26   
ref|XP_006367433.1|  PREDICTED: uncharacterized protein LOC102585817    116   3e-26   
ref|XP_009801637.1|  PREDICTED: uncharacterized protein LOC104247...    115   4e-26   
ref|XP_010050437.1|  PREDICTED: uncharacterized protein LOC104439000    116   1e-25   
ref|XP_006475098.1|  PREDICTED: uncharacterized protein LOC102614440    111   7e-25   
ref|NP_001063278.1|  Os09g0439800                                       111   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010323988.1|  PREDICTED: uncharacterized protein LOC101261...    111   1e-24   
ref|XP_009598284.1|  PREDICTED: uncharacterized protein LOC104094124    111   1e-24   
ref|XP_010667542.1|  PREDICTED: uncharacterized protein LOC104884565    111   2e-24   
emb|CDP03060.1|  unnamed protein product                                110   5e-24   
gb|EEC75443.1|  hypothetical protein OsI_11979                          109   2e-23   Oryza sativa Indica Group [Indian rice]
gb|AAU89241.1|  hypothetical protein                                    110   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EEE59230.1|  hypothetical protein OsJ_11212                          109   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002461010.1|  hypothetical protein SORBIDRAFT_02g039163          108   2e-23   Sorghum bicolor [broomcorn]
ref|XP_010086679.1|  hypothetical protein L484_000781                   108   2e-23   
ref|XP_010323989.1|  PREDICTED: uncharacterized protein LOC101261...    107   4e-23   
ref|XP_008661108.1|  PREDICTED: uncharacterized protein LOC103640271    105   6e-23   
ref|XP_004956930.1|  PREDICTED: uncharacterized protein LOC101758998    106   8e-23   
ref|XP_010238214.1|  PREDICTED: uncharacterized protein LOC100830...    106   8e-23   
ref|XP_009801636.1|  PREDICTED: uncharacterized protein LOC104247...    104   5e-22   
ref|XP_008450944.1|  PREDICTED: uncharacterized protein LOC103492...    103   1e-21   
ref|XP_006660662.1|  PREDICTED: uncharacterized protein LOC102701575    102   2e-21   
gb|EEE67587.1|  hypothetical protein OsJ_25119                          102   3e-21   Oryza sativa Japonica Group [Japonica rice]
dbj|BAN59748.1|  early auxin response protein                           100   5e-21   
gb|EAZ44876.1|  hypothetical protein OsJ_29516                          100   1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09249.1|  hypothetical protein OsI_31522                        99.0    4e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_010238213.1|  PREDICTED: uncharacterized protein LOC100830...  97.8    2e-19   
ref|XP_010238212.1|  PREDICTED: uncharacterized protein LOC100830...  97.4    3e-19   
ref|XP_010230135.1|  PREDICTED: uncharacterized protein LOC100823948  94.0    6e-19   
ref|XP_006651487.1|  PREDICTED: uncharacterized protein LOC102712432  94.4    2e-18   
gb|EMT28023.1|  hypothetical protein F775_01939                       92.0    2e-17   
ref|XP_003595336.1|  hypothetical protein MTR_2g042670                90.9    2e-17   
ref|XP_002462450.1|  hypothetical protein SORBIDRAFT_02g025775        90.5    3e-17   Sorghum bicolor [broomcorn]
ref|XP_009383154.1|  PREDICTED: uncharacterized protein LOC103970971  89.7    5e-17   
ref|XP_006452829.1|  hypothetical protein CICLE_v10010597mg           88.2    2e-16   
ref|XP_008652771.1|  PREDICTED: uncharacterized protein LOC103632815  87.0    4e-16   
ref|XP_008450943.1|  PREDICTED: uncharacterized protein LOC103492...  87.8    5e-16   
gb|KDO73859.1|  hypothetical protein CISIN_1g041375mg                 86.7    6e-16   
ref|XP_004488128.1|  PREDICTED: uncharacterized protein LOC101503007  85.9    9e-16   
ref|XP_009117564.1|  PREDICTED: uncharacterized protein LOC103842...  84.7    9e-16   
ref|XP_008460313.1|  PREDICTED: uncharacterized protein LOC103499172  85.5    1e-15   
ref|XP_010462785.1|  PREDICTED: uncharacterized protein LOC104743395  82.4    3e-14   
ref|XP_010477114.1|  PREDICTED: uncharacterized protein LOC104756...  80.5    3e-14   
gb|EYU25842.1|  hypothetical protein MIMGU_mgv1a022105mg              81.3    3e-14   
ref|XP_009117565.1|  PREDICTED: uncharacterized protein LOC103842...  73.9    6e-12   
ref|XP_002890319.1|  hypothetical protein ARALYDRAFT_472133           73.6    7e-12   
emb|CDY21681.1|  BnaA09g44320D                                        73.2    2e-11   
ref|XP_010498321.1|  PREDICTED: uncharacterized protein LOC104776025  71.6    3e-11   
emb|CDY50636.1|  BnaC06g24290D                                        70.9    5e-11   
emb|CDX81915.1|  BnaC08g36860D                                        71.6    5e-11   
ref|NP_001117311.1|  uncharacterized protein                          70.5    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477117.1|  PREDICTED: uncharacterized protein LOC104756...  70.1    1e-10   
ref|NP_001117312.1|  uncharacterized protein                          70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28324.1|  unknown                                               70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117313.1|  uncharacterized protein                          70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79295.1|AC068602_18  F14D16.27                                  70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306438.1|  hypothetical protein CARUB_v10012380mg           69.3    2e-10   
ref|XP_006416536.1|  hypothetical protein EUTSA_v10009462mg           69.3    2e-10   
ref|XP_010477116.1|  PREDICTED: uncharacterized protein LOC104756...  69.3    2e-10   
gb|EMS54923.1|  hypothetical protein TRIUR3_20000                     67.0    3e-09   
emb|CDX83786.1|  BnaC08g18590D                                        57.8    1e-06   
emb|CDY41020.1|  BnaC05g14780D                                        55.1    3e-06   
gb|EYU28317.1|  hypothetical protein MIMGU_mgv1a026132mg              55.1    2e-05   



>ref|XP_010033723.1| PREDICTED: uncharacterized protein LOC104422973 [Eucalyptus grandis]
 gb|KCW53522.1| hypothetical protein EUGRSUZ_J02802 [Eucalyptus grandis]
Length=273

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 169/289 (58%), Positives = 210/289 (73%), Gaps = 20/289 (7%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F+W+QN+ NG + G+ K  PVP    +H KQEPR EEFSDWP   LAIGT GNND  
Sbjct  1    MKLFSWVQNKLNGTK-GNAKPEPVPSNRHHHVKQEPR-EEFSDWPQGLLAIGTFGNNDLG  58

Query  305  ESARKPekneiiveegeeeeQ---CSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQ  475
            E+       +   +E ++  Q    SSPDL++FTPEEVGKLQKALTKLLSRKP+SK E +
Sbjct  59   ENQESQNNLQENNQESQDNIQENPSSSPDLSDFTPEEVGKLQKALTKLLSRKPSSKVERE  118

Query  476  TNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQ  655
            T  D PLDRFLNCPSSLEVDRR+S +S ++   D +ED I+RTI  IIG+CK++C  N +
Sbjct  119  T-TDQPLDRFLNCPSSLEVDRRVS-SSLSSEPGDREED-IERTISIIIGKCKEICADNSK  175

Query  656  HKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAAS  835
             K+IGKKS+SFL+KKMFVCRSGFAP+PSLRD   ESRMEKLLRT+L KK+YPQN SRA+S
Sbjct  176  -KAIGKKSISFLLKKMFVCRSGFAPAPSLRDPLPESRMEKLLRTLLRKKMYPQNTSRASS  234

Query  836  LKRFLENkrtsaatataiaeeeeekkrertSDSG-RWDKTDSEYIVLEI  979
            +KR+LE+                +K+++  +D G +WDKTDSEYIVLEI
Sbjct  235  MKRYLED----------KPISRADKEKQEEADEGSKWDKTDSEYIVLEI  273



>ref|XP_011012020.1| PREDICTED: uncharacterized protein LOC105116386 [Populus euphratica]
 ref|XP_011012021.1| PREDICTED: uncharacterized protein LOC105116386 [Populus euphratica]
Length=271

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 207/285 (73%), Gaps = 14/285 (5%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F+WMQN+ NG Q  + K   V    T H KQE R EEFSDWP   LAIGT GN +  
Sbjct  1    MKLFSWMQNKLNGKQGNNTKPNAVIS-ATRHVKQESR-EEFSDWPHGLLAIGTFGNKELG  58

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            ES       +   ++  EE+   S DL +FTPEE+GKLQK LTKLL+RKP S+ + +  A
Sbjct  59   ESNE---IQDAEEDQLVEEDPSPSHDLQDFTPEEIGKLQKELTKLLTRKPTSQDKEKETA  115

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            +LPLDRFLNCPSSLEVDRR+SNT+  +   D  ED+I+RTI  I+GRCKD+CE NK+ K+
Sbjct  116  NLPLDRFLNCPSSLEVDRRVSNTAIGD--VDDKEDDIERTISVILGRCKDICENNKK-KA  172

Query  665  IGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKR  844
            IGKKSVSFL+KK+FVCRSGFAP PSLRDT QESRMEKLLRT+L KKI PQ+ SRA+S+K+
Sbjct  173  IGKKSVSFLLKKIFVCRSGFAPQPSLRDTLQESRMEKLLRTLLHKKINPQSTSRASSMKK  232

Query  845  FLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            ++E+         +  E+E+++KR +TSD  +W KTDSEYIVLEI
Sbjct  233  YIED------KKISKKEKEDDEKRYKTSDGSKWVKTDSEYIVLEI  271



>ref|XP_007024667.1| Uncharacterized protein TCM_029168 [Theobroma cacao]
 gb|EOY27289.1| Uncharacterized protein TCM_029168 [Theobroma cacao]
Length=272

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 167/285 (59%), Positives = 200/285 (70%), Gaps = 13/285 (5%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFF WMQN+FNG Q  S+   P     T   KQEPR EEFSDWP   LAIGT GNND  
Sbjct  1    MKFFGWMQNKFNGKQGSSK---PNTVSATRRMKQEPR-EEFSDWPHGLLAIGTFGNNDLK  56

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            E+ +     +       +EE  SS DL EFT EEVGKLQK LTKLLSRKP S  + +  A
Sbjct  57   ENPQCQNTIQQDHPSDIQEEPSSSEDLQEFTQEEVGKLQKELTKLLSRKPTSDVQKEL-A  115

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            +LPLDRFLNCPSSLEVDRR+SN   ++S  D +ED IDRTI  I+GRCKD+C +NK+ K+
Sbjct  116  NLPLDRFLNCPSSLEVDRRISNALCSDS-GDREED-IDRTISVILGRCKDICAENKK-KA  172

Query  665  IGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKR  844
            IGKKS+SFL+KKMFVC SGF+P+PSL DT QESRMEKLLR +L KKIY QNPSRA+SLK+
Sbjct  173  IGKKSISFLLKKMFVCASGFSPAPSLSDTLQESRMEKLLRVMLHKKIYSQNPSRASSLKK  232

Query  845  FLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +LE+              ++E +  ++ D  +W KTDSEYIVLEI
Sbjct  233  YLED-----KQTPKRQNNQDETRERKSEDGSKWVKTDSEYIVLEI  272



>ref|XP_011081526.1| PREDICTED: uncharacterized protein LOC105164552 [Sesamum indicum]
Length=278

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 166/286 (58%), Positives = 201/286 (70%), Gaps = 9/286 (3%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFFNWMQ++F+ GQ   R    +    TNH + EP  E FSDWP S L IGTLGN D  
Sbjct  1    MKFFNWMQSKFSSGQGDKRANSVLD---TNHKRVEPPKEGFSDWPHSLLTIGTLGNKDLT  57

Query  305  ESARKPekneiiveege-eeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
            +     + ++ +      +EEQCSSPD +EFT EEVGKLQK LTKLL RKPA+    +  
Sbjct  58   DKQEIVKVDQNLQNGRTPQEEQCSSPDFSEFTAEEVGKLQKELTKLLRRKPAASKPEERM  117

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
            ADLPLDRFLNCPSSLEVDR +S+  +  S+ D DE+EIDRTIR I+GRCKDVCEK K+  
Sbjct  118  ADLPLDRFLNCPSSLEVDRTVSDRFSTYSVDDKDEEEIDRTIRIILGRCKDVCEKKKKKT  177

Query  662  SIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLK  841
            +IGKKS+SFLVKKMFVC SGF P+PSLRDT QESRMEKLLRT+LSKKIY ++ SRA S K
Sbjct  178  AIGKKSLSFLVKKMFVCSSGFVPTPSLRDTLQESRMEKLLRTMLSKKIYHRSSSRATSTK  237

Query  842  RFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            + L++ R +        E  ++ +     D  +WDKTDSEYIVLEI
Sbjct  238  KCLQDGRPTLTNPETEDESHDKYR-----DGSKWDKTDSEYIVLEI  278



>ref|XP_002304121.2| hypothetical protein POPTR_0003s06620g [Populus trichocarpa]
 gb|EEE79100.2| hypothetical protein POPTR_0003s06620g [Populus trichocarpa]
Length=266

 Score =   285 bits (729),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 159/285 (56%), Positives = 206/285 (72%), Gaps = 19/285 (7%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F+WMQN+ NG Q   RK   V    T H KQE R EEFSDWP   LAIGT GNN+  
Sbjct  1    MKLFSWMQNKINGKQGNCRKPNTVLS-ATQHVKQESR-EEFSDWPHGLLAIGTFGNNELR  58

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            ++            +  EE+   S DL +FTPEE+GKLQK LT+LL+RKP+S+ + +  A
Sbjct  59   DN---------NEIQDVEEDPSPSDDLQDFTPEEIGKLQKELTELLTRKPSSQDKEKEIA  109

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            +LPLDRFLNCPSSLEVDRR+SNT  ++   D  ED+I+RTI  I+GRCKD+CE N + K+
Sbjct  110  NLPLDRFLNCPSSLEVDRRISNTVISD--VDNHEDDIERTISVILGRCKDICENNNKKKA  167

Query  665  IGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKR  844
            IGK+S+SFL+KK+FVC SGFAP PSLRDT  ESRMEKLLRT+L KKI PQ+ SRA+S+K+
Sbjct  168  IGKRSISFLLKKIFVCTSGFAPQPSLRDTLHESRMEKLLRTLLHKKINPQSTSRASSMKK  227

Query  845  FLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            ++E+       +T   ++E+++KR++TS+  +W KTDSEYIVLEI
Sbjct  228  YIED------RSTPKKDKEDDEKRDKTSNGSKWVKTDSEYIVLEI  266



>ref|XP_011036472.1| PREDICTED: uncharacterized protein LOC105133976 [Populus euphratica]
Length=266

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/285 (55%), Positives = 205/285 (72%), Gaps = 19/285 (7%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F+WMQN+ NG Q   RK   V      H KQE R EEFSDWP   LAIGT GNN+  
Sbjct  1    MKLFSWMQNKINGKQGKCRKPNTVLS-AAQHVKQESR-EEFSDWPHGLLAIGTFGNNELR  58

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            ++            +  EE+   S DL +FTPEE+GKLQK LT+LL+RKP+S+ + +  A
Sbjct  59   DN---------NEIQDVEEDPSPSDDLQDFTPEEIGKLQKELTELLTRKPSSQDKEKEIA  109

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            +LPLDRFLNCPSSLEVDRR+SNT  ++   D  ED+I+RTI  I+GRCKD+C+ N + K+
Sbjct  110  NLPLDRFLNCPSSLEVDRRISNTVISD--VDNHEDDIERTISVILGRCKDICDSNNKKKA  167

Query  665  IGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKR  844
            IGK+S+SFL+KK+FVC SGFAP PSLRDT  ESRMEKLLRT+L KKI PQ+ SRA+S+K+
Sbjct  168  IGKRSISFLLKKIFVCTSGFAPQPSLRDTLHESRMEKLLRTLLHKKINPQSTSRASSMKK  227

Query  845  FLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            ++E+       +T   ++E+++KR++TS+  +W KTDSEYIVLEI
Sbjct  228  YIED------RSTPKKDKEDDEKRDKTSNGSKWVKTDSEYIVLEI  266



>ref|XP_006369124.1| hypothetical protein POPTR_0001s16690g [Populus trichocarpa]
 gb|ERP65693.1| hypothetical protein POPTR_0001s16690g [Populus trichocarpa]
Length=287

 Score =   279 bits (713),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 158/279 (57%), Positives = 201/279 (72%), Gaps = 14/279 (5%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F+WMQN+ NG Q  + K   V    T H KQE R EEFSDWP   LAIGT GN +  
Sbjct  1    MKLFSWMQNKLNGKQGNNTKPNAVIS-ATRHVKQESR-EEFSDWPHGLLAIGTFGNKELG  58

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            ES       +   ++  EE+  SS DL +FTPEE+GKLQK LTKLL+RKP S+ + +  A
Sbjct  59   ESNE---IQDAEEDQLVEEDPSSSHDLQDFTPEEIGKLQKELTKLLTRKPTSQDKEKETA  115

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            +LPLDRFLNCPSSLEVDRR+SNT+  +   D  ED+I+RTI  I+GRCKD+CE NK+ K+
Sbjct  116  NLPLDRFLNCPSSLEVDRRVSNTAIGD--VDDKEDDIERTISVILGRCKDICENNKK-KA  172

Query  665  IGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKR  844
            IGKKS+SFL+KK+FVCRSGFAP PSLRDT QESRMEKLLRT+L KKI PQ+ SR +S+K+
Sbjct  173  IGKKSISFLLKKIFVCRSGFAPQPSLRDTLQESRMEKLLRTLLHKKINPQSTSRPSSMKK  232

Query  845  FLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            ++E+         +  E+E+++K+ +TSD  +W KTDSE
Sbjct  233  YIED------KKISKKEKEDDEKQYKTSDGSKWVKTDSE  265



>emb|CDO97832.1| unnamed protein product [Coffea canephora]
Length=283

 Score =   279 bits (713),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 200/294 (68%), Gaps = 27/294 (9%)
 Frame = +2

Query  143  MQNRFNGGQAGSRKGYPVPPPTTNHGK-QEPRNEEFSDWPGSFLAIGTLGNNDPPES---  310
            MQN+ NGGQA  +   P   P  N  K +EP  E+FS W    LAIGT GN D  E    
Sbjct  1    MQNKLNGGQANKK---PNAVPAANQTKFEEPGKEKFSGWSNGLLAIGTFGNRDRREDEEI  57

Query  311  --ARKPekneiiveegeeeeQCSSPD-LAEFTPEEVGKLQKALTKLLSRKPASKGE----  469
              A    + +      E+ EQCSSPD L EFTPEEVG+LQK LT+LL RKP S       
Sbjct  58   QRAAHTAETDSHEILQEDHEQCSSPDDLTEFTPEEVGQLQKELTRLLKRKPTSTAATKAT  117

Query  470  ----AQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDV  637
                ++  ADLPLDRFLNCPSSLEVDR +SN  + NS Y  DE++IDRTIR IIGRCK+V
Sbjct  118  PLEGSEVAADLPLDRFLNCPSSLEVDRTVSNRFSVNSDYR-DEEDIDRTIRVIIGRCKEV  176

Query  638  CEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQN  817
            C +NK+  +IGKKS+SFL+KKMFVCRSGFAP+PSLRDT QESRMEKLLRT+LSKK+YPQN
Sbjct  177  CMENKK-AAIGKKSISFLLKKMFVCRSGFAPAPSLRDTLQESRMEKLLRTMLSKKMYPQN  235

Query  818  PSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             SRA+S+KR LE+             E+E++ +++  +  +W KTDSE+IVL++
Sbjct  236  ASRASSMKRILED-------RHTQKGEKEDETQDKIQEVCKWVKTDSEFIVLDL  282



>ref|XP_010654413.1| PREDICTED: uncharacterized protein LOC100249804 isoform X1 [Vitis 
vinifera]
Length=266

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 160/288 (56%), Positives = 200/288 (69%), Gaps = 25/288 (9%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNND--  298
            MK F WMQN+ N  Q G+RK     P  T+  KQEP  EEFSDWP   LAIGT GNND  
Sbjct  1    MKLFGWMQNKLNVRQ-GNRKTNA--PSATHLTKQEPIKEEFSDWPHGLLAIGTFGNNDLK  57

Query  299  -PPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQ  475
              PES   P + +            SS +L +FTPEE+GKLQK LTKLLSRKPAS  E +
Sbjct  58   ENPESQNPPHQEDPS----------SSEELLDFTPEEIGKLQKELTKLLSRKPASNVEKE  107

Query  476  TNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQ  655
              A+LPLD+FLNCPSSLEVDRR+S T  ++S  D  ++ I+RTI  I+G+C++VC  + +
Sbjct  108  I-AELPLDKFLNCPSSLEVDRRISATLCSDS--DDKDENIERTISVILGKCREVCTDHGK  164

Query  656  HKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAAS  835
             K+IGK+S+SFL+KKMFVCRSGFAP+PSLRDT QESRMEKLLR +L KKIYPQN SRA+S
Sbjct  165  -KNIGKRSLSFLLKKMFVCRSGFAPAPSLRDTLQESRMEKLLRAMLHKKIYPQNSSRASS  223

Query  836  LKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +K++LE+             E+E +++ +  D  +W KTDSEYIVLEI
Sbjct  224  MKKYLED-----KQRPKRENEDEVQEKHKAKDGYKWVKTDSEYIVLEI  266



>ref|XP_011072657.1| PREDICTED: uncharacterized protein LOC105157859 [Sesamum indicum]
Length=283

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 167/284 (59%), Positives = 202/284 (71%), Gaps = 13/284 (5%)
 Frame = +2

Query  128  KFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPPE  307
            +FFNWMQ++FNGGQ   R       P TNH K+EP  EEFSDWP   LAIGT GN D  +
Sbjct  13   QFFNWMQSKFNGGQGDKRSN---AVPATNHTKKEPPKEEFSDWPHGLLAIGTFGNTDLRD  69

Query  308  SARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNAD  487
              +     +  V E  + ++CSSPD +EFT EEVGKLQK LTKLLSRKPA+K E +  AD
Sbjct  70   R-QDVHVEQNTVSEVPQADECSSPDFSEFTAEEVGKLQKELTKLLSRKPATKAE-EPIAD  127

Query  488  LPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSI  667
            LPLDRFLNCPSSLEVDR  SN  +  S  D  E+EIDRTIR I+GRCKDVCEK K+    
Sbjct  128  LPLDRFLNCPSSLEVDRTTSNRFSTYS-DDKGEEEIDRTIRIILGRCKDVCEKKKKKAIG  186

Query  668  GKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRF  847
             KKS+SFLVKKMF CRSGF P+PSLRDTFQESRMEKL+RT+L+KKIY ++ SR+ S K++
Sbjct  187  -KKSLSFLVKKMFACRSGFGPTPSLRDTFQESRMEKLMRTMLTKKIYSESSSRSPSSKKY  245

Query  848  LENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +E+        +A   E EE+ +++  D  +W KTDSEYIVLEI
Sbjct  246  IED------CRSASTAEREEEAQDKNQDGSKWVKTDSEYIVLEI  283



>ref|XP_004252519.1| PREDICTED: uncharacterized protein LOC101266104 [Solanum lycopersicum]
Length=282

 Score =   278 bits (710),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 172/299 (58%), Positives = 201/299 (67%), Gaps = 31/299 (10%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFFNWM N+ NGGQ GSR+   +P  TTNH      NEEF DWP S L+IGT GN    
Sbjct  1    MKFFNWMHNKLNGGQ-GSRRSNAMPI-TTNHNI----NEEFKDWPDSLLSIGTFGN----  50

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKP---ASKGE--  469
             S+   E++++ V++ E     SSP+LAEFT EEV KLQK LTKLLSRKP   AS  E  
Sbjct  51   RSSDLKEQSKLHVKDDELTSYSSSPELAEFTSEEVEKLQKELTKLLSRKPPPTASNSEFV  110

Query  470  ----AQTNAD--LPLDRFLNCPSSLEVDRRLSNT--SAANSLYDCDEDEIDRTIRAIIGR  625
                   NAD  LPLDRFLNCPSSLEVDRR++++  S+ N  YD DE+EIDRTIR IIGR
Sbjct  111  DIKNGAANADDILPLDRFLNCPSSLEVDRRVNSSRFSSVNYSYDYDEEEIDRTIRVIIGR  170

Query  626  CKDVCEKNKQHKSIGKKSVSFLVKKMFVC-RSGFAPSPSLRDTFQESRMEKLLRTILSKK  802
            CKDVC K  + KSIG KS+SFL+KKM VC + GFAP+P+LRDTF ESRMEKLLRT+LSKK
Sbjct  171  CKDVCRKQSKKKSIGMKSISFLLKKMLVCTKGGFAPAPNLRDTFPESRMEKLLRTMLSKK  230

Query  803  IYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            I+PQN  R  S KR+LE K            EE         D  +W KTDSE+IVLEI
Sbjct  231  IHPQNAPR-TSTKRYLEEKHAQREEKEEKKREENSY------DGSKWVKTDSEFIVLEI  282



>ref|XP_008228169.1| PREDICTED: uncharacterized protein LOC103327608 [Prunus mume]
Length=268

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 160/287 (56%), Positives = 194/287 (68%), Gaps = 21/287 (7%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNH-GKQEPRNEEFSDWPGSFLAIGTLGNNDP  301
            MK F WMQN+ NG Q   +   P   PTT H  KQEPR EEFSDWP   LAIGT GNND 
Sbjct  1    MKLFGWMQNKLNGKQGNKK---PNTVPTTTHPAKQEPR-EEFSDWPHGLLAIGTFGNNDL  56

Query  302  PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
             E+A + +  +            S   L  FTPEEVGKL K LTKLL+RKP  + E    
Sbjct  57   KENAAESQDIQEDPTS-------SEEILDNFTPEEVGKLHKELTKLLTRKPNIEKEI---  106

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
            ADLPLDRFLNCPSSLEVDRR SN   ++S  D  +++I++TI  I+GRCK++C  N + K
Sbjct  107  ADLPLDRFLNCPSSLEVDRRNSNALCSDSADDHKDEDIEKTISVILGRCKEICGDNNK-K  165

Query  662  SIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIY-PQNPSRAASL  838
            +IGKKS+SFL+KKMFVCRSGFAP PSLR+TFQESRMEKLLR +L+KKI  PQ  SRAAS+
Sbjct  166  AIGKKSISFLLKKMFVCRSGFAPQPSLRNTFQESRMEKLLRVMLNKKIINPQGSSRAASM  225

Query  839  KRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            K++LE+        T      E+  +E+ +D  +W KTDSEYIVLEI
Sbjct  226  KKYLED----RQIPTKKESNTEDDTKEKINDGCKWVKTDSEYIVLEI  268



>ref|XP_006361334.1| PREDICTED: uncharacterized protein LOC102585440 [Solanum tuberosum]
Length=283

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 170/299 (57%), Positives = 200/299 (67%), Gaps = 30/299 (10%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFFNWM N+ NGGQ GSR+   +P  TTNH      NEEF DWP S LAIGT GN    
Sbjct  1    MKFFNWMHNKLNGGQ-GSRRSNAIPI-TTNHI-----NEEFKDWPDSLLAIGTFGNR--S  51

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPA---SKGE--  469
               ++  K  +  +  ++E+  SSPDLAEFT EEV KLQK LTKLLSRKP+   SK E  
Sbjct  52   SDLKEQSKLHVKNDIEDDEQTSSSPDLAEFTSEEVEKLQKELTKLLSRKPSPTTSKSEFV  111

Query  470  ----AQTNAD--LPLDRFLNCPSSLEVDRRLSNT--SAANSLYDCDEDEIDRTIRAIIGR  625
                   N D  LPLDRFLNCPSSLEVDRR++++  S+AN   D DE+EIDRTIR IIGR
Sbjct  112  EIKNNAVNDDDILPLDRFLNCPSSLEVDRRINSSRFSSANCSDDYDEEEIDRTIRVIIGR  171

Query  626  CKDVCEKNKQHKSIGKKSVSFLVKKMFVCRS-GFAPSPSLRDTFQESRMEKLLRTILSKK  802
            CKDVC K  + KSIG KS+SFL+KKM VC + GFAP+PSLRDTF ESRMEKLLRT+LSKK
Sbjct  172  CKDVCSKQSKKKSIGMKSISFLLKKMLVCTNGGFAPAPSLRDTFPESRMEKLLRTMLSKK  231

Query  803  IYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            I+PQN  R ++ KR+LE K            EE         D  +W KTDS++IVLEI
Sbjct  232  IHPQNAPRTST-KRYLEEKHPQREEKEEEKREEICY------DGSKWVKTDSDFIVLEI  283



>ref|XP_009350860.1| PREDICTED: uncharacterized protein LOC103942400 [Pyrus x bretschneideri]
Length=268

 Score =   273 bits (697),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 161/288 (56%), Positives = 199/288 (69%), Gaps = 23/288 (8%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F+WMQN+ NG Q G++K   V   TT+H KQEPR EEFSDWP   LAIGT GNN+  
Sbjct  1    MKLFSWMQNKINGKQ-GNKKPNTVST-TTHHAKQEPR-EEFSDWPHGLLAIGTFGNNELK  57

Query  305  E--SARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQT  478
            E  +A+ P+  E            S   L  FTPEEVGKL K LTKLL+RKP  + +   
Sbjct  58   ENNAAQSPDIQEDPSS--------SEEILDNFTPEEVGKLHKELTKLLTRKPDIEKKI--  107

Query  479  NADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQH  658
             ADLPLDRFLNCPSSLEVDRR SN   ++S  D  +++I++TI  I+GRCKD+C  NK  
Sbjct  108  -ADLPLDRFLNCPSSLEVDRRTSNVLCSDSSDDHKDEDIEKTISVILGRCKDICADNK--  164

Query  659  KSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIY-PQNPSRAAS  835
            K+IGKKS+SFL+KKMFVCRSGFAP+PSLRDT QESRMEKLLR +L+KKI  PQ   RA+S
Sbjct  165  KAIGKKSISFLLKKMFVCRSGFAPAPSLRDTLQESRMEKLLRVMLNKKIINPQGTPRASS  224

Query  836  LKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +K++LE+        T    + E+  +E+ +D  +W KTDSEYIVLEI
Sbjct  225  MKKYLED----RQNPTIRENQNEDDTKEKINDGCKWVKTDSEYIVLEI  268



>ref|XP_002272432.2| PREDICTED: uncharacterized protein LOC100249804 isoform X2 [Vitis 
vinifera]
 ref|XP_010654414.1| PREDICTED: uncharacterized protein LOC100249804 isoform X2 [Vitis 
vinifera]
 ref|XP_010654415.1| PREDICTED: uncharacterized protein LOC100249804 isoform X2 [Vitis 
vinifera]
 ref|XP_010654416.1| PREDICTED: uncharacterized protein LOC100249804 isoform X2 [Vitis 
vinifera]
Length=260

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 196/282 (70%), Gaps = 25/282 (9%)
 Frame = +2

Query  143  MQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNND---PPESA  313
            MQN+ N  Q G+RK     P  T+  KQEP  EEFSDWP   LAIGT GNND    PES 
Sbjct  1    MQNKLNVRQ-GNRKTNA--PSATHLTKQEPIKEEFSDWPHGLLAIGTFGNNDLKENPESQ  57

Query  314  RKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNADLP  493
              P + +            SS +L +FTPEE+GKLQK LTKLLSRKPAS  E +  A+LP
Sbjct  58   NPPHQEDPS----------SSEELLDFTPEEIGKLQKELTKLLSRKPASNVEKEI-AELP  106

Query  494  LDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGK  673
            LD+FLNCPSSLEVDRR+S T  ++S  D  ++ I+RTI  I+G+C++VC  + + K+IGK
Sbjct  107  LDKFLNCPSSLEVDRRISATLCSDS--DDKDENIERTISVILGKCREVCTDHGK-KNIGK  163

Query  674  KSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLE  853
            +S+SFL+KKMFVCRSGFAP+PSLRDT QESRMEKLLR +L KKIYPQN SRA+S+K++LE
Sbjct  164  RSLSFLLKKMFVCRSGFAPAPSLRDTLQESRMEKLLRAMLHKKIYPQNSSRASSMKKYLE  223

Query  854  NkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +             E+E +++ +  D  +W KTDSEYIVLEI
Sbjct  224  D-----KQRPKRENEDEVQEKHKAKDGYKWVKTDSEYIVLEI  260



>ref|XP_009772866.1| PREDICTED: uncharacterized protein LOC104223189 [Nicotiana sylvestris]
Length=261

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 169/291 (58%), Positives = 201/291 (69%), Gaps = 36/291 (12%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKF NWM N+ NGGQ GSRK   VP  TTN       NEEF+DWP S L IGT GN    
Sbjct  1    MKFLNWMHNKLNGGQ-GSRKCNAVP--TTNQ-----TNEEFTDWPYSLLTIGTFGN----  48

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
               +  +  +  +    +    +SPDLAEFTPEEVGKLQK LTKLLSRKPA+      NA
Sbjct  49   ---KSSDFKQSQLHVQNDHLLENSPDLAEFTPEEVGKLQKELTKLLSRKPAA-----NNA  100

Query  485  D--LPLDRFLNCPSSLEVDRRLSNTSAANSL---YDCDEDEIDRTIRAIIGRCKDVCEKN  649
            D  LPLDRFLNCPSSLEVDRR+S++  +++    +D DE+EIDRTIR IIGRCKDVC K 
Sbjct  101  DDILPLDRFLNCPSSLEVDRRISSSRLSSTNSDNFDYDEEEIDRTIRVIIGRCKDVCSK-  159

Query  650  KQHKSIGKKSVSFLVKKMFVCRSG-FAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSR  826
              H  IGKKS+SFL+KKMFVC SG F P+PSLRDTFQESRMEKLLRTILSKKI  QN SR
Sbjct  160  --HNKIGKKSISFLLKKMFVCASGNFGPAPSLRDTFQESRMEKLLRTILSKKINSQNASR  217

Query  827  AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             ++ KR+LE+            E+EE+K+ +  +D  +W KTDS++IVLEI
Sbjct  218  TST-KRYLED------KYPQKKEQEEKKREKTCNDGSKWVKTDSDFIVLEI  261



>ref|XP_010685287.1| PREDICTED: uncharacterized protein LOC104899733 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=277

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 162/290 (56%), Positives = 201/290 (69%), Gaps = 18/290 (6%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEP-RNEEFSDWPGSFLAIGTLGNND-  298
            MKF NWMQN+ NG + G++K   V P   NH  ++P + EEF+DWP   L IGT GN D 
Sbjct  1    MKFLNWMQNKING-KPGNQKPNTVIP--LNHLPKQPSQREEFNDWPHGLLTIGTFGNTDL  57

Query  299  PPESARKPekneiiveegeeeeQC-SSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQ  475
              ++A    +     +E E+   C SSPDL+EFTPEEVGKLQK LTKLL RK A + E  
Sbjct  58   KDKAASSEIQTATHEQEQEQNPTCASSPDLSEFTPEEVGKLQKELTKLLKRKSAKQEEE-  116

Query  476  TNAD-LPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDV-CEKN  649
             NAD LPLDRFLNCPSSLEV RR+SN    +   D  ED+I+RTI  IIG+CK+V  EK 
Sbjct  117  -NADHLPLDRFLNCPSSLEVSRRISNVVCTDP--DNKEDDIERTISVIIGKCKEVRAEKT  173

Query  650  KQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRA  829
            K    IGKKS+SFL+KKMFVC +GF+P+PSLRDT QESRMEKLLRTIL KKIYP+  +R 
Sbjct  174  KNE--IGKKSLSFLLKKMFVCANGFSPAPSLRDTLQESRMEKLLRTILHKKIYPKTSNRT  231

Query  830  ASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +S+KR+L +       A     EE+ +++ R S++ +WDKTDSEYIVLEI
Sbjct  232  SSMKRYLGD----KHIAEKKNNEEDTQEKPRPSEACKWDKTDSEYIVLEI  277



>ref|XP_004305759.1| PREDICTED: uncharacterized protein LOC101312755 [Fragaria vesca 
subsp. vesca]
Length=269

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 159/288 (55%), Positives = 196/288 (68%), Gaps = 22/288 (8%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            M+ F W+Q++ +G Q   +        +T+H K EPR EEFSDWP S LAIGT GNN+  
Sbjct  1    MRLFGWVQDKLHGKQGNKKPN--TASTSTHHVKPEPR-EEFSDWPHSLLAIGTFGNNNLK  57

Query  305  ESARKPekneiiveegeeeeQCSSPD--LAEFTPEEVGKLQKALTKLLSRKPASKGEAQT  478
            ES           +    +E+ SS D  L  FTPEEVGKL K LTKLL+RKP  + E   
Sbjct  58   EST--------DYQSQHIQEEPSSSDEILENFTPEEVGKLHKELTKLLTRKPDIEKEI--  107

Query  479  NADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQH  658
             A LPLDRFLNCPSSLEVDRR SN   ++S    DED I++TI  I+GRCKD+C  N + 
Sbjct  108  -AALPLDRFLNCPSSLEVDRRTSNALCSDSDDHKDED-IEKTISVILGRCKDICADNNK-  164

Query  659  KSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIY-PQNPSRAAS  835
            K+IGKKS+SFL+KKMFVCRSGFAP+PSLRDTFQESRMEK LR +L+KKI  PQN SRA+S
Sbjct  165  KAIGKKSISFLLKKMFVCRSGFAPAPSLRDTFQESRMEKFLRLMLNKKIINPQNSSRASS  224

Query  836  LKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +K++LE+   +    T      EE K+E+ +D  +W KTDSEYIVLEI
Sbjct  225  MKKYLED---TRQNPTKKGNNNEEDKKEKINDGCKWVKTDSEYIVLEI  269



>ref|XP_007135421.1| hypothetical protein PHAVU_010G128000g [Phaseolus vulgaris]
 gb|ESW07415.1| hypothetical protein PHAVU_010G128000g [Phaseolus vulgaris]
Length=261

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 196/286 (69%), Gaps = 26/286 (9%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPT-TNHGKQEPRNEEFSDWPGSFLAIGTLGNNDP  301
            MKF +WMQN+  GG+  +RK  P    T T H KQEPR EEFSDWP   LAIGT GNN  
Sbjct  1    MKFLSWMQNKL-GGKQDNRK--PNTHTTATYHAKQEPR-EEFSDWPHGLLAIGTFGNN--  54

Query  302  PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
                   E  E   ++  +E+  SS ++A+FTPEE+G LQK LTKLL RKP  + E    
Sbjct  55   ------SEIKENSDDQNAQEDPSSSEEIADFTPEEIGNLQKELTKLLRRKPNVEKEI---  105

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
            ++LPLDRFLNCPSSLEVDRR+SN   + S  D  E++I++T+  II +CKD+C  N++ K
Sbjct  106  SELPLDRFLNCPSSLEVDRRISNALCSES--DDKEEDIEKTLSVIIDKCKDICAHNRK-K  162

Query  662  SIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLK  841
            +IGKKS+SFL+KK+FVCRSGFAP+PSLRDT QESRMEKLLRT+L KKIY QN SR + + 
Sbjct  163  TIGKKSISFLLKKIFVCRSGFAPTPSLRDTLQESRMEKLLRTMLHKKIYTQNSSRTSLMT  222

Query  842  RFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            + +E+            +  +++  E+T D  +W KTDSEYIVLEI
Sbjct  223  KCIED-------KKMTRKRSDDESDEKTGDGCKWVKTDSEYIVLEI  261



>ref|XP_008462281.1| PREDICTED: uncharacterized protein LOC103500678 isoform X1 [Cucumis 
melo]
Length=264

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 158/287 (55%), Positives = 200/287 (70%), Gaps = 25/287 (9%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFF+WMQ + NG Q    K  P    T++H KQE R EEFSDWP   LAIGT GNN+  
Sbjct  1    MKFFSWMQTKLNGKQE---KKIPDTISTSHHKKQESR-EEFSDWPHGLLAIGTFGNNEIK  56

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            + + +         + EEE   SS ++ +F+PEEVGKLQK LTKLLSRKP ++ +    A
Sbjct  57   DDSER--------RDIEEENPSSSEEIVDFSPEEVGKLQKELTKLLSRKPNAEKQV---A  105

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            DLPLDRFLNCPSSLEVDRR+SN    +S  D  +++I+RTI  IIG+CKD+C  +K+ K+
Sbjct  106  DLPLDRFLNCPSSLEVDRRISN--PLSSDSDDKDEDIERTISLIIGKCKDICADSKK-KA  162

Query  665  IGKKSVSFLVKKMFVCRSGFAPSP--SLRDTFQESRMEKLLRTILSKKIYPQNPSRAASL  838
            IGKKS+SFL+KK+FVCR+GF P P  SLR+T QESRMEKLLRTIL KKI PQN SR++SL
Sbjct  163  IGKKSISFLLKKLFVCRTGFTPMPPPSLRETLQESRMEKLLRTILQKKISPQNASRSSSL  222

Query  839  KRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            KR++E        +     +EEE +++   D  +W KTDSEYIVLEI
Sbjct  223  KRYIEE-----KQSAKNRNDEEEDQKKHAKDGSKWVKTDSEYIVLEI  264



>ref|XP_008462282.1| PREDICTED: uncharacterized protein LOC103500678 isoform X2 [Cucumis 
melo]
Length=264

 Score =   259 bits (661),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 157/287 (55%), Positives = 200/287 (70%), Gaps = 25/287 (9%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            M+FF+WMQ + NG Q    K  P    T++H KQE R EEFSDWP   LAIGT GNN+  
Sbjct  1    MQFFSWMQTKLNGKQE---KKIPDTISTSHHKKQESR-EEFSDWPHGLLAIGTFGNNEIK  56

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            + + +         + EEE   SS ++ +F+PEEVGKLQK LTKLLSRKP ++ +    A
Sbjct  57   DDSER--------RDIEEENPSSSEEIVDFSPEEVGKLQKELTKLLSRKPNAEKQV---A  105

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            DLPLDRFLNCPSSLEVDRR+SN    +S  D  +++I+RTI  IIG+CKD+C  +K+ K+
Sbjct  106  DLPLDRFLNCPSSLEVDRRISN--PLSSDSDDKDEDIERTISLIIGKCKDICADSKK-KA  162

Query  665  IGKKSVSFLVKKMFVCRSGFAPSP--SLRDTFQESRMEKLLRTILSKKIYPQNPSRAASL  838
            IGKKS+SFL+KK+FVCR+GF P P  SLR+T QESRMEKLLRTIL KKI PQN SR++SL
Sbjct  163  IGKKSISFLLKKLFVCRTGFTPMPPPSLRETLQESRMEKLLRTILQKKISPQNASRSSSL  222

Query  839  KRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            KR++E        +     +EEE +++   D  +W KTDSEYIVLEI
Sbjct  223  KRYIEE-----KQSAKNRNDEEEDQKKHAKDGSKWVKTDSEYIVLEI  264



>ref|XP_004141714.1| PREDICTED: uncharacterized protein LOC101207004 [Cucumis sativus]
 ref|XP_004155910.1| PREDICTED: uncharacterized LOC101207004 [Cucumis sativus]
 gb|KGN45473.1| hypothetical protein Csa_7G448840 [Cucumis sativus]
Length=264

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 158/287 (55%), Positives = 202/287 (70%), Gaps = 25/287 (9%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFF+WMQ + NG Q    K  P    T++H KQE R EEFSDWP   LAIGT GNN+  
Sbjct  1    MKFFSWMQTKLNGKQE---KKIPDTISTSHHKKQESR-EEFSDWPHGLLAIGTFGNNEIK  56

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            + + +        E+ EEE   SS ++ +F+PEEVGKLQK LTKLLSRKP ++ +    A
Sbjct  57   DDSDQ-------REDIEEENPSSSEEIVDFSPEEVGKLQKELTKLLSRKPNAEKQV---A  106

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            DLPLDRFLNCPSSLEVDRR+SN    +S  D  +++I+RTI  IIG+CKD+C  +K+ K+
Sbjct  107  DLPLDRFLNCPSSLEVDRRISN--PLSSDSDDKDEDIERTISLIIGKCKDICADSKK-KA  163

Query  665  IGKKSVSFLVKKMFVCRSGFAPSP--SLRDTFQESRMEKLLRTILSKKIYPQNPSRAASL  838
            IGKKS+SFL+KK+FVCR+GF+P P  SLR+T QESRMEKLLRTIL +KI PQN SR++SL
Sbjct  164  IGKKSISFLLKKLFVCRTGFSPMPPPSLRETLQESRMEKLLRTILQRKISPQNASRSSSL  223

Query  839  KRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            KR++E         +A    +EE +++   D  +W KTDSEYIVLEI
Sbjct  224  KRYIEE------KQSAKNRNDEEDQKKHAKDGSKWVKTDSEYIVLEI  264



>gb|KDO64967.1| hypothetical protein CISIN_1g040349mg [Citrus sinensis]
Length=290

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/295 (52%), Positives = 194/295 (66%), Gaps = 15/295 (5%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F WMQN+ +  Q  ++K    P    N  KQEPR EEF+DWP   LAIGT GNN   
Sbjct  1    MKLFGWMQNKLSSKQESNKKPNAAPASYRNK-KQEPR-EEFNDWPRGLLAIGTFGNNPEI  58

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
             + +    +EI   + ++EE  SS DL +FTPEE+GK +K LTKLL RKP S  E +  A
Sbjct  59   NNNKGNNDSEIQNIQDDQEEASSSIDLQDFTPEEIGKFEKELTKLLRRKPNSDKEKKV-A  117

Query  485  DLPLDRFLNCPSSLEVDRRLSNT----------SAANSLYDCDEDEIDRTIRAIIGRCKD  634
             LPLDRFLNCPSSLEVDRR+SN           +  +   D  +++IDRTI  I+GRCKD
Sbjct  118  SLPLDRFLNCPSSLEVDRRISNAICNEISDDHHNKDHDNQDIKDEDIDRTISVILGRCKD  177

Query  635  VCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQ  814
            +   +   K+IGKKS+SFL+KKMFVCRSGFAP PSLRD+ QESRME+ LR +L KK+ PQ
Sbjct  178  I-RADSSKKAIGKKSISFLLKKMFVCRSGFAPQPSLRDSLQESRMERFLRIMLHKKMNPQ  236

Query  815  NPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            N SRA S+K++LE+    A+      E++ EK + +  +  +W KTDSEYIVLEI
Sbjct  237  NASRAPSMKKYLED-TKQASDNKKGTEDDREKLQGKNKEGCKWVKTDSEYIVLEI  290



>ref|XP_004510522.1| PREDICTED: uncharacterized protein LOC101501332 [Cicer arietinum]
Length=262

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 155/285 (54%), Positives = 194/285 (68%), Gaps = 23/285 (8%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFF+WMQN+  GG+  +RK       TT H KQE R EEFSDWP S LAIGT GNN+  
Sbjct  1    MKFFSWMQNKL-GGKQENRKS-NTSSATTYHAKQEQR-EEFSDWPHSLLAIGTFGNNNEI  57

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            +   +  +N             SS ++ +FTPEE+GKLQK LTKLL RKP  + E    +
Sbjct  58   KQNIEDNQNTQEDPS-------SSDEIVDFTPEEIGKLQKELTKLLRRKPNVEKEI---S  107

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            +LPLDRFLNCPSSLEVDRR+SNT  + S  D DED I++T+  I+ +CKD+C +  +   
Sbjct  108  ELPLDRFLNCPSSLEVDRRISNTLCSES-GDKDED-IEKTLSVILDKCKDICAEKSKKSI  165

Query  665  IGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKR  844
             GKKS+SFL+KKMFVCRSGFAP+P+LRD+ QESRMEKLLRTIL KKIY QN SRA+ LK+
Sbjct  166  -GKKSISFLLKKMFVCRSGFAPTPNLRDSLQESRMEKLLRTILHKKIYTQNSSRASVLKK  224

Query  845  FLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             +E+         +I    E++  E+T D  +W KTDSEYIVLEI
Sbjct  225  CIED-------KKSIRNMNEDEAEEKTDDGSKWVKTDSEYIVLEI  262



>ref|XP_003529839.1| PREDICTED: uncharacterized protein LOC100808146 [Glycine max]
Length=263

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 192/285 (67%), Gaps = 22/285 (8%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKF +WMQN+  G Q   +        TT   KQEPR EEFSDWP   LAIGT GN    
Sbjct  1    MKFLSWMQNKLGGKQDNRKPNTHTTNTTTYLAKQEPR-EEFSDWPHGLLAIGTFGN----  55

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
                K E  E + ++  +E+  SS ++A+FTPEE+G LQK LTKLL RKP  + E    +
Sbjct  56   ----KSEIKEDLDDQNTQEDPSSSEEIADFTPEEIGNLQKELTKLLRRKPNVEKEI---S  108

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            +LPLDRFLNCPSSLEVDRR+SN   + S  +  E++I++T+  II +CKD+C  +K+ K+
Sbjct  109  ELPLDRFLNCPSSLEVDRRISNALCSES--EDKEEDIEKTLSVIIDKCKDIC-ADKRKKA  165

Query  665  IGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKR  844
            IGKKS+SFL+KK+FVCRSGFAP+PSLRDT QESRMEKLLRT+L KKIY QN SR+  +K+
Sbjct  166  IGKKSISFLLKKIFVCRSGFAPTPSLRDTLQESRMEKLLRTMLHKKIYTQNSSRSPLVKK  225

Query  845  FLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             +E+            +  E++  ER  D  +W KTDSEYIVLEI
Sbjct  226  GIED-------KKMTRKRNEDESDERNGDGCKWVKTDSEYIVLEI  263



>gb|KHN01427.1| hypothetical protein glysoja_009633 [Glycine soja]
Length=281

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 192/285 (67%), Gaps = 22/285 (8%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKF +WMQN+  G Q   +        TT   KQEPR EEFSDWP   LAIGT GN    
Sbjct  19   MKFLSWMQNKLGGKQDNRKPNTHTTNTTTYLAKQEPR-EEFSDWPHGLLAIGTFGN----  73

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
                K E  E + ++  +E+  SS ++A+FTPEE+G LQK LTKLL RKP  + E    +
Sbjct  74   ----KSEIKEDLDDQNTQEDPSSSEEIADFTPEEIGNLQKELTKLLRRKPNVEKEI---S  126

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            +LPLDRFLNCPSSLEVDRR+SN   + S  +  E++I++T+  II +CKD+C  +K+ K+
Sbjct  127  ELPLDRFLNCPSSLEVDRRISNALCSES--EDKEEDIEKTLSVIIDKCKDIC-ADKRKKA  183

Query  665  IGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKR  844
            IGKKS+SFL+KK+FVCRSGFAP+PSLRDT QESRMEKLLRT+L KKIY QN SR+  +K+
Sbjct  184  IGKKSISFLLKKIFVCRSGFAPTPSLRDTLQESRMEKLLRTMLHKKIYTQNSSRSPLVKK  243

Query  845  FLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             +E+            +  E++  ER  D  +W KTDSEYIVLEI
Sbjct  244  GIED-------KKMTRKRNEDESDERNGDGCKWVKTDSEYIVLEI  281



>ref|XP_010685288.1| PREDICTED: uncharacterized protein LOC104899733 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010685289.1| PREDICTED: uncharacterized protein LOC104899733 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=271

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 157/284 (55%), Positives = 196/284 (69%), Gaps = 18/284 (6%)
 Frame = +2

Query  143  MQNRFNGGQAGSRKGYPVPPPTTNHGKQEP-RNEEFSDWPGSFLAIGTLGNND-PPESAR  316
            MQN+ NG + G++K   V P   NH  ++P + EEF+DWP   L IGT GN D   ++A 
Sbjct  1    MQNKING-KPGNQKPNTVIP--LNHLPKQPSQREEFNDWPHGLLTIGTFGNTDLKDKAAS  57

Query  317  KPekneiiveegeeeeQC-SSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNAD-L  490
               +     +E E+   C SSPDL+EFTPEEVGKLQK LTKLL RK A + E   NAD L
Sbjct  58   SEIQTATHEQEQEQNPTCASSPDLSEFTPEEVGKLQKELTKLLKRKSAKQEEE--NADHL  115

Query  491  PLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDV-CEKNKQHKSI  667
            PLDRFLNCPSSLEV RR+SN    +   D  ED+I+RTI  IIG+CK+V  EK K    I
Sbjct  116  PLDRFLNCPSSLEVSRRISNVVCTDP--DNKEDDIERTISVIIGKCKEVRAEKTKNE--I  171

Query  668  GKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRF  847
            GKKS+SFL+KKMFVC +GF+P+PSLRDT QESRMEKLLRTIL KKIYP+  +R +S+KR+
Sbjct  172  GKKSLSFLLKKMFVCANGFSPAPSLRDTLQESRMEKLLRTILHKKIYPKTSNRTSSMKRY  231

Query  848  LENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            L +       A     EE+ +++ R S++ +WDKTDSEYIVLEI
Sbjct  232  LGD----KHIAEKKNNEEDTQEKPRPSEACKWDKTDSEYIVLEI  271



>ref|XP_008342054.1| PREDICTED: uncharacterized protein LOC103404866 [Malus domestica]
Length=245

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 146/260 (56%), Positives = 179/260 (69%), Gaps = 21/260 (8%)
 Frame = +2

Query  209  TNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPPE--SARKPekneiiveegeeeeQCSSPD  382
             +H KQEPR EEFSDWP   LAIGT GNN+  E  +A+ P+  E            S   
Sbjct  4    VDHAKQEPR-EEFSDWPHGLLAIGTFGNNELKENNAAQSPDIQEDPSS--------SEEI  54

Query  383  LAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAA  562
            L  FTPEEVGKL K LTKLL+RKP  + +    ADLPLDRFLNCPSSLEVDRR SN   +
Sbjct  55   LDNFTPEEVGKLHKELTKLLTRKPDIEKKI---ADLPLDRFLNCPSSLEVDRRTSNVLCS  111

Query  563  NSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSL  742
            +S  D  +++I++TI  I+GRCKD+C  NK  K+IGKKS+SFL+KKMFVCRSGFAP+PSL
Sbjct  112  DSSNDHKDEDIEKTISVILGRCKDICADNK--KAIGKKSISFLLKKMFVCRSGFAPAPSL  169

Query  743  RDTFQESRMEKLLRTILSKKIY-PQNPSRAASLKRFLENkrtsaatataiaeeeeekkre  919
            RDT QESRMEKLLR +L+KKI  PQ   RA+S+K++LE+        T      E+  +E
Sbjct  170  RDTLQESRMEKLLRVMLNKKIINPQGTPRASSMKKYLED----GQNPTKREXHNEDDTKE  225

Query  920  rtSDSGRWDKTDSEYIVLEI  979
            + +D  +W KTDSEYIVLEI
Sbjct  226  KINDGCKWVKTDSEYIVLEI  245



>ref|XP_007216439.1| hypothetical protein PRUPE_ppa021925mg [Prunus persica]
 gb|EMJ17638.1| hypothetical protein PRUPE_ppa021925mg [Prunus persica]
Length=265

 Score =   248 bits (634),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 150/274 (55%), Positives = 186/274 (68%), Gaps = 19/274 (7%)
 Frame = +2

Query  143  MQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPPESARKP  322
            MQN+ NG Q G++K   VP  TT+  KQEPR EEFSDWP   LAIGT GNND  E+A + 
Sbjct  1    MQNKLNGKQ-GNKKPNTVPI-TTHPAKQEPR-EEFSDWPHGLLAIGTFGNNDLKENAAES  57

Query  323  ekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNADLPLDR  502
            +  +            S   L  FTPEEVGKL K LTKLL+RKP  + E    ADLPLDR
Sbjct  58   QDIQEDPTS-------SEEILDNFTPEEVGKLHKELTKLLTRKPNIEKEI---ADLPLDR  107

Query  503  FLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSV  682
            FLNCPSSLEVDRR SN   ++S  D  +++I++TI  I+GRCK++C  +K  K+IGKKS+
Sbjct  108  FLNCPSSLEVDRRNSNALCSDSADDHKDEDIEKTISVILGRCKEIC-GDKNKKAIGKKSI  166

Query  683  SFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIY-PQNPSRAASLKRFLENk  859
            SFL+KKMFVCRSGFAP PSLRDT QESRMEKLLR +L+KKI  PQ  SRAAS+K++LE+ 
Sbjct  167  SFLLKKMFVCRSGFAPQPSLRDTLQESRMEKLLRVMLNKKIINPQGSSRAASMKKYLED-  225

Query  860  rtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
                   T      E+  +E+ ++  +W KTDSE
Sbjct  226  ---RQIPTKKESNTEDDTKEKINNGCKWVKTDSE  256



>ref|XP_009599830.1| PREDICTED: uncharacterized protein LOC104095403 [Nicotiana tomentosiformis]
Length=265

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 164/291 (56%), Positives = 196/291 (67%), Gaps = 32/291 (11%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFFNWM N+ NGGQ  SRK   VP   TN       NEEF DWP S LAIGT G     
Sbjct  1    MKFFNWMHNKLNGGQR-SRKTNAVP--ITNQT-----NEEFKDWPDSLLAIGTFGIKSSE  52

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            E  +    +             +SPDLAEFTPEEVGKLQK LTKLLSRKPA+      NA
Sbjct  53   EVGKLQNDHHQDEILE------NSPDLAEFTPEEVGKLQKELTKLLSRKPAA-----NNA  101

Query  485  D--LPLDRFLNCPSSLEVDRRLSNTSAANSL---YDCDEDEIDRTIRAIIGRCKDVCEKN  649
            D   PLDRFLNCPSSLEVDRR+S++  +++    +D DE+E+DRTIR IIGRCKDVC K 
Sbjct  102  DYIFPLDRFLNCPSSLEVDRRISSSRFSSTNSDNFDYDEEELDRTIRVIIGRCKDVCNKQ  161

Query  650  KQHKSIGKKSVSFLVKKMFVCRSG-FAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSR  826
             + KSIGKKS+SFL+KKMFVC SG F P+P LRDTFQ+SRMEKLLRT+LSKKI PQN SR
Sbjct  162  NKKKSIGKKSISFLLKKMFVCASGNFGPAPGLRDTFQKSRMEKLLRTMLSKKISPQNASR  221

Query  827  AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             ++ KR+LE+            E+E +K  +  +D  +W KTDS++IVLE+
Sbjct  222  TST-KRYLED------EHPQKEEQEGKKLEKIFNDGSKWVKTDSDFIVLEM  265



>gb|KEH18489.1| hypothetical protein MTR_8g021237 [Medicago truncatula]
Length=262

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 191/285 (67%), Gaps = 23/285 (8%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFFNWMQN+  G Q   +        +T + K EPR EEFSDWP S LAIGT GNN+  
Sbjct  1    MKFFNWMQNKLGGKQENRKSNTST---STTYAKPEPR-EEFSDWPHSLLAIGTFGNNNE-  55

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
                      I  +  ++E+  SS ++ +FTPEE+GKLQK LT+LL RKP  + E    +
Sbjct  56   ------ITQNIENQNTQQEDPSSSEEVPDFTPEEIGKLQKELTRLLRRKPNVEKEI---S  106

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            +LPLDRFLNCPSSLEVDRR+SN   + S  D DED I++T+  I+ +CKD+C +  +   
Sbjct  107  ELPLDRFLNCPSSLEVDRRISNALCSESGGDKDED-IEKTLSVILDKCKDICAEKSKKSI  165

Query  665  IGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKR  844
             GKKS+SFL+KKMFVCRSGFAP+PSLRDT QESRMEKLLRT+L KK+Y QN SRA  LK+
Sbjct  166  -GKKSISFLLKKMFVCRSGFAPTPSLRDTLQESRMEKLLRTMLHKKLYTQNNSRAPVLKK  224

Query  845  FLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             LEN         +I +  E++  ER  +  +W KTDSEYIVLEI
Sbjct  225  CLEN-------KKSIKKRNEDEAEERIDEGSKWVKTDSEYIVLEI  262



>ref|XP_003548367.1| PREDICTED: uncharacterized protein LOC100811893 [Glycine max]
Length=266

 Score =   243 bits (621),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 148/289 (51%), Positives = 195/289 (67%), Gaps = 27/289 (9%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRK----GYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGN  292
            MKF +WMQN+  GG+  +RK           TT H KQEPR EEFSDWP   LAIGT GN
Sbjct  1    MKFLSWMQNKL-GGKQDNRKPNAHTTTTTTTTTYHPKQEPR-EEFSDWPHGLLAIGTFGN  58

Query  293  NDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEA  472
                    K    E + ++  +E+  SS ++A+FTPEE+G LQK LTKLL RKP  + E 
Sbjct  59   --------KTAIKEDLDDQNTQEDPSSSEEIADFTPEEIGNLQKELTKLLRRKPNVEKEI  110

Query  473  QTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNK  652
               ++LPLDRFLNCPSSLEVDRR+SN   + S  +  E++I++T+  II +CKD+C  +K
Sbjct  111  ---SELPLDRFLNCPSSLEVDRRISNALCSES--EDKEEDIEKTLSVIIDKCKDIC-ADK  164

Query  653  QHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAA  832
            + K++GKKS+SFL+KK+F+CRSGFAP+PSLRDT QESRMEK+LRT+L KKI  QN SR+ 
Sbjct  165  RKKAMGKKSISFLLKKIFLCRSGFAPTPSLRDTLQESRMEKVLRTMLHKKICTQNSSRSP  224

Query  833  SLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             +K+ +E+            ++ E++  ER  D  +W KTDSEYIVLEI
Sbjct  225  LVKKCIED-------KKMTRKKNEDESDERNGDGCKWVKTDSEYIVLEI  266



>gb|KHN39614.1| hypothetical protein glysoja_020692 [Glycine soja]
Length=284

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 148/289 (51%), Positives = 195/289 (67%), Gaps = 27/289 (9%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRK----GYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGN  292
            MKF +WMQN+  GG+  +RK           TT H KQEPR EEFSDWP   LAIGT GN
Sbjct  19   MKFLSWMQNKL-GGKQDNRKPNAHTTTTTTTTTYHPKQEPR-EEFSDWPHGLLAIGTFGN  76

Query  293  NDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEA  472
                    K    E + ++  +E+  SS ++A+FTPEE+G LQK LTKLL RKP  + E 
Sbjct  77   --------KTAIKEDLDDQNTQEDPSSSEEIADFTPEEIGNLQKELTKLLRRKPNVEKEI  128

Query  473  QTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNK  652
               ++LPLDRFLNCPSSLEVDRR+SN   + S  +  E++I++T+  II +CKD+C  +K
Sbjct  129  ---SELPLDRFLNCPSSLEVDRRISNALCSES--EDKEEDIEKTLSVIIDKCKDIC-ADK  182

Query  653  QHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAA  832
            + K++GKKS+SFL+KK+F+CRSGFAP+PSLRDT QESRMEK+LRT+L KKI  QN SR+ 
Sbjct  183  RKKAMGKKSISFLLKKIFLCRSGFAPTPSLRDTLQESRMEKVLRTMLHKKICTQNSSRSP  242

Query  833  SLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             +K+ +E+            ++ E++  ER  D  +W KTDSEYIVLEI
Sbjct  243  LVKKCIED-------KKMTRKKNEDESDERNGDGCKWVKTDSEYIVLEI  284



>ref|XP_009778621.1| PREDICTED: uncharacterized protein LOC104227935 [Nicotiana sylvestris]
Length=237

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 166/236 (70%), Gaps = 19/236 (8%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQE-PRNEEFSDWPGSFLAIGTLGNNDP  301
            MKFF+WMQN+FN GQ    +  P    T N   QE PRNEEF+ WP S LAIGT G N  
Sbjct  1    MKFFSWMQNKFNAGQGN--RSMPNAVQTKNQTNQERPRNEEFNGWPDSLLAIGTFGTNSS  58

Query  302  PESARKPekneiiveegee-------eeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPAS  460
               A+      +  +E +E        EQ SSPDLAEFTPEEVGKLQK LTKLLS+KPA+
Sbjct  59   NLKAKSESAQNVQNQERDEIILDDNINEQSSSPDLAEFTPEEVGKLQKELTKLLSKKPAA  118

Query  461  K--GEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLY-----DCDEDEIDRTIRAII  619
            K   + + + DLPLDRFLNCPSSLEVDRR S++  +++ Y     + DE+EIDRTIRAII
Sbjct  119  KLIDQGRQDGDLPLDRFLNCPSSLEVDRRASSSRFSSTNYSENYDNYDEEEIDRTIRAII  178

Query  620  GRCKD-VCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLR  784
            GRCKD VC+ NK+ K  G KS+SFL+KKMFVC SGFAP+PSLRDTF ESRMEK+ R
Sbjct  179  GRCKDHVCKTNKK-KVNGMKSISFLLKKMFVCSSGFAPTPSLRDTFPESRMEKIYR  233



>gb|KDP40678.1| hypothetical protein JCGZ_24677 [Jatropha curcas]
Length=251

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 182/256 (71%), Gaps = 9/256 (4%)
 Frame = +2

Query  221  KQEPRNEEFSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQ---CSSPDLAE  391
            KQ+ R EEFSDWP   LAIGT GNN+   S     +N    +  EEEE+    SS DL +
Sbjct  2    KQDSR-EEFSDWPHGLLAIGTFGNNEISSSENLEIQNVQENQNVEEEEEEDPSSSEDLRD  60

Query  392  FTPEEVGKLQKALTKLLSRKPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSL  571
            FTPEE+GKLQK LTKLL+++P S  E +    LPLDRFLNCPSSLEVDRR+SNT  ++  
Sbjct  61   FTPEEIGKLQKELTKLLTKRPTSDKEKEVAKTLPLDRFLNCPSSLEVDRRISNTVTSD--  118

Query  572  YDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDT  751
             D +E++I+RTI  I+GRCKD+CEKNK+    GKKS++FL+KKMFVCRSGFAP PSLRD 
Sbjct  119  MDDNEEDIERTISVILGRCKDICEKNKKKAI-GKKSITFLLKKMFVCRSGFAPQPSLRDP  177

Query  752  FQESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSD  931
              ESRMEKLLRT+L KKI  QN S A+S+K++LE+ +  +       +E+E + +    D
Sbjct  178  LPESRMEKLLRTLLHKKINHQNASGASSMKKYLEDNKQISNKEKEKEKEDERRTKTY--D  235

Query  932  SGRWDKTDSEYIVLEI  979
             G+W KTDSEYIVLEI
Sbjct  236  GGKWVKTDSEYIVLEI  251



>ref|XP_009607430.1| PREDICTED: uncharacterized protein LOC104101650 [Nicotiana tomentosiformis]
Length=356

 Score =   237 bits (604),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 174/229 (76%), Gaps = 18/229 (8%)
 Frame = +2

Query  218  GKQEPRNEEFSDWPGSFLAIGTLGN--------NDPPESARKPekneiiveegeeeeQCS  373
             ++ PRNEEF+ WP S LAIGT G         ++  ++ +  +++EII+++    EQ S
Sbjct  5    NQERPRNEEFNGWPDSLLAIGTFGTTSSNLKEKSESAQNVQNQDRDEIILDDNNNNEQSS  64

Query  374  SPDLAEFTPEEVGKLQKALTKLLSRKPASK--GEAQTNADLPLDRFLNCPSSLEVDRRLS  547
            SPDLAEFTPEEVGKLQK LTKLLS+KPA+K   + + + DLPLDRFLNCPSSLEVDRR S
Sbjct  65   SPDLAEFTPEEVGKLQKELTKLLSKKPAAKLADQGRQDGDLPLDRFLNCPSSLEVDRRAS  124

Query  548  NTSAANSLY-----DCDEDEIDRTIRAIIGRCKD-VCEKNKQHKSIGKKSVSFLVKKMFV  709
            ++  +++ Y     + DE+EIDRTIRAIIGRCKD VC+ NK+ K  G KS+SFL+KKMFV
Sbjct  125  SSRFSSTNYSDNYDNYDEEEIDRTIRAIIGRCKDHVCKTNKK-KVNGMKSISFLLKKMFV  183

Query  710  CRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLEN  856
            C SGFAP+PSLRDTF ESRMEKLLRTILSKKI PQN +R  S KR+LE+
Sbjct  184  CSSGFAPTPSLRDTFPESRMEKLLRTILSKKINPQNATR-VSTKRYLED  231



>ref|XP_007139074.1| hypothetical protein PHAVU_009G262800g [Phaseolus vulgaris]
 gb|ESW11068.1| hypothetical protein PHAVU_009G262800g [Phaseolus vulgaris]
Length=279

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 155/305 (51%), Positives = 187/305 (61%), Gaps = 46/305 (15%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKF +WMQN+  GG+  +RK    P   T  GKQE R EEFSDWP   LAIGT GNN+  
Sbjct  1    MKFLSWMQNKI-GGKQDNRK----PDTYTYDGKQEGR-EEFSDWPDGLLAIGTFGNNN--  52

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            E+  K  ++             SS  + +FTPEE+GKLQK LTKLL +KP  + E    A
Sbjct  53   EAKEKATEDPS-----------SSEQIPDFTPEEIGKLQKELTKLLRQKPKVEKEI---A  98

Query  485  DLPLDRFLNCPSSLEVDRRLSNT------------------SAANSLYDCDEDEIDRTIR  610
             LPLDRFLNCPSSLEVDRR+SN                             E++I++T+ 
Sbjct  99   HLPLDRFLNCPSSLEVDRRISNVLCNDEEEQKQEREEEEEEEEEEEEKQETEEDIEKTLS  158

Query  611  AIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDT--FQESRMEKLLR  784
             I+G+ K++C KN + K+IGKKS+SFL+KKMFVCRSGFAP PSLRDT   QESRMEKLLR
Sbjct  159  VILGKFKEICAKNSK-KAIGKKSISFLLKKMFVCRSGFAPPPSLRDTLQLQESRMEKLLR  217

Query  785  TILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEY  964
            TIL KKI  Q+ SRA SLK+ LE+            EE E+K    T D  +W KTDSEY
Sbjct  218  TILQKKIKSQHCSRAVSLKKRLED---RQKMPMEEEEEAEDKADAETDDGCKWVKTDSEY  274

Query  965  IVLEI  979
            IVLEI
Sbjct  275  IVLEI  279



>ref|XP_010540190.1| PREDICTED: uncharacterized protein LOC104814044 [Tarenaya hassleriana]
Length=296

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 190/306 (62%), Gaps = 31/306 (10%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNND--  298
            MKFF WMQ + +G Q  +    P     ++H KQEPR EEFSDWP   LAIGT G N+  
Sbjct  1    MKFFGWMQTKLSGKQLNN-NSRPSTSSASHHLKQEPR-EEFSDWPHGLLAIGTFGTNNCA  58

Query  299  -----------PPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLS  445
                         E++           + ++++  SS DL +FT EEVG+LQK LTKLLS
Sbjct  59   RRDKNRKVQWIQEEASNAKHGENEDRNQEQDQDPSSSDDLEDFTSEEVGRLQKELTKLLS  118

Query  446  RKPASKGEA--QTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAII  619
            R    K +   +   +LPLDRFLNCPSSLEVDRR+SNT  +    D +ED I+RTI  I+
Sbjct  119  RTKKRKSDVHRELTNNLPLDRFLNCPSSLEVDRRISNTLCSIDPDDKEED-IERTISIIL  177

Query  620  GRCKDVCEKNKQHK---SIGKKSVSFLVKKMFVCRSGF---APSPSLRDTFQESRMEKLL  781
            GRCK++  +NK  K    IGK  VS+L+KK+F+CR GF   APSPSLRDT QESRMEK L
Sbjct  178  GRCKEISTENKNKKKKTDIGKTCVSYLLKKIFICREGFSSRAPSPSLRDTLQESRMEKFL  237

Query  782  RTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            R +L KKI PQ  SRA S+K +L++          +++  EE+  E+++D  +W KTDS+
Sbjct  238  RMMLHKKINPQASSRATSVKNYLQD-------KQRVSKNIEEEANEKSNDGCKWVKTDSD  290

Query  962  YIVLEI  979
            +IVLEI
Sbjct  291  FIVLEI  296



>ref|XP_002888880.1| hypothetical protein ARALYDRAFT_476382 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65139.1| hypothetical protein ARALYDRAFT_476382 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 147/303 (49%), Positives = 189/303 (62%), Gaps = 36/303 (12%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNN---  295
            MKFF WMQN+ +G Q G     P     ++H   +PR EEFSDWP   LAIGT GN    
Sbjct  1    MKFFGWMQNKLHGKQ-GINTHRPSISSVSSH---QPR-EEFSDWPHGLLAIGTFGNKAQT  55

Query  296  ----DPPESARKPekneiiveegeeeeQCSSPDLAE-FTPEEVGKLQKALTKLLSRKPAS  460
                D  E   +         +  ++E  S+ DL E FTPEEVGKLQK LTKLL+R+ + 
Sbjct  56   SQKVDQEEIQEETVSKVEGQAQDRDQELSSTDDLEEDFTPEEVGKLQKELTKLLTRR-SK  114

Query  461  KGEAQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCK  631
            K ++  N   A+LPLDRFLNCPSSLEVDRR+SN     +L D  E++I+RTI  I+GRCK
Sbjct  115  KRKSDVNRELANLPLDRFLNCPSSLEVDRRISN-----ALCDEKEEDIERTISVILGRCK  169

Query  632  DVC--EKNKQHKS---IGKKSVSFLVKKMFVCRSGFAP--SPSLRDTFQESRMEKLLRTI  790
             +    KNK  KS   + K SVS L+KKMFVC  GF+P  SPSLRDTFQE+RMEKLLR +
Sbjct  170  AISTESKNKTKKSKRDLSKTSVSHLLKKMFVCTEGFSPVPSPSLRDTFQETRMEKLLRMM  229

Query  791  LSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIV  970
            L KKI  Q   +  S K++L++          ++ + EE++   +SD G+W KTDS++IV
Sbjct  230  LHKKINTQTSLKQTSTKKYLQD-------KQQLSLKNEEEEERSSSDGGKWVKTDSDFIV  282

Query  971  LEI  979
            LEI
Sbjct  283  LEI  285



>emb|CBI35848.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 141/282 (50%), Positives = 178/282 (63%), Gaps = 46/282 (16%)
 Frame = +2

Query  143  MQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNND---PPESA  313
            MQN+ N  Q G+RK     P  T+  KQEP  EEFSDWP   LAIGT GNND    PES 
Sbjct  1    MQNKLNVRQ-GNRKTNA--PSATHLTKQEPIKEEFSDWPHGLLAIGTFGNNDLKENPESQ  57

Query  314  RKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNADLP  493
              P + +            SS +L +FTPEE+GKLQK LTKLLSRKPAS           
Sbjct  58   NPPHQEDP----------SSSEELLDFTPEEIGKLQKELTKLLSRKPASN----------  97

Query  494  LDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGK  673
                        VDRR+S T  ++S  D  ++ I+RTI  I+G+C++VC  + + K+IGK
Sbjct  98   ------------VDRRISATLCSDS--DDKDENIERTISVILGKCREVCTDHGK-KNIGK  142

Query  674  KSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLE  853
            +S+SFL+KKMFVCRSGFAP+PSLRDT QESRMEKLLR +L KKIYPQN SRA+S+K++LE
Sbjct  143  RSLSFLLKKMFVCRSGFAPAPSLRDTLQESRMEKLLRAMLHKKIYPQNSSRASSMKKYLE  202

Query  854  NkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +             E+E +++ +  D  +W KTDSEYIVLEI
Sbjct  203  D-----KQRPKRENEDEVQEKHKAKDGYKWVKTDSEYIVLEI  239



>ref|XP_009104854.1| PREDICTED: uncharacterized protein LOC103830789 [Brassica rapa]
Length=291

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 140/306 (46%), Positives = 189/306 (62%), Gaps = 36/306 (12%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFF WMQN+ +G Q  + +     P  ++    +PR EEFSDWP   LAIGT G+    
Sbjct  1    MKFFGWMQNKLHGKQGNTHR-----PSISSASSHQPR-EEFSDWPQGLLAIGTFGSVAKE  54

Query  305  ESA----------RKPekneiiveegeeeeQCS-SPDLAEFTPEEVGKLQKALTKLLSRK  451
            ++             P    +  +  +E++  S S DL +FTPEEVGKLQK LTKLL+RK
Sbjct  55   QTQIQVVQEVIQEENPSNVHVEGQVQDEDQDLSFSGDLEDFTPEEVGKLQKELTKLLTRK  114

Query  452  PASKGEAQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIG  622
               K ++  N   A+LPLDRFLNCPSSLEVDRR+SN  ++    + +E++I+RTI  I+G
Sbjct  115  -TKKRKSDVNRELANLPLDRFLNCPSSLEVDRRISNAISSGGYSNENEEDIERTISVILG  173

Query  623  RCKDVCEK-----NKQHKSIGKKSVSFLVKKMFVCRSGFA--PSPSLRDTFQESRMEKLL  781
            RCK +  +      K  + + K SVS+L+KKMFVC  GF+  P+PSLRDTFQESRMEKLL
Sbjct  174  RCKAISTESSNKKKKSKRDMSKTSVSYLLKKMFVCSGGFSPLPNPSLRDTFQESRMEKLL  233

Query  782  RTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            R +L KKI  Q PS+  S KR++E+              + E++  R+SD  +W KTDS+
Sbjct  234  RVMLHKKINAQAPSKETSTKRYVED--------KQQLALKNEEEEGRSSDGSKWVKTDSD  285

Query  962  YIVLEI  979
            +IVLEI
Sbjct  286  FIVLEI  291



>ref|XP_002532726.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29657.1| conserved hypothetical protein [Ricinus communis]
Length=249

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 158/225 (70%), Gaps = 11/225 (5%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRK--GYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNND  298
            MK  +WMQN+ NG + G+ +       P +T+H KQ+PR EEFSDWP   LAIGT GNN+
Sbjct  1    MKLLSWMQNKLNGNKQGTVRKPAANTAPSSTHHVKQDPR-EEFSDWPHGLLAIGTFGNNE  59

Query  299  P-----PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASK  463
                       +  + +    E +E E  SS DL +FTPEE+GKLQK LTKLL+RKP S 
Sbjct  60   IRSENLEIERVEEVEEQQQHVEEDEVETSSSEDLQDFTPEEIGKLQKELTKLLTRKPTSD  119

Query  464  GEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCE  643
             E + + +LPLDRFLNCPSSLEVDRR+SNT  ++   D +E++I+RTI  I+GRCKD+CE
Sbjct  120  KEKEVSKNLPLDRFLNCPSSLEVDRRISNTVTSD--MDDNEEDIERTISVILGRCKDICE  177

Query  644  KNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKL  778
            K K+    GKKS+SFL+KKMFVCRSGFAP PSLRDT QESRMEK 
Sbjct  178  KKKKKAL-GKKSISFLLKKMFVCRSGFAPQPSLRDTLQESRMEKF  221



>gb|EYU21305.1| hypothetical protein MIMGU_mgv1a024559mg, partial [Erythranthe 
guttata]
Length=282

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 171/253 (68%), Gaps = 8/253 (3%)
 Frame = +2

Query  215  HGKQEPRNEEFSDWPGSFLAIGTLGNN-DPPESARKPekneiiveegeeeeQCSSPDLAE  391
            H K+E   EEFSDWP   LAIGT G+  D  +   K            +EE+ SS DL+E
Sbjct  1    HAKKESPKEEFSDWPHGLLAIGTFGDTADTIQVDEK--NPHKNEIIPLKEEEYSSGDLSE  58

Query  392  FTPEEVGKLQKALTKLLSRKPASKG-EAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANS  568
            FT EEV KLQK LTKLLS+K A+K  + ++ A+LPLDRFLNCPSSLE+DR  SN  +  S
Sbjct  59   FTAEEVVKLQKELTKLLSKKSATKSTDKKSVANLPLDRFLNCPSSLEMDRINSNRFSTYS  118

Query  569  LYDCDEDEIDRTIRAIIGRCKDVCEKNKQH--KSIGKKSVSFLVKKMFVCRSGFAPSPSL  742
                +E+EIDRTIR I+GRCKDV EK K++  K+IG KS+SFLVKKMFVCRSGF P+ S 
Sbjct  119  DNRDEEEEIDRTIRIILGRCKDVYEKKKKNSNKTIGIKSLSFLVKKMFVCRSGFGPTTSF  178

Query  743  RDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrer  922
            RDT QESRMEKLLRT+L+K IY Q  SR +S K+++EN         A  EEE E+    
Sbjct  179  RDTLQESRMEKLLRTMLTKTIYTQKCSRTSSTKKYIEN--YYKPEMKAEKEEEVEESHGI  236

Query  923  tSDSGRWDKTDSE  961
            + +  +WDKTDSE
Sbjct  237  SEEGSKWDKTDSE  249



>ref|XP_006390651.1| hypothetical protein EUTSA_v10019851mg [Eutrema salsugineum]
 gb|ESQ27937.1| hypothetical protein EUTSA_v10019851mg [Eutrema salsugineum]
Length=291

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 140/305 (46%), Positives = 189/305 (62%), Gaps = 34/305 (11%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F WMQN+ +G Q  + +     P  ++    +PR EEFSDWP   LAIGT G+ +  
Sbjct  1    MKLFGWMQNKLHGKQGNTHR-----PSISSAPSHQPR-EEFSDWPHGLLAIGTFGSVNKD  54

Query  305  ESARKPekneiiveegeeeeQC----------SSPDLAEFTPEEVGKLQKALTKLLSRKP  454
            ++ +K ++  I  EE                 SS DL +FTPEEVGKLQK LTKLL+R+ 
Sbjct  55   QTPQKLDQEVIQEEETSANVNVEDHRDQELSSSSDDLEDFTPEEVGKLQKELTKLLTRR-  113

Query  455  ASKGEAQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGR  625
            + K ++  N   A+LPLDRFLNCPSSLEVDRR+SN  +A    D  E++I+RTI  I+GR
Sbjct  114  SKKRKSDVNRELANLPLDRFLNCPSSLEVDRRISNALSAGGDSDEKEEDIERTISVILGR  173

Query  626  CKDVCEK-----NKQHKSIGKKSVSFLVKKMFVCRSGF--APSPSLRDTFQESRMEKLLR  784
            CK +  +      K  + + K SVS+L+KKMFVC  GF  APSPSLRDTF ESRMEKLLR
Sbjct  174  CKAISTESKNKKKKSKRDLSKTSVSYLLKKMFVCTEGFAPAPSPSLRDTFHESRMEKLLR  233

Query  785  TILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEY  964
             +L KK   Q  S+  S  ++L++          ++ ++EE++   +SD G+W KTDS++
Sbjct  234  MMLHKKTNAQASSKQTSTMQYLQD-------KQQLSLKDEEEEGRSSSDGGKWVKTDSDF  286

Query  965  IVLEI  979
            IVLEI
Sbjct  287  IVLEI  291



>ref|XP_010537630.1| PREDICTED: uncharacterized protein LOC104812257 [Tarenaya hassleriana]
Length=292

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 144/299 (48%), Positives = 184/299 (62%), Gaps = 21/299 (7%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFF WMQN+ NG     R   P  P  + H KQEPR EEFSDWP   LAIGT G N+  
Sbjct  1    MKFFGWMQNKLNGKHVNGR---PNTPSASQHVKQEPR-EEFSDWPHGLLAIGTFGINNGV  56

Query  305  ------ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKG  466
                  +  +K ++ +    + +++   SS DL +FTPEEVGKLQK LTKLL+R    K 
Sbjct  57   SKGGNRDGDQKIQEIQEEGSDKDQDPPSSSEDLEDFTPEEVGKLQKELTKLLTRTKKRKS  116

Query  467  EAQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDV  637
            +       ++LPLDRFLNCPSSLEVDRR+SN        D  ED I+RTI  I+GRCK++
Sbjct  117  DVHREIIASNLPLDRFLNCPSSLEVDRRISNALCGIDPDDKGED-IERTIGVILGRCKEI  175

Query  638  CEKNKQHK--SIGKKSVSFLVKKMFVCRSGFAPSPS---LRDTFQESRMEKLLRTILSKK  802
              +NK+ K   IGK SVS+L+KK+FVC  GF+       LRDT QESRMEKLLR +L KK
Sbjct  176  STENKRKKKTDIGKASVSYLLKKIFVCSDGFSSPSPSPSLRDTLQESRMEKLLRMMLHKK  235

Query  803  IYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +  Q  SRA  +KR L +            EE   +K+E+++D  +W KTDS++IVLEI
Sbjct  236  MNSQAASRATPVKRCLRD--KQQVPEKTEEEEGGGEKKEKSNDGYKWVKTDSDFIVLEI  292



>ref|XP_006302634.1| hypothetical protein CARUB_v10020740mg [Capsella rubella]
 gb|EOA35532.1| hypothetical protein CARUB_v10020740mg [Capsella rubella]
Length=288

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 149/306 (49%), Positives = 188/306 (61%), Gaps = 39/306 (13%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNND-P  301
            MKFF WMQN+ +G Q  + +     P  ++    +PR EEFSDWP   LAIGT GN +  
Sbjct  1    MKFFGWMQNKLHGKQGNTHR-----PSISSASSHQPR-EEFSDWPHGLLAIGTFGNKEHT  54

Query  302  PESARKPekneiiveegeeeeQC---------SSPDLAE-FTPEEVGKLQKALTKLLSRK  451
            P+   +    E  V     EEQ          SS DL E FTPEEVGKLQK LTKLL+R+
Sbjct  55   PQKLDQEVIQEETVSNTHVEEQAQDRDQDLSYSSDDLEEDFTPEEVGKLQKELTKLLTRR  114

Query  452  PASKGEAQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIG  622
             + K  +  N   A+LPLDRFLNCPSSLEVDRR+SN   +    D  E++I+RTI  I+G
Sbjct  115  -SKKRNSDVNRELANLPLDRFLNCPSSLEVDRRISNALCS----DEKEEDIERTISVILG  169

Query  623  RCKDVC--EKNKQHKS---IGKKSVSFLVKKMFVCRSGFAP--SPSLRDTFQESRMEKLL  781
            RCK +    KNK  KS   + K SVS L+KKMFVC  GF+P  +PSLRDTFQESRMEKLL
Sbjct  170  RCKAISTESKNKTKKSTRDLSKTSVSHLLKKMFVCAEGFSPVPNPSLRDTFQESRMEKLL  229

Query  782  RTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            RT+L KKI  Q  S+  S  + L+           ++ + EE++   +SD G+W KTDS+
Sbjct  230  RTMLHKKINTQPSSKQTSTIKNLQE-------KQQLSLKNEEEEGRSSSDGGKWVKTDSD  282

Query  962  YIVLEI  979
            +IVLEI
Sbjct  283  FIVLEI  288



>ref|XP_006426700.1| hypothetical protein CICLE_v10027453mg [Citrus clementina]
 gb|ESR39940.1| hypothetical protein CICLE_v10027453mg [Citrus clementina]
Length=284

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 173/258 (67%), Gaps = 14/258 (5%)
 Frame = +2

Query  221  KQEPRNEEFSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTP  400
            KQEPR EEF+DWP   LAIGT GNN    + +    +EI   + ++EE  SS DL +FTP
Sbjct  25   KQEPR-EEFNDWPRGLLAIGTFGNNPEINNNKGNNDSEIQNIQDDQEEASSSIDLQDFTP  83

Query  401  EEVGKLQKALTKLLSRKPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNT---------  553
            EE+GK +K LTKLL RKP    E +  A LPLDRFLNCPSSLEVDRR+SN          
Sbjct  84   EEIGKFEKELTKLLRRKPNLDKEKKV-ASLPLDRFLNCPSSLEVDRRISNAICNEISDDH  142

Query  554  -SAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAP  730
             +  +   D  +++IDRTI  I+GRCKD+   +   K+IGKKS+SFL+KKMFVCRSGFAP
Sbjct  143  HNKDHDNQDIKDEDIDRTISVILGRCKDI-RADSSKKAIGKKSISFLLKKMFVCRSGFAP  201

Query  731  SPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeek  910
             PSLRD+ QESRME+ LR +L KK+ PQN SRA S+K++LE+    A+      E++ EK
Sbjct  202  QPSLRDSLQESRMERFLRIMLHKKMNPQNASRAPSMKKYLED-TKQASNNKNGTEDDREK  260

Query  911  krertSDSGRWDKTDSEY  964
             + +  +  +W KTDSE+
Sbjct  261  LQGKNKEGCKWVKTDSEW  278



>ref|XP_010415999.1| PREDICTED: uncharacterized protein LOC104701933 [Camelina sativa]
Length=287

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 142/305 (47%), Positives = 186/305 (61%), Gaps = 38/305 (12%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDP-  301
            MKFF WMQN+ +G Q     G    P  ++    +PR EEFSDWP   LAIGT GN +P 
Sbjct  1    MKFFGWMQNKLHGKQ-----GITHRPSISSTSSHQPR-EEFSDWPHGLLAIGTFGNKEPQ  54

Query  302  PESARKPekneiiveegeeeeQCSSPDL---------AEFTPEEVGKLQKALTKLLSRKP  454
            P+   +    E  V     E+Q    D           EFTPEEVGKLQK LTKLL+R+ 
Sbjct  55   PQKLDQEVIQEETVSNVHVEDQTQDRDQDLSSSDNLEEEFTPEEVGKLQKELTKLLTRR-  113

Query  455  ASKGEAQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGR  625
            + K ++  N   A+LPLDRFLNCPSSLEVDRR+SN   +    D +E++I+RTI  I+GR
Sbjct  114  SKKTKSDVNRELANLPLDRFLNCPSSLEVDRRISNALCS----DENEEDIERTISVILGR  169

Query  626  CKDVCEKNKQHK-----SIGKKSVSFLVKKMFVCRSGFAP--SPSLRDTFQESRMEKLLR  784
            CK +  ++K         + K SVS L+KKMFVC  GF+P  +PSLRDTFQESRMEKLLR
Sbjct  170  CKAISTESKNKTKKSKKDLSKISVSHLLKKMFVCTDGFSPVPNPSLRDTFQESRMEKLLR  229

Query  785  TILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEY  964
             +L KKI  Q  S+  S K+ L++          ++ + EE++   ++D G+W KTDS++
Sbjct  230  MMLHKKINTQTSSKQTSTKKNLQD-------KQRLSLKNEEEEGRSSNDGGKWVKTDSDF  282

Query  965  IVLEI  979
            IVLEI
Sbjct  283  IVLEI  287



>ref|XP_006416708.1| hypothetical protein EUTSA_v10009299mg [Eutrema salsugineum]
 gb|ESQ35061.1| hypothetical protein EUTSA_v10009299mg [Eutrema salsugineum]
Length=297

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 141/302 (47%), Positives = 185/302 (61%), Gaps = 22/302 (7%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFF WMQN+ N  Q G++    +    ++H KQEPR EEFSDWP + LAIGT G     
Sbjct  1    MKFFGWMQNKLNAKQ-GNQNRTSISSACSHHVKQEPR-EEFSDWPHALLAIGTFGTTSNG  58

Query  305  ESARKP----ekneiiveegeeeeQCSSP----DLAEFTPEEVGKLQKALTKLLSRKPAS  460
             +  K     E+ E       + EQ   P    D+ +FTPEEVGKLQK L KLLSR    
Sbjct  59   VNENKSNNVCEEIEAEKNSISQFEQEEEPSSFDDIGDFTPEEVGKLQKELMKLLSRTKKR  118

Query  461  KGEA--QTNADLPLDRFLNCPSSLEVDRRLSNT--SAANSLYDCDEDEIDRTIRAIIGRC  628
            K +   +   +LPLDRFLNCPSSLEV+RR+SN   +  +S  +  E+ ++RTI AI+GRC
Sbjct  119  KSDVNRELMKNLPLDRFLNCPSSLEVERRISNALCAVVDSSEENKEEHMERTINAILGRC  178

Query  629  KDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGF--APSPSLRDTFQESRMEKLLRTILSKK  802
            K++  + K+ + I K S+S+L KK+FVC  GF  +PSPSLRDT QESRMEKLL+ +L KK
Sbjct  179  KEISIETKKKRDISKTSISYLFKKIFVCTDGFSISPSPSLRDTLQESRMEKLLKMMLHKK  238

Query  803  IYPQNPSR---AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVL  973
            I     S    +++ KR LE        +    EEEE  +R  +SD  +W KTDS++IVL
Sbjct  239  INNAQASSKPTSSTTKRNLE---EKKQLSMKSEEEEETNERRSSSDGHKWVKTDSDFIVL  295

Query  974  EI  979
            EI
Sbjct  296  EI  297



>ref|XP_010428134.1| PREDICTED: uncharacterized protein LOC104712854 isoform X1 [Camelina 
sativa]
Length=287

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 144/305 (47%), Positives = 190/305 (62%), Gaps = 38/305 (12%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDP-  301
            MKFF WMQN+ +G Q  + +  P    T++H   +PR EEFSDWP   LAIGT GN +  
Sbjct  1    MKFFGWMQNKLHGKQGNTHR--PSISSTSSH---QPR-EEFSDWPHGLLAIGTFGNKETT  54

Query  302  PESARKPekneiiveegeeeeQC--------SSPDLAE-FTPEEVGKLQKALTKLLSRKP  454
            P+   +    E  V     E+Q         SS DL E FTPEEVGKLQK LTKLL+R+ 
Sbjct  55   PQKLDQEVIQEETVSNVNVEDQAQDRDQDLSSSDDLEEDFTPEEVGKLQKELTKLLTRR-  113

Query  455  ASKGEAQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGR  625
            + K ++  N   A+LPLDRFLNCPSSLEVDRR+SN   +    D +E++I+RTI  I+GR
Sbjct  114  SKKRKSDVNRELANLPLDRFLNCPSSLEVDRRISNALCS----DENEEDIERTISVILGR  169

Query  626  CKDVCEKNKQHK-----SIGKKSVSFLVKKMFVCRSGFAP--SPSLRDTFQESRMEKLLR  784
            CK +  ++K         + K SVS L+KKMFVC  GF+P  +PSLRDTFQE+RMEKLLR
Sbjct  170  CKAISTESKNKTKKSKKDLSKTSVSHLLKKMFVCTDGFSPVPNPSLRDTFQETRMEKLLR  229

Query  785  TILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEY  964
             +L KKI  Q  S+  S KR L++          ++ + EE++   ++D  +W KTDS++
Sbjct  230  MMLHKKINTQTSSKQTSTKRNLQD-------KQRLSLKNEEEEGRSSNDGSKWVKTDSDF  282

Query  965  IVLEI  979
            IVLEI
Sbjct  283  IVLEI  287



>ref|XP_010428135.1| PREDICTED: uncharacterized protein LOC104712854 isoform X2 [Camelina 
sativa]
Length=291

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 144/305 (47%), Positives = 189/305 (62%), Gaps = 34/305 (11%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDP-  301
            MKFF WMQN+ +G Q  + +  P    T++H   +PR EEFSDWP   LAIGT GN +  
Sbjct  1    MKFFGWMQNKLHGKQGNTHR--PSISSTSSH---QPR-EEFSDWPHGLLAIGTFGNKETT  54

Query  302  PESARKPekneiiveegeeeeQC--------SSPDLAE-FTPEEVGKLQKALTKLLSRKP  454
            P+   +    E  V     E+Q         SS DL E FTPEEVGKLQK LTKLL+R+ 
Sbjct  55   PQKLDQEVIQEETVSNVNVEDQAQDRDQDLSSSDDLEEDFTPEEVGKLQKELTKLLTRR-  113

Query  455  ASKGEAQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGR  625
            + K ++  N   A+LPLDRFLNCPSSLEVDRR+SN   ++   +  E +I+RTI  I+GR
Sbjct  114  SKKRKSDVNRELANLPLDRFLNCPSSLEVDRRISNALCSDENEEDIEQDIERTISVILGR  173

Query  626  CKDVCEK-----NKQHKSIGKKSVSFLVKKMFVCRSGFA--PSPSLRDTFQESRMEKLLR  784
            CK +  +      K  K + K SVS L+KKMFVC  GF+  P+PSLRDTFQE+RMEKLLR
Sbjct  174  CKAISTESKNKTKKSKKDLSKTSVSHLLKKMFVCTDGFSPVPNPSLRDTFQETRMEKLLR  233

Query  785  TILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEY  964
             +L KKI  Q  S+  S KR L++          ++ + EE++   ++D  +W KTDS++
Sbjct  234  MMLHKKINTQTSSKQTSTKRNLQD-------KQRLSLKNEEEEGRSSNDGSKWVKTDSDF  286

Query  965  IVLEI  979
            IVLEI
Sbjct  287  IVLEI  291



>ref|NP_177393.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAU44428.1| hypothetical protein AT1G72490 [Arabidopsis thaliana]
 gb|AAU44429.1| hypothetical protein AT1G72490 [Arabidopsis thaliana]
 gb|AAX23800.1| hypothetical protein At1g72490 [Arabidopsis thaliana]
 gb|AEE35330.1| uncharacterized protein AT1G72490 [Arabidopsis thaliana]
Length=287

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 188/306 (61%), Gaps = 40/306 (13%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNN-DP  301
            MKFF WMQN+ +G Q  + +     P  ++     PR EEF+DWP   LAIGT GN    
Sbjct  1    MKFFGWMQNKLHGKQEITHR-----PSISSASSHHPR-EEFNDWPHGLLAIGTFGNKKQT  54

Query  302  PESARKPekneiiveegeeeeQ---------CSSPDLAE-FTPEEVGKLQKALTKLLSRK  451
            P++  +    E  V     E +          SS DL E FTPEEVGKLQK LTKLL+R+
Sbjct  55   PQTLDQEVIQEETVSNLHVEGRQAQDTDQELSSSDDLEEDFTPEEVGKLQKELTKLLTRR  114

Query  452  PASKGEAQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIG  622
             + K ++  N   A+LPLDRFLNCPSSLEVDRR+SN     +L D  E++I+RTI  I+G
Sbjct  115  -SKKRKSDVNRELANLPLDRFLNCPSSLEVDRRISN-----ALCDEKEEDIERTISVILG  168

Query  623  RCKDVC--EKNKQHKS---IGKKSVSFLVKKMFVCRSGFAPSPS--LRDTFQESRMEKLL  781
            RCK +    KNK  K+   + K SVS L+KKMFVC  GF+P P   LRDTFQE+RMEKLL
Sbjct  169  RCKAISTESKNKTKKNKRDLSKTSVSHLLKKMFVCTEGFSPVPRPILRDTFQETRMEKLL  228

Query  782  RTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            R +L KK+  Q  S+  S K++L++          ++ + EE++   ++D G+W KTDS+
Sbjct  229  RMMLHKKVNTQASSKQTSTKKYLQD-------KQQLSLKNEEEEGRSSNDGGKWVKTDSD  281

Query  962  YIVLEI  979
            +IVLEI
Sbjct  282  FIVLEI  287



>gb|KHN11347.1| hypothetical protein glysoja_036044 [Glycine soja]
Length=245

 Score =   217 bits (552),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 168/268 (63%), Gaps = 38/268 (14%)
 Frame = +2

Query  212  NHGKQEPRNEEFSDWPGSFLAIGTLGN-NDPPESARKPekneiiveegeeeeQCSSPDLA  388
            +  KQEPR EEFSDWP   LAIGT GN N+  E   K    E            SS ++A
Sbjct  4    DDAKQEPR-EEFSDWPDGLLAIGTFGNSNEVKEKTEKHILREDPS---------SSEEIA  53

Query  389  EFTPEEVGKLQKALTKLLSRKPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANS  568
            +FTPEE+GKLQK LTKLL +KP  + E    A+LPLDRFLNCPSSLEVDRR+SN   ++S
Sbjct  54   DFTPEEIGKLQKELTKLLRQKPNVEKEI---AELPLDRFLNCPSSLEVDRRISNVLCSDS  110

Query  569  LYDCDEDEIDR---------TIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSG  721
                 ++E            T+  I+G+ K++C  N + K+IGKKS+SFL+KKMFVCRSG
Sbjct  111  EDKDKDEEEREKEEEEDIEKTLSVILGKFKEICANNSK-KAIGKKSISFLLKKMFVCRSG  169

Query  722  FAPSPSLRDT--FQESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiae  895
            FAP+PSLRDT   QESRMEKLLR IL KKI  Q+ SRA SLK+ LE+             
Sbjct  170  FAPAPSLRDTLQLQESRMEKLLRIILHKKINSQHSSRALSLKKRLED------------R  217

Query  896  eeeekkrertSDSGRWDKTDSEYIVLEI  979
            +  ++      D  +W KTDSEYIVLEI
Sbjct  218  KMPKEDEAENDDGCKWVKTDSEYIVLEI  245



>ref|XP_009105908.1| PREDICTED: uncharacterized protein LOC103831755 [Brassica rapa]
 ref|XP_009105910.1| PREDICTED: uncharacterized protein LOC103831755 [Brassica rapa]
Length=289

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 143/304 (47%), Positives = 191/304 (63%), Gaps = 34/304 (11%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGN----  292
            MK F WMQN+ +G Q  + +     P T++    +PR EEFSDWP   LAIGT G+    
Sbjct  1    MKLFGWMQNKLHGKQGNTHR-----PSTSSASSHQPR-EEFSDWPHGLLAIGTFGSVTKE  54

Query  293  NDPPESAR--KPekneiiveegeeeeQCSSP-DLAEFTPEEVGKLQKALTKLLSRKPASK  463
              P E+ +  KP    +  +  + ++  SS  DL +FTPEEVGKLQK LTKLL+RK   K
Sbjct  55   QIPIETVQEEKPSNLHVEGQAQDRDQDLSSSGDLEDFTPEEVGKLQKELTKLLTRK-NKK  113

Query  464  GEAQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDE--IDRTIRAIIGRC  628
             ++  N   A+LPLDRFLNCPSSLEVDRR+SN + +    DCDE+E  I+RTI  I+GRC
Sbjct  114  RQSDVNRELANLPLDRFLNCPSSLEVDRRISN-ALSGGCGDCDENEEDIERTISVILGRC  172

Query  629  KDVCEKNKQHKSIGKK-----SVSFLVKKMFVCRSGFAP--SPSLRDTFQESRMEKLLRT  787
            K +  ++   K   KK     SVS+L+KKMFVC  GF+P   PS+RDTFQESRMEKLLR 
Sbjct  173  KAISTESNSKKKKTKKDLSKTSVSYLLKKMFVCTEGFSPLPKPSVRDTFQESRMEKLLRV  232

Query  788  ILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYI  967
            +L KKI  Q PS+     R++++          ++ + EE++   +SD  +W KTDS++I
Sbjct  233  MLLKKINAQAPSKETPTNRYVQD-------KQQLSLKNEEEEGSSSSDGCKWVKTDSDFI  285

Query  968  VLEI  979
            VLEI
Sbjct  286  VLEI  289



>ref|XP_010261786.1| PREDICTED: uncharacterized protein LOC104600511 [Nelumbo nucifera]
Length=269

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 183/293 (62%), Gaps = 32/293 (11%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNND-P  301
            MK F+WMQ++ +G + G++K   V P   N   +EP  EEFSDWP   LAIGT GNND  
Sbjct  1    MKIFSWMQSKIHG-RPGNKKPSGVLPNHLN--LREPLKEEFSDWPHGLLAIGTFGNNDLK  57

Query  302  PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
             ES R              E   SS DL +FT EEVGKL+K LTKLLS KP S G   TN
Sbjct  58   GESER----------CDPLENPSSSQDLLDFTAEEVGKLEKELTKLLSHKPDSIGTESTN  107

Query  482  ----ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKN  649
                  LPLD+FLNCPSSL+VDR   +    +S  D +++ +      ++ + KDVC   
Sbjct  108  LGETIHLPLDKFLNCPSSLDVDRTNCHKFCEDS-EDKNDNNLLGNTSIVLSKGKDVCVDG  166

Query  650  KQHKSIGKKSVSFLVKKMFVCRSGF--APSPSLRDTFQESRMEKLLRTILSKKIYPQNPS  823
            K  K+IGK+S++FL+KK+FVCRSGF  AP+PSL D   ESRMEKLLR IL KKIYPQ+ S
Sbjct  167  K--KAIGKRSITFLLKKIFVCRSGFPPAPAPSLWDQLPESRMEKLLRAILHKKIYPQS-S  223

Query  824  RAASLKRFLENkrtsaatataiaeeeeekkrertSDSG-RWDKTDSEYIVLEI  979
             ++SLK++L+N          +    ++ + E TSD G +WDKTDSEYIVLEI
Sbjct  224  TSSSLKKYLDN-------RQMLKAINKDDELEETSDDGCKWDKTDSEYIVLEI  269



>ref|XP_002892949.1| hypothetical protein ARALYDRAFT_471945 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69208.1| hypothetical protein ARALYDRAFT_471945 [Arabidopsis lyrata subsp. 
lyrata]
Length=296

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 144/309 (47%), Positives = 190/309 (61%), Gaps = 37/309 (12%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLG--NND  298
            MKFF WMQN+ NG    +              KQEPR EEF DWP + LAIGT G  +N 
Sbjct  1    MKFFGWMQNKLNGDHNRTSTSSASSHHV----KQEPR-EEFRDWPHALLAIGTFGTTSNS  55

Query  299  PPESARKPekneiiveegeeeeQCSSP-----------DLAEFTPEEVGKLQKALTKLLS  445
              E+  K      + EE E E++C++            DL +FTPEEVGKLQK L KLLS
Sbjct  56   VSENESK-----NVHEEIEAEKKCTAKSEQEEEPSSSVDLEDFTPEEVGKLQKELMKLLS  110

Query  446  RKPASKGEA--QTNADLPLDRFLNCPSSLEVDRRLSN--TSAANSLYDCDEDEIDRTIRA  613
            R    K +   +   +LPLDRFLNCPSSLEVDRR+SN  ++  +S  +  E++++RTI  
Sbjct  111  RTKKRKSDVNRELMKNLPLDRFLNCPSSLEVDRRISNALSAVVDSSEENKEEDMERTISV  170

Query  614  IIGRCKDVC---EKNKQHKSIGKKSVSFLVKKMFVCRSGF--APSPSLRDTFQESRMEKL  778
            I+GRCK++    +KNK+ + I K SVS+L KK+FVC +G   APSPSLRDT QESRMEKL
Sbjct  171  ILGRCKEISIESKKNKKKRDISKTSVSYLFKKIFVCANGISTAPSPSLRDTLQESRMEKL  230

Query  779  LRTILSKKIYPQNPSR--AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKT  952
            L+ +L KKI  Q  S+  +++ KR+LE+       +    EEEE  +R  + D  +W KT
Sbjct  231  LKMMLHKKINAQASSKPTSSTTKRYLED---KKQLSLKSEEEEETSERRSSGDGYKWVKT  287

Query  953  DSEYIVLEI  979
            DS++IVLEI
Sbjct  288  DSDFIVLEI  296



>ref|NP_173183.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AAX55082.1| hypothetical protein At1g17400 [Arabidopsis thaliana]
 gb|AEE29582.1| uncharacterized protein AT1G17400 [Arabidopsis thaliana]
Length=295

 Score =   213 bits (543),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 190/309 (61%), Gaps = 38/309 (12%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLG--NND  298
            MKFF WMQN+ NG    +              KQEPR EEFSDWP + LAIGT G  +N 
Sbjct  1    MKFFGWMQNKLNGDHNRTSTSSASSHHV----KQEPR-EEFSDWPHALLAIGTFGTTSNS  55

Query  299  PPESARKPekneiiveegeeeeQCSSP-----------DLAEFTPEEVGKLQKALTKLLS  445
              E+  K      + EE E E++C++            +L +FTPEEVGKLQK L KLLS
Sbjct  56   VSENESK-----NVHEEIEAEKKCTAQSEQEEEPSSSVNLEDFTPEEVGKLQKELMKLLS  110

Query  446  RKPASKGEA--QTNADLPLDRFLNCPSSLEVDRRLSN--TSAANSLYDCDEDEIDRTIRA  613
            R    K +   +   +LPLDRFLNCPSSLEVDRR+SN  ++  +S  +  E++++RTI  
Sbjct  111  RTKKRKSDVNRELMKNLPLDRFLNCPSSLEVDRRISNALSAVVDSSEENKEEDMERTINV  170

Query  614  IIGRCKDVC---EKNKQHKSIGKKSVSFLVKKMFVCRSGF--APSPSLRDTFQESRMEKL  778
            I+GRCK++    + NK+ + I K SVS+L KK+FVC  G   APSPSLRDT QESRMEKL
Sbjct  171  ILGRCKEISIESKNNKKKRDISKNSVSYLFKKIFVCADGISTAPSPSLRDTLQESRMEKL  230

Query  779  LRTILSKKIYPQNPSRAASL--KRFLENkrtsaatataiaeeeeekkrertSDSGRWDKT  952
            L+ +L KKI  Q  S+  SL  KR+L++        +  +EEEE  +R  +SD  +W KT
Sbjct  231  LKMMLHKKINAQASSKPTSLTTKRYLQD----KKQLSLKSEEEETSERRSSSDGYKWVKT  286

Query  953  DSEYIVLEI  979
            DS++IVLEI
Sbjct  287  DSDFIVLEI  295



>ref|XP_010498086.1| PREDICTED: uncharacterized protein LOC104775850 [Camelina sativa]
Length=298

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 142/305 (47%), Positives = 187/305 (61%), Gaps = 27/305 (9%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYP-VPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLG--NN  295
            MKFF WMQ + N          P     +++H KQEPR EEF+DWP + LAIGT G  +N
Sbjct  1    MKFFGWMQTKLNVDH-----NRPSTSSASSHHVKQEPR-EEFNDWPNALLAIGTFGTTSN  54

Query  296  DPPESARKPekneiiveegeeeeQC-------SSPDLAEFTPEEVGKLQKALTKLLSRKP  454
               E+  K   +E +  E +   Q        SS DL +FTPEEVGKLQK L KLLSR  
Sbjct  55   RMSENEGKSVVHEEVETEKKCTTQAEQEEEPSSSDDLEDFTPEEVGKLQKELMKLLSRTK  114

Query  455  ASKGEA--QTNADLPLDRFLNCPSSLEVDRRLSNT-SAANSLYDCDEDEIDRTIRAIIGR  625
              K +   +   +LPLDRFLNCPSSLEVDRR+SN  SA   L +   ++++RTI  I+GR
Sbjct  115  KRKSDVNRELMKNLPLDRFLNCPSSLEVDRRISNALSAVVDLSEEKGEDMERTINVILGR  174

Query  626  CKDV---CEKNKQHKSIGKKSVSFLVKKMFVCRSGF--APSPSLRDTFQESRMEKLLRTI  790
            CK++    +KN + + I K S S+L KK+FVC  GF  AP PSLRDT QESRMEKLL+ +
Sbjct  175  CKEISIESKKNNKKRDISKTSASYLFKKIFVCADGFSTAPKPSLRDTLQESRMEKLLKMM  234

Query  791  LSKKIYPQNPSR--AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEY  964
            + KKI  Q  S+  +++ KR L + +   +  +   EEEE  +R  +SD  +W KTDS++
Sbjct  235  IHKKINAQASSKPTSSTTKRCLRD-KKQLSLKSEEEEEEETNERRSSSDGYKWVKTDSDF  293

Query  965  IVLEI  979
            IVLEI
Sbjct  294  IVLEI  298



>ref|XP_010459328.1| PREDICTED: uncharacterized protein LOC104740433 isoform X2 [Camelina 
sativa]
Length=298

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 145/305 (48%), Positives = 187/305 (61%), Gaps = 27/305 (9%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYP-VPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLG--NN  295
            MKFF WMQ + NG         P     +++H KQEPR EEF+DWP + LAIGT G  +N
Sbjct  1    MKFFGWMQTKLNGDH-----NRPSTSSASSHHVKQEPR-EEFNDWPNALLAIGTFGTTSN  54

Query  296  DPPESARKPekneiiveegeeeeQC-------SSPDLAEFTPEEVGKLQKALTKLLSRKP  454
               E+  K   +E I  E +   Q        SS DL +FTPEEVGKLQK L KLLSR  
Sbjct  55   SMSENEGKSVVHEEIETEKKCTTQAEQEEEPSSSDDLEDFTPEEVGKLQKELMKLLSRTK  114

Query  455  ASKGEA--QTNADLPLDRFLNCPSSLEVDRRLSNT-SAANSLYDCDEDEIDRTIRAIIGR  625
              K +   +   +LPLDRFLNCPSSLEVDRR+SN  SA   L +   ++++RTI  I+GR
Sbjct  115  KRKSDVNKELMKNLPLDRFLNCPSSLEVDRRISNALSAVVDLSEEKGEDMERTINVILGR  174

Query  626  CKDVC---EKNKQHKSIGKKSVSFLVKKMFVCRSGF--APSPSLRDTFQESRMEKLLRTI  790
            CK++    +KN + + I K S S+L KK+FVC  GF  AP PSLRDT QESRMEKLLR +
Sbjct  175  CKEISIESKKNNKKRDISKTSASYLFKKIFVCADGFSTAPKPSLRDTLQESRMEKLLRMM  234

Query  791  LSKKIYPQ--NPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEY  964
            L KKI  Q  +   +++ KR L + +   +  +   EEEE  +R  +SD  +W KTDS++
Sbjct  235  LHKKINAQTSSKPTSSTTKRCLRD-KKQLSLKSEEEEEEETNERRSSSDGYKWVKTDSDF  293

Query  965  IVLEI  979
            IVLEI
Sbjct  294  IVLEI  298



>ref|XP_009149192.1| PREDICTED: uncharacterized protein LOC103872526 [Brassica rapa]
Length=295

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 143/302 (47%), Positives = 185/302 (61%), Gaps = 24/302 (8%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F WMQN+ N       +       + +  KQEPR EEFSDWP + LAIGT G+    
Sbjct  1    MKLFGWMQNKRNAKYENHNRTSTSSASSHHL-KQEPR-EEFSDWPHALLAIGTFGSTSNG  58

Query  305  ESARKPekneiiveegeeeeQ--------CSSPDLAEFTPEEVGKLQKALTKLLSRKPAS  460
             S  K +     +EE +E            SS D+ +FTPEEVGKLQK L KLLSR    
Sbjct  59   VSDTKSKNVHEEIEEEKEAISQPEQEEEPSSSDDIDDFTPEEVGKLQKELIKLLSRTKKR  118

Query  461  KGEA--QTNADLPLDRFLNCPSSLEVDRRLSNTSAA---NSLYDCDEDEIDRTIRAIIGR  625
            K +   +   +LPLDRFLNCPSSLEV+RR+SN   A   +S  + DED ++RTI AI+GR
Sbjct  119  KSDVNRELMKNLPLDRFLNCPSSLEVERRISNALCAVVDSSEGNKDED-MERTINAILGR  177

Query  626  CKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGF--APSPSLRDTFQESRMEKLLRTILSK  799
            CK++  ++K+   I KKS S+L KK+FVC  G   +PSPSLRDT QESRMEKLL+ +L K
Sbjct  178  CKEISIESKKKTDISKKSFSYLFKKIFVCSDGISTSPSPSLRDTLQESRMEKLLKMMLHK  237

Query  800  KIYPQNPSRAAS--LKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVL  973
            KI  Q  S+ AS   KR+LE+        +  +EEEE  +R  +S+  +W KTDS++IVL
Sbjct  238  KINSQASSKPASSTTKRYLED----KKQLSLKSEEEETNERRSSSEGHKWVKTDSDFIVL  293

Query  974  EI  979
            EI
Sbjct  294  EI  295



>ref|XP_006605277.1| PREDICTED: uncharacterized protein LOC100814844 [Glycine max]
Length=336

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 175/304 (58%), Gaps = 47/304 (15%)
 Frame = +2

Query  98   TFASIFQNRM----KFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGS  265
            TF  I Q  +    KFF   + R  G      KG        +  KQEPR EEFSDWP  
Sbjct  62   TFPLILQLEVVDIGKFFGTQKARLYGS-----KGLRNWRGEADDAKQEPR-EEFSDWPDG  115

Query  266  FLAIGTLGN-NDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLL  442
             LAIGT GN N+  E   K    E            SS ++A+FTPEE+GKLQK LTKLL
Sbjct  116  LLAIGTFGNSNEVKEKTEKHILREDPS---------SSEEIADFTPEEIGKLQKELTKLL  166

Query  443  SRKPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDR-------  601
             +KP  + E    A+LPLDRFLNCPSSLEVDRR+SN   ++S     ++E          
Sbjct  167  RQKPNVEKEI---AELPLDRFLNCPSSLEVDRRISNVLCSDSEDKDKDEEEREKEEEEDI  223

Query  602  --TIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDT--FQESRM  769
              T+  I+G+ K++C  N + K+IGKKS+SFL+KKMFVCRSGFAP+PSL+DT   QESRM
Sbjct  224  EKTLSVILGKFKEICANNSK-KAIGKKSISFLLKKMFVCRSGFAPAPSLKDTLQLQESRM  282

Query  770  EKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDK  949
            EKLLR IL KKI  Q+ SRA SLK+ LE+             +  ++      D  +W K
Sbjct  283  EKLLRIILHKKINSQHSSRALSLKKRLED------------RKMPKEDEAENDDGCKWVK  330

Query  950  TDSE  961
            TDSE
Sbjct  331  TDSE  334



>ref|XP_010459327.1| PREDICTED: uncharacterized protein LOC104740433 isoform X1 [Camelina 
sativa]
Length=326

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 154/248 (62%), Gaps = 24/248 (10%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYP-VPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLG--NN  295
            MKFF WMQ + NG         P     +++H KQEPR EEF+DWP + LAIGT G  +N
Sbjct  1    MKFFGWMQTKLNGDH-----NRPSTSSASSHHVKQEPR-EEFNDWPNALLAIGTFGTTSN  54

Query  296  DPPESARKPekneiiveegeeeeQC-------SSPDLAEFTPEEVGKLQKALTKLLSRKP  454
               E+  K   +E I  E +   Q        SS DL +FTPEEVGKLQK L KLLSR  
Sbjct  55   SMSENEGKSVVHEEIETEKKCTTQAEQEEEPSSSDDLEDFTPEEVGKLQKELMKLLSRTK  114

Query  455  ASKGEA--QTNADLPLDRFLNCPSSLEVDRRLSNT-SAANSLYDCDEDEIDRTIRAIIGR  625
              K +   +   +LPLDRFLNCPSSLEVDRR+SN  SA   L +   ++++RTI  I+GR
Sbjct  115  KRKSDVNKELMKNLPLDRFLNCPSSLEVDRRISNALSAVVDLSEEKGEDMERTINVILGR  174

Query  626  CKDVC---EKNKQHKSIGKKSVSFLVKKMFVCRSGF--APSPSLRDTFQESRMEKLLRTI  790
            CK++    +KN + + I K S S+L KK+FVC  GF  AP PSLRDT QESRMEKLLR +
Sbjct  175  CKEISIESKKNNKKRDISKTSASYLFKKIFVCADGFSTAPKPSLRDTLQESRMEKLLRMM  234

Query  791  LSKKIYPQ  814
            L KKI  Q
Sbjct  235  LHKKINAQ  242



>ref|XP_006577366.1| PREDICTED: uncharacterized protein LOC100786825 [Glycine max]
Length=273

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 180/300 (60%), Gaps = 42/300 (14%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            M+F +WMQN+  GG+   RK  P     TN  K   R EE SDWP   LAIGT GNN+  
Sbjct  1    MQFLSWMQNKI-GGKQDIRK--PNTYTATNDAKL-VRREELSDWPDGLLAIGTFGNNNEV  56

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            +   +                 SS ++A+FTPEE+GKL+K LTKLL +KP      +  A
Sbjct  57   KEKTEKNILREDPS--------SSEEIADFTPEEIGKLKKELTKLLRQKPNIV--EKEIA  106

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDR-------------TIRAIIGR  625
            +LPLDRFLNCPSSLEVDRR+SN   ++S     ++E +              T+  I+G+
Sbjct  107  ELPLDRFLNCPSSLEVDRRISNVLGSDSEDKDKDEEKEEEREKEEEEEDIEKTLSVILGK  166

Query  626  CKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDT--FQESRMEKLLRTILSK  799
             K++C  N + K+IGKKS+SFL+KKMFVCRSGFAP+PSLRDT   QESRMEKLLRTIL K
Sbjct  167  FKEICANNSK-KAIGKKSISFLLKKMFVCRSGFAPAPSLRDTLQLQESRMEKLLRTILHK  225

Query  800  KIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            KI  Q+ SRA SLK+ LE+             +  ++      D  +W KTDSEYIVLEI
Sbjct  226  KINSQHSSRALSLKKRLED------------RKMPKEDEAENDDGCKWVKTDSEYIVLEI  273



>emb|CDX96411.1| BnaA07g30220D [Brassica napus]
Length=305

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 136/298 (46%), Positives = 184/298 (62%), Gaps = 34/298 (11%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGN----  292
             + F WMQN+ +G Q  + +     P T++    +PR EEFSDWP   LAIGT G+    
Sbjct  17   FQLFGWMQNKLHGKQGNTHR-----PSTSSASSHQPR-EEFSDWPHGLLAIGTFGSVTKE  70

Query  293  NDPPESAR--KPekneiiveegeeeeQCSSP-DLAEFTPEEVGKLQKALTKLLSRKPASK  463
              P E+ +  KP    +  +  + ++  SS  DL +FTPEEVGKLQK LTKLL+RK   K
Sbjct  71   QIPIETVQEEKPSNLHVEGQAQDRDQDLSSSGDLEDFTPEEVGKLQKELTKLLTRK-NKK  129

Query  464  GEAQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDE--IDRTIRAIIGRC  628
             ++  N   A+LPLDRFLNCPSSLEVDRR+SN + +    DCDE+E  I+RTI  I+GRC
Sbjct  130  RQSDVNRELANLPLDRFLNCPSSLEVDRRISN-ALSGGCGDCDENEEDIERTISVILGRC  188

Query  629  KDVCEKNKQHKSIGKK-----SVSFLVKKMFVCRSGFAP--SPSLRDTFQESRMEKLLRT  787
            K +  ++   K   KK     SVS+L+KKMFVC  GF+P   PS+RDTFQESRMEKLLR 
Sbjct  189  KAISTESNSKKKKTKKDLSKTSVSYLLKKMFVCTEGFSPLPKPSVRDTFQESRMEKLLRV  248

Query  788  ILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            +L KKI  Q PS+     R++++          ++ + EE++   +SD  +W KTDS+
Sbjct  249  MLLKKINAQAPSKETPTNRYVQD-------KQQLSLKNEEEEGSSSSDGCKWVKTDSD  299



>ref|XP_010111989.1| Nucleoside diphosphate kinase 6 [Morus notabilis]
 gb|EXC32300.1| Nucleoside diphosphate kinase 6 [Morus notabilis]
Length=468

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 137/270 (51%), Positives = 175/270 (65%), Gaps = 31/270 (11%)
 Frame = +2

Query  215  HGKQEPRNEEFSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEF  394
            + KQE R EEFSDWP    +IGT GN+D  E       N I  E         S ++ + 
Sbjct  124  YAKQEHR-EEFSDWPQGLFSIGTFGNDDIKEITESQNINNIQEENNPSW----SEEVLDI  178

Query  395  TPEEVGKLQKALTKLLSRKPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNT-------  553
            TPEEVGKLQK LTKLLSRKP  + E    ++LPLDRFLNCPSSLEVDRR+SN        
Sbjct  179  TPEEVGKLQKELTKLLSRKPNKEKEI---SELPLDRFLNCPSSLEVDRRISNALCCSESD  235

Query  554  -SAANSLYDCDEDEIDRTIRAIIGRCKDV---CEKNKQHKSIGKKSVSFLVKKMFVCRSG  721
                ++  D D+++ID+TI  IIG+CK+V    E+NK  K+IGKKS+SFL+KKMFVCRSG
Sbjct  236  NHDDHNYDDKDDEDIDKTISVIIGKCKEVLISAERNK--KAIGKKSISFLLKKMFVCRSG  293

Query  722  FAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLENk----------rtsa  871
            FAP+PSLRDT QESRMEKLLRT+L KK+  QN  RA+S+K++LE+           +T+ 
Sbjct  294  FAPAPSLRDTLQESRMEKLLRTMLHKKMSHQNSYRASSVKKYLEDNPMTKKKNDQDKTAY  353

Query  872  atataiaeeeeekkrertSDSGRWDKTDSE  961
                   +++E    ++T D G+W KTDSE
Sbjct  354  NELKKKNDQDETTHDQKTDDGGKWVKTDSE  383



>ref|XP_003627330.1| hypothetical protein MTR_8g021200 [Medicago truncatula]
Length=224

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 151/234 (65%), Gaps = 32/234 (14%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFFNWMQN+  G Q   +        +T + K EPR EEFSDWP S LAIGT GNN+  
Sbjct  1    MKFFNWMQNKLGGKQENRKSNTST---STTYAKPEPR-EEFSDWPHSLLAIGTFGNNNE-  55

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
                      I  +  ++E+  SS ++ +FTPEE+GKLQK LT+LL RKP  + E    +
Sbjct  56   ------ITQNIENQNTQQEDPSSSEEVPDFTPEEIGKLQKELTRLLRRKPNVEKEI---S  106

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            +LPLDRFLNCPSS                 D DED I++T+  I+ +CKD+C +  +   
Sbjct  107  ELPLDRFLNCPSS----------------GDKDED-IEKTLSVILDKCKDICAEKSKKSI  149

Query  665  IGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSR  826
             GKKS+SFL+KKMFVCRSGFAP+PSLRDT QESRMEKLLRT+L KK+Y QN SR
Sbjct  150  -GKKSISFLLKKMFVCRSGFAPTPSLRDTLQESRMEKLLRTMLHKKLYTQNNSR  202



>ref|XP_002277684.1| PREDICTED: uncharacterized protein LOC100257848 [Vitis vinifera]
Length=266

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 126/288 (44%), Positives = 167/288 (58%), Gaps = 25/288 (9%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK  NW+Q+R N  + GS+K  P+   + N  +QEP+ EEFSDWP   LAIGT G ND  
Sbjct  1    MKILNWVQSRLNR-RHGSKKQNPI---SANWCQQEPQKEEFSDWPHGLLAIGTFGKNDVK  56

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEA---Q  475
            E   K           +     S   L + TPEEVGKLQK L  LL ++ +++  +    
Sbjct  57   EDPEK--------HNLQGSLPSSQDHLQDLTPEEVGKLQKELKSLLHKQVSAEHGSIPEL  108

Query  476  TNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQ  655
             N +LPLD+ L+  SS   D   SN S  N L   D D + R    II R KDVC  + +
Sbjct  109  DNPNLPLDKILDSLSSWGFDTATSNAST-NDLKQRD-DRLQRNSGLIISRGKDVCLDDSK  166

Query  656  HKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAAS  835
              +I KKS+SFL+KKMF+CRSGFAP+PSL+D   ESRM+K+LR +L KKIYPQ+ S   S
Sbjct  167  -SAIAKKSLSFLLKKMFICRSGFAPTPSLKDPVPESRMDKILRLLLHKKIYPQSSSSTLS  225

Query  836  LKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            + R+L N             + E++  E+ ++  +W KTDSEYIVLEI
Sbjct  226  IMRYLAN-------RHMPKSDNEDEVNEKVTEGSKWVKTDSEYIVLEI  266



>ref|XP_010476888.1| PREDICTED: glutamic acid-rich protein-like [Camelina sativa]
Length=305

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 144/313 (46%), Positives = 191/313 (61%), Gaps = 36/313 (12%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYP-VPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLG--NN  295
            MKFF WMQ + NG         P     +++H KQEPR EEF+DWP + LAIGT G  +N
Sbjct  1    MKFFGWMQTKLNGDH-----NRPSTSSASSHHEKQEPR-EEFNDWPNALLAIGTFGTTSN  54

Query  296  DPPESARKPekneiiveegeeeeQC-------SSPDLAEFTPEEVGKLQKALTKLLSRKP  454
               E+  K   +E I  E +   Q        SS DL +FTPEEVGKLQK L KLLSR  
Sbjct  55   SMSENEGKSVVHEEIETEKKCTTQAEQEEEPSSSDDLEDFTPEEVGKLQKELMKLLSRTK  114

Query  455  ASKGEA--QTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDE---IDRTIRAII  619
              K +   +   +LPLDRFLNCPSSLEVDRR+SN  A +++ D  E++   ++RTI  I+
Sbjct  115  KRKSDVNRELMKNLPLDRFLNCPSSLEVDRRISN--ALSAVVDLSEEKGEGMERTINVIL  172

Query  620  GRCKDV---CEKNKQHKSIGKKSVSFLVKKMFVCRSGF----APSPSLRDTFQESRMEKL  778
            GRCK++    +KN + + I K S S+L KK+F+C  GF    AP PSLRDT QESRMEKL
Sbjct  173  GRCKEISIESKKNNKKRDISKTSASYLFKKIFLCADGFSTAQAPKPSLRDTLQESRMEKL  232

Query  779  LRTILSKKIYPQNPSR--AASLKRFLENkrtsaata----taiaeeeeekkrertSDSGR  940
            L+ +L KKI  Q  S+  +++ K+ L +K+  +  +        EEEE  +R  +SD  +
Sbjct  233  LKMLLHKKINVQASSKPTSSTTKKCLRDKKQLSLKSEEEEEEEEEEEETNERRSSSDGYK  292

Query  941  WDKTDSEYIVLEI  979
            W KTDS++IVLEI
Sbjct  293  WVKTDSDFIVLEI  305



>ref|XP_009127937.1| PREDICTED: uncharacterized protein LOC103852785 [Brassica rapa]
Length=291

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 124/305 (41%), Positives = 172/305 (56%), Gaps = 34/305 (11%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGN----  292
            MK F WM N+ +G QA + +     P T++    + R EEFSDWP   LAIGT G     
Sbjct  1    MKLFGWMHNKLHGKQANTHR-----PRTSSACSHQSR-EEFSDWPHGLLAIGTFGTLIKD  54

Query  293  -------NDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRK  451
                    +  +  +    +     +    +   S DL +FTPEEVGKLQ  LTKLL+RK
Sbjct  55   QTPIHVVQEVIQEEKTSNMHVEGKAQDRNHDLSLSDDLEDFTPEEVGKLQNELTKLLTRK  114

Query  452  PASKGEAQTNADL---PLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIG  622
               K ++  N +L   PLDRFLNCPSS EVDRR+SN  +     D ++++I+R I  I+G
Sbjct  115  -NKKRKSDVNKELENLPLDRFLNCPSSFEVDRRISNAFSGGGDSDENQEDIERAISTILG  173

Query  623  RCKDVC----EKNKQHKSIGKKSVSFLVKKMFVCRSGFA--PSPSLRDTFQESRMEKLLR  784
            RCK +      K K  +   K SVS+L+KKMFVC  G +  P+P LRDTFQESRMEK LR
Sbjct  174  RCKAISTGSKSKMKAKRDWSKTSVSYLLKKMFVCTEGHSPLPNPGLRDTFQESRMEKFLR  233

Query  785  TILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEY  964
             +L KKI  +   +  S  R++++          ++ + +E++   +SD   W KTDS++
Sbjct  234  VMLLKKINTRACPKETSTCRYVQD-------RQQLSLKNKEEEGRSSSDGSTWVKTDSDF  286

Query  965  IVLEI  979
            IVLEI
Sbjct  287  IVLEI  291



>ref|XP_006305422.1| hypothetical protein CARUB_v10009828mg [Capsella rubella]
 gb|EOA38320.1| hypothetical protein CARUB_v10009828mg [Capsella rubella]
Length=309

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 159/256 (62%), Gaps = 27/256 (11%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYP-VPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLG----  289
            MK F WMQ + N  Q       P     +++H KQ PR EEFSDWP + LAIGT G    
Sbjct  1    MKLFGWMQTKLNVDQ-----NRPSTSSASSHHVKQGPR-EEFSDWPHALLAIGTFGTTRN  54

Query  290  ---NNDPPESARKPekneiiveegeeeeQ-CSSPDLAEFTPEEVGKLQKALTKLLSRKPA  457
               +N+      + E  +    + E+EE+  SS DL +FTPEEVGKLQK L KLLSR   
Sbjct  55   SVSDNEGKNVHEEIETEKKCTTQAEQEEEPSSSDDLEDFTPEEVGKLQKELMKLLSRTKK  114

Query  458  SKGEA--QTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDE---DEIDRTIRAIIG  622
             K +   +   +LPLDRFLNCPSSLEVDRR+SN  A +++ D  E   ++++RTI  I+G
Sbjct  115  RKSDVNRELMKNLPLDRFLNCPSSLEVDRRISN--ALSAVVDSSEEKGEDMERTINVILG  172

Query  623  RCKDVC---EKNKQHKSIGKKSVSFLVKKMFVCRSGF--APSPSLRDTFQESRMEKLLRT  787
            RCK++    +KN + + I K S S+L KK+FVC  GF  +PSPSLRDT QESRMEKLL+ 
Sbjct  173  RCKEITTESKKNNKKRDISKTSASYLFKKIFVCAEGFSTSPSPSLRDTLQESRMEKLLKM  232

Query  788  ILSKKIYPQNPSRAAS  835
            +L KKI  Q  S+  S
Sbjct  233  MLHKKINSQASSKPTS  248



>emb|CDY48301.1| BnaC05g13550D [Brassica napus]
Length=359

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 181/301 (60%), Gaps = 24/301 (8%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGN--ND  298
            ++ F WMQN+ N       +       + +  KQEPR EEFSDWP + LAIGT G+  N 
Sbjct  24   IQLFGWMQNKRNAKYENHNRTSTSSASSHH-VKQEPR-EEFSDWPHALLAIGTFGSTTNG  81

Query  299  PPESARKPekneiiveegeeeeQC-------SSPDLAEFTPEEVGKLQKALTKLLSRKPA  457
              ++  K    E    E +   Q        SS D+ +FTPEEVGKLQK L KLLSR   
Sbjct  82   VSQNESKNVHEEKEEGEKKSISQTGQEEEPSSSDDIDDFTPEEVGKLQKELIKLLSRTKK  141

Query  458  SKGEA--QTNADLPLDRFLNCPSSLEVDRRLSNTSAA---NSLYDCDEDEIDRTIRAIIG  622
             K +   +   +LPLDRFLNCPSSLEV+RR+SN   A   +S  + DED ++RTI AI+G
Sbjct  142  RKSDVNRELMKNLPLDRFLNCPSSLEVERRISNALCAVVDSSEGNKDED-MERTINAILG  200

Query  623  RCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGF--APSPSLRDTFQESRMEKLLRTILS  796
            RCK++  ++K+   I KKS S+L KK+FVC  G   +PSPSLRDT QESRMEKLL+ +L 
Sbjct  201  RCKEISIESKKKTDISKKSFSYLFKKIFVCSDGISTSPSPSLRDTLQESRMEKLLKMMLH  260

Query  797  KKIYPQNPSR--AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIV  970
            KKI  Q  S+  +++ KR+L++       +    EEEE  +R  +S+  +W KTDS+Y  
Sbjct  261  KKINAQASSKPTSSTTKRYLQD---KKQLSLKSEEEEETNERRSSSEGHKWVKTDSDYST  317

Query  971  L  973
            L
Sbjct  318  L  318



>ref|XP_010531879.1| PREDICTED: uncharacterized protein LOC104808059 isoform X2 [Tarenaya 
hassleriana]
Length=279

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 128/294 (44%), Positives = 167/294 (57%), Gaps = 30/294 (10%)
 Frame = +2

Query  143  MQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPPESARKP  322
            MQN+ N  Q   R         ++HGKQEPR  EFSD P   LAIGT G N       + 
Sbjct  1    MQNKLNQKQVNGR--SSTSSAASHHGKQEPR-AEFSDLPHGLLAIGTFGTNTGVVQEIQG  57

Query  323  ekneiiveegeeeeQ--CSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEA--QTNADL  490
                   +  ++++Q   SS DL  F PEEVGKLQK LTKLL+R    K +   +   +L
Sbjct  58   GNRTDKKDINKDQDQDPSSSDDLEGFNPEEVGKLQKELTKLLTRTKKRKSDVHRELTNNL  117

Query  491  PLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK---  661
            PLDRFLNCPSSLEVDRR+    +       +E++I+RTI  IIGRCK++   N + K   
Sbjct  118  PLDRFLNCPSSLEVDRRICTADSDGK----EEEDIERTINVIIGRCKEISAVNNRKKKKK  173

Query  662  ----SIGKKSVSFLVKKMFVCRSGF---APSPSLRDTFQESRMEKLLRTILSKKI-YPQN  817
                 IGK SVS+L+KK+FVC  GF   +P+P LRDT QESRMEK LR +L KK+   Q 
Sbjct  174  KKKMDIGKASVSYLLKKIFVCTDGFPLPSPAPGLRDTLQESRMEKFLRMVLHKKMSSSQA  233

Query  818  PSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             +RA S K +L++K+  +       +           D  +W KTDS++IVLEI
Sbjct  234  TARATSAKNYLQDKQQVSKNIGENEKSNV--------DGHKWVKTDSDFIVLEI  279



>gb|KHN16376.1| hypothetical protein glysoja_033780 [Glycine soja]
Length=308

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 136/295 (46%), Positives = 175/295 (59%), Gaps = 42/295 (14%)
 Frame = +2

Query  122  RMKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDP  301
             ++F +WMQN+  GG+   RK  P     TN  K  PR EE SDWP   LAIGT GNN+ 
Sbjct  39   HLQFLSWMQNKI-GGKQDIRK--PNTYTATNDAKLVPR-EELSDWPDGLLAIGTFGNNNE  94

Query  302  PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
             +   +                 SS ++A+FTPEE+GKL+K LTKLL +KP      +  
Sbjct  95   VKEKTEKNILREDPS--------SSEEIADFTPEEIGKLKKELTKLLRQKPNIV--EKEI  144

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDR-------------TIRAIIG  622
            A+LPLDRFLNCPSSLEVDRR+SN   ++S     ++E +              T+  I+G
Sbjct  145  AELPLDRFLNCPSSLEVDRRISNVLGSDSEDKDKDEEKEEEREKEEEEEDIEKTLSVILG  204

Query  623  RCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDT--FQESRMEKLLRTILS  796
            + K++C  N + K+IGKKS+SFL+KKMFVCRSGFAP+PSLRDT   QESRMEKLLRTIL 
Sbjct  205  KFKEICANNSK-KAIGKKSISFLLKKMFVCRSGFAPAPSLRDTLQLQESRMEKLLRTILH  263

Query  797  KKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            KKI  Q+ SRA SLK+ LE+             +  ++      D  +W KTDSE
Sbjct  264  KKINSQHSSRALSLKKRLED------------RKMPKEDEAENDDGCKWVKTDSE  306



>ref|XP_010273857.1| PREDICTED: uncharacterized protein LOC104609282 [Nelumbo nucifera]
 ref|XP_010273858.1| PREDICTED: uncharacterized protein LOC104609282 [Nelumbo nucifera]
Length=260

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 132/294 (45%), Positives = 167/294 (57%), Gaps = 43/294 (15%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGK-QEPRN--EEFSDWPGSFLAIGTLGNN  295
            MK FNW+QN+  G + GS+K   V   + NH   QEP    EEFSDWP   LAIGT GNN
Sbjct  1    MKIFNWVQNKLQGRKQGSKKQSGV---SANHQNFQEPYKPKEEFSDWPHGLLAIGTFGNN  57

Query  296  D---PPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKG  466
            D    PE    PE               SS DL  FTPEEVGKL+K LTKLLSR P   G
Sbjct  58   DLKQEPEMCDPPEDPS------------SSQDLLGFTPEEVGKLEKELTKLLSRNPVPTG  105

Query  467  EAQTNAD---LPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDV  637
               T  +   LPLD+FLNCPSSLEVDR +      +     D+        +++ + KDV
Sbjct  106  AESTEGEATHLPLDKFLNCPSSLEVDRTICQRFCHDLDDRDDDHP--GCSSSVVSKGKDV  163

Query  638  CEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQN  817
                + + +I ++S+SFL+KK+FVCRSGF P PSLRD   ES+MEKLL+ +L K+IYP++
Sbjct  164  --NLEGNTAIRRRSISFLLKKIFVCRSGFTPIPSLRDQLXESKMEKLLKDMLHKRIYPRS  221

Query  818  PSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             S  +S K++LEN               +  K     D  +W KTDSEYIVLE+
Sbjct  222  -SSTSSTKKYLEN--------------RQMLKTGNEDDGCKWVKTDSEYIVLEM  260



>emb|CDY26247.1| BnaA06g11700D [Brassica napus]
Length=291

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 167/264 (63%), Gaps = 23/264 (9%)
 Frame = +2

Query  221  KQEPRNEEFSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQ--------CSS  376
            KQEPR EEFSDWP + LAIGT G+     S  K +     +EE +E            SS
Sbjct  26   KQEPR-EEFSDWPHALLAIGTFGSTSNGVSDTKSKNVHEEIEEEKEAISQPEQEEEPSSS  84

Query  377  PDLAEFTPEEVGKLQKALTKLLSRKPASKGEA--QTNADLPLDRFLNCPSSLEVDRRLSN  550
             D+ +FTPEEVGKLQK L KLLSR    K +   +   +LPLDRFLNCPSSLEV+RR+SN
Sbjct  85   DDIDDFTPEEVGKLQKELIKLLSRTKKRKSDVNRELMKNLPLDRFLNCPSSLEVERRISN  144

Query  551  TSAA---NSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSG  721
               A   +S  + DED ++RTI AI+GRCK++  ++K+   I KKS S+L KK+FVC  G
Sbjct  145  ALCAVVDSSEGNKDED-MERTINAILGRCKEISIESKKKTDISKKSFSYLFKKIFVCSDG  203

Query  722  F--APSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAAS--LKRFLENkrtsaatatai  889
               +PSPSLRDT QESRMEKLL+ +L KKI  Q  S+ AS   KR+LE+        +  
Sbjct  204  ISTSPSPSLRDTLQESRMEKLLKMMLHKKINSQASSKPASSTTKRYLED----KKQLSLK  259

Query  890  aeeeeekkrertSDSGRWDKTDSE  961
            +EEEE  +R  +S+  +W KTDS+
Sbjct  260  SEEEETNERRSSSEGHKWVKTDSD  283



>emb|CDX96771.1| BnaA08g23140D [Brassica napus]
Length=308

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 182/311 (59%), Gaps = 23/311 (7%)
 Frame = +2

Query  101  FASIFQNR-MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAI  277
            F + FQ++   F  WM N+ N  + G          +++H KQE R EEFSDWP + LAI
Sbjct  3    FGNKFQSKDTSFLGWMLNKQNA-KHGDYNRTSTSSASSHHVKQESR-EEFSDWPHALLAI  60

Query  278  GTLGNNDPPESARKPekneiiveegeeeeQCSS--------PDLAEFTPEEVGKLQKALT  433
            GT G+     S ++       +EE ++    S          D+ +FTPEE  KLQK L 
Sbjct  61   GTFGSTSTGVSQKESNNVHEEIEEEKKSISHSEQEEEPSSSDDIDDFTPEEAKKLQKELM  120

Query  434  KLLSRKPASKGEA--QTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTI  607
            K+LSR    K +   +   +LPLDRFLNCPSSL+V+RR+SN   A      + ++++RTI
Sbjct  121  KILSRTKKRKSDVNRELMKNLPLDRFLNCPSSLDVERRISNALCAVVDSSEESEDMERTI  180

Query  608  RAIIGRCKDV---CEKNKQHKSIGKKSVSFLVKKMFVCRSGFA--PSPSLRDTFQESRME  772
              I+GRCK++    +KNK    I K SVS+L KK+FVC  GF+  P+PSLRDT QESRME
Sbjct  181  NVILGRCKEISIESKKNKMKTEISKTSVSYLFKKIFVCADGFSTPPNPSLRDTLQESRME  240

Query  773  KLLRTILSKKIYPQNPSRAA--SLKRFLENkrtsaatataiaeeeeekkrertSDSGRWD  946
            KLL+ +L KKI  Q+ S+ A  + +R L+        +    E+EE  +R  +SD  +W 
Sbjct  241  KLLKMMLHKKINVQSSSKPATSTTQRCLQG---KKQLSLKSEEKEETNERRSSSDGHKWV  297

Query  947  KTDSEYIVLEI  979
            KTDS++IVLEI
Sbjct  298  KTDSDFIVLEI  308



>gb|AAG52588.1|AC016529_19 hypothetical protein; 22751-23787 [Arabidopsis thaliana]
Length=316

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 181/313 (58%), Gaps = 52/313 (17%)
 Frame = +2

Query  101  FASIFQNRMKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIG  280
             A+I  N +   +W+ + F                  ++ KQ+   EEF+DWP   LAIG
Sbjct  4    IANIIPNILLSIDWLSDIF----------------VFSYLKQDHPREEFNDWPHGLLAIG  47

Query  281  TLGNN-DPPESARKPekneiiveegeeeeQ---------CSSPDLAE-FTPEEVGKLQKA  427
            T GN    P++  +    E  V     E +          SS DL E FTPEEVGKLQK 
Sbjct  48   TFGNKKQTPQTLDQEVIQEETVSNLHVEGRQAQDTDQELSSSDDLEEDFTPEEVGKLQKE  107

Query  428  LTKLLSRKPASKGEAQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEID  598
            LTKLL+R+ + K ++  N   A+LPLDRFLNCPSSLEVDRR+SN     +L D  E++I+
Sbjct  108  LTKLLTRR-SKKRKSDVNRELANLPLDRFLNCPSSLEVDRRISN-----ALCDEKEEDIE  161

Query  599  RTIRAIIGRCKDVC--EKNKQHKS---IGKKSVSFLVKKMFVCRSGFAPSPS--LRDTFQ  757
            RTI  I+GRCK +    KNK  K+   + K SVS L+KKMFVC  GF+P P   LRDTFQ
Sbjct  162  RTISVILGRCKAISTESKNKTKKNKRDLSKTSVSHLLKKMFVCTEGFSPVPRPILRDTFQ  221

Query  758  ESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSG  937
            E+RMEKLLR +L KK+  Q  S+  S K++L++          ++ + EE++   ++D G
Sbjct  222  ETRMEKLLRMMLHKKVNTQASSKQTSTKKYLQD-------KQQLSLKNEEEEGRSSNDGG  274

Query  938  RWDKTDS--EYIV  970
            +W KTDS  E+++
Sbjct  275  KWVKTDSDCEFLI  287



>ref|XP_009110412.1| PREDICTED: uncharacterized protein LOC103835958 [Brassica rapa]
Length=297

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 175/302 (58%), Gaps = 22/302 (7%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKF  WM N+ N  + G          +++H KQE R EEFSDWP + LAIGT G+    
Sbjct  1    MKFLGWMLNKQNA-KHGDYNRTSTSSASSHHVKQESR-EEFSDWPHALLAIGTFGSTSTG  58

Query  305  ESARKPekneiiveegeeeeQCSSPDLAE--------FTPEEVGKLQKALTKLLSRKPAS  460
             S ++       +EE ++    S  +           FTPEE  KLQK L K+LSR    
Sbjct  59   VSQKESNNVHEEIEEEKKSISHSEQEEESSSSDDIDDFTPEEAKKLQKELMKILSRTKKR  118

Query  461  KGEA--QTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKD  634
            K +   +   +LPLDRFLNCPSSL+ +RR+SN   A      + ++++RTI  I+GRCK+
Sbjct  119  KSDVNRELMKNLPLDRFLNCPSSLDAERRISNALCAVVDSSEESEDMERTINVILGRCKE  178

Query  635  V---CEKNKQHKSIGKKSVSFLVKKMFVCRSGFA--PSPSLRDTFQESRMEKLLRTILSK  799
            +    +KNK    I K SVS+L KK+FVC  GF+  P+PSLRDT QESRMEKLL+ +L K
Sbjct  179  ISIESKKNKMKTEISKTSVSYLFKKIFVCADGFSTPPNPSLRDTLQESRMEKLLKMMLHK  238

Query  800  KIYPQNPSRAA--SLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVL  973
            KI  Q+ S+ A  + KR L+        +    E+EE  +R  +SD  +W KTDS++IVL
Sbjct  239  KINVQSSSKPATSTTKRCLQG---KKQLSLKSEEKEETNERRSSSDGHKWVKTDSDFIVL  295

Query  974  EI  979
            EI
Sbjct  296  EI  297



>gb|AAF79489.1|AC022492_33 F1L3.5 [Arabidopsis thaliana]
Length=320

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 117/235 (50%), Positives = 153/235 (65%), Gaps = 30/235 (13%)
 Frame = +2

Query  224  QEPRNEEFSDWPGSFLAIGTLG--NNDPPESARKPekneiiveegeeeeQCSSP------  379
            QEPR EEFSDWP + LAIGT G  +N   E+  K      + EE E E++C++       
Sbjct  35   QEPR-EEFSDWPHALLAIGTFGTTSNSVSENESK-----NVHEEIEAEKKCTAQSEQEEE  88

Query  380  -----DLAEFTPEEVGKLQKALTKLLSRKPASKGEA--QTNADLPLDRFLNCPSSLEVDR  538
                 +L +FTPEEVGKLQK L KLLSR    K +   +   +LPLDRFLNCPSSLEVDR
Sbjct  89   PSSSVNLEDFTPEEVGKLQKELMKLLSRTKKRKSDVNRELMKNLPLDRFLNCPSSLEVDR  148

Query  539  RLSN--TSAANSLYDCDEDEIDRTIRAIIGRCKDVC---EKNKQHKSIGKKSVSFLVKKM  703
            R+SN  ++  +S  +  E++++RTI  I+GRCK++    + NK+ + I K SVS+L KK+
Sbjct  149  RISNALSAVVDSSEENKEEDMERTINVILGRCKEISIESKNNKKKRDISKNSVSYLFKKI  208

Query  704  FVCRSGF--APSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASL--KRFLEN  856
            FVC  G   APSPSLRDT QESRMEKLL+ +L KKI  Q  S+  SL  KR+L++
Sbjct  209  FVCADGISTAPSPSLRDTLQESRMEKLLKMMLHKKINAQASSKPTSLTTKRYLQD  263



>ref|XP_006836601.1| hypothetical protein AMTR_s00131p00105060 [Amborella trichopoda]
 gb|ERM99454.1| hypothetical protein AMTR_s00131p00105060 [Amborella trichopoda]
Length=267

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 30/291 (10%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRN-EEFSDWPGSFLAIGTLGNNDP  301
            MK  +WMQ++ NG         P P   T+   ++ ++ E+ + W    LAIGTLGNND 
Sbjct  1    MKLLSWMQHKLNGRNTPKNTQLPSPGFGTHEASKDTKSKEDNTQWQHGLLAIGTLGNNDL  60

Query  302  PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
             E     E N+   +E E        +++EFT EE+ KLQK LT+LL+ KP+S G+A +N
Sbjct  61   KEDGENQELNKNGAQELE--------EMSEFTAEEIAKLQKELTRLLAFKPSS-GDACSN  111

Query  482  -----ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEK  646
                 +D PL +FL+CPS+L ++RR    +  + +   ++     T+R+   + KDVC  
Sbjct  112  NGGENSDCPLKKFLSCPSTLNLERRYQLDATEDRIELREDSNCSSTVRS---KGKDVCVD  168

Query  647  NKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSR  826
            NK    I ++S+SFL+KKMFVCRSGFAP PSLRD   ESRMEKLLRTIL ++IYPQ  S 
Sbjct  169  NKS--VICQRSISFLLKKMFVCRSGFAPVPSLRDPLPESRMEKLLRTILHRRIYPQ--ST  224

Query  827  AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            + S +++L +         ++A+ E   + +   DS RW KTDS++IVLE+
Sbjct  225  STSSRKYLSS--------KSMAKSETTNEEQGQGDSCRWVKTDSDFIVLEM  267



>emb|CDX83907.1| BnaC08g17380D [Brassica napus]
Length=292

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 168/270 (62%), Gaps = 20/270 (7%)
 Frame = +2

Query  221  KQEPRNEEFSDWPGSFLAIGTLGNNDPPESARK--------PekneiiveegeeeeQCSS  376
            KQE R EEFSDWP + LAIGT G+     S ++         E+ + I     EEE  SS
Sbjct  26   KQESR-EEFSDWPHALLAIGTFGSTSIGVSQKERNNVHEEIEEEKKSISHSEPEEEPSSS  84

Query  377  PDLAEFTPEEVGKLQKALTKLLSRKPASKGEA--QTNADLPLDRFLNCPSSLEVDRRLSN  550
             D+ +FTPEE  KLQK L K+LSR    K +   +   +LPLDRFLNCPSSL V+RR+SN
Sbjct  85   ADIDDFTPEEAKKLQKELMKILSRTKKRKSDVNRELMINLPLDRFLNCPSSLNVERRISN  144

Query  551  TSAANSLYDCDEDEIDRTIRAIIGRCKDV---CEKNKQHKSIGKKSVSFLVKKMFVCRSG  721
               A      + D+++RTI  I+GRCK++    +KNK+   I K SVS+L KK+FVC  G
Sbjct  145  ALCAVVDSSEESDDMERTINVILGRCKEISIESKKNKKKTDISKTSVSYLFKKIFVCADG  204

Query  722  FA--PSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAA--SLKRFLENkrtsaatatai  889
            F+  P+PSLRDT QESRMEKLL+ +L KKI  Q+ S+ A  + +R L+       +  + 
Sbjct  205  FSTPPNPSLRDTLQESRMEKLLKMMLHKKINVQSSSKPATSTTQRCLQG--KKQLSLKSE  262

Query  890  aeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             ++EE  +R  +SD  +W KTDS++IVLEI
Sbjct  263  EKKEETNERRSSSDGHKWVKTDSDFIVLEI  292



>ref|XP_010531878.1| PREDICTED: uncharacterized protein LOC104808059 isoform X1 [Tarenaya 
hassleriana]
Length=290

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 123/288 (43%), Positives = 161/288 (56%), Gaps = 30/288 (10%)
 Frame = +2

Query  143  MQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPPESARKP  322
            MQN+ N  Q   R         ++HGKQEPR  EFSD P   LAIGT G N       + 
Sbjct  1    MQNKLNQKQVNGR--SSTSSAASHHGKQEPR-AEFSDLPHGLLAIGTFGTNTGVVQEIQG  57

Query  323  ekneiiveegeeeeQ--CSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEA--QTNADL  490
                   +  ++++Q   SS DL  F PEEVGKLQK LTKLL+R    K +   +   +L
Sbjct  58   GNRTDKKDINKDQDQDPSSSDDLEGFNPEEVGKLQKELTKLLTRTKKRKSDVHRELTNNL  117

Query  491  PLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK---  661
            PLDRFLNCPSSLEVDRR+    +       +E++I+RTI  IIGRCK++   N + K   
Sbjct  118  PLDRFLNCPSSLEVDRRICTADSDGK----EEEDIERTINVIIGRCKEISAVNNRKKKKK  173

Query  662  ----SIGKKSVSFLVKKMFVCRSGF---APSPSLRDTFQESRMEKLLRTILSKKI-YPQN  817
                 IGK SVS+L+KK+FVC  GF   +P+P LRDT QESRMEK LR +L KK+   Q 
Sbjct  174  KKKMDIGKASVSYLLKKIFVCTDGFPLPSPAPGLRDTLQESRMEKFLRMVLHKKMSSSQA  233

Query  818  PSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
             +RA S K +L++K+  +       +           D  +W KTDS+
Sbjct  234  TARATSAKNYLQDKQQVSKNIGENEKSNV--------DGHKWVKTDSD  273



>ref|XP_010939894.1| PREDICTED: uncharacterized protein LOC105058613 [Elaeis guineensis]
Length=268

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 175/297 (59%), Gaps = 41/297 (14%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNH-GKQEPRNEEFSDWPGSFLAIGTLGNNDP  301
            M   +W+Q +FNG Q   R    V   +  H   Q+   EEFSDWP   L+IGT GN + 
Sbjct  1    MGVLSWVQKKFNGKQEKHRSD--VGSSSARHTSMQDACKEEFSDWPQVLLSIGTFGNKEL  58

Query  302  PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
             E  ++ E +E +          SS +L +FT EEV KLQK L KLLS     K +A TN
Sbjct  59   KEDPQRHEPSENLD---------SSQNLPDFTSEEVRKLQKELIKLLS----GKSKAGTN  105

Query  482  ---------ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDR--TIRAIIGRC  628
                     A+LPL+RFLNCPSSLEVDR    T++     D D +  D   T + I+ + 
Sbjct  106  GLEVGEEERANLPLNRFLNCPSSLEVDR----TASLRLHDDLDNNNGDLSPTTKIILKKA  161

Query  629  KDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIY  808
            KD+   N    +I KKS++FL+KK+FVCRSGF+P+PSLRD   ESRMEK+LRT+L KKIY
Sbjct  162  KDLLFDNGD--AIKKKSLTFLLKKIFVCRSGFSPAPSLRDPIPESRMEKILRTLLHKKIY  219

Query  809  PQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            P++ + ++S +++LE           + + + E+K E+  D  +W KTDSEYIVLEI
Sbjct  220  PRSSASSSSTRKYLEE--------KPMEKVQAEEKEEKGEDRCKWVKTDSEYIVLEI  268



>emb|CDY03636.1| BnaA02g16010D [Brassica napus]
Length=331

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 117/293 (40%), Positives = 164/293 (56%), Gaps = 34/293 (12%)
 Frame = +2

Query  143  MQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGN----------  292
            M N+ +G QA + +     P T++    + R EEFSDWP   LAIGT G           
Sbjct  1    MHNKLHGKQANTHR-----PRTSSACSHQSR-EEFSDWPHGLLAIGTFGTLIEDQSPIHV  54

Query  293  -NDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGE  469
              +  +  +    +     +    +   S DL +FTPEEVGKLQ  LTKLL+RK   K +
Sbjct  55   VQEVIQEEKTSNMHVEGRAQDRNHDLSLSDDLEDFTPEEVGKLQNELTKLLTRKNK-KRK  113

Query  470  AQTN---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVC  640
            +  N   A+LPLDRFLNCPSS EVDRR+SN  +     D ++++I+RTI  I+GRCK + 
Sbjct  114  SDVNKELANLPLDRFLNCPSSFEVDRRISNAFSGGGDSDENQEDIERTISTILGRCKAIS  173

Query  641  ----EKNKQHKSIGKKSVSFLVKKMFVCRSGFA--PSPSLRDTFQESRMEKLLRTILSKK  802
                 K K  +   K SVS+L+KKMFVC  G +  P+P LRDTFQESRMEK LR +L KK
Sbjct  174  TESKSKMKAKRDWSKTSVSYLLKKMFVCTEGHSPLPNPGLRDTFQESRMEKFLRVMLLKK  233

Query  803  IYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            I  +   +  S  R++++          ++ + +E++   +SD   W KTDS+
Sbjct  234  INTRACPKETSTSRYVQD-------RQQLSLKNKEEEGRSSSDGSTWVKTDSD  279



>emb|CDY53299.1| BnaC02g46380D [Brassica napus]
Length=284

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 119/290 (41%), Positives = 161/290 (56%), Gaps = 29/290 (10%)
 Frame = +2

Query  143  MQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPPESARKP  322
            M N+ +G QA + K      P T+          FSDWP   LAIGT G     ++  + 
Sbjct  1    MHNKLHGKQANTHK------PRTSSACSHKLKSNFSDWPHGLLAIGTFGTLTKDQTPIQE  54

Query  323  ekneiiveegeeeeQCS--------SPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQT  478
               E        E +          S DL +FTPEEVGKLQ  LTKLL+RK   K ++  
Sbjct  55   VIQEEKTSNMHVEGRAQDRDHDISLSDDLEDFTPEEVGKLQNELTKLLTRK-NKKRKSDV  113

Query  479  N---ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKN  649
            N   A+LPLDRFLNCPSS EVDRR+SN  +     D ++++I+RTI  I+GRCK +  ++
Sbjct  114  NKELANLPLDRFLNCPSSFEVDRRISNAFSGGGDSDENQEDIERTISIILGRCKAIYTES  173

Query  650  KQHK----SIGKKSVSFLVKKMFVCRSGFA--PSPSLRDTFQESRMEKLLRTILSKKIYP  811
            K  K     + K SVS L+KKMFVC  G +  P+P LRDTFQESRMEK LR +L KKI  
Sbjct  174  KNKKKGKRDVSKTSVSHLLKKMFVCTEGLSPIPNPGLRDTFQESRMEKFLRVMLLKKINT  233

Query  812  QNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            +   +  S  R++++         ++  +EEE +   +SD  +W KTDS+
Sbjct  234  RASPKQTSTSRYVQD-----RQQLSLKNKEEEGRSSSSSDGSKWVKTDSD  278



>gb|AAF97317.1|AC007843_20 Hypothetical protein [Arabidopsis thaliana]
Length=225

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 143/234 (61%), Gaps = 32/234 (14%)
 Frame = +2

Query  143  MQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLG--NNDPPESAR  316
            MQN+ NG    +              KQEPR EEFSDWP + LAIGT G  +N   E+  
Sbjct  1    MQNKLNGDHNRTSTSSASSHHV----KQEPR-EEFSDWPHALLAIGTFGTTSNSVSENES  55

Query  317  KPekneiiveegeeeeQCSSP-----------DLAEFTPEEVGKLQKALTKLLSRKPASK  463
            K      + EE E E++C++            +L +FTPEEVGKLQK L KLLSR    K
Sbjct  56   K-----NVHEEIEAEKKCTAQSEQEEEPSSSVNLEDFTPEEVGKLQKELMKLLSRTKKRK  110

Query  464  GEA--QTNADLPLDRFLNCPSSLEVDRRLSN--TSAANSLYDCDEDEIDRTIRAIIGRCK  631
             +   +   +LPLDRFLNCPSSLEVDRR+SN  ++  +S  +  E++++RTI  I+GRCK
Sbjct  111  SDVNRELMKNLPLDRFLNCPSSLEVDRRISNALSAVVDSSEENKEEDMERTINVILGRCK  170

Query  632  DV---CEKNKQHKSIGKKSVSFLVKKMFVCRSGF--APSPSLRDTFQESRMEKL  778
            ++    + NK+ + I K SVS+L KK+FVC  G   APSPSLRDT QESRMEK+
Sbjct  171  EISIESKNNKKKRDISKNSVSYLFKKIFVCADGISTAPSPSLRDTLQESRMEKV  224



>ref|XP_010937372.1| PREDICTED: uncharacterized protein LOC105056767 [Elaeis guineensis]
Length=401

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 123/288 (43%), Positives = 175/288 (61%), Gaps = 29/288 (10%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQ-EPRNEEFSDWPGSFLAIGTLGNNDP  301
            M+  +W+QN+FN  Q   +K +     +  H    + R EEF+DWP + L+IGT GNND 
Sbjct  1    MRILSWVQNKFNAKQ--EKKRFDAGSSSARHASMPDVRKEEFNDWPQALLSIGTFGNNDL  58

Query  302  PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPAS--KG---  466
             E    P+++E+       E   +S D  +FT EEV KLQK LTKLLSRK  S  KG   
Sbjct  59   KED---PQRHELSENLDSSENLDASQDFPDFTMEEVRKLQKELTKLLSRKSKSSTKGPEV  115

Query  467  -EAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRT--IRAIIGRCKDV  637
             E +  A+LPL+RFLN PSSLEVDR    T++     D D ++ D +   + I+ + KD 
Sbjct  116  VEEEERANLPLNRFLNFPSSLEVDR----TASLRLQDDLDNNKGDLSPNTKIILNKAKDW  171

Query  638  CEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQN  817
               N+   ++ +K+++FL+KK+FVCRSGF+P+PSLRD   ESRMEK+LRT+L KKIYP++
Sbjct  172  LLDNRN--AMKEKTLTFLLKKIFVCRSGFSPTPSLRDPMPESRMEKILRTLLQKKIYPRS  229

Query  818  PSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
             S ++S+++ LE           +   + EKK E+  D  +W KTDSE
Sbjct  230  -SASSSMRKCLEE--------RPVENVQAEKKEEKGEDRYKWVKTDSE  268



>ref|XP_010322990.1| PREDICTED: uncharacterized protein LOC104648114 [Solanum lycopersicum]
Length=183

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 124/189 (66%), Gaps = 17/189 (9%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F+W+QN+FNGGQ    +       T N   +EPRNEEF+ WP S LAIGT G +   
Sbjct  1    MKLFSWVQNKFNGGQVNKVQ-------TKNQPSKEPRNEEFNGWPDSLLAIGTFGASSSS  53

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLS------RKPASKG  466
               +    N+   E  E+ +Q SSPDLAEFTPEEVGKLQK LTKLLS       K  +  
Sbjct  54   LKPKIQNDNDNDNEISEDVKQSSSPDLAEFTPEEVGKLQKELTKLLSKKPAAAAKLTAAA  113

Query  467  EAQTNADLPLDRFLNCPSSLEVDRRLSN--TSAANSLYD-CDEDEIDRTIRAIIGRCKD-  634
            E + + +LPLDRFLNCPSSLEVDRR S+  +S  + +Y+  DE+EIDRTIRAIIGRCKD 
Sbjct  114  EGRQDGNLPLDRFLNCPSSLEVDRRTSSRFSSTNSEIYENLDEEEIDRTIRAIIGRCKDH  173

Query  635  VCEKNKQHK  661
            VC+ N + K
Sbjct  174  VCKTNNKKK  182



>ref|XP_008786930.1| PREDICTED: uncharacterized protein LOC103705093 [Phoenix dactylifera]
Length=262

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 143/231 (62%), Gaps = 11/231 (5%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQ-EPRNEEFSDWPGSFLAIGTLGNNDP  301
            M+  +W+QN+FNG Q   +K +     +  H    + R EEF DWP + L+IGT GN + 
Sbjct  1    MRILSWVQNKFNGKQ--EKKRFDAGSSSARHTSMPDVRKEEFDDWPQALLSIGTFGNKEL  58

Query  302  PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKP--ASKGEAQ  475
             E  +          +  E  + +S D  +FT EEV KLQ+ L  LLSRKP  +++   +
Sbjct  59   KEDLQ--GHELSENLDSSENLEDASQDFPDFTSEEVRKLQQELANLLSRKPKPSTQVGKE  116

Query  476  TNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQ  655
              A+LPL+RFLNCPSSLEVDR  + +       D ++ ++    + I+ + KD+   N+ 
Sbjct  117  ERANLPLNRFLNCPSSLEVDR--TGSLRLQDELDNNKGDLSPDTKIILNKVKDLLLGNRS  174

Query  656  HKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIY  808
              ++ KK+++FL+KK+FVCRSGF+P+PSLRD  QESRMEK+LRT+L KKI+
Sbjct  175  --AVKKKTLTFLLKKIFVCRSGFSPAPSLRDPIQESRMEKILRTLLQKKIF  223



>ref|XP_002516251.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46253.1| conserved hypothetical protein [Ricinus communis]
Length=241

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 114/288 (40%), Positives = 153/288 (53%), Gaps = 50/288 (17%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F WMQ +     +GS+K  P+   + NH     R EEFSDWP   LAIGT GNN   
Sbjct  1    MKIFGWMQKKL----SGSKKRNPI---SVNH---YTRKEEFSDWPHGLLAIGTFGNNAAK  50

Query  305  ESARKPekneiiveegeeeeQCSSP--DLAEFTPEEVGKLQKALTKLLSRKPASKGEAQT  478
            E   K               Q + P  +L + TPEEV  LQ  L  +L ++  S  +  +
Sbjct  51   EEDSK-----------SNFVQENQPHDNLEQLTPEEVQSLQNELNLILHKQDGSTCDTGS  99

Query  479  NADLPLD-RFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQ  655
            + +   +   +N   SLE D+            DC      R+ R ++GR K++C  +  
Sbjct  100  DNNNKNNNELVNGNPSLEDDQ------------DC------RSDRVVLGRGKEICVDHTI  141

Query  656  HKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAAS  835
            + +I K+S+SFL+KKMFVCR GF P+PSLRD   E RMEK+LR IL KKIYPQNPS  +S
Sbjct  142  N-AINKRSLSFLLKKMFVCRGGFTPTPSLRDQVPECRMEKILRAILHKKIYPQNPSSTSS  200

Query  836  LKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             K++LEN             + E++  E   +  +W KTDSEYIVLEI
Sbjct  201  RKKYLEN-------KLEAVSDSEDEMNENDDNKSKWVKTDSEYIVLEI  241



>ref|XP_008242324.1| PREDICTED: uncharacterized protein LOC103340664 [Prunus mume]
Length=270

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 117/304 (38%), Positives = 161/304 (53%), Gaps = 53/304 (17%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F+WMQ++  G     +   P      +   Q+P  EE ++WP   L IGTLGN+D  
Sbjct  1    MKIFDWMQSKLTGKTLIKK---PSSKVFDDDKVQKPPKEEVNEWPHGLLTIGTLGNSDLK  57

Query  305  ESARKPekneiiveegeeeeQCSSP------DLAEFTPEEVGKLQKALTKLLSRKPASKG  466
            E                   Q S+P       L  FTPEEV  +Q  L   L+ +   + 
Sbjct  58   ED------------------QQSNPPPSPKDHLHGFTPEEVRNIQNELNSYLNEEADHQS  99

Query  467  EAQTNAD-----LPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDE-----DEIDRTIRAI  616
             +    +     LPLD+FL   SSL+V+R  +N        DCDE         R+   +
Sbjct  100  NSGAELEKVPNFLPLDKFLTRQSSLKVERNGNNA-------DCDEPKENGSRFQRSGSVV  152

Query  617  IGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAP--SPSLRDTFQESRMEKLLRTI  790
            + R KDVC +N  + +IGKKS+SFL+KK+FVCRSGFAP  +P LRD   ESRMEK+L+ I
Sbjct  153  LSRGKDVCLEN-TNTAIGKKSLSFLLKKVFVCRSGFAPAAAPGLRDPILESRMEKILKAI  211

Query  791  LSKKIYPQNPSRAA-SLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYI  967
            L KKIYP++ S +  S+K++LEN         A +  +EE   ++  +  +W KTDSEYI
Sbjct  212  LHKKIYPKSSSASTMSMKKYLEN-----RHNIAKSANDEEINIDKEDEGSKWVKTDSEYI  266

Query  968  VLEI  979
            VLEI
Sbjct  267  VLEI  270



>ref|XP_004959822.1| PREDICTED: uncharacterized protein LOC101779024 [Setaria italica]
Length=281

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 121/303 (40%), Positives = 159/303 (52%), Gaps = 40/303 (13%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPV-----PPPTTNHGKQEPRNEEFS---DWPGSFLAIG  280
            M   NWMQNRFNG Q   R    V       P     +QE   EE S   DWP   L+IG
Sbjct  1    MGIINWMQNRFNGKQEKRRSEAGVVNSARDAPVRESCRQEHAREEKSPNGDWPQGLLSIG  60

Query  281  TLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPAS  460
            TL              +E   + G      ++ D+ +FT EEV KLQ AL KLL R  + 
Sbjct  61   TL-------------GDEPPPDGGPPRASQAAADVPDFTIEEVKKLQDALNKLLRRAKSK  107

Query  461  K--------GEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAI  616
                      E + ++ LPLDRFLNCPSSLEVDRR+S   AA      D  E     + I
Sbjct  108  SSSRGSGATDEDRASSQLPLDRFLNCPSSLEVDRRISLRHAAG-----DGGEFSPDTQII  162

Query  617  IGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILS  796
            + + +D+   N    +I +KS  FL+KKMF CR GF P+PSL+D   ESRMEKL +T+L 
Sbjct  163  LSKARDLL-VNSNGAAIKQKSFKFLLKKMFACRGGFGPAPSLKDPV-ESRMEKLFKTMLQ  220

Query  797  KKI--YPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIV  970
            KK+   P N +  +S K +LE+    +          EE+  ++ SDS +WDKTD+++IV
Sbjct  221  KKMSARPSNANAGSSRKYYLED--KPSGRRMIGDRPYEEEDDDKGSDSFKWDKTDTDFIV  278

Query  971  LEI  979
            LEI
Sbjct  279  LEI  281



>gb|EYU45892.1| hypothetical protein MIMGU_mgv1a017823mg, partial [Erythranthe 
guttata]
Length=243

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 125/285 (44%), Positives = 159/285 (56%), Gaps = 48/285 (17%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MKFFNWMQ +FN   AG + G+     TT     EP  +EF+   G  L+IGT GN    
Sbjct  1    MKFFNWMQKKFN---AGGQNGHD-HQITTKKKLIEPSKQEFN---GLMLSIGTFGNKH--  51

Query  305  ESARKPekneiiveegeeeeQCSSPD-LAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
            +   +P                SSPD  +EFT EE+ KL+K LTKLL+RK      +  N
Sbjct  52   DVVDQP---------------SSSPDNFSEFTAEEIVKLEKELTKLLTRK------SDKN  90

Query  482  ADLPLDRFLNCPSSL---EVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNK  652
              LPLDRFLN PSSL         ++ S      + D+DEIDRT+R I+ RCK++    K
Sbjct  91   DHLPLDRFLNSPSSLLATSDTSFSTSFSDDKEDEEEDDDEIDRTVRIILKRCKELSRNKK  150

Query  653  QHKSIGKKS-VSFLVKKMFVCRSGFAPS-PSLRDTFQESRMEKLLRTILSKKIYPQNPSR  826
                IGKKS +SFLVKKMFVC  GFA + P  RD FQESRMEKLLRT+L++ I+P+N S 
Sbjct  151  S--IIGKKSSLSFLVKKMFVCTGGFAAAAPRFRDAFQESRMEKLLRTMLTRTIFPRNSSG  208

Query  827  AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            A+S K+F+E               E+E   +    S +W KTDSE
Sbjct  209  ASSTKKFIEE----------RRRNEDESHDQIGDGSSKWIKTDSE  243



>ref|XP_009406841.1| PREDICTED: uncharacterized protein LOC103989647 [Musa acuminata 
subsp. malaccensis]
Length=290

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/255 (43%), Positives = 153/255 (60%), Gaps = 31/255 (12%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSR--KGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNND  298
            M+  +W+QN+F+G Q   +   G       +  G Q+   EE +DWP + L IGTLGNND
Sbjct  1    MRILSWVQNKFHGRQEKKKFDAGVSSAHYASMSGNQK---EEPNDWPQALLTIGTLGNND  57

Query  299  PPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEA--  472
              E + + E ++ +          SS DL++FT EEV KLQK L KLL+RK   K     
Sbjct  58   LKEESHRVEYSQDLD---------SSQDLSDFTIEEVNKLQKELKKLLTRKSKLKSNGSE  108

Query  473  ---QTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDE----IDRTIRAIIGRCK  631
               +  A+LPL+RFLNCPSSLEVDR       AN+ ++C E+E    +    + ++ + +
Sbjct  109  IGEEDRANLPLNRFLNCPSSLEVDR------TANTKHECSENENNGDLSPNTKIMLSKLR  162

Query  632  DVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYP  811
            D    N+   +I KKS+SFL+KK+FVC  GFAP+PS RD   ESRMEK+LR IL+KK+  
Sbjct  163  DALLGNRN--TIKKKSISFLLKKVFVCGGGFAPAPSSRDPAPESRMEKILRAILAKKMSQ  220

Query  812  QNPSRAASLKRFLEN  856
             N + A+S K++LEN
Sbjct  221  PNSAPASSEKKYLEN  235



>ref|XP_009404177.1| PREDICTED: uncharacterized protein LOC103987569 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=258

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 111/293 (38%), Positives = 160/293 (55%), Gaps = 43/293 (15%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            M+  +W+Q +F+G Q   R    +   +        + EEF DWP + LAIGTLGN D  
Sbjct  1    MRILSWVQTKFSGRQEHKRCAAALSSASCTSIPVISK-EEFRDWPQALLAIGTLGNRDIK  59

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEA----  472
            E  ++PE +E +          +S DL +FT EEV + +  L KLL+RKP S   A    
Sbjct  60   EDPQRPESSENLQ---------ASEDLPDFTMEEVNRFRVELVKLLTRKPNSSTSAPEIA  110

Query  473  -QTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKN  649
                A+L L+ FLN PSSLEVDR+L N             ++  + + I+ + +D    N
Sbjct  111  EADRANLLLNWFLNRPSSLEVDRKLENLG-----------DLSPSTKIILSKVRDALLSN  159

Query  650  KQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRA  829
            +   +I K+S+SFL KKMFVC SGFAP  +L+D   E R++K+LR IL+KKIYP++ S  
Sbjct  160  RT--AIKKESLSFLFKKMFVCGSGFAPPRNLKDPIPEPRIDKVLRAILTKKIYPRS-SAL  216

Query  830  ASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEY---IVLEI  979
            A  K++L N              E+ ++ ++  D  +W KTDSE+   IVLEI
Sbjct  217  APAKKYLAN-----------KPTEKMQEEDKRKDQYKWVKTDSEFIELIVLEI  258



>ref|XP_011039964.1| PREDICTED: uncharacterized protein LOC105136356 [Populus euphratica]
Length=253

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/287 (38%), Positives = 139/287 (48%), Gaps = 36/287 (13%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK   WMQN+        +   P       H +QE R EEF DWP   LAIGT GN    
Sbjct  1    MKIVVWMQNKLYRRHDSKK---PNSISVDYHIRQESRKEEFIDWPNELLAIGTFGNKSIK  57

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            E  +                  S     E TPEEVGKLQ  L+ LL ++  S   A++  
Sbjct  58   EEFK--------------HNHFSQNLPQELTPEEVGKLQNELSILLHKQGGSTDGAESET  103

Query  485  DLPLDRFLNCPSSLEVDR-RLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
                  F N   S++ D       S  ++  DC    +      +  R KD+        
Sbjct  104  A----NFFNSQKSVQDDSTNFDGCSDESNNKDCC---VQANNEVVTSRRKDIWADTSA--  154

Query  662  SIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLK  841
            +I KKS+SFL+KKMF+C  GF+P+PSL++   ESRMEKLLR IL KKIYPQNPS  +S K
Sbjct  155  AINKKSLSFLLKKMFICGGGFSPTPSLKNQVPESRMEKLLRAILHKKIYPQNPSPKSSTK  214

Query  842  RFLENkrtsaatataiaeeeeekkrertSDSG-RWDKTDSEYIVLEI  979
            ++LEN            +  +       +D G +W KTDSEYIVLEI
Sbjct  215  KYLEN--------KQKPKSADGDGINERADEGSKWVKTDSEYIVLEI  253



>ref|XP_004986912.1| PREDICTED: uncharacterized protein LOC101771763 [Setaria italica]
Length=278

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 111/302 (37%), Positives = 151/302 (50%), Gaps = 41/302 (14%)
 Frame = +2

Query  125  MKFFNWMQNRFNG--------GQAG--SRKGYPVPPPTTNHGKQEPRNEEFSDWP-GSFL  271
            M   NWMQNR +G        G A   S +G  V        +   ++     WP G  L
Sbjct  1    MGIINWMQNRLHGKTDNRSFDGAAAVSSSRGAGVYETQGVTYESSEKHLNAEQWPQGGLL  60

Query  272  AIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSR-  448
            +IGTLGN++PP + ++                    DL EFT EEV KLQ AL ++L R 
Sbjct  61   SIGTLGNDEPPPAQQEE-------------------DLPEFTVEEVKKLQDALARILRRA  101

Query  449  --KPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIG  622
              K +++G        PLDRFLNCPS LEVDRR+  T+      D    ++    + I+ 
Sbjct  102  RSKSSARGSGAGEDRPPLDRFLNCPSCLEVDRRVVQTTKHGD-GDGHSGDLSPDTKIILT  160

Query  623  RCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGF-APSPSLRDTFQESRMEKLLRTILSK  799
            R +D+ + +    SI +KS  FL+KKM VC  GF AP+ SL+D   ESRMEK  RTIL K
Sbjct  161  RARDLLDNSSGSGSIKQKSFKFLLKKMLVCNGGFSAPARSLKDPV-ESRMEKFFRTILGK  219

Query  800  KIYPQNPSRAASLKR--FLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVL  973
            K+   + +  AS ++   LE+                  + E   +S RWD+TDSE+IVL
Sbjct  220  KMNAGSGNGTASSRKKYLLED---GTKEKRRGGRRRCGCEDEEREESCRWDRTDSEFIVL  276

Query  974  EI  979
            EI
Sbjct  277  EI  278



>ref|XP_009597245.1| PREDICTED: uncharacterized protein LOC104093219 [Nicotiana tomentosiformis]
Length=249

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 155/297 (52%), Gaps = 60/297 (20%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK FNW+QN+ NG Q  S+   P P   T     +P  EEFSDWP   LAIGT G N  P
Sbjct  1    MKIFNWIQNKINGKQNPSK---PNPVTDTYQKVHQPCKEEFSDWPNELLAIGTFGKNSIP  57

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            ++A                   + PD  + TPEEVG+L K L  L+S  P++KG   +N 
Sbjct  58   KNA----------------GNLNQPD-EKLTPEEVGQLNKELKHLIS--PSAKG---SNK  95

Query  485  DLPLDRFLNCPSSLE---VDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQ  655
            D  LD+F +C  +LE    + + SN   +NSL              + GR ++  +    
Sbjct  96   D--LDKFFDCLQNLEDENSESKESNFKRSNSL--------------VCGRGQESAQLENT  139

Query  656  HKSIGKKSVSFLVKKMFVCRSGFA--PSPSLRD------TFQESRMEKLLRTILSKKIYP  811
            +  I +KSVS+L+KK F+C  GF   P   LRD       F++SRMEK+LR IL KKIYP
Sbjct  140  NNGISRKSVSYLLKKTFLCSDGFTPPPPYPLRDPVLPQSKFEKSRMEKILRAILHKKIYP  199

Query  812  QNPS-RAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            Q  S R  + KR+L+N         A+  + E+   E   +  +WDK+DS++IVLEI
Sbjct  200  QATSPRGTTRKRYLDN-------RCALESDSEDDTFETVKNGSKWDKSDSDFIVLEI  249



>ref|XP_009404176.1| PREDICTED: uncharacterized protein LOC103987569 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=260

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 154/284 (54%), Gaps = 40/284 (14%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            M+  +W+Q +F+G Q   R    +   +        + EEF DWP + LAIGTLGN D  
Sbjct  1    MRILSWVQTKFSGRQEHKRCAAALSSASCTSIPVISK-EEFRDWPQALLAIGTLGNRDIK  59

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEA----  472
            E  ++PE +E +          +S DL +FT EEV + +  L KLL+RKP S   A    
Sbjct  60   EDPQRPESSENLQ---------ASEDLPDFTMEEVNRFRVELVKLLTRKPNSSTSAPEIA  110

Query  473  -QTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKN  649
                A+L L+ FLN PSSLEVDR+L N             ++  + + I+ + +D    N
Sbjct  111  EADRANLLLNWFLNRPSSLEVDRKLENLG-----------DLSPSTKIILSKVRDALLSN  159

Query  650  KQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRA  829
            +   +I K+S+SFL KKMFVC SGFAP  +L+D   E R++K+LR IL+KKIYP++ S  
Sbjct  160  RT--AIKKESLSFLFKKMFVCGSGFAPPRNLKDPIPEPRIDKVLRAILTKKIYPRS-SAL  216

Query  830  ASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            A  K++L N              E+ ++ ++  D  +W KTDSE
Sbjct  217  APAKKYLAN-----------KPTEKMQEEDKRKDQYKWVKTDSE  249



>ref|XP_010917475.1| PREDICTED: uncharacterized protein LOC105042073 [Elaeis guineensis]
Length=237

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 103/253 (41%), Positives = 142/253 (56%), Gaps = 24/253 (9%)
 Frame = +2

Query  233  RNEEFSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVG  412
            R +EFSDWP + L IGT GN++  E     + +E +          S  D  +   EEV 
Sbjct  5    RKDEFSDWPQALLTIGTFGNSESKEDTATYDSSEDLH---------SLQDQPDLMLEEVI  55

Query  413  KLQKALTKLLSRKPASKGEAQTNA----DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDC  580
            K QK L KLL+ KP S  +          +PL++F NC SSL++D++ S     + L D 
Sbjct  56   KFQKELAKLLALKPKSSTDGSEMGCEKNKVPLNQFRNCSSSLDIDQK-SCLKFCDGLDDE  114

Query  581  DEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQE  760
            D  E     + I+ R K +   +    +I KKS+SFL+KKMF C SGF P+ +LRD F E
Sbjct  115  DNCENSPNSKIILNRAKKLLADHSS--AIKKKSISFLLKKMFACNSGFGPAHNLRDPFPE  172

Query  761  SRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGR  940
            S++EKLL+TIL KKI+PQN S + S  ++LE K+     A     E+E+       D G+
Sbjct  173  SKIEKLLKTILHKKIHPQN-SNSTSKMKYLEKKQEETTHAEDKMHEKEK-------DGGK  224

Query  941  WDKTDSEYIVLEI  979
            W KTDSEYIVLE+
Sbjct  225  WVKTDSEYIVLEM  237



>ref|XP_009796965.1| PREDICTED: uncharacterized protein LOC104243476 [Nicotiana sylvestris]
Length=249

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 150/294 (51%), Gaps = 54/294 (18%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK +NW+QN+ NG Q+ S+   P P    +    +P  EEFSDWP   LAIGT G N  P
Sbjct  1    MKIYNWIQNKINGKQSTSK---PNPVAVAHQKVHQPCKEEFSDWPNELLAIGTFGKNSIP  57

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            +                       PD  + T EEVG+L K L  L+   P++KG   +N 
Sbjct  58   K----------------ITGSLDQPD-EKLTAEEVGQLNKELKHLIP--PSAKG---SNK  95

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
            D  LD+F +C   LE         A NS  +  E    R+   + GR ++  +    +  
Sbjct  96   D--LDKFFDCLQKLE---------AENS--ENKESNFKRSNSLVCGRGQESAQLENTNNG  142

Query  665  IGKKSVSFLVKKMFVCRSGFAPSP--SLRD------TFQESRMEKLLRTILSKKIYPQNP  820
            I +KSVS+L+KK F+C  GF   P   LRD       F++SRMEK+LR IL KKIYPQ  
Sbjct  143  ISRKSVSYLLKKTFLCSDGFTLPPPYHLRDPVLPQSKFEKSRMEKILRAILHKKIYPQAT  202

Query  821  S-RAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            S R+ + KR+L+N          +  + E++  E   +  +WDK+DS++IVLEI
Sbjct  203  SPRSTTRKRYLDN-------RCELESDSEDETSETVKNGNKWDKSDSDFIVLEI  249



>ref|XP_007012607.1| Uncharacterized protein TCM_037503 [Theobroma cacao]
 gb|EOY30226.1| Uncharacterized protein TCM_037503 [Theobroma cacao]
Length=353

 Score =   149 bits (376),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 106/249 (43%), Positives = 136/249 (55%), Gaps = 22/249 (9%)
 Frame = +2

Query  224  QEPRNEEFSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPE  403
            Q+P  EEFSDWP   L IGT GN    E  +K    E            +   L   TPE
Sbjct  104  QQPCKEEFSDWPHGLLTIGTFGNKIKQEPDQKANLQENFPS--------AQDHLHGLTPE  155

Query  404  EVGKLQKALTKLLSRKPASKGEAQTNAD---LPLDRFLNCPSSLEVDRRLSNTSAANSLY  574
            EVGKLQK L  L+ ++    G    N +   LP ++FL+  SS E + R  N SA +   
Sbjct  156  EVGKLQKELN-LIFQEHVGVGPTSDNLEAPNLPFEKFLDTNSSTEAEER--NCSACSHDS  212

Query  575  DCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTF  754
            +   D I  +   +  R KD+C  N +  +IGKKS+SFL+KKMFVCRSGF+P+PSLRD  
Sbjct  213  NKKNDHIQCSTSLVHSRGKDICFDNSK-GAIGKKSLSFLLKKMFVCRSGFSPAPSLRDPN  271

Query  755  QESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDS  934
             ESRMEKLLRTIL KKIYPQ+ S   S  + LE+       +        ++K E+  D 
Sbjct  272  LESRMEKLLRTILHKKIYPQSSSPKLSTNKPLES-------SYTPKTANGDEKVEKADDG  324

Query  935  GRWDKTDSE  961
             +W KTDSE
Sbjct  325  SKWVKTDSE  333



>ref|XP_007203967.1| hypothetical protein PRUPE_ppa023774mg, partial [Prunus persica]
 gb|EMJ05166.1| hypothetical protein PRUPE_ppa023774mg, partial [Prunus persica]
Length=275

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 145/288 (50%), Gaps = 60/288 (21%)
 Frame = +2

Query  224   QEPRNEEFSDWPGSFLAIGTLGNND---------PPESARKPekneiiveegeeeeQCSS  376
             Q+P  EE ++WP   L IGTLGN+D         PP     P                  
Sbjct  4     QKPPKEEVNEWPHGLLTIGTLGNSDLKEDQQSNPPPSPKNHPHG----------------  47

Query  377   PDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNAD-----LPLDRFLNCPSSLEVDRR  541
                  FTPEEV  +Q  L   L+ +   +  + T  +     LPLD+FLN  SSL+ +R 
Sbjct  48    -----FTPEEVRNIQNELNSYLNEEADHQSNSGTELEKVPNFLPLDKFLNRQSSLKAERN  102

Query  542   LSNTSAANSLYDCDE-----DEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMF  706
              +N        DCDE         R+   ++ R KDVC +N  + +IGKKS+SFL+KK+ 
Sbjct  103   GNNA-------DCDEPKENGSRFQRSGNVVLSRGKDVCLEN-TNTAIGKKSLSFLLKKVC  154

Query  707   VCRSGFAPS--PSLRDTFQESRMEKLLRTILSKKIYPQNPSRAA-SLKRFLENkrtsaat  877
             VCRSGFAP+  P LRD   ESRMEK+L+ IL KKIYP++ S +  S+K++LEN       
Sbjct  155   VCRSGFAPAAAPGLRDPILESRMEKILKAILHKKIYPKSSSASTMSMKKYLEN-----GH  209

Query  878   ataiaeeeeekkrertSDSGRWDKTDSEYIVLEI*IAVSVWFLCIPNF  1021
               A +  +EE   ++  +  +W KTDSEY          V   C+PN 
Sbjct  210   NIAKSANDEEINIDKEDEGSKWVKTDSEYFCQ----CGGVVLFCMPNL  253



>gb|AFW88086.1| hypothetical protein ZEAMMB73_597563 [Zea mays]
Length=282

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 158/308 (51%), Gaps = 49/308 (16%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSR-----------KGYPVPPPTTNHGKQEPRNEEFSD---WP-  259
            M   NWMQ+RF+G    SR           +G      TT  G     +E+  D   WP 
Sbjct  1    MGIINWMQSRFHGKTETSRIFDGATATSSYRGGAGAQGTT-QGTIVHESEKRLDAEPWPQ  59

Query  260  GSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKL  439
               L+IGTLG+ +PP                         DL EFT EEV KLQ AL  L
Sbjct  60   AGILSIGTLGSEEPP---------------------AQEQDLPEFTVEEVKKLQDALAML  98

Query  440  LSR---KPASKGEAQTNADL--PLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRT  604
            L R   K +++G      +   PLDRFLNCPS LEV+RR+  T+A N     +E ++   
Sbjct  99   LRRAKSKSSARGSGAGAGEDRPPLDRFLNCPSCLEVERRVVQTTATNH-GGQEEGDLSPD  157

Query  605  IRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSP--SLRDTFQESRMEKL  778
             + I+ R +D+ +       I ++S  FL+KKMF C  GF+ +P  SL+D   ESRMEK 
Sbjct  158  TKIILNRARDLLDSGGGGGGIKQRSFKFLLKKMFACNGGFSAAPPRSLKDPV-ESRMEKF  216

Query  779  LRTILSKKIYPQNPSRAASLKR-FLENkrtsaatataiaeeeeekkrertSDSGRWDKTD  955
             RT++ KK+  ++ + +AS ++ FLE+   +            +++ ER ++S RWD+TD
Sbjct  217  FRTMIGKKMNARSGNGSASSRKYFLED--GTKGRRRGGRRCGCQEEEEREAESCRWDRTD  274

Query  956  SEYIVLEI  979
            SE+IVLEI
Sbjct  275  SEFIVLEI  282



>ref|XP_009337231.1| PREDICTED: uncharacterized protein LOC103929730 [Pyrus x bretschneideri]
Length=256

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 114/300 (38%), Positives = 154/300 (51%), Gaps = 59/300 (20%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F+WMQ++  G     +    V        KQ+P  EE S+WP   LAIGTLGN D  
Sbjct  1    MKIFDWMQSKLTGKPRLEKPSLKVF--DDEKVKQKPSKEEASEWPHGLLAIGTLGNGD--  56

Query  305  ESARKPekneiiveegeeeeQCSSP-----DLAEFTPEEVGKLQKALTKLLSRKPASKGE  469
                            ++++Q + P      L +FTPEE   +   L +L S    S   
Sbjct  57   ---------------LKQDQQTNPPPSPNDHLHDFTPEEATHI---LNELSSYWNQSNSA  98

Query  470  AQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDE------DEIDRTIRAIIGRCK  631
            A    +   ++FL+  SSL+ +R    TS  N   DCDE          R+   ++ R K
Sbjct  99   ALLELEKAPNKFLSKQSSLKPER----TSTDN--VDCDELPKENMSRFQRSSSVVLSRGK  152

Query  632  DVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPS---LRDTFQESRMEKLLRTILSKK  802
            DVC  N  + +IGKKS+SFL+KK+FVC SGFAP+ +   LRD   ESRMEK+LR IL KK
Sbjct  153  DVCLDN-INSTIGKKSLSFLLKKVFVCGSGFAPAAAASGLRDPVPESRMEKILRAILHKK  211

Query  803  IYPQ-NPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            IYPQ + +   S+K++LEN                  K  + ++  +WDKTDSEYIVLEI
Sbjct  212  IYPQSSSTSTMSMKKYLEN---------------SNPKSAKANEGSKWDKTDSEYIVLEI  256



>ref|XP_006381603.1| hypothetical protein POPTR_0006s14240g [Populus trichocarpa]
 gb|ERP59400.1| hypothetical protein POPTR_0006s14240g [Populus trichocarpa]
Length=274

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 128/250 (51%), Gaps = 37/250 (15%)
 Frame = +2

Query  113  FQNRMKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGN  292
            +   + F  W+Q R+          Y V     +H +QE R EEF DWP   LAIGT GN
Sbjct  11   YHEVIIFIGWLQGRW-------AHLYSVK----DHIRQESRKEEFIDWPNELLAIGTFGN  59

Query  293  NDPPESARKPekneiiveegeeeeQCSSPDL-AEFTPEEVGKLQKALTKLLSRKPASKGE  469
                E  +                   S +L  E TPEEVGKLQ  L+ LL ++  S   
Sbjct  60   KSIKEEFKHNHF---------------SQNLPQELTPEEVGKLQNELSILLHKQGGSTDG  104

Query  470  AQTNADLPLDRFLNCPSSLEVDRRLSN-TSAANSLYDCDEDEIDRTIRAIIGRCKDVCEK  646
            A++        F N  +S+E D   S+  S  ++  DC    +      +  R KD+   
Sbjct  105  AESETA----NFFNSQTSMEDDSTNSDGCSDESNNKDCC---VQANTEVVTSRRKDIWAD  157

Query  647  NKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQNPSR  826
            N    +I KKS+SFL+KKMF+C  GF+P+PSL++   ESRMEK+LR IL KKIYPQNPS 
Sbjct  158  NS--AAINKKSLSFLLKKMFICGGGFSPTPSLKNQVPESRMEKILRAILHKKIYPQNPSP  215

Query  827  AASLKRFLEN  856
             +S  ++LEN
Sbjct  216  KSSRNKYLEN  225



>ref|XP_011093842.1| PREDICTED: uncharacterized protein LOC105173691 [Sesamum indicum]
 ref|XP_011093843.1| PREDICTED: uncharacterized protein LOC105173691 [Sesamum indicum]
 ref|XP_011093844.1| PREDICTED: uncharacterized protein LOC105173691 [Sesamum indicum]
Length=262

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 101/291 (35%), Positives = 146/291 (50%), Gaps = 35/291 (12%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK FNWM+N+ N  ++ +    P   P  NH   +   EEFSDWP   L IGT GNN+  
Sbjct  1    MKIFNWMRNKRNAKESSNHSSNPQSVP--NHIMHQHCKEEFSDWPNGLLTIGTFGNNNLK  58

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGK-LQKALTKLLSRKPASKGEAQTN  481
             S +            +         L +   EEV K L + L K +S   +   E++ +
Sbjct  59   HSDK---------CSVQGPLHSGQDHLEQKDLEEVDKELIRLLNKHISLYSSLSDESEKH  109

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
             +L +++FL+C   L+ D +     A   + +  +  + R+   +    KD+   NK  K
Sbjct  110  NNLSVEKFLDC---LKEDEK----KAGELMSENKDARLQRSTSLVQRAGKDIRLDNKT-K  161

Query  662  SIGKKSVSFLVKKMFVCRSGFAPSPSLRD-----TFQESRMEKLLRTILSKKIYPQNPSR  826
             I KKS+SFL+KK FVCR GF P+P LRD         SRMEK+LR +L KKIYPQ  + 
Sbjct  162  GISKKSLSFLLKKAFVCRGGFVPNPMLRDPLPDPKLDNSRMEKILRAMLHKKIYPQKHTP  221

Query  827  AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
              + K++L+              + +E++ E  S   +W KTDSEYIVLEI
Sbjct  222  RTASKKYLD----------MAETDSDEEQCEEASRRSKWVKTDSEYIVLEI  262



>ref|XP_002465154.1| hypothetical protein SORBIDRAFT_01g032860 [Sorghum bicolor]
 gb|EER92152.1| hypothetical protein SORBIDRAFT_01g032860 [Sorghum bicolor]
Length=282

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 109/312 (35%), Positives = 152/312 (49%), Gaps = 57/312 (18%)
 Frame = +2

Query  125  MKFFNWMQNRFNG--------GQAGSRKGYPVPPPTTNHGKQEPRN------------EE  244
            M   NWMQNRF+G        G A +   Y         G QE +             E 
Sbjct  1    MGIINWMQNRFHGKTENRIFDGGATATSSY------RGAGAQERQETIIREPEKHLDAEP  54

Query  245  FSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQK  424
            +   P   L+IGTLG+ +PP  A                    + DL EFT EEV KLQ 
Sbjct  55   WPQAPAGLLSIGTLGSEEPPPPA--------------------AQDLPEFTVEEVKKLQD  94

Query  425  ALTKLLSR---KPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEI  595
            AL  LL R   K +++G A      PLDRFLNCPS LEVDRR+  T+         E E 
Sbjct  95   ALAMLLRRAKSKSSARGSAAGEDRPPLDRFLNCPSCLEVDRRVQTTAKHGECGGGQEGEG  154

Query  596  DRT--IRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSP--SLRDTFQES  763
            D +   + I+ R +D+ +       I ++S  FL+KKMF C  GF+ +P  SL+D   ES
Sbjct  155  DLSPDTKIILTRARDLLDSG---GGIKQRSFKFLLKKMFACNGGFSAAPPRSLKDPV-ES  210

Query  764  RMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRW  943
            RMEK  RT++ KK+   + +R+++ +++     TS            +++ E   +S +W
Sbjct  211  RMEKFFRTVIGKKMNASSGNRSSTSRKYFLEDGTSKGKRRGARRCGCQEEEEEREESCKW  270

Query  944  DKTDSEYIVLEI  979
            D+TDSE+IVLEI
Sbjct  271  DRTDSEFIVLEI  282



>emb|CDX68264.1| BnaA07g23040D [Brassica napus]
Length=260

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 147/293 (50%), Gaps = 75/293 (26%)
 Frame = +2

Query  143   MQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPPESARKP  322
             MQN+ +G Q  + +     P  ++    +PR EEFSDWP   LAIGT G+N        P
Sbjct  1     MQNKLHGKQGNTHR-----PSISSASSHQPR-EEFSDWPQGLLAIGTFGSN--------P  46

Query  323   ekneiiveegeeeeQCS-SPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNADLPLD  499
                 +  +  + ++  S S DL +FTPEEVGKLQK LTKLL+RK   +            
Sbjct  47    SNVHVEGQAQDRDQDLSFSGDLEDFTPEEVGKLQKELTKLLTRKTKKR------------  94

Query  500   RFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKS  679
                         +R+SN  ++    + +E++I+RTI  I+GRCK +  ++   K      
Sbjct  95    ------------KRISNAISSGGYSNENEEDIERTISVILGRCKAISTESSNKKK-----  137

Query  680   VSFLVKKMFVCRSGFAP--SPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLE  853
                        + GF+P  +PSLRDTFQESRMEKLLR +L KKI  Q PS+  S KR++E
Sbjct  138   -----------KKGFSPLPNPSLRDTFQESRMEKLLRVMLHKKINAQAPSKETSTKRYVE  186

Query  854   NkrtsaatataiaeeeeekkrertSDSGRWDKTDS--EYIVLEI*IAVSVWFL  1006
             +              + E++  R+SD  +W KTDS  E+ +         WFL
Sbjct  187   D--------KQQLALKNEEEEGRSSDGSKWVKTDSDCEFQIF--------WFL  223



>ref|XP_006658811.1| PREDICTED: uncharacterized protein LOC102708077 [Oryza brachyantha]
Length=302

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 121/322 (38%), Positives = 167/322 (52%), Gaps = 57/322 (18%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHG-------KQEPRNEE--FSD-WP----G  262
            M   NW+QNR N  Q   R         ++         +QE R++E    D WP     
Sbjct  1    MGIINWVQNRLNAKQDRRRNEAAAAAAVSSSARSRGESCRQEARDQEKIAGDCWPVGGAH  60

Query  263  SFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLL  442
              L+IGTLGN  PP +A +                 ++ D+A+FT EEV KLQ+AL KLL
Sbjct  61   GLLSIGTLGNESPPPAAEE--------------AASAAQDVADFTIEEVKKLQEALNKLL  106

Query  443  SR---KPASKGEAQTNAD---------------LPLDRFLNCPSSLEVDRRLSNTSAANS  568
             R   K +S+G    + D               LPLDRFLNCPSSLEVDRR+S   AA  
Sbjct  107  RRAKSKSSSRGSTADHDDDQLRPQVHGGGAASLLPLDRFLNCPSSLEVDRRISLRHAAAD  166

Query  569  LYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGF---APSPS  739
                 E   D  I  I+ + +D+        +I +KS  FL+KKMFVCR GF   +P+PS
Sbjct  167  GGQNGEFSPDTQI--ILSKARDLLVNTNATTTIKQKSFKFLLKKMFVCRGGFSSPSPAPS  224

Query  740  LRDTFQESRMEKLLRTILSKKI--YPQNPSRAASLKRFLENkrtsaatataiaeeeeekk  913
            L+D   ESR+EKL RT+L K++   P N + A+S K +LE+K      +  + ++E++  
Sbjct  225  LKDPV-ESRIEKLFRTMLHKRMNARPSNAAAASSRKYYLEDKPRRKMQSEHLHDDEDDDS  283

Query  914  rertSDSGRWDKTDSEYIVLEI  979
             E      +WDKTDS++IVLE+
Sbjct  284  GEDIF---KWDKTDSDFIVLEM  302



>ref|XP_006597880.1| PREDICTED: uncharacterized protein LOC102665474 [Glycine max]
Length=262

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 145/288 (50%), Gaps = 29/288 (10%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F WMQNR NG     ++   +   TT++ + EP  +EFSDWP + LAIGT G ++  
Sbjct  1    MKIFEWMQNRINGSNGKKKQSNSIS--TTHYMRHEPCKQEFSDWPQALLAIGTFGGSNLK  58

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLL-SRKPASKGEAQTN  481
            E +    ++    E+    + C+     E T E+VG LQ   +     +  A++ E  TN
Sbjct  59   EDS--GGRSNHAAEDSSSFQDCTQ----EVTLEDVGNLQSEFSIFFKGQNLAAEQEEHTN  112

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
             DL  +    C  S   +    N   +NS+              I  R KD    +   K
Sbjct  113  -DLIKENDSLCDGS---NASRGNFYPSNSI--------------IFSRGKDCSLDHSSKK  154

Query  662  SIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQ-ESRMEKLLRTILSKKIYPQNP-SRAAS  835
             +GKKS+SFL+KKM  C+SGF P+P  +D    ESRMEK+LR IL KKIYPQ   S    
Sbjct  155  GVGKKSLSFLLKKMLACKSGFQPTPLFKDPLSTESRMEKILRAILQKKIYPQGSCSTTPF  214

Query  836  LKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +K++LE    S        +EEEE       +  +W KTDSEYIVLEI
Sbjct  215  VKKYLEATPISQFDDEEDDDEEEELAAAAAENGSKWVKTDSEYIVLEI  262



>ref|XP_007138640.1| hypothetical protein PHAVU_009G225800g [Phaseolus vulgaris]
 gb|ESW10634.1| hypothetical protein PHAVU_009G225800g [Phaseolus vulgaris]
Length=282

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 150/291 (52%), Gaps = 15/291 (5%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F WMQNR +G    +++   +    T++ K EP  +EFSDWP + LAIGT G+N   
Sbjct  1    MKIFEWMQNRISGSNGKNKRTLSIS--ATHYLKHEPCKQEFSDWPQALLAIGTFGSNTIR  58

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRK--PASKGEAQT  478
            E +    ++    E+    + C+     E T EEV  LQ   +     +  P   GE + 
Sbjct  59   EDS--GGRSNNTAEDSSSFKDCTQ----EITLEEVANLQNEFSIFFKGRVEPNLGGEQEE  112

Query  479  NADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQH  658
            + +  +   LN   S  +D       + +   + +      +   I  R KD C  N   
Sbjct  113  HTNDLIKECLNSEHS-RLDSEGKENESLSDGSNANRGNFYPSKSIIFSRGKDCCLDNSSK  171

Query  659  KSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQ-ESRMEKLLRTILSKKIYPQNP-SRAA  832
            + +GKKS+SFL+KK+  C+SGF P+P  +D    ESRMEK+LR IL KKIYPQ   S   
Sbjct  172  RGVGKKSLSFLLKKILACKSGFQPTPLFKDPLSTESRMEKILRAILHKKIYPQGSCSTTP  231

Query  833  SLKRFLENk-rtsaatataiaeeeeekkrertSDSG-RWDKTDSEYIVLEI  979
             +K++LE    + +       + ++E++    S++G +W KTDSEYIVLEI
Sbjct  232  FIKKYLEATPISHSDDDEDNYDGDDEEEHATISENGSKWVKTDSEYIVLEI  282



>ref|XP_003534954.2| PREDICTED: uncharacterized protein LOC100775761 [Glycine max]
Length=262

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 144/288 (50%), Gaps = 29/288 (10%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F WMQNR NG     ++   +   +  + + EP  +EFSDWP + LAIGT G N+  
Sbjct  1    MKIFEWMQNRINGSNGKKKQSGSISTTSNYNMRHEPCKQEFSDWPQALLAIGTFGGNNLK  60

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            E +    ++    E+    + C+     E T E+VG LQ   + +  + P   GE + + 
Sbjct  61   EDS--GGRSNNTAEDSSSFQDCTQ----EITLEDVGNLQNEFS-IFFKGPNLAGEQEEHT  113

Query  485  -DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
             DL  +    C          SN S  N    C  + I      I  R KD    +   K
Sbjct  114  NDLIKENESPCDG--------SNVSRGNF---CPSNSI------IFSRGKDCSLDHSSKK  156

Query  662  SIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQ-ESRMEKLLRTILSKKIYPQNP-SRAAS  835
             +GKKS+SFL+KKM  C+SGF P+P  +D    ESRMEK+LR IL KKIYPQ   S    
Sbjct  157  GVGKKSLSFLLKKMLACKSGFQPTPLFKDLLSTESRMEKILRAILHKKIYPQGSCSTTPF  216

Query  836  LKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +K++LE   T  +      ++EEE       +  +W KTDSEYIVLEI
Sbjct  217  VKKYLE--ATPISDDGEDDDDEEELAAAAAENGCKWVKTDSEYIVLEI  262



>ref|XP_009390430.1| PREDICTED: uncharacterized protein LOC103976829 [Musa acuminata 
subsp. malaccensis]
Length=260

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 148/289 (51%), Gaps = 52/289 (18%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            M+  +W+QN+FNG         P    + +     PRNE  S+WP + LAIGT G ND  
Sbjct  1    MRILSWVQNKFNG--------RPEKKCSASRA-SAPRNEH-SEWPQALLAIGTFGINDMK  50

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQT--  478
            +  +  E  +            +S DL +FT EEV  LQK L KLLSRKP          
Sbjct  51   QDPQIAENLD------------ASEDLLDFTAEEVNTLQKELAKLLSRKPKCSTSGSEIA  98

Query  479  --------NADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKD  634
                     A+LPL+RFLNCPSSLEVDR         SL   +  ++    + I+ + KD
Sbjct  99   EEEEEEEGRANLPLNRFLNCPSSLEVDR-------TTSLKLDNNGDLSPYTKIILSKVKD  151

Query  635  VCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIYPQ  814
              + N+   +I KKS+SFL+KK+ VC SGF   PS RD   E R+EK+L+ IL+KK    
Sbjct  152  ALQGNRN--AIRKKSLSFLLKKICVCGSGFESPPSFRDPIPEPRIEKILKAILTKK----  205

Query  815  NPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
              S   S++ +LE+K      A+ + E++  K      +  RW KTDSE
Sbjct  206  -SSAPTSMRSYLESKPNEKLQASKVEEDDRRK------NQCRWVKTDSE  247



>gb|KHN12293.1| hypothetical protein glysoja_026185, partial [Glycine soja]
Length=262

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 144/288 (50%), Gaps = 29/288 (10%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            ++ F WMQNR NG     ++   +   +  + + EP  +EFSDWP + LAIGT G N+  
Sbjct  1    LQIFEWMQNRINGSNGKKKQSGSISTTSNYNMRHEPCKQEFSDWPQALLAIGTFGGNNLK  60

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            E +    ++    E+    + C+     E T E+VG LQ   + +  + P   GE + + 
Sbjct  61   EDS--GGRSNNTAEDSSSFQDCTQ----EITLEDVGNLQNEFS-IFFKGPNLAGEQEEHT  113

Query  485  -DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
             DL  +    C          SN S  N    C  + I      I  R KD    +   K
Sbjct  114  NDLIKENESPCDG--------SNVSRGNF---CPSNSI------IFSRGKDCSLDHSSKK  156

Query  662  SIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQ-ESRMEKLLRTILSKKIYPQNP-SRAAS  835
             +GKKS+SFL+KKM  C+SGF P+P  +D    ESRMEK+LR IL KKIYPQ   S    
Sbjct  157  GVGKKSLSFLLKKMLACKSGFQPTPLFKDLLSTESRMEKILRAILHKKIYPQGSCSTTPF  216

Query  836  LKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +K++LE   T  +      ++EEE       +  +W KTDSEYIVLEI
Sbjct  217  VKKYLE--ATPISDDGEDDDDEEELAAAAAENGCKWVKTDSEYIVLEI  262



>ref|XP_008654146.1| PREDICTED: uncharacterized protein LOC103634391 [Zea mays]
Length=292

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 120/320 (38%), Positives = 157/320 (49%), Gaps = 63/320 (20%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHG------KQEPRNEEF------SDWPG--  262
            M   NWMQ+RFNG     R      P   N G      +Q+ R  E        DWP   
Sbjct  1    MGIINWMQDRFNGKHDKRR------PEAINSGSARESCRQDDRAREGKSRNDGGDWPAPQ  54

Query  263  -SFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKL  439
               L+IGTLG++DPP                       + D+ +FT EEV KLQ AL KL
Sbjct  55   HGLLSIGTLGDDDPP----------------PPRASSQADDVLDFTIEEVKKLQDALNKL  98

Query  440  LSRKP-----------------ASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANS  568
            L R                     +    +++ LPLDRFLNCPSSLEVDRR+S       
Sbjct  99   LRRAKSKSSSSSSSSRGSGASATDEDRRASHSQLPLDRFLNCPSSLEVDRRVSLIRHDGG  158

Query  569  LYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRD  748
                +  E     + I+ + +D+   +    +I KKS  FL+KKMFVC  GFAP+PSL+D
Sbjct  159  ---GESGEFSPDTQIILSKARDLL-VHSNGTAIRKKSFKFLLKKMFVCHGGFAPAPSLKD  214

Query  749  TFQESRMEKLLRTILSKKIYPQNPSRAA--SLKRFLENk-rtsaatataiaeeeeekkre  919
               ESRMEKL RT+L KK+  + PS AA  S K +L++K      T       + E   E
Sbjct  215  PV-ESRMEKLFRTMLQKKMNAR-PSNAAVSSRKYYLDDKPSGRMMTRDGRRRHDGEDDDE  272

Query  920  rtSDSGRWDKTDSEYIVLEI  979
            + SD  +WDKTD+++IVLEI
Sbjct  273  KGSDRIKWDKTDTDFIVLEI  292



>ref|NP_001060263.1| Os07g0614400 [Oryza sativa Japonica Group]
 dbj|BAC80089.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22177.1| Os07g0614400 [Oryza sativa Japonica Group]
 dbj|BAG96233.1| unnamed protein product [Oryza sativa Japonica Group]
Length=295

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 158/321 (49%), Gaps = 62/321 (19%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHG---------KQEPRNEEFSDWPGSFLAI  277
            M   NWMQNR +  +   R+       ++            +QE   +E        L+I
Sbjct  1    MGIINWMQNRLSTAKQDKRRTEAAAVASSARRRGGGGGESCRQEEARDEIKIAGDHLLSI  60

Query  278  GTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPA  457
            GTLGN  PP                      ++ ++A+FT EEV KLQ+AL KLL R  +
Sbjct  61   GTLGNESPPRPP-------------AAAAATAAEEVADFTIEEVKKLQEALNKLLRRAKS  107

Query  458  SKG-------EAQTNAD--------------LPLDRFLNCPSSLEVDRRLSNTSAANSLY  574
            +K         A+ +AD              LPLDRFLNCPSSLEVDRR++   AA+  +
Sbjct  108  TKSGSRRGSTAAEHDADERSSSSSSSGSQLLLPLDRFLNCPSSLEVDRRVA---AADGEF  164

Query  575  DCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPS----PSL  742
              D        + I+ + +D+        +I +KS  FL+KKMFVCR GF+PS    P+L
Sbjct  165  SPD-------TQIILSKARDLLVNTNGGGAIKQKSFRFLLKKMFVCRGGFSPSPAPPPTL  217

Query  743  RDTFQESRMEKLLRTILSKKI--YPQNPSRAASLKRFLENkrtsaatataiaeeeeekkr  916
            +D   ESR+EKL RT+L K++   P N + ++S K +LE+              ++E   
Sbjct  218  KDPV-ESRIEKLFRTMLHKRMNARPSNAAASSSRKYYLED--KPREKMQREHLHDDEDDD  274

Query  917  ertSDSGRWDKTDSEYIVLEI  979
            E   D  +WDKTDS++IVLE+
Sbjct  275  ENAEDIFKWDKTDSDFIVLEM  295



>ref|XP_003559965.1| PREDICTED: uncharacterized protein LOC100842803 [Brachypodium 
distachyon]
Length=280

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 114/318 (36%), Positives = 148/318 (47%), Gaps = 71/318 (22%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQ----------AGSRKGYPVPPPTTNHGKQEPRNEEFS------DW  256
            M   NW+QNR N  Q           GS +  PV P        E   EE +      DW
Sbjct  1    MGIINWVQNRLNAKQEKKRPPAAAAVGSSRDAPVRP--------ESCREEINGAGAGNDW  52

Query  257  PGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPD-LAEFTPEEVGKLQKALT  433
              S L+IGTLGN   P  A                     PD + +FT +EV KLQ+AL 
Sbjct  53   --SLLSIGTLGNEPEPPPAM--------------------PDQVPDFTIDEVKKLQEALN  90

Query  434  KLLSR-------KPASKGEAQTNAD-----LPLDRFLNCPSSLEVDR----RLSNTSAAN  565
            KLL R       + ++ G      D     LPLDRFLNCPSSLEVDR    RL      N
Sbjct  91   KLLRRAKSKSSARGSTAGSTAGAGDEDPNQLPLDRFLNCPSSLEVDRSLSLRLQGGGGQN  150

Query  566  SLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLR  745
              +  D   I    R ++         N    +I +KS  FL+KKMF CR GFAP+P+L+
Sbjct  151  GEFSPDTQIILTKARELL------VGTNAGAGAIKQKSFKFLLKKMFACRGGFAPAPTLK  204

Query  746  DTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrert  925
            D   E+R+EKL +T+L KK+  + PS AAS  R    +             +E++     
Sbjct  205  DPV-ETRLEKLFKTMLQKKMSAR-PSNAASSSRKYYLEDKPMGKIRMDRFPDEDEDDNGE  262

Query  926  SDSGRWDKTDSEYIVLEI  979
             D  +WDKTDS++IVLE+
Sbjct  263  DDIFKWDKTDSDFIVLEV  280



>ref|XP_010497648.1| PREDICTED: uncharacterized protein LOC104775028, partial [Camelina 
sativa]
Length=116

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 85/120 (71%), Gaps = 11/120 (9%)
 Frame = +2

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK-  661
            +LPLDRFLNCPSSLEVDRR+SN       YD +E++I+RTI  I+GRCK +  ++K    
Sbjct  1    NLPLDRFLNCPSSLEVDRRISNALC----YDENEEDIERTISVILGRCKAISTESKNKTK  56

Query  662  ----SIGKKSVSFLVKKMFVCRSGFAP--SPSLRDTFQESRMEKLLRTILSKKIYPQNPS  823
                 + K SVS L+KKMFVC  GF+P  +PSLRDTFQESRMEKLLR +L KKI  Q  S
Sbjct  57   KSKKDLSKTSVSHLLKKMFVCTDGFSPVPNPSLRDTFQESRMEKLLRMMLHKKINTQTSS  116



>gb|EMT10978.1| hypothetical protein F775_02087 [Aegilops tauschii]
Length=402

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 112/307 (36%), Positives = 144/307 (47%), Gaps = 50/307 (16%)
 Frame = +2

Query  128  KFFNWMQNRFNGGQAGSRKGYPV---------PPPTTNHGKQEPRNEEFSDWPGSFLAIG  280
            +  NW+QNR N  Q   R               P      + +  +E   DW  S L+IG
Sbjct  123  QIINWVQNRLNTKQEKKRSAAAAAAGASSVRNAPVREKSCRGQADDELPGDW--SMLSIG  180

Query  281  TLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSR---K  451
            TLGN   P  A                       + +FT EEV KLQ AL KLL R   K
Sbjct  181  TLGNEPTPAPAPA-----------------PDQAVPDFTIEEVKKLQDALNKLLRRAKSK  223

Query  452  PASKGEAQTNAD----LPLDRFLNCPSSLEVDRRLS-----NTSAANSLYDCDEDEIDRT  604
             +S+G      D    LPLDRFLNCPSSLEVDRRLS          N  +  D   I   
Sbjct  224  SSSRGSTARAGDEEQNLPLDRFLNCPSSLEVDRRLSLRLQGADGGQNGEFSPDTQIILSK  283

Query  605  IRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLR  784
             R ++         N     + +KS  FL+K MF CR+GF P PSL+D   E+++EKL +
Sbjct  284  ARELL------VSTNGNGGGVKQKSFKFLLKNMFACRAGFPPQPSLKDPV-ETKLEKLFK  336

Query  785  TILSKKIYPQNPSRAASLKR--FLENkrtsaatataiaeeeeekkrertSDSGRWDKTDS  958
            T+L KK+    PS AAS  R  +LE+K           +EEEE+         +WDKTDS
Sbjct  337  TMLQKKMSVPRPSNAASSSRKYYLEDKPMGRIQMDGRHDEEEEEDYNDEDIF-KWDKTDS  395

Query  959  EYIVLEI  979
            ++IVLE+
Sbjct  396  DFIVLEV  402



>emb|CDX72918.1| BnaC06g33660D [Brassica napus]
Length=212

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 105/167 (63%), Gaps = 23/167 (14%)
 Frame = +2

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
            A+LPLDRFLNCPSSLEVDRR+SN  +          +I+RTI  I+GRCK +  ++   K
Sbjct  56   ANLPLDRFLNCPSSLEVDRRISNALS----------DIERTISVILGRCKAISTESNSKK  105

Query  662  SIGKK-----SVSFLVKKMFVCRSGFAP--SPSLRDTFQESRMEKLLRTILSKKIYPQNP  820
               KK     SVS+L+KKMFVC  GF+P   P LRDTFQESRMEKLLR +L KKI  Q P
Sbjct  106  KKTKKDLSKTSVSYLLKKMFVCTEGFSPLPKPILRDTFQESRMEKLLRVMLLKKINAQAP  165

Query  821  SRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            S+   +K+++++            + EEE+    +SD  +W KTDS+
Sbjct  166  SKETPMKKYVQD------EQQLSLKNEEEEGSSSSSDGCKWVKTDSD  206



>gb|EAZ04698.1| hypothetical protein OsI_26858 [Oryza sativa Indica Group]
Length=323

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 97/280 (35%), Positives = 139/280 (50%), Gaps = 60/280 (21%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHG---------KQEPRNEEFSDWPGSFLAI  277
            M   NWMQNR +  +   R+       ++            +QE   +E        L+I
Sbjct  1    MGIINWMQNRLSTAKQDKRRTEAAAVASSARRRGGGGGESCRQEEARDEIKIAGDHLLSI  60

Query  278  GTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPA  457
            GTLGN  PP                      ++ ++A+FT EEV KLQ+AL KLL R  +
Sbjct  61   GTLGNESPPRPPPAAAAT-------------AAEEVADFTIEEVKKLQEALNKLLRRAKS  107

Query  458  SKG-------EAQTNAD--------------LPLDRFLNCPSSLEVDRRLSNTSAANSLY  574
            +K         A+ +AD              LPLDRFLNCPSSLEVDRR++   AA+  +
Sbjct  108  TKSGSRRGSTAAEHDADERSSSSSSSGGQLLLPLDRFLNCPSSLEVDRRVA---AADGEF  164

Query  575  DCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPS----PSL  742
              D        + I+ + +D+        +I +KS  FL+KKMFVCR GF+PS    P+L
Sbjct  165  SPD-------TQIILSKARDLLVNTNGGGAIKQKSFRFLLKKMFVCRGGFSPSPAPPPTL  217

Query  743  RDTFQESRMEKLLRTILSKKI--YPQNPSRAASLKRFLEN  856
            +D   ESR+EKL RT+L K++   P N + ++S K +LE+
Sbjct  218  KDPV-ESRIEKLFRTMLHKRMNARPSNAAASSSRKYYLED  256



>ref|XP_009389860.1| PREDICTED: uncharacterized protein LOC103976393 [Musa acuminata 
subsp. malaccensis]
Length=271

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 128/212 (60%), Gaps = 20/212 (9%)
 Frame = +2

Query  239  EEFSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKL  418
            EE +DWP + L+IGTLGN++  E  R+        +E        S DL+ FT +EV  L
Sbjct  7    EELNDWPQALLSIGTLGNSEMKEEPRR--------DEHSRTLDSPSEDLSNFTIDEVSNL  58

Query  419  QKALTKLLSRK-----PASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCD  583
            QK L KLLS K       S+   +  A LPL+RFLNCPSSLEVDR     SA     D D
Sbjct  59   QKELKKLLSLKSKTKSAGSEFGEEDRAKLPLNRFLNCPSSLEVDRI---ASAKLEYLDND  115

Query  584  ED-EIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQE  760
             + ++    + ++ + K+V   N+   +I KKS+SFL+K+MFVC  GFAP+P  RD   E
Sbjct  116  NNGDLSPNTKIVLSKVKEVLLGNRN--AIKKKSISFLLKRMFVCGGGFAPAPGFRDPMPE  173

Query  761  SRMEKLLRTILSKKIYPQNPSRAASLKRFLEN  856
            SRMEK+LR IL+KK++ Q+ + ++S K +LEN
Sbjct  174  SRMEKILRAILTKKMHQQSSTPSSSQK-YLEN  204



>ref|XP_008792891.1| PREDICTED: uncharacterized protein LOC103709370 [Phoenix dactylifera]
Length=214

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 127/251 (51%), Gaps = 43/251 (17%)
 Frame = +2

Query  233  RNEEFSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVG  412
              +EF DWP + LAIGT GN++  E                       PDL     EEV 
Sbjct  5    HKDEFGDWPQALLAIGTFGNSELEEDT------ATYDSSKSLYTLQDQPDL---LLEEVI  55

Query  413  KLQKALTKLLSRKPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDE  592
            K QK L KLL+ +P S+ +                S +E  +   +       +D DED 
Sbjct  56   KFQKELAKLLAAEPKSRTDE---------------SEMEWGKEFCDG------FD-DEDN  93

Query  593  IDRT--IRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESR  766
             D +   + I+ R K++    +   +I KKS+SFL+KKMFVC+SGF P+ +LRD F ES+
Sbjct  94   CDLSPNSKIILNRAKNLLADPRG--AIKKKSISFLLKKMFVCKSGFGPARNLRDPFPESK  151

Query  767  MEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWD  946
            +EKLL+T+L KKI+PQN S + S  + LE                E+K  E   D G+W 
Sbjct  152  IEKLLKTMLHKKIHPQN-SNSTSKPKHLEK-------KQEERTHAEDKMHEEEKDGGKWV  203

Query  947  KTDSEYIVLEI  979
            KTDSEYIVLE+
Sbjct  204  KTDSEYIVLEM  214



>tpg|DAA63587.1| TPA: hypothetical protein ZEAMMB73_189953 [Zea mays]
Length=329

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 115/314 (37%), Positives = 151/314 (48%), Gaps = 63/314 (20%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHG------KQEPRNEEF------SDWPG--  262
            M   NWMQ+RFNG     R      P   N G      +Q+ R  E        DWP   
Sbjct  1    MGIINWMQDRFNGKHDKRR------PEAINSGSARESCRQDDRAREGKSRNDGGDWPAPQ  54

Query  263  -SFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKL  439
               L+IGTLG++DPP                       + D+ +FT EEV KLQ AL KL
Sbjct  55   HGLLSIGTLGDDDPP----------------PPRASSQADDVLDFTIEEVKKLQDALNKL  98

Query  440  LSRKP-----------------ASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANS  568
            L R                     +    +++ LPLDRFLNCPSSLEVDRR+S       
Sbjct  99   LRRAKSKSSSSSSSSRGSGASATDEDRRASHSQLPLDRFLNCPSSLEVDRRVSLIRHDGG  158

Query  569  LYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRD  748
                +  E     + I+ + +D+   +    +I KKS  FL+KKMFVC  GFAP+PSL+D
Sbjct  159  ---GESGEFSPDTQIILSKARDLL-VHSNGTAIRKKSFKFLLKKMFVCHGGFAPAPSLKD  214

Query  749  TFQESRMEKLLRTILSKKIYPQNPSRAA--SLKRFLENk-rtsaatataiaeeeeekkre  919
               ESRMEKL RT+L KK+  + PS AA  S K +L++K      T       + E   E
Sbjct  215  PV-ESRMEKLFRTMLQKKMNAR-PSNAAVSSRKYYLDDKPSGRMMTRDGRRRHDGEDDDE  272

Query  920  rtSDSGRWDKTDSE  961
            + SD  +WDKTD++
Sbjct  273  KGSDRIKWDKTDTD  286



>ref|XP_004161131.1| PREDICTED: uncharacterized protein LOC101232294 [Cucumis sativus]
 gb|KGN66315.1| hypothetical protein Csa_1G597130 [Cucumis sativus]
Length=270

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 147/292 (50%), Gaps = 29/292 (10%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            M+  NWMQ +   G+ GS++         +    + R EEFS+W    LAIGT G+ +  
Sbjct  1    MRILNWMQGKKPSGRKGSKR--TTSNSINDEIVHKTRPEEFSNWSHVLLAIGTFGDENLN  58

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            E+  K  +        +         L + TPEE+  LQK    LL+         Q+  
Sbjct  59   EARPKRSQENSSSSLQQ--------HLKDLTPEELNILQKEFNLLLAEHLK-----QSGP  105

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRT---IRAIIGRCKDVCEKNKQ  655
             L  +   +CPS++ ++R+L+  S       C E+ I ++      I+ + KDV      
Sbjct  106  TLEFEVSKHCPSNIFLNRQLTFGSETTKKELCYEELIKKSNIFQHVILSKGKDVGVDAND  165

Query  656  HKSIGKKSVSFLVKKMFVCRSGFAP----SPSLRDTFQESRMEKLLRTILSKKIYPQNPS  823
               IGK+++S L+KK+FVC  G AP    +P LR    ES+MEK+LRTIL KKIYP++ +
Sbjct  166  TAIIGKRTLSLLLKKIFVCGGGTAPPAVVTPPLRPAL-ESKMEKILRTILQKKIYPRSSN  224

Query  824  RAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
               S      +K+          +E E++K ++TSD  +W +TDSEYIVLEI
Sbjct  225  VRTS------SKKKYLRKKNKQRDENEDEKNDKTSDGSKWVQTDSEYIVLEI  270



>gb|KHN42784.1| hypothetical protein glysoja_038346 [Glycine soja]
Length=233

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 96/256 (38%), Positives = 129/256 (50%), Gaps = 27/256 (11%)
 Frame = +2

Query  221  KQEPRNEEFSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTP  400
            + EP  +EFSDWP + LAIGT G ++  E +    ++    E+    + C+     E T 
Sbjct  2    RHEPCKQEFSDWPQALLAIGTFGGSNLKEDS--GGRSNHAAEDSSSFQDCTQ----EVTL  55

Query  401  EEVGKLQKALTKLL-SRKPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYD  577
            E+VG LQ   +     +  A++ E  TN DL  +    C  S  V R   N   +NS+  
Sbjct  56   EDVGNLQSEFSIFFKGQNLAAEQEEHTN-DLIKENDSLCDGS-NVSR--GNFYPSNSI--  109

Query  578  CDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQ  757
                        I  R KD    +   K +GKKS+SFL+KKM  C+SGF P+P  +D   
Sbjct  110  ------------IFSRGKDCSLDHSSKKGVGKKSLSFLLKKMLACKSGFQPTPLFKDPLS  157

Query  758  -ESRMEKLLRTILSKKIYPQNP-SRAASLKRFLENkrtsaatataiaeeeeekkrertSD  931
             ESRMEK+LR IL KKIYPQ   S    +K++LE    S        +EEEE       +
Sbjct  158  TESRMEKILRAILQKKIYPQGSCSTTPFVKKYLEATPISQFDDEEDDDEEEELAAAAAEN  217

Query  932  SGRWDKTDSEYIVLEI  979
              +W KTDSEYIVLEI
Sbjct  218  GSKWVKTDSEYIVLEI  233



>gb|KCW79378.1| hypothetical protein EUGRSUZ_C00791, partial [Eucalyptus grandis]
Length=221

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 86/255 (34%), Positives = 125/255 (49%), Gaps = 42/255 (16%)
 Frame = +2

Query  227  EPRNEEFSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEE  406
            EP  EEFSDWP   L IGT GN D      K +  +   +      Q   P   + T EE
Sbjct  5    EPFKEEFSDWPNGLLTIGTFGNGD----LNKDQARQDQQDHTPSPSQDQLP--QDLTIEE  58

Query  407  VGKLQKALTKLLSRKPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDE  586
            V KLQ+ L   L+ +P  +              +  P + E + +  N    N       
Sbjct  59   VWKLQQELNSFLNTQPQQE--------------IAEPIAHEPNTKDDNFQETNGA-----  99

Query  587  DEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGF----APSPSLRDTF  754
                  +    G+   V +  K+++ IGK+S+S L+KKMF C+SGF    +P  +L+D  
Sbjct  100  -----VVSRKSGKDTAVLDGAKRNR-IGKRSLSLLMKKMFACKSGFDHELSPVLNLKDPL  153

Query  755  QESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDS  934
             E+RMEK+L+ IL KKIYPQ+ S+A S KR+LE                ++++  + +  
Sbjct  154  PETRMEKILKAILHKKIYPQSSSQALSAKRYLEQ-------RPMPKSSSDQEEVNKETTK  206

Query  935  GRWDKTDSEYIVLEI  979
             +WD+TDSEYIVLEI
Sbjct  207  SKWDRTDSEYIVLEI  221



>ref|XP_006367433.1| PREDICTED: uncharacterized protein LOC102585817 [Solanum tuberosum]
Length=256

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 88/293 (30%), Positives = 144/293 (49%), Gaps = 45/293 (15%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F+W+Q + NG Q+  +     P   T+H   +   EEFSDWP   LAIGT G+    
Sbjct  1    MKIFSWIQTKINGKQSTYKSN---PVAVTHHMLHQSCKEEFSDWPNELLAIGTFGSWKND  57

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLL-SRKPASKGEAQTN  481
             + ++ +++                     T EEVG+L   L  L    + ++   A+  
Sbjct  58   GNLKQQDQS--------------------LTVEEVGQLHNELKHLFPDHEESNPLSAKIG  97

Query  482  ADLPLDRFLNCPSSL-EVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQH  658
            +   LD+F +C  +L + D R+   +  N       +  + T+  +  +     E++ Q 
Sbjct  98   SKKDLDKFFDCLQNLVDDDHRVIENNKENIF-----ERSNSTLVHVRSQ-----EQSSQL  147

Query  659  KSIGKKSVSFLVKKMFVCRSGFAP---SPSL-RDTFQESRMEKLLRTILSKKIYPQ--NP  820
            ++I KKS+S+L+KK   C +GFA     P L +   ++SRMEK+LR IL KKIYPQ  +P
Sbjct  148  ENISKKSLSYLLKKTLFCSAGFAAPLRDPVLPQSKIEKSRMEKILRAILHKKIYPQASSP  207

Query  821  SRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
                + KR+++N     +      E  +   +    +  +WDK+DS++IVLEI
Sbjct  208  RGTTTRKRYIDNICMIESDTDQDNEAFDSTVK----NGSKWDKSDSDFIVLEI  256



>ref|XP_009801637.1| PREDICTED: uncharacterized protein LOC104247347 isoform X2 [Nicotiana 
sylvestris]
Length=253

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 147/293 (50%), Gaps = 48/293 (16%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK FNW Q++ NG +   ++        TNH   +P  EEF+DWP   LAIGT GNN   
Sbjct  1    MKIFNWFQSKNNGKKRIHKQKSVT---VTNHTLHQPCREEFNDWPIELLAIGTFGNN---  54

Query  305  ESARKPekneiiveegeeeeQCSSPD-LAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
                      +  + G    Q S PD L + TPEEVG+LQK L  LL    +      + 
Sbjct  55   ---------SLNKDFGNLNHQPSCPDHLEKLTPEEVGQLQKELKLLLCDSTSPDSAKGST  105

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
             DL   +F +C   LE D+               E+ + +    + G+ ++V  +N  + 
Sbjct  106  KDLV--KFFDCLQRLEDDK---------------ENHLKQRNSIVCGKKQEVQLEN-TNS  147

Query  662  SIGKKSVSFLVKKMFVCRSGF-APSPS-LRD-----TFQESRMEKLLRTILSKKIYPQNP  820
             I KK++SFL++K F CR  F  PSP  LRD      F++ R+EK+LR I+ KKI+PQ  
Sbjct  148  GISKKTLSFLLEKAFACRGRFTVPSPPLLRDPISQSKFEKLRLEKILRAIIHKKIFPQAS  207

Query  821  SRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            S  A  K++L+N          +  + E++  E   D  +WD +DS++IVLEI
Sbjct  208  SPRAVKKKYLDN-------GKIVETDSEDEAFETVKDGNKWDNSDSDFIVLEI  253



>ref|XP_010050437.1| PREDICTED: uncharacterized protein LOC104439000 [Eucalyptus grandis]
Length=337

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 136/261 (52%), Gaps = 33/261 (13%)
 Frame = +2

Query  227  EPRNEEFSDWPGSFLAIGTLGNND-PPESARKPekneiiveegeeeeQCSSPDLAEFTPE  403
            EP  EEFSDWP   L IGT GN D   + AR+ +++       ++  Q       + T E
Sbjct  28   EPFKEEFSDWPNGLLTIGTFGNGDLNKDQARQDQQDHTPSPSQDQLPQ-------DLTIE  80

Query  404  EVGKLQKALTKLLSRKPA----SKGEAQTNADLPLDRFLNCPSSLEV---DRRLSNTSAA  562
            EV KLQ+ L   L+ +P     S G         + R  +CP S E+   +R ++   A 
Sbjct  81   EVWKLQQELNSFLNTQPQQHNPSAGTTGNGGSFGVYRSTSCPMSSEIITDEREIAEPIAH  140

Query  563  NSLYDCDEDEIDRTIRAIIGR--CKD--VCEKNKQHKSIGKKSVSFLVKKMFVCRSGF--  724
                +  +D    T  A++ R   KD  V +  K+++ IGK+S+S L+KKMF C+SGF  
Sbjct  141  EP--NTKDDNFQETNGAVVSRKSGKDTAVLDGAKRNR-IGKRSLSLLMKKMFACKSGFDH  197

Query  725  --APSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaee  898
              +P  +L+D   E+RMEK+L+ IL KKIYPQ+ S+A S KR+LE               
Sbjct  198  ELSPVLNLKDPLPETRMEKILKAILHKKIYPQSSSQALSAKRYLEQ-------RPMPKSS  250

Query  899  eeekkrertSDSGRWDKTDSE  961
             ++++  + +   +WD+TDSE
Sbjct  251  SDQEEVNKETTKSKWDRTDSE  271



>ref|XP_006475098.1| PREDICTED: uncharacterized protein LOC102614440 [Citrus sinensis]
Length=235

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 136/291 (47%), Gaps = 62/291 (21%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNH---GKQEPRNEEFSDWPGSFLAIGTLGNN  295
            M+ FNWMQN+  GG   S+K   +   + N     ++E   EEF +W    LAIGT+GN 
Sbjct  1    MRIFNWMQNKL-GGIHSSKKPDLLSSLSANSRDCVQKESCKEEFVEWTHGLLAIGTIGNV  59

Query  296  DPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQ  475
            +  +                +  Q  +PD      EEV  LQ  +  +L     S+ + +
Sbjct  60   NLKD-------------LDHDSVQDPTPD------EEVATLQNEVNLILHEPEDSEVDDE  100

Query  476  TNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVC-EKNK  652
            T  +               D     T+AA                A     KD+  +  K
Sbjct  101  TTIN---------------DSNPRTTTAA----------------AFSSSGKDISFDSTK  129

Query  653  QHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSK--KIYPQNPSR  826
                I  KS+SFL+KKM  CRSGFAP+PSL+D   ES+MEK++R IL K  KIYPQ+   
Sbjct  130  SPGVISSKSLSFLLKKMIACRSGFAPAPSLKDPVSESQMEKIMRAILHKKMKIYPQSSGT  189

Query  827  AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            A S K++L+++  +   +    +  E+ +     +  +W KTDSEYIVLEI
Sbjct  190  ALSSKKYLKSRTVNTPESANEDDFNEDAE-----NGSKWVKTDSEYIVLEI  235



>ref|NP_001063278.1| Os09g0439800 [Oryza sativa Japonica Group]
 dbj|BAD36146.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25192.1| Os09g0439800 [Oryza sativa Japonica Group]
 dbj|BAN59747.1| early auxin response protein [Oryza sativa Japonica Group]
Length=251

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 103/296 (35%), Positives = 150/296 (51%), Gaps = 56/296 (19%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPV---PPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNN  295
            MK F+W+ N+ +G Q  +R  +P     P   N    + R +EFSDWP S LAIGT GN 
Sbjct  1    MKIFSWVANKISGKQEANR--FPANSSAPYRANVS--DCRKDEFSDWPQSLLAIGTFGNK  56

Query  296  DPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQ  475
               E A+    ++ +          S  D  +FT EEV K++K    LL+ K   + EAQ
Sbjct  57   QIEEVAQVENSSDNVQ---------SVQDTVKFTEEEVDKIRKEFETLLAIK--DQAEAQ  105

Query  476  TNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQ  655
             + D            + + +R             D ++ ++ IR +I + + +  K+K 
Sbjct  106  RSHD---------DDQVGLQKR------------ADGEDNEKHIRQLINK-RIIVSKSKN  143

Query  656  HKSIGKK-------SVSFLVKKMFVCRSGF-APSPSLRDTFQESRMEKLLRTILSKKIYP  811
              S+GKK       SV+ L+K +F+C+ GF +  P  R+TF +SRMEKLL+ IL KKI+P
Sbjct  144  --SLGKKGNTLKPRSVASLLK-LFMCKGGFTSVVPEPRNTFPQSRMEKLLKAILQKKIHP  200

Query  812  QNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            QN S   + KR L+         T I E  E+  R+   D  +W KTDSEYIVLE+
Sbjct  201  QNSSTLVA-KRHLD----WKPDETEINECLEDALRDLDDDGAKWVKTDSEYIVLEM  251



>ref|XP_010323988.1| PREDICTED: uncharacterized protein LOC101261934 isoform X1 [Solanum 
lycopersicum]
Length=256

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 94/301 (31%), Positives = 143/301 (48%), Gaps = 61/301 (20%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGN--ND  298
            MK F+W+Q +FNG Q   +     P   T+H      ++EFSDWP   LAIGT G+  ND
Sbjct  1    MKIFSWIQTKFNGKQTTCKSN---PVAVTHH----MLHQEFSDWPNELLAIGTFGSLKND  53

Query  299  PPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQT  478
                 +                          T EEVG+L K L  L    P  +   + 
Sbjct  54   GKLKQQDQS----------------------LTVEEVGQLHKELKHLF---PDHEESNKI  88

Query  479  NADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIG-RCKDVCEK--N  649
             ++  LD+F +C  +L  D         + + +  E+   R+   ++  R ++   K  N
Sbjct  89   GSNKDLDKFFDCLQNLVDD-------DDHRVIENKENIFKRSNSTLVHVRSQEQSSKLDN  141

Query  650  KQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDT-------FQESRMEKLLRTILSKKIY  808
              +  I KKS+S+L+KK   C +GFA +P LRD         Q+SRMEK+LR IL KKIY
Sbjct  142  MTNTGISKKSLSYLLKKTLFCSAGFA-AP-LRDNPLLPHSKIQKSRMEKILRAILHKKIY  199

Query  809  PQNPS----RAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLE  976
            PQ  S     + + KR+++N         +  ++++E       +  +WDK+DS++IVLE
Sbjct  200  PQANSPRGNGSTTRKRYIDN----TCVIESDTDQDDEAFDTTVKNGSKWDKSDSDFIVLE  255

Query  977  I  979
            I
Sbjct  256  I  256



>ref|XP_009598284.1| PREDICTED: uncharacterized protein LOC104094124 [Nicotiana tomentosiformis]
Length=251

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 102/297 (34%), Positives = 146/297 (49%), Gaps = 58/297 (20%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNN---  295
            MK FNW Q++ NG Q G+ K   V    TNH   +P  EEFSDWP   LAIGT GNN   
Sbjct  1    MKIFNWFQSKKNGKQ-GTNKQKAVR--VTNHMLHQPIREEFSDWPIELLAIGTFGNNSLN  57

Query  296  -DPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEA  472
             D      +P                    L E TPEEVG+LQK L  LL    +     
Sbjct  58   KDVGNLNHQPYH------------------LEELTPEEVGELQKELKLLLCDSTSPDPAK  99

Query  473  QTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNK  652
             +  DL  ++F +C  SLE D+               E+ + ++   + G+ ++V  +N 
Sbjct  100  GSTKDL--EKFFDCLQSLEDDK---------------ENHLKQSNSIVCGKKQEVQLEN-  141

Query  653  QHKSIGKKSVSFLVKKMFVCRSGF-APSPSL-RD-----TFQESRMEKLLRTILSKKIYP  811
             +  I  K++S+L++K F CR  F  PSP L RD      F++ R+EK+LR I+ KKI+ 
Sbjct  142  TNSGISTKTLSYLLEKAFACRGRFTVPSPPLLRDPISQSKFEKLRLEKILRAIIHKKIFR  201

Query  812  QNPS-RAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            Q  S R    K++L+N          +  + E++  E   D  +WD +DS++IVLEI
Sbjct  202  QASSPRGDMKKKYLDN-------GNILEIDSEDEAFETVKDRNKWDNSDSDFIVLEI  251



>ref|XP_010667542.1| PREDICTED: uncharacterized protein LOC104884565 [Beta vulgaris 
subsp. vulgaris]
Length=263

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 94/296 (32%), Positives = 144/296 (49%), Gaps = 44/296 (15%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F+W+ ++ NG Q+ +                  + EEFSDWP  FL+IGTL      
Sbjct  1    MKLFSWVHDKLNGRQSNNSNTNIHASNKNQTQHLAAQKEEFSDWPQGFLSIGTLFTKSLK  60

Query  305  ESARKPekneiiveegeeeeQCSSPD-LAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
            E                   Q +SP+ + + T EEV +LQK L  L+S            
Sbjct  61   ED------------NTTTTNQQNSPNPILDITLEEVNELQKELNALISS-----------  97

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEID-RTIRAII---GRCKDV-CEK  646
                 +  ++C S  E +    ++S+     + +E+E D +   +++    + KDV  + 
Sbjct  98   -----NDLIDCFSEKEKNHESLSSSSNKEEEEDEEEESDDQHFTSMVLNHNKGKDVYLDS  152

Query  647  NKQHKSIGKKSVSFLVKKMFVC-RSGFAPSPSLRDTF----QESRMEKLLRTILSKKIYP  811
            N  + +I KKS+SFL+KKMFVC   G  P+PSLRD      + +R  K+LR +L KKIYP
Sbjct  153  NGNNNAISKKSLSFLLKKMFVCGVGGLGPTPSLRDPVLSAPKTTRFSKILRAMLRKKIYP  212

Query  812  QNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            QNP    S KR+L      +    +   ++E+      ++  +WDK+D+EYIVLEI
Sbjct  213  QNPGPNMSRKRYL-----GSGQIGSSNYDDEDDMDTEANNHIKWDKSDTEYIVLEI  263



>emb|CDP03060.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 148/295 (50%), Gaps = 48/295 (16%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDP-  301
            MK F+WMQ++ N  Q  S+   P   P   H   +   EEFSDWP   LAIGT GNN+P 
Sbjct  1    MKIFSWMQSKLNRNQRSSK---PNTKPAKYHLMHDTCKEEFSDWPSGLLAIGTFGNNNPN  57

Query  302  -PESARKPekneiiveegeeeeQCSSPDL-AEFTPEEVGKLQKALTKLLSRKPASKGE--  469
             PE +  P             E+C S +   EFT EE+ ++   L  LL+++  +  +  
Sbjct  58   DPEKSNLP------------GEECPSQEYPEEFTHEEMREIHTELKLLLNQQALADSDLA  105

Query  470  AQTNADLPLDRFLNCPSSLEVDRRL------SNTSAANSLYDCDEDEIDRTIRAIIGRCK  631
             ++  D+P ++F +   S E DR         N ++  S Y     + +++I    G+  
Sbjct  106  EESANDIPQEKFFDVSKSFEDDRSTCGELISDNLTSKGSHY-----QSNKSIHT-KGKNS  159

Query  632  DVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRD-----TFQESRMEKLLRTILS  796
            D+ +KN    +I K+S+SFL++K F        SP  +D       ++S +EK+LRTIL 
Sbjct  160  DMDKKN----NIRKRSLSFLIRKAFHRTVKPQLSPQFKDPLPDLKLEKSILEKILRTILH  215

Query  797  KKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            KK+YPQ+ +  A +K+ L++             + E++  + TS+  +W KTDS+
Sbjct  216  KKVYPQSSTPKAPIKKCLDS-------KHQSETDGEDEMHDSTSEGSKWVKTDSD  263



>gb|EEC75443.1| hypothetical protein OsI_11979 [Oryza sativa Indica Group]
Length=308

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 114/331 (34%), Positives = 148/331 (45%), Gaps = 69/331 (21%)
 Frame = +2

Query  125  MKFFNWMQNRFNG---GQAGSR-----KGYP-------VPPPTTNHGKQEPRNEEFSDWP  259
            M   +W+Q R  G     A SR      G P        P     H +  P +     WP
Sbjct  1    MGIVSWVQGRLGGRTSAAAESRGLAAGNGNPSLVAAVVAPGKERKHQQVVPDDLAGDQWP  60

Query  260  G---SFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKAL  430
                   +IGTLGN+                     E+     DL EF+ EEV KLQ AL
Sbjct  61   TPATHLFSIGTLGND------------------ELPEQGEEEEDLPEFSVEEVRKLQDAL  102

Query  431  TKLLSRKPA---------------SKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAAN  565
             +LL R  +                 G    ++ LPLD FLNCPSSLEVDRR        
Sbjct  103  ARLLLRARSKNYSEAVATAAATATCCGGGGADSGLPLDMFLNCPSSLEVDRRAQRDHGGG  162

Query  566  SLYDCDEDEIDRTIRAIIGRCKDV-CEKNKQHKS-----IGKKSVSFLVKKMFVCRSGFA  727
                     +    + I+ + KD+  + N ++ +     I  KS  FL+KKMFVC  GFA
Sbjct  163  GAAVG----LSPGTKMILTKAKDILVDGNTRNTTTSGGDIKNKSFKFLLKKMFVCHGGFA  218

Query  728  PSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLE-------Nkrtsaatata  886
            P+PSL+D   ES MEK LRT+L KKI  +  +  AS   FLE       + R        
Sbjct  219  PAPSLKDP-TESSMEKFLRTVLGKKIAARPSNSPASRTYFLEGNNAHGDDHRLCRRRRPR  277

Query  887  iaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
              EEEEE++  +  +S +WD+TDSEYIVLEI
Sbjct  278  CGEEEEEEEENKGEESCKWDRTDSEYIVLEI  308



>gb|AAU89241.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96520.1| hypothetical protein LOC_Os03g29270 [Oryza sativa Japonica Group]
Length=355

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 111/332 (33%), Positives = 149/332 (45%), Gaps = 70/332 (21%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTN---------------HGKQEPRNEEFSDWP  259
            M   +W+Q R  G  + + +   +     N               H +  P +     WP
Sbjct  47   MGIVSWVQGRLGGRTSAAAESRGLAAGNGNPSVVAAVVAAGKERKHQQVVPDDLAGDQWP  106

Query  260  G---SFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKAL  430
                   +IGTLGN++ PE   +                    DL EF+ EEV KLQ AL
Sbjct  107  TPATHLFSIGTLGNDELPEQGEE------------------EEDLPEFSVEEVRKLQDAL  148

Query  431  TKLLSRKPASK-GEA--------------QTNADLPLDRFLNCPSSLEVDRRLSNTSAAN  565
             +LL R  + K  EA                ++ LPLD FLNCPSSLEVDRR        
Sbjct  149  ARLLLRARSKKYSEAVATAAATATCCGGGGADSGLPLDMFLNCPSSLEVDRRAQRDHGGG  208

Query  566  SLYDCDEDEIDRTIRAIIGRCKDV-CEKNKQHKS-----IGKKSVSFLVKKMFVCRSGFA  727
                     +    + I+ + KD+  + N ++ +     I  KS  FL+KKMFVC  GFA
Sbjct  209  GA----AVGLSPGTKMILTKAKDILVDGNTRNTTTSGGDIKNKSFKFLLKKMFVCHGGFA  264

Query  728  PSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaata--------t  883
            P+PSL+D   ES MEK LRT+L KKI  +  +  AS   FLE                  
Sbjct  265  PAPSLKDP-TESSMEKFLRTVLGKKIAARPSNSPASRTYFLEGNNAHGDDHRLCRRRRPR  323

Query  884  aiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
               EEEEE++  +  +S +WD+TDSEYIVLEI
Sbjct  324  CGEEEEEEEEENKGEESCKWDRTDSEYIVLEI  355



>gb|EEE59230.1| hypothetical protein OsJ_11212 [Oryza sativa Japonica Group]
Length=309

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 110/332 (33%), Positives = 147/332 (44%), Gaps = 70/332 (21%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTN---------------HGKQEPRNEEFSDWP  259
            M   +W+Q R  G  + + +   +     N               H +  P +     WP
Sbjct  1    MGIVSWVQGRLGGRTSAAAESRGLAAGNGNPSVVAAVVAAGKERKHQQVVPDDLAGDQWP  60

Query  260  G---SFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKAL  430
                   +IGTLGN+                     E+     DL EF+ EEV KLQ AL
Sbjct  61   TPATHLFSIGTLGND------------------ELPEQGEEEEDLPEFSVEEVRKLQDAL  102

Query  431  TKLLSRKPASK-GEA--------------QTNADLPLDRFLNCPSSLEVDRRLSNTSAAN  565
             +LL R  + K  EA                ++ LPLD FLNCPSSLEVDRR        
Sbjct  103  ARLLLRARSKKYSEAVATAAATATCCGGGGADSGLPLDMFLNCPSSLEVDRRAQRDHGGG  162

Query  566  SLYDCDEDEIDRTIRAIIGRCKDV-CEKNKQHKS-----IGKKSVSFLVKKMFVCRSGFA  727
                     +    + I+ + KD+  + N ++ +     I  KS  FL+KKMFVC  GFA
Sbjct  163  GAAVG----LSPGTKMILTKAKDILVDGNTRNTTTSGGDIKNKSFKFLLKKMFVCHGGFA  218

Query  728  PSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaata--------t  883
            P+PSL+D   ES MEK LRT+L KKI  +  +  AS   FLE                  
Sbjct  219  PAPSLKDP-TESSMEKFLRTVLGKKIAARPSNSPASRTYFLEGNNAHGDDHRLCRRRRPR  277

Query  884  aiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
               EEEEE++  +  +S +WD+TDSEYIVLEI
Sbjct  278  CGEEEEEEEEENKGEESCKWDRTDSEYIVLEI  309



>ref|XP_002461010.1| hypothetical protein SORBIDRAFT_02g039163 [Sorghum bicolor]
 gb|EER97531.1| hypothetical protein SORBIDRAFT_02g039163 [Sorghum bicolor]
Length=293

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 149/297 (50%), Gaps = 41/297 (14%)
 Frame = +2

Query  143  MQNRFNGGQAGSRKGYPVPPPTT-------------NHGKQEPRNEEFSDWP-GSFLAIG  280
            MQNRFNG     R                       +HG+++       DWP    L+IG
Sbjct  1    MQNRFNGKHEKRRPEATAAAAAAAFSSAHASESCRQDHGRED--KIPTGDWPPQGLLSIG  58

Query  281  TLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLL----SR  448
            TL            +      + G    + S  D+ +FT EEV KLQ AL KLL    S+
Sbjct  59   TL----------GDDPPPAAGDGGGGPPRASQADVLDFTIEEVKKLQDALNKLLRRAKSK  108

Query  449  KPASKGEAQTNAD----LPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAI  616
              +S+G   T+ D    LPLDRFLNCPSSLEVDRR+S   AA      +  E     + I
Sbjct  109  SSSSRGSGATDEDRASQLPLDRFLNCPSSLEVDRRISLRHAAGD-GGGENGEFSPDTQII  167

Query  617  IGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILS  796
            + + +D+   N    +I KKS  FL+KKMFVC  GFAP+PSL+D   ESR+EKL RT+L 
Sbjct  168  LSKARDLL-VNSNGTTIKKKSFKFLLKKMFVCHGGFAPAPSLKDPV-ESRIEKLFRTMLQ  225

Query  797  KKIYPQNPSRAA--SLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            KK+    PS AA  S K +LE+    +          +E+  E+ SD  +WDKTD++
Sbjct  226  KKMNNARPSNAAVSSRKYYLED--KPSGRMMIRDGHHDEEDDEKGSDRIKWDKTDTD  280



>ref|XP_010086679.1| hypothetical protein L484_000781 [Morus notabilis]
 gb|EXC35622.1| hypothetical protein L484_000781 [Morus notabilis]
Length=319

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 119/256 (46%), Gaps = 16/256 (6%)
 Frame = +2

Query  89   YYSTFASIFQNRMKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSF  268
            Y      +  N    F WMQ++   G+       P   P    GK     EE ++W    
Sbjct  49   YGHVNGQLHVNAWLIFGWMQSKLKNGRHDESSQKPNSKPVNQPGK-----EEVNEWLYGL  103

Query  269  LAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSR  448
            L IGT G ND  E  ++           E+ +Q       +   +EVG L+  L  LL +
Sbjct  104  LKIGTFGKNDLKEELQEVNLQGNSQSPSEDHDQ-------DRVSDEVGNLRDELNSLLHK  156

Query  449  KPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRC  628
            +   +  + T  +  L   L+  SSLE +R   N +   +        + R    ++ R 
Sbjct  157  QDDQESASATELEQVL---LHRQSSLETERFAGNDTQCCNESSNKSGSLRRRTSLVLSRG  213

Query  629  KDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSKKIY  808
            K V   N ++ +IGKKS SFL+KK+FVC SGF   PS +    ES ME +LR +L KKIY
Sbjct  214  KQVSMDNAKN-AIGKKSFSFLLKKVFVCGSGFPFGPSPKAPIPESIMEMILRAMLHKKIY  272

Query  809  PQNPSRAASLKRFLEN  856
            PQ+ S + S K++LEN
Sbjct  273  PQSSSPSLSAKKYLEN  288



>ref|XP_010323989.1| PREDICTED: uncharacterized protein LOC101261934 isoform X2 [Solanum 
lycopersicum]
Length=247

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 94/301 (31%), Positives = 141/301 (47%), Gaps = 70/301 (23%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGN--ND  298
            MK F+W+Q +FNG Q            TT H      ++EFSDWP   LAIGT G+  ND
Sbjct  1    MKIFSWIQTKFNGKQ------------TTYH----MLHQEFSDWPNELLAIGTFGSLKND  44

Query  299  PPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQT  478
                 +                          T EEVG+L K L  L    P  +   + 
Sbjct  45   GKLKQQDQS----------------------LTVEEVGQLHKELKHLF---PDHEESNKI  79

Query  479  NADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIG-RCKDVCEK--N  649
             ++  LD+F +C  +L  D         + + +  E+   R+   ++  R ++   K  N
Sbjct  80   GSNKDLDKFFDCLQNLVDD-------DDHRVIENKENIFKRSNSTLVHVRSQEQSSKLDN  132

Query  650  KQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDT-------FQESRMEKLLRTILSKKIY  808
              +  I KKS+S+L+KK   C +GFA +P LRD         Q+SRMEK+LR IL KKIY
Sbjct  133  MTNTGISKKSLSYLLKKTLFCSAGFA-AP-LRDNPLLPHSKIQKSRMEKILRAILHKKIY  190

Query  809  PQNPS----RAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLE  976
            PQ  S     + + KR+++N         +  ++++E       +  +WDK+DS++IVLE
Sbjct  191  PQANSPRGNGSTTRKRYIDN----TCVIESDTDQDDEAFDTTVKNGSKWDKSDSDFIVLE  246

Query  977  I  979
            I
Sbjct  247  I  247



>ref|XP_008661108.1| PREDICTED: uncharacterized protein LOC103640271 [Zea mays]
Length=186

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 101/166 (61%), Gaps = 7/166 (4%)
 Frame = +2

Query  491  PLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIG  670
            PLDRFLNCPS LEV+RR+  T+A N     +E ++    + I+ R +D+ +       I 
Sbjct  25   PLDRFLNCPSCLEVERRVVQTTATNHGGQ-EEGDLSPDTKIILNRARDLLDSGGGGGGIK  83

Query  671  KKSVSFLVKKMFVCRSGFAPSP--SLRDTFQESRMEKLLRTILSKKIYPQNPS-RAASLK  841
            ++S  FL+KKMF C  GF+ +P  SL+D   ESRMEK  RT++ KK+  ++ +  A+S K
Sbjct  84   QRSFKFLLKKMFACNGGFSAAPPRSLKDPV-ESRMEKFFRTMIGKKMNARSGNGSASSRK  142

Query  842  RFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             FLE+   +            +++ ER ++S RWD+TDSE+IVLEI
Sbjct  143  YFLED--GTKGRRRGGRRCGCQEEEEREAESCRWDRTDSEFIVLEI  186



>ref|XP_004956930.1| PREDICTED: uncharacterized protein LOC101758998 [Setaria italica]
Length=249

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 136/286 (48%), Gaps = 38/286 (13%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK F+W+ N+  G Q   R       P   +   E RN+EFSDWP S LAIGT GN    
Sbjct  1    MKIFSWVANKIGGKQEPRRSAATSTAPYRGN-VSECRNDEFSDWPQSLLAIGTFGNKQIE  59

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            E A+    N             +  D  +FT EEV  +++    LL  +   + E Q + 
Sbjct  60   EEAQSSSGNVQ-----------TVQDSVKFTEEEVDNIREEFEVLL--EGNDQAEVQGS-  105

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
                    +    +   +R+    +A         EI      II + +++    K+  +
Sbjct  106  --------HADEQVASQKRVGEHDSAKHQEQLMNKEI------IISKAREIV--GKKGGA  149

Query  665  IGKKSVSFLVKKMFVCRSGF-APSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLK  841
            I  +S++ L++ +FVC+ GF AP    R++F ++RMEKLL+ IL KKI+PQN S  A+ +
Sbjct  150  IKPRSIASLLR-LFVCKGGFTAPVLEPRNSFPQTRMEKLLKAILQKKIHPQNSSTVAT-R  207

Query  842  RFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            R L+           I E  E+   +   D  +W KTDS++IVLE+
Sbjct  208  RHLD----WKLDEKEINECLEDALSDLDDDGAKWVKTDSDFIVLEM  249



>ref|XP_010238214.1| PREDICTED: uncharacterized protein LOC100830671 isoform X3 [Brachypodium 
distachyon]
 ref|XP_010238215.1| PREDICTED: uncharacterized protein LOC100830671 isoform X3 [Brachypodium 
distachyon]
Length=248

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 140/287 (49%), Gaps = 41/287 (14%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGK-QEPRNEEFSDWPGSFLAIGTLGNNDP  301
            MK F+W+ N+  G Q  SR  +P      +     + R +EFSDWP S LAIGT GN   
Sbjct  1    MKIFSWVANKIGGKQEASR--FPASSSGPSRANVSDCRKDEFSDWPQSLLAIGTFGNKQI  58

Query  302  PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
             E A+     E +          S  D  +FT EEV K+QK    +L+ K   +GEA  +
Sbjct  59   EEVAQVHNSPEDVH---------SMQDGIKFTEEEVDKIQKEFAMILAGK--DQGEAHYS  107

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
             D       + P +  VD  ++       +Y           + II + +D     K+  
Sbjct  108  HDD------DQPKT--VDESVNEKHMDQLMYK----------KIIISKARDSL--GKKRS  147

Query  662  SIGKKSVSFLVKKMFVCRSGFAPS-PSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASL  838
            +I  +SV+ L+K + +C+ GF  + P  R +F +SR+EKLL+ IL KKI+PQN S A   
Sbjct  148  NIKPRSVASLLK-LLICKGGFTSAVPDPRSSFPQSRIEKLLKAILQKKIHPQNSS-AQGP  205

Query  839  KRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +R L+           I E  E+  R+   D  +W KTDS++IVLE+
Sbjct  206  RRHLD----WKPDEQEINECLEDALRDLDDDGAKWVKTDSDFIVLEM  248



>ref|XP_009801636.1| PREDICTED: uncharacterized protein LOC104247347 isoform X1 [Nicotiana 
sylvestris]
Length=283

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 97/287 (34%), Positives = 140/287 (49%), Gaps = 48/287 (17%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            MK FNW Q++ NG +   R         TNH   +P  EEF+DWP   LAIGT GNN   
Sbjct  1    MKIFNWFQSKNNGKK---RIHKQKSVTVTNHTLHQPCREEFNDWPIELLAIGTFGNN---  54

Query  305  ESARKPekneiiveegeeeeQCSSPD-LAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
                      +  + G    Q S PD L + TPEEVG+LQK L  LL    +      + 
Sbjct  55   ---------SLNKDFGNLNHQPSCPDHLEKLTPEEVGQLQKELKLLLCDSTSPDSAKGST  105

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
             DL   +F +C   LE D+               E+ + +    + G+ ++V  +N  + 
Sbjct  106  KDLV--KFFDCLQRLEDDK---------------ENHLKQRNSIVCGKKQEVQLEN-TNS  147

Query  662  SIGKKSVSFLVKKMFVCRSGF-APS-PSLRD-----TFQESRMEKLLRTILSKKIYPQNP  820
             I KK++SFL++K F CR  F  PS P LRD      F++ R+EK+LR I+ KKI+PQ  
Sbjct  148  GISKKTLSFLLEKAFACRGRFTVPSPPLLRDPISQSKFEKLRLEKILRAIIHKKIFPQAS  207

Query  821  SRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            S  A  K++L+N          +  + E++  E   D  +WD +DS+
Sbjct  208  SPRAVKKKYLDN-------GKIVETDSEDEAFETVKDGNKWDNSDSD  247



>ref|XP_008450944.1| PREDICTED: uncharacterized protein LOC103492380 isoform X2 [Cucumis 
melo]
Length=270

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 100/297 (34%), Positives = 146/297 (49%), Gaps = 39/297 (13%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNND--  298
            M+  NWMQ +   G+ GS++          H K  P+  EFS+W    LAIGT G+ +  
Sbjct  1    MRILNWMQGKKPSGRKGSKRTSNSINDEIVH-KTHPK--EFSNWSHVLLAIGTFGDENLN  57

Query  299  ---PPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGE  469
               P  S   P  +                 L + TPEE+  LQK    LL+        
Sbjct  58   EARPKRSQENPSSSLQQ-------------HLKDLTPEELNILQKEFNLLLAEHLK----  100

Query  470  AQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRT---IRAIIGRCKDVC  640
             Q+   L  +   +CPS++ ++R+L+  S         E+ I ++      I+ + KDV 
Sbjct  101  -QSGPTLEFEVSKHCPSNIFLNRQLTFGSETTKKELYYEELIKKSNIFQHVILSKGKDVG  159

Query  641  EKNKQHKSIGKKSVSFLVKKMFVCRSGFAP----SPSLRDTFQESRMEKLLRTILSKKIY  808
             +      IGKK++S L+KK+FVC  G AP    +P LR T  ES MEK+LRTIL KKIY
Sbjct  160  VEANDTAIIGKKTLSLLLKKIFVCGGGTAPPAVVTPPLRITTLESTMEKILRTILQKKIY  219

Query  809  PQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            P++ +   S      +K+          +E E++K ++TSD  +W +TDSEYIVLEI
Sbjct  220  PRSSNVRTS------SKKKYLRKKNKQRDENEDEKNDKTSDGSKWVQTDSEYIVLEI  270



>ref|XP_006660662.1| PREDICTED: uncharacterized protein LOC102701575 [Oryza brachyantha]
Length=255

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 92/298 (31%), Positives = 137/298 (46%), Gaps = 56/298 (19%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPV---PPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNN  295
            MK F+W+ N+  G Q  +R  +P     P   N    + R +EFSDWP S LAIGT GN 
Sbjct  1    MKIFSWVANKIGGKQEANR--FPANSSAPYRANVS--DCRKDEFSDWPQSLLAIGTFGNK  56

Query  296  DPPESARKPekneiiveegeeeeQCSSP--------DLAEFTPEEVGKLQKALTKLLSRK  451
               E A                 Q  +P        D  +FT EEV  ++K    LL+  
Sbjct  57   QIEEVA-----------------QVQNPSDNVQPVQDTIKFTEEEVDNIRKEFETLLAIN  99

Query  452  PASKGEAQTNAD-LPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRC  628
              ++ +   + D +   + ++   S +  R+L N                   R II + 
Sbjct  100  DQAEAQGSHDDDQVASQKRVDGEDSEKHGRQLINK------------------RIIISKS  141

Query  629  KDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGF-APSPSLRDTFQESRMEKLLRTILSKKI  805
            K      K+  +I  +SV+ L+K +F+C+ GF +  P  R++F ++RMEKLL+ IL KKI
Sbjct  142  KGSL--GKKGNTIKPRSVASLLK-LFMCKGGFTSVVPEPRNSFPQTRMEKLLKVILQKKI  198

Query  806  YPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            +PQN S     KR L+ K         + +   +   +   D  +W KTDSEYIVLE+
Sbjct  199  HPQNSSVLVG-KRHLDWKPEEKEINECLEDALRDLDDDDDDDGAKWVKTDSEYIVLEM  255



>gb|EEE67587.1| hypothetical protein OsJ_25119 [Oryza sativa Japonica Group]
Length=294

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 101/177 (57%), Gaps = 38/177 (21%)
 Frame = +2

Query  407  VGKLQKALTKLLSRKPASKG-------EAQTNAD--------------LPLDRFLNCPSS  523
            V KLQ+AL KLL R  ++K         A+ +AD              LPLDRFLNCPSS
Sbjct  62   VKKLQEALNKLLRRAKSTKSGSRRGSTAAEHDADERSSSSSSSGSQLLLPLDRFLNCPSS  121

Query  524  LEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKM  703
            LEVDRR++   AA+  +  D        + I+ + +D+        +I +KS  FL+KKM
Sbjct  122  LEVDRRVA---AADGEFSPD-------TQIILSKARDLLVNTNGGGAIKQKSFRFLLKKM  171

Query  704  FVCRSGFAPS----PSLRDTFQESRMEKLLRTILSKKI--YPQNPSRAASLKRFLEN  856
            FVCR GF+PS    P+L+D   ESR+EKL RT+L K++   P N + ++S K +LE+
Sbjct  172  FVCRGGFSPSPAPPPTLKDPV-ESRIEKLFRTMLHKRMNARPSNAAASSSRKYYLED  227



>dbj|BAN59748.1| early auxin response protein [Oryza sativa Indica Group]
Length=231

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 86/254 (34%), Positives = 129/254 (51%), Gaps = 52/254 (20%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPV---PPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNN  295
            MK F+W+ N+ +G Q  +R  +P     P   N    + R +EFSDWP S LAIGT GN 
Sbjct  1    MKIFSWVANKISGKQEANR--FPANSSAPYRANVS--DCRKDEFSDWPQSLLAIGTFGNK  56

Query  296  DPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQ  475
               E A+    ++ +          S  D  +FT EEV K++K    LL+ K   + EAQ
Sbjct  57   QIEEVAQVENSSDNVQ---------SVQDTVKFTEEEVDKIRKEFETLLAIK--DQAEAQ  105

Query  476  TNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQ  655
             + D            + + +R             D ++ ++ IR +I + + +  K+K 
Sbjct  106  RSHD---------DDQVGLQKR------------ADGEDNEKHIRQLINK-RIIVSKSKN  143

Query  656  HKSIGKK-------SVSFLVKKMFVCRSGF-APSPSLRDTFQESRMEKLLRTILSKKIYP  811
              S+GKK       SV+ L+K +F+C+ GF +  P  R+TF +SRMEKLL+ IL KKI+P
Sbjct  144  --SLGKKGNTLKPRSVASLLK-LFMCKGGFTSVVPEPRNTFPQSRMEKLLKAILQKKIHP  200

Query  812  QNPSRAASLKRFLE  853
            QN S   + KR L+
Sbjct  201  QNSSTLVA-KRHLD  213



>gb|EAZ44876.1| hypothetical protein OsJ_29516 [Oryza sativa Japonica Group]
Length=260

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 86/254 (34%), Positives = 129/254 (51%), Gaps = 52/254 (20%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPV---PPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNN  295
            MK F+W+ N+ +G Q  +R  +P     P   N    + R +EFSDWP S LAIGT GN 
Sbjct  1    MKIFSWVANKISGKQEANR--FPANSSAPYRANVS--DCRKDEFSDWPQSLLAIGTFGNK  56

Query  296  DPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQ  475
               E A+    ++ +          S  D  +FT EEV K++K    LL+ K   + EAQ
Sbjct  57   QIEEVAQVENSSDNVQ---------SVQDTVKFTEEEVDKIRKEFETLLAIK--DQAEAQ  105

Query  476  TNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQ  655
             + D            + + +R             D ++ ++ IR +I + + +  K+K 
Sbjct  106  RSHD---------DDQVGLQKR------------ADGEDNEKHIRQLINK-RIIVSKSKN  143

Query  656  HKSIGKK-------SVSFLVKKMFVCRSGF-APSPSLRDTFQESRMEKLLRTILSKKIYP  811
              S+GKK       SV+ L+K +F+C+ GF +  P  R+TF +SRMEKLL+ IL KKI+P
Sbjct  144  --SLGKKGNTLKPRSVASLLK-LFMCKGGFTSVVPEPRNTFPQSRMEKLLKAILQKKIHP  200

Query  812  QNPSRAASLKRFLE  853
            QN S   + KR L+
Sbjct  201  QNSSTLVA-KRHLD  213



>gb|EAZ09249.1| hypothetical protein OsI_31522 [Oryza sativa Indica Group]
Length=260

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 86/254 (34%), Positives = 128/254 (50%), Gaps = 52/254 (20%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPV---PPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNN  295
            MK F+W+ N+ +G Q  +R  +P     P   N    + R +EFSDWP S LAIGT GN 
Sbjct  1    MKIFSWVANKISGKQEANR--FPANSSAPYRANVS--DCRKDEFSDWPQSLLAIGTFGNK  56

Query  296  DPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQ  475
               E A+    ++ +          S  D  +FT EEV K++K    LL+ K   + EAQ
Sbjct  57   QIEEVAQVENSSDNVQ---------SVQDTVKFTEEEVDKIRKEFETLLAIK--DQAEAQ  105

Query  476  TNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQ  655
             + D            + + +R             D ++ ++ IR +I + + +  K+K 
Sbjct  106  RSHD---------DDQVGLQKR------------ADGEDNEKHIRQLINK-RIIVSKSKN  143

Query  656  HKSIGKK-------SVSFLVKKMFVCRSGF-APSPSLRDTFQESRMEKLLRTILSKKIYP  811
              S+GKK       SV+ L+K  F+C+ GF +  P  R+TF +SRMEKLL+ IL KKI+P
Sbjct  144  --SLGKKGNTLKPRSVASLLK-FFMCKGGFTSVVPEPRNTFPQSRMEKLLKAILQKKIHP  200

Query  812  QNPSRAASLKRFLE  853
            QN S   + KR L+
Sbjct  201  QNSSTLVA-KRHLD  213



>ref|XP_010238213.1| PREDICTED: uncharacterized protein LOC100830671 isoform X2 [Brachypodium 
distachyon]
Length=325

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 111/237 (47%), Gaps = 40/237 (17%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVP---PPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNN  295
            MK F+W+ N+  G Q  SR  +P     P   N    + R +EFSDWP S LAIGT GN 
Sbjct  1    MKIFSWVANKIGGKQEASR--FPASSSGPSRAN--VSDCRKDEFSDWPQSLLAIGTFGNK  56

Query  296  DPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQ  475
               E A+     E +          S  D  +FT EEV K+QK    +L+ K   +    
Sbjct  57   QIEEVAQVHNSPEDVH---------SMQDGIKFTEEEVDKIQKEFAMILAGKDQGEAHYS  107

Query  476  TNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQ  655
             + D P            VD  ++       +Y           + II + +D     K+
Sbjct  108  HDDDQPK----------TVDESVNEKHMDQLMYK----------KIIISKARD--SLGKK  145

Query  656  HKSIGKKSVSFLVKKMFVCRSGFAPS-PSLRDTFQESRMEKLLRTILSKKIYPQNPS  823
              +I  +SV+ L+K + +C+ GF  + P  R +F +SR+EKLL+ IL KKI+PQN S
Sbjct  146  RSNIKPRSVASLLK-LLICKGGFTSAVPDPRSSFPQSRIEKLLKAILQKKIHPQNSS  201



>ref|XP_010238212.1| PREDICTED: uncharacterized protein LOC100830671 isoform X1 [Brachypodium 
distachyon]
Length=326

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 75/235 (32%), Positives = 110/235 (47%), Gaps = 36/235 (15%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGK-QEPRNEEFSDWPGSFLAIGTLGNNDP  301
            MK F+W+ N+  G Q  SR  +P      +     + R +EFSDWP S LAIGT GN   
Sbjct  1    MKIFSWVANKIGGKQEASR--FPASSSGPSRANVSDCRKDEFSDWPQSLLAIGTFGNKQI  58

Query  302  PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
             E A+     E +          S  D  +FT EEV K+QK    +L+ K   +     +
Sbjct  59   EEVAQVHNSPEDVH---------SMQDGIKFTEEEVDKIQKEFAMILAGKDQGEAHYSHD  109

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
             D P            VD  ++       +Y           + II + +D     K+  
Sbjct  110  DDQPK----------TVDESVNEKHMDQLMYK----------KIIISKARD--SLGKKRS  147

Query  662  SIGKKSVSFLVKKMFVCRSGFAPS-PSLRDTFQESRMEKLLRTILSKKIYPQNPS  823
            +I  +SV+ L+K + +C+ GF  + P  R +F +SR+EKLL+ IL KKI+PQN S
Sbjct  148  NIKPRSVASLLK-LLICKGGFTSAVPDPRSSFPQSRIEKLLKAILQKKIHPQNSS  201



>ref|XP_010230135.1| PREDICTED: uncharacterized protein LOC100823948 [Brachypodium 
distachyon]
Length=194

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 79/226 (35%), Positives = 109/226 (48%), Gaps = 45/226 (20%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            M   NW ++RF+  +    +G+ V  P     +++ R EE  +  G  L+IGT G     
Sbjct  1    MGIINWGRSRFSAKRES--RGFDVGVP-----EEQWRPEEDQE-TGGLLSIGTFGEKKDA  52

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLL--SRKPASKGEAQT  478
                KP   +                L EFT EE  KLQ AL KLL  +R  +S      
Sbjct  53   ----KPTTLDQ---------------LPEFTIEEAEKLQDALEKLLLRARSKSSARRGDD  93

Query  479  NADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVC------  640
            +  LPLDR LNCPSSLEVDRR+        L    +DE   T + ++   KD+       
Sbjct  94   SLSLPLDRSLNCPSSLEVDRRV--------LRQKHDDEGGDT-KIVLTMAKDLLASCSGS  144

Query  641  EKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKL  778
             +N +   I   S  FL++KM VC  GFAP+PS++D   ESRM+K+
Sbjct  145  NRNNKGAGIKNNSFKFLLRKMLVCNGGFAPAPSMKDPV-ESRMDKV  189



>ref|XP_006651487.1| PREDICTED: uncharacterized protein LOC102712432 [Oryza brachyantha]
Length=295

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 92/259 (36%), Positives = 123/259 (47%), Gaps = 48/259 (19%)
 Frame = +2

Query  257  PGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTK  436
            P    +IGTLGN+  PE   +                       EF+ EEV KLQ AL +
Sbjct  67   PSHLFSIGTLGNDQLPEEEEEDL--------------------PEFSVEEVRKLQDALAR  106

Query  437  LLSRKPASKGEAQT-----------NADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCD  583
            LL R  + K EA             ++ LPLD+FLNCPSSLE+DRR           D  
Sbjct  107  LLLRARSKKSEAVAAVATAAGGAGADSGLPLDKFLNCPSSLELDRRAQRDHGGGLSPD--  164

Query  584  EDEIDRTIRAIIGRCKD-VCEKNKQHKS-IGKKSVSFLVKKMFVCRSG-FAPSPSLRDTF  754
                    + I+ + KD + + N    S I  KS  FL+KK+ VC  G F P+PSL+D  
Sbjct  165  -------TKMILTKAKDLLVDGNTTTTSNIKNKSFKFLLKKVCVCHGGCFVPAPSLKDP-  216

Query  755  QESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDS  934
             ES MEK LRT+L +K   +  S  A+   FLE K+            +++   +   + 
Sbjct  217  TESTMEKFLRTVLGRKFSARPSSSPAARAYFLEGKKARGDRRRRRHRGDKDDDDDEEENK  276

Query  935  G----RWDKTDSEYIVLEI  979
            G    +WD+TDSEYIVLEI
Sbjct  277  GGESCKWDRTDSEYIVLEI  295



>gb|EMT28023.1| hypothetical protein F775_01939 [Aegilops tauschii]
Length=297

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 102/318 (32%), Positives = 146/318 (46%), Gaps = 54/318 (17%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVP---PPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNN  295
            MK F+WM N+ +  Q  SR  +P     P  +N    + RN+EFSDWP S LAIGT GN 
Sbjct  1    MKIFSWMANKISRKQEASR--FPASSSGPSRSN--VPDCRNDEFSDWPQSLLAIGTFGNK  56

Query  296  DPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPA-----S  460
               E A+  + +E            S  D  +FT EEV ++QK    +L+ K       S
Sbjct  57   QIEEVAQVQDTSEDGQ---------SMQDAIKFTEEEVDRIQKEFAMILASKDQAEAHDS  107

Query  461  KGEAQTNADLPLDRFLNCPSSLE-VDRRLSNTSAANSL-----------------YDCDE  586
              + Q  +   +D  +N     + +++++  + A +SL                  D DE
Sbjct  108  HDDEQVTSHKDVDESINEKHRDQLLNKKVVISKAKDSLGKKASTLKPRSKELFPHKDVDE  167

Query  587  DEIDRTIRAIIGRCKDVCEKNKQHKSIGKK-------SVSFLVKKMFVCRSGFAPSPSLR  745
              I+   R  +   K V  K K   S+GKK       SV+ L K +       A  P  R
Sbjct  168  -SINEKHRDQLLNKKVVISKAKD--SLGKKASTLKPRSVASLFKLLMRKGGCAAAVPDPR  224

Query  746  DTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrert  925
             +  +SRMEKLL+ IL KKI+PQN S A   +R L+           I E  E+  R+  
Sbjct  225  SSCPQSRMEKLLKAILQKKIHPQNSS-ALVPRRHLD----WKPDEQEINECLEDALRDLD  279

Query  926  SDSGRWDKTDSEYIVLEI  979
             D  +W KTDS++IVLE+
Sbjct  280  DDGAKWVKTDSDFIVLEM  297



>ref|XP_003595336.1| hypothetical protein MTR_2g042670 [Medicago truncatula]
 gb|AES65587.1| hypothetical protein MTR_2g042670 [Medicago truncatula]
Length=237

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 123/295 (42%), Gaps = 68/295 (23%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            M  F WMQNR NG      K  P     T+H   E   +EFSDW  + LAIGTLGNN+  
Sbjct  1    MNIFKWMQNRLNGTNG---KMKPSSISATHHMLNETYKQEFSDWDHAILAIGTLGNNNLN  57

Query  305  ESARKPekneiiveegeeeeQCSSPDLA-EFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
            E++ K    E            S  D   EF+ EEVG  Q  L                 
Sbjct  58   ENSNKSIDEEDSH---------SFQDFTHEFSFEEVGNFQNELK----------------  92

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
                    +N   S        N   +N+L              I  R +   +K+ +++
Sbjct  93   --------MNLEES-------GNFYPSNNL--------------ICNRGRKSLDKSNKNE  123

Query  662  SIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQ-ESRMEKLLRTILSKKIYPQNPSRAASL  838
             +  +S+SFL+KK+FVC     P+   +D    ESRMEK+LR IL KKI+P        +
Sbjct  124  -VSNQSLSFLLKKIFVCGGELPPTSVFKDPLSTESRMEKILRAILHKKIHPHGSCSTTFV  182

Query  839  KRFLENkrt--------saatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             ++LEN                    E EEE K        +W KT+SEYIVLEI
Sbjct  183  NKYLENNSKPEYDYEDEDEDEDEYEYEYEEELKNSVVEKGCKWVKTNSEYIVLEI  237



>ref|XP_002462450.1| hypothetical protein SORBIDRAFT_02g025775 [Sorghum bicolor]
 gb|EER98971.1| hypothetical protein SORBIDRAFT_02g025775 [Sorghum bicolor]
Length=263

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 75/242 (31%), Positives = 112/242 (46%), Gaps = 28/242 (12%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            ++ F+W+ N+  G Q   R   P   PT  +   E RN+EFSDWP S LAIGT GN    
Sbjct  1    LQIFSWVANKIGGKQEPKRSPAPYRKPTCGN-VSECRNDEFSDWPQSLLAIGTFGNKQLE  59

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            E       +             ++ D A+FT EEV  +++    LL      +G AQ  A
Sbjct  60   EEVASESSSANAQ---------TTQDPAKFTEEEVDNIRREFEVLL------QGNAQAEA  104

Query  485  DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKS  664
                    +C    +V     +    N+     E  ++R +  II + +++  K K  K 
Sbjct  105  QG------SCEDE-QVAASKEHDGEDNNEKQRREQLMNREM--IISKARELVGKKKSAKL  155

Query  665  IGKKSVSFLVKKMFVCRSGFA-PSPSLRDTFQESRMEKLLRTILSKKIYPQNPSRAASLK  841
              +  VS L  ++  C+ GF  P    R+ F +SRMEKLL+ IL KKI+PQN +  A+ +
Sbjct  156  KPRSMVSLL--RLLACKGGFTTPVLEPRNAFPQSRMEKLLKAILQKKIHPQNSNTVATRR  213

Query  842  RF  847
              
Sbjct  214  HL  215



>ref|XP_009383154.1| PREDICTED: uncharacterized protein LOC103970971 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 115/236 (49%), Gaps = 19/236 (8%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDPP  304
            M+  +W+QN+FN  Q   RK +     +T+        +E  +   + LAIGTLG+    
Sbjct  1    MRILSWVQNKFNSSQ--ERKRFDAGSSSTSRASIPDVRKELGNCLHTLLAIGTLGDAHTK  58

Query  305  ESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNA  484
            E  ++ +   +           +S DL  FT EE  +L K L KLL+RK  S       A
Sbjct  59   EDPQRHDDPYLD----------TSEDLPCFTIEEAKELHKELAKLLTRKLKSSAHGSEIA  108

Query  485  -DLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
             D   +RFL      E D+  S     +   +C +   D   R I+ + +D    N  + 
Sbjct  109  NDDRANRFLGRSLRPEADKATSFLLENSEDVNCGDLSPD--TRIILHKLEDALSCN--YT  164

Query  662  SIGKKSVSFLVKKMFVCRSGFA-PSPSLR-DTFQESRMEKLLRTILSKKIYPQNPS  823
            +I K+S+SFL+KK FVC  GFA  + S +     E  +EK+L+ IL+KKIYPQ+ +
Sbjct  165  AIKKESLSFLLKKRFVCGRGFAQQTRSFKGGLIAEPSVEKILKAILTKKIYPQSSA  220



>ref|XP_006452829.1| hypothetical protein CICLE_v10010597mg [Citrus clementina]
 gb|ESR66069.1| hypothetical protein CICLE_v10010597mg [Citrus clementina]
Length=265

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 86/289 (30%), Positives = 129/289 (45%), Gaps = 62/289 (21%)
 Frame = +2

Query  143  MQNRFNGGQAGSRKGYPVPPPTTNH---GKQEPRNEEFSDWPGSFLAIGTLGNNDPPESA  313
            MQN+  GG   S+K   +   + N     ++E   EEF +W    LAIGT+GN +  +  
Sbjct  1    MQNKL-GGIHSSKKPDLLSSLSANSRDCVQKESCKEEFVEWTHGLLAIGTIGNVNLKD--  57

Query  314  RKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTNADLP  493
                          +  Q  +PD      EEV  LQ  +  +L     S+ + +T  +  
Sbjct  58   -----------LDHDSVQDPTPD------EEVATLQNEVNLILHEPEDSEVDDETTIN--  98

Query  494  LDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVC-EKNKQHKSIG  670
                         D     T+AA                A     KD+  +  K    I 
Sbjct  99   -------------DSNPRTTTAA----------------AFSSAGKDISFDSTKSTGVIS  129

Query  671  KKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRMEKLLRTILSK--KIYPQNPSRAASLKR  844
             KS+SFL+KKM  CRSGFAP+PSL+D   ES+MEK++R IL K  KIYPQ+   A S K+
Sbjct  130  SKSLSFLLKKMIACRSGFAPAPSLKDPVSESQMEKIMRAILHKKMKIYPQSSGTALSSKK  189

Query  845  FLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI*IAV  991
            +L+++  +   +    +  E+ +     +  +W KTDSE   L +  A+
Sbjct  190  YLKSRTVNTPESANEDDFNEDAE-----NGSKWVKTDSECKFLYVSFAI  233



>ref|XP_008652771.1| PREDICTED: uncharacterized protein LOC103632815 [Zea mays]
 tpg|DAA61648.1| TPA: hypothetical protein ZEAMMB73_993217 [Zea mays]
Length=255

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 89/293 (30%), Positives = 139/293 (47%), Gaps = 46/293 (16%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGK---QEPRNEEFSDWPGSFLAIGTLGNN  295
            MK F+W+ N+  G Q         P  +  H +    E RN+EFSDWP S LAIGT GN 
Sbjct  1    MKIFSWVANKIGGKQE--------PKRSAAHYRGNVSECRNDEFSDWPQSLLAIGTFGNR  52

Query  296  DPPESARKPekneiiveegeeeeQCSSPDLAEFTPEE-VGKLQKALTKLLSRKPASKGEA  472
               E   +     +           ++ D A+FT EE    +++ L  LL +   + G  
Sbjct  53   QLEEGVVETSSGNVQ----------AAQDPAKFTEEEEADSIRRELEVLLLQGNNNNG-G  101

Query  473  QTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAII--GRCKDVCEK  646
            Q  A            S   +RR    +      +C +++   +   +    R +++   
Sbjct  102  QAEAQ----------GSRGDERR--QVAWKEHDGECSKEKQPTSGEMVTSKARAREMV-A  148

Query  647  NKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSL--RDTFQESRMEKLLRTILSKKIYPQNP  820
             K+  ++  +SV+ L++ +  C+ GFA +P L  R  F +SRMEKLL+ IL KKI+PQNP
Sbjct  149  GKKRSTLKPRSVASLLR-LLACKGGFA-TPVLEPRSPFPQSRMEKLLKAILEKKIHPQNP  206

Query  821  SRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
            S AA+ +  L+           I E  ++  R+   D  +W KTDS++IVLE+
Sbjct  207  STAAARRHQLD----WKLDEKEIDECLDDALRDLDDDGAKWVKTDSDFIVLEM  255



>ref|XP_008450943.1| PREDICTED: uncharacterized protein LOC103492380 isoform X1 [Cucumis 
melo]
Length=299

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 100/326 (31%), Positives = 145/326 (44%), Gaps = 68/326 (21%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNND--  298
            M+  NWMQ +   G+ GS++          H K  P+  EFS+W    LAIGT G+ +  
Sbjct  1    MRILNWMQGKKPSGRKGSKRTSNSINDEIVH-KTHPK--EFSNWSHVLLAIGTFGDENLN  57

Query  299  ---PPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGE  469
               P  S   P  +                 L + TPEE+  LQK    LL+      G 
Sbjct  58   EARPKRSQENPSSSLQQ-------------HLKDLTPEELNILQKEFNLLLAEHLKQSGP  104

Query  470  AQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRT---IRAIIGRCKDVC  640
                  L  +   +CPS++ ++R+L+  S         E+ I ++      I+ + KDV 
Sbjct  105  T-----LEFEVSKHCPSNIFLNRQLTFGSETTKKELYYEELIKKSNIFQHVILSKGKDVG  159

Query  641  EKNKQHKSIGKKSVSFLVKKMFVCRSGFAP----SPSLRDTFQESRMEK-----------  775
             +      IGKK++S L+KK+FVC  G AP    +P LR T  ES MEK           
Sbjct  160  VEANDTAIIGKKTLSLLLKKIFVCGGGTAPPAVVTPPLRITTLESTMEKVESRTHINAQI  219

Query  776  ------------------LLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeee  901
                              +LRTIL KKIYP++ +   S      +K+          +E 
Sbjct  220  FDLNFGNLILISISGCKQILRTILQKKIYPRSSNVRTS------SKKKYLRKKNKQRDEN  273

Query  902  eekkrertSDSGRWDKTDSEYIVLEI  979
            E++K ++TSD  +W +TDSEYIVLEI
Sbjct  274  EDEKNDKTSDGSKWVQTDSEYIVLEI  299



>gb|KDO73859.1| hypothetical protein CISIN_1g041375mg [Citrus sinensis]
Length=233

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 84/272 (31%), Positives = 116/272 (43%), Gaps = 74/272 (27%)
 Frame = +2

Query  221  KQEPRNEEFSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTP  400
            ++E   EEF +W    LAIGT+GN +  +                +  Q  +PD      
Sbjct  17   EKESCKEEFVEWTHGLLAIGTIGNVNLKD-------------LDHDSVQDPTPD------  57

Query  401  EEVGKLQKALTKLLSRKPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDC  580
            EEV  LQ  +  +L     S+ + +T  +               D     T+AA      
Sbjct  58   EEVATLQNEVNLILHEPEDSEVDDETTIN---------------DSNPRTTTAA------  96

Query  581  DEDEIDRTIRAIIGRCKDVC-EKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQ  757
                      A     KD+  +  K    I  KS+SFL+KKM  CRSGFAP+PSL+D   
Sbjct  97   ----------AFSSSGKDISFDSTKSPGVISSKSLSFLLKKMIACRSGFAPAPSLKDPVS  146

Query  758  ESRMEKLLRTILSK--KIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSD  931
            ES+MEK++R IL K  KIYPQ+   A S K++L++      T        E+   E   +
Sbjct  147  ESQMEKIMRAILHKKMKIYPQSSGTALSSKKYLKS-----RTVNTPESANEDDFNEDAEN  201

Query  932  SGRWDK----------------TDSEYIVLEI  979
              +W K                TDSEYIVLEI
Sbjct  202  GSKWVKTDSECKFLYVSFAIKITDSEYIVLEI  233



>ref|XP_004488128.1| PREDICTED: uncharacterized protein LOC101503007 [Cicer arietinum]
Length=218

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 68/246 (28%), Positives = 102/246 (41%), Gaps = 66/246 (27%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQEPRNEEFSDWPGSF-LAIGTLGNNDP  301
            MKFF WMQNR N     + K  P     T++   +   +EF+D P +  LAIGT GN + 
Sbjct  1    MKFFKWMQNRLN---VSNEKKKPSSVSATHYMVNDTNKQEFNDLPQALVLAIGTFGNYNL  57

Query  302  PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
             E + K    E             SP   + + EEVG     L  +L             
Sbjct  58   KEDSNKSIAEE------------ESPSFHDCSFEEVGNFHNELNIIL-------------  92

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHK  661
                                             +E+  + +   I  + K+  +K+K   
Sbjct  93   ---------------------------------EENNFNLSNNLIYNKGKECLDKSKN--  117

Query  662  SIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQ-ESRMEKLLRTILSKKIYPQNPSRAASL  838
             + KK+++F +K MFVC  G  P+P  +D    ESRMEK++R +L KKI+P        +
Sbjct  118  GVSKKALTFFLK-MFVCGGGLPPTPLFKDPLSIESRMEKIMRAVLHKKIHPHGSCSTTFV  176

Query  839  KRFLEN  856
            K++LEN
Sbjct  177  KKYLEN  182



>ref|XP_009117564.1| PREDICTED: uncharacterized protein LOC103842664 isoform X1 [Brassica 
rapa]
Length=174

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 69/111 (62%), Gaps = 20/111 (18%)
 Frame = +2

Query  662  SIGKK-SVSFLVKKMFVCRSGFAPSPSL----RDTFQESRMEKLLRTILSKKIYPQNPSR  826
            SIGKK S+SFL+KKMFVC SGF   P L    RD+   +RMEK+LRTIL+KKI+PQ  + 
Sbjct  79   SIGKKKSISFLLKKMFVCTSGFKTPPPLLDLSRDSLPNTRMEKMLRTILNKKIHPQRSNA  138

Query  827  AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
             A  K++LEN +      +++             D  +W KTDSEYIVLE+
Sbjct  139  IA--KKYLENHKIIDEARSSV-------------DVKKWVKTDSEYIVLEM  174



>ref|XP_008460313.1| PREDICTED: uncharacterized protein LOC103499172 [Cucumis melo]
Length=232

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 116/249 (47%), Gaps = 39/249 (16%)
 Frame = +2

Query  125  MKFFNWMQNRFNGGQAGSRKG-YPVPPPTTNHGKQEPRNEEFSDWPGSFLAIGTLGNNDP  301
            MK  +WMQ++  G      KG Y    P+T    ++P  E  +  P   LAIGT GNN  
Sbjct  1    MKLLSWMQSKLQGKVKFQNKGSYNSSNPST---IEQPAEESSASLPLGLLAIGTFGNNTN  57

Query  302  PESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQTN  481
                 K +    +++      +  + D  + + ++V +L++ LTKL           Q N
Sbjct  58   DVKVLKTDVENAVIDAKSTSNE--TDDDNDSSLKDVPELEEELTKLW----------QQN  105

Query  482  ADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQH-  658
            +                       S        +E  + + I  ++   +   EKN    
Sbjct  106  SQFR-----------------EEESDDFDDDQTEEQVVKKNIGLVVREWQGDVEKNNDPP  148

Query  659  KSIGKKSVSFLVKKMFVCRSGFAPSP-----SLRDTFQESRMEKLLRTILSKKIYPQNPS  823
             SI K+SV+FLVKK+F+C SGFAP P     +  D  Q++ M+K+LR +L KKIYP+N S
Sbjct  149  ISIVKRSVTFLVKKIFICGSGFAPLPPSPPPNFMDRPQDATMKKILRMMLEKKIYPKNSS  208

Query  824  RAASLKRFL  850
            + ASLKRFL
Sbjct  209  QMASLKRFL  217



>ref|XP_010462785.1| PREDICTED: uncharacterized protein LOC104743395 [Camelina sativa]
Length=273

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 67/112 (60%), Gaps = 20/112 (18%)
 Frame = +2

Query  662  SIGKK-SVSFLVKKMFVCRSGFAPSPSLR-----DTFQESRMEKLLRTILSKKIYPQNPS  823
            +IGKK S+SFL+KKMFVC SGF   P L      DT   +RMEK+LRTIL+KKI+PQ  +
Sbjct  176  TIGKKKSLSFLLKKMFVCTSGFKTPPHLLDLSRGDTMPNTRMEKMLRTILNKKIHPQRSN  235

Query  824  RAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
              A  K++LEN       A +              ++ +W KTDSEYIVLE+
Sbjct  236  SIA--KKYLENNHKIIDEARSSV------------EANKWVKTDSEYIVLEM  273



>ref|XP_010477114.1| PREDICTED: uncharacterized protein LOC104756254 isoform X1 [Camelina 
sativa]
Length=175

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 67/112 (60%), Gaps = 20/112 (18%)
 Frame = +2

Query  662  SIGKK-SVSFLVKKMFVCRSGFAPSPSLR-----DTFQESRMEKLLRTILSKKIYPQNPS  823
            +IGKK S+SFL+KKMFVC SGF   P L      D+   +RMEK+LRTIL+KKI+PQ  +
Sbjct  78   TIGKKKSLSFLLKKMFVCTSGFKTPPHLLDLSRGDSMPNTRMEKMLRTILNKKIHPQRSN  137

Query  824  RAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYIVLEI  979
              A  K++LEN       A +              ++ +W KTDSEYIVLE+
Sbjct  138  SIA--KKYLENNHKIIDEARSSV------------EANKWVKTDSEYIVLEM  175



>gb|EYU25842.1| hypothetical protein MIMGU_mgv1a022105mg, partial [Erythranthe 
guttata]
Length=220

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 102/219 (47%), Gaps = 46/219 (21%)
 Frame = +2

Query  239  EEFSDWPGSFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKL  418
            E +SDWP   LAIGTLGN+D              +      E  +S     F  EE  + 
Sbjct  8    EVYSDWPNGLLAIGTLGNSDK-------------LSVHANNENTASQVQDNFEEEEEEEE  54

Query  419  QKALTKLLSRKPASKGEAQTNADLPLDR---FLNCPSSLEVDRRLSNTSAANSLYDCDED  589
            Q+ + K L            N  + LDR   FL+C  S E++ R      A  L   ++ 
Sbjct  55   QQVIDKEL--------RLLLNNHISLDREKLFLDC--SREIEER------AVHLLANEDA  98

Query  590  EIDRTIRAIIGR-CKDV-------CEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLR  745
             I RTI + + +  KD           NK+   IGKKS+SFL+KK  +CR GF       
Sbjct  99   RIQRTISSTVNKGAKDARLNNNNNNNNNKRKNGIGKKSISFLIKKALLCRGGFVLRDPHP  158

Query  746  DT--FQESRMEKLLRTILSKKIYPQNPSRAASLKRFLEN  856
            DT     SR++K+LR +L KKIYPQ P+     K++L+N
Sbjct  159  DTTKVDNSRLDKILRALLHKKIYPQRPTS----KKYLDN  193



>ref|XP_009117565.1| PREDICTED: uncharacterized protein LOC103842664 isoform X2 [Brassica 
rapa]
Length=168

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 63/105 (60%), Gaps = 20/105 (19%)
 Frame = +2

Query  662  SIGKK-SVSFLVKKMFVCRSGFAPSPSL----RDTFQESRMEKLLRTILSKKIYPQNPSR  826
            SIGKK S+SFL+KKMFVC SGF   P L    RD+   +RMEK+LRTIL+KKI+PQ  + 
Sbjct  79   SIGKKKSISFLLKKMFVCTSGFKTPPPLLDLSRDSLPNTRMEKMLRTILNKKIHPQRSNA  138

Query  827  AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
             A  K++LEN +      +++             D  +W KTDSE
Sbjct  139  IA--KKYLENHKIIDEARSSV-------------DVKKWVKTDSE  168



>ref|XP_002890319.1| hypothetical protein ARALYDRAFT_472133 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66578.1| hypothetical protein ARALYDRAFT_472133 [Arabidopsis lyrata subsp. 
lyrata]
Length=173

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 76/146 (52%), Gaps = 28/146 (19%)
 Frame = +2

Query  542  LSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKK-SVSFLVKKMFVCRS  718
            L+  +  N+L   +E+E D +   +     DV        +IGKK S+SFL+KKMFVC S
Sbjct  46   LAIGTLGNNLCPKEEEETDSSKLDLTAVNTDV--------TIGKKKSLSFLLKKMFVCTS  97

Query  719  GFAPSPSLR-----DTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatat  883
            GF   P L      D+   +RMEK+LRTIL+KKI+PQ  +  A  K++LEN       A 
Sbjct  98   GFKTPPPLLDLSRGDSLHNTRMEKMLRTILNKKIHPQRSNSIA--KKYLENHHKIVDEAR  155

Query  884  aiaeeeeekkrertSDSGRWDKTDSE  961
            +              D+ +W KTDSE
Sbjct  156  SSV------------DANKWVKTDSE  169



>emb|CDY21681.1| BnaA09g44320D [Brassica napus]
Length=190

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 63/105 (60%), Gaps = 20/105 (19%)
 Frame = +2

Query  662  SIGKK-SVSFLVKKMFVCRSGFAPSPSL----RDTFQESRMEKLLRTILSKKIYPQNPSR  826
            SIGKK S+SFL+KKMFVC SGF   P L    RD+   +RMEK+LRTIL+KKI+PQ  + 
Sbjct  96   SIGKKKSISFLLKKMFVCTSGFKTPPPLLDLSRDSLPNTRMEKMLRTILNKKIHPQRSNA  155

Query  827  AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
             A  K++LEN +      +++             D  +W KTDSE
Sbjct  156  IA--KKYLENHKIIDEARSSV-------------DVKKWVKTDSE  185



>ref|XP_010498321.1| PREDICTED: uncharacterized protein LOC104776025 [Camelina sativa]
Length=173

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 77/146 (53%), Gaps = 28/146 (19%)
 Frame = +2

Query  542  LSNTSAANSLYDCDEDEIDRTIRAIIGRCKDVCEKNKQHKSIGKK-SVSFLVKKMFVCRS  718
            L+  +  N++   +E+E+  + + +     DV        +IGKK S+SFL+KKMFVC S
Sbjct  46   LAIGTLGNNICPREEEEVTESSKDLTAVNTDV--------TIGKKKSLSFLLKKMFVCTS  97

Query  719  GFAPSPSLR-----DTFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatat  883
            GF   P L      DT   +RMEK+LRTIL+KKI+PQ  +  A  K++LEN       A 
Sbjct  98   GFKTPPHLLDLSRGDTMPNTRMEKMLRTILNKKIHPQRSNSIA--KKYLENNHKIIDEAR  155

Query  884  aiaeeeeekkrertSDSGRWDKTDSE  961
            +              ++ +W KTDSE
Sbjct  156  SSV------------EANKWVKTDSE  169



>emb|CDY50636.1| BnaC06g24290D [Brassica napus]
Length=153

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 69/123 (56%), Gaps = 22/123 (18%)
 Frame = +2

Query  593  IDRTIRAIIGRCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLRDTFQESRME  772
            ++RTI  I+GRCK +  ++   K   KK +S L            P+PSLRDTFQESRME
Sbjct  1    MERTISVILGRCKAISTESSNKK--KKKGLSPL------------PNPSLRDTFQESRME  46

Query  773  KLLRTILSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKT  952
            KLLR +L KKI  Q  S+  S KR++E+              + E++  R+SD  +W KT
Sbjct  47   KLLRVMLHKKINAQASSKQTSTKRYVED--------KQQLSLKNEEEEGRSSDGSKWVKT  98

Query  953  DSE  961
            DS+
Sbjct  99   DSD  101



>emb|CDX81915.1| BnaC08g36860D [Brassica napus]
Length=192

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 63/105 (60%), Gaps = 20/105 (19%)
 Frame = +2

Query  662  SIGKK-SVSFLVKKMFVCRSGFAPSPSL----RDTFQESRMEKLLRTILSKKIYPQNPSR  826
            SIGKK S+SFL+KKMFVC SGF   P L    RD+   +RMEK+LRTIL+KKI+PQ  + 
Sbjct  96   SIGKKKSLSFLLKKMFVCTSGFKTPPPLLDLSRDSLPNTRMEKMLRTILNKKIHPQRSNA  155

Query  827  AASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
             A  K++LEN +      +++             D+ +W  TDSE
Sbjct  156  IA--KKYLENHKIIDEARSSV-------------DAKKWVNTDSE  185



>ref|NP_001117311.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE29804.1| uncharacterized protein AT1G19115 [Arabidopsis thaliana]
Length=174

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 62/118 (53%), Gaps = 19/118 (16%)
 Frame = +2

Query  626  CKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLR-----DTFQESRMEKLLRTI  790
             KD+   N       KKS+SFL+KKMFVC SGF   P L      D+   +RMEK+LRTI
Sbjct  69   SKDITPVNTDVTIGKKKSLSFLLKKMFVCTSGFKTPPPLLDLSRGDSLHNTRMEKMLRTI  128

Query  791  LSKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEY  964
            L+KKI+PQ  +  A  K++LE+       A +              D+ +W KTDSE 
Sbjct  129  LNKKIHPQRSNSIA--KKYLESNHKIMDEARSSV------------DANKWVKTDSEL  172



>ref|XP_010477117.1| PREDICTED: uncharacterized protein LOC104756254 isoform X3 [Camelina 
sativa]
Length=172

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 62/108 (57%), Gaps = 20/108 (19%)
 Frame = +2

Query  662  SIGKK-SVSFLVKKMFVCRSGFAPSPSLR-----DTFQESRMEKLLRTILSKKIYPQNPS  823
            +IGKK S+SFL+KKMFVC SGF   P L      D+   +RMEK+LRTIL+KKI+PQ  +
Sbjct  78   TIGKKKSLSFLLKKMFVCTSGFKTPPHLLDLSRGDSMPNTRMEKMLRTILNKKIHPQRSN  137

Query  824  RAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYI  967
              A  K++LEN       A +              ++ +W KTDSE I
Sbjct  138  SIA--KKYLENNHKIIDEARSSV------------EANKWVKTDSECI  171



>ref|NP_001117312.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE29805.1| uncharacterized protein AT1G19115 [Arabidopsis thaliana]
Length=174

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 62/116 (53%), Gaps = 19/116 (16%)
 Frame = +2

Query  629  KDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLR-----DTFQESRMEKLLRTIL  793
            KD+   N       KKS+SFL+KKMFVC SGF   P L      D+   +RMEK+LRTIL
Sbjct  70   KDITPVNTDVTIGKKKSLSFLLKKMFVCTSGFKTPPPLLDLSRGDSLHNTRMEKMLRTIL  129

Query  794  SKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            +KKI+PQ  +  A  K++LE+       A +              D+ +W KTDSE
Sbjct  130  NKKIHPQRSNSIA--KKYLESNHKIMDEARSSV------------DANKWVKTDSE  171



>gb|ABK28324.1| unknown [Arabidopsis thaliana]
Length=175

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 62/116 (53%), Gaps = 19/116 (16%)
 Frame = +2

Query  629  KDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLR-----DTFQESRMEKLLRTIL  793
            KD+   N       KKS+SFL+KKMFVC SGF   P L      D+   +RMEK+LRTIL
Sbjct  69   KDITPVNTDVTIGKKKSLSFLLKKMFVCTSGFKTPPPLLDLSRGDSLHNTRMEKMLRTIL  128

Query  794  SKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            +KKI+PQ  +  A  K++LE+       A +              D+ +W KTDSE
Sbjct  129  NKKIHPQRSNSIA--KKYLESNHKIMDEARSSV------------DANKWVKTDSE  170



>ref|NP_001117313.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABF59201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29806.1| uncharacterized protein AT1G19115 [Arabidopsis thaliana]
Length=175

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 62/116 (53%), Gaps = 19/116 (16%)
 Frame = +2

Query  629  KDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLR-----DTFQESRMEKLLRTIL  793
            KD+   N       KKS+SFL+KKMFVC SGF   P L      D+   +RMEK+LRTIL
Sbjct  70   KDITPVNTDVTIGKKKSLSFLLKKMFVCTSGFKTPPPLLDLSRGDSLHNTRMEKMLRTIL  129

Query  794  SKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            +KKI+PQ  +  A  K++LE+       A +              D+ +W KTDSE
Sbjct  130  NKKIHPQRSNSIA--KKYLESNHKIMDEARSSV------------DANKWVKTDSE  171



>gb|AAF79295.1|AC068602_18 F14D16.27 [Arabidopsis thaliana]
Length=187

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 62/116 (53%), Gaps = 19/116 (16%)
 Frame = +2

Query  629  KDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSPSLR-----DTFQESRMEKLLRTIL  793
            KD+   N       KKS+SFL+KKMFVC SGF   P L      D+   +RMEK+LRTIL
Sbjct  82   KDITPVNTDVTIGKKKSLSFLLKKMFVCTSGFKTPPPLLDLSRGDSLHNTRMEKMLRTIL  141

Query  794  SKKIYPQNPSRAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
            +KKI+PQ  +  A  K++LE+       A +              D+ +W KTDSE
Sbjct  142  NKKIHPQRSNSIA--KKYLESNHKIMDEARSSV------------DANKWVKTDSE  183



>ref|XP_006306438.1| hypothetical protein CARUB_v10012380mg [Capsella rubella]
 gb|EOA39336.1| hypothetical protein CARUB_v10012380mg [Capsella rubella]
Length=171

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 62/108 (57%), Gaps = 20/108 (19%)
 Frame = +2

Query  662  SIGKK-SVSFLVKKMFVCRSGFAPSPSLR-----DTFQESRMEKLLRTILSKKIYPQNPS  823
            +IGKK S+SFL+KKMFVC SGF   P L      D+   +RMEK+LRTIL+KKI+PQ  +
Sbjct  77   TIGKKKSLSFLLKKMFVCTSGFKTPPPLLDLSRGDSLPNTRMEKMLRTILNKKIHPQRSN  136

Query  824  RAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSEYI  967
              A  K++LEN       A +              ++ +W KTDSE I
Sbjct  137  SIA--KKYLENNHKIIDEARSSI------------EANKWVKTDSECI  170



>ref|XP_006416536.1| hypothetical protein EUTSA_v10009462mg [Eutrema salsugineum]
 gb|ESQ34889.1| hypothetical protein EUTSA_v10009462mg [Eutrema salsugineum]
Length=172

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 21/106 (20%)
 Frame = +2

Query  662  SIGKK-SVSFLVKKMFVCRSGFAPSPSLR-----DTFQESRMEKLLRTILSKKIYPQNPS  823
            +IGKK S+SFL+KKMFVC SGF   P L      D+   +RMEK+LRTIL+KKI+PQ  +
Sbjct  78   TIGKKKSLSFLLKKMFVCTSGFKTPPPLLDLSRGDSLPNTRMEKMLRTILNKKIHPQRSN  137

Query  824  RAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
              A  K++LEN +      +++             D+ +W KTDSE
Sbjct  138  AIA--KKYLENHKIIDEPRSSV-------------DANKWVKTDSE  168



>ref|XP_010477116.1| PREDICTED: uncharacterized protein LOC104756254 isoform X2 [Camelina 
sativa]
Length=173

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 61/106 (58%), Gaps = 20/106 (19%)
 Frame = +2

Query  662  SIGKK-SVSFLVKKMFVCRSGFAPSPSLR-----DTFQESRMEKLLRTILSKKIYPQNPS  823
            +IGKK S+SFL+KKMFVC SGF   P L      D+   +RMEK+LRTIL+KKI+PQ  +
Sbjct  78   TIGKKKSLSFLLKKMFVCTSGFKTPPHLLDLSRGDSMPNTRMEKMLRTILNKKIHPQRSN  137

Query  824  RAASLKRFLENkrtsaatataiaeeeeekkrertSDSGRWDKTDSE  961
              A  K++LEN       A +              ++ +W KTDSE
Sbjct  138  SIA--KKYLENNHKIIDEARSSV------------EANKWVKTDSE  169



>gb|EMS54923.1| hypothetical protein TRIUR3_20000 [Triticum urartu]
Length=241

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 62/123 (50%), Gaps = 14/123 (11%)
 Frame = +2

Query  122  RMKFFNWMQNRFNGGQAGSRKGYPVPPPTTNHGKQ-EPRNEEFSDWPGSFLAIGTLGNND  298
            +MK F+WM N+ +G Q  SR  +P      +     + RN+EFSDWP S LAIGT GN  
Sbjct  23   KMKIFSWMANKISGKQEASR--FPASSSGPSRSNMPDCRNDEFSDWPQSLLAIGTFGNKQ  80

Query  299  PPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLLSRKPASKGEAQT  478
              E A+  + +E            S  D  +FT EEV ++QK    +L+ K   + EA  
Sbjct  81   IEEVAQVQDTSEDGQ---------SMQDAIKFTEEEVDRIQKEFAMILASK--DQAEAHD  129

Query  479  NAD  487
            + D
Sbjct  130  SHD  132



>emb|CDX83786.1| BnaC08g18590D [Brassica napus]
Length=165

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = +2

Query  629  KDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPSP-----SLRDTFQESRMEKLLRTIL  793
            KD+   N       KKS+SFL+K MFVC +GF   P     S  D+   +RMEK+L+TIL
Sbjct  79   KDLTRVNTDVTIGKKKSLSFLLK-MFVCTNGFKIPPPPLDLSTGDSVPNTRMEKMLKTIL  137

Query  794  SKKIYPQNPSRAASLKRFLEN  856
            +KKI+PQ+ +  A  K +LEN
Sbjct  138  NKKIHPQHSNAIA--KMYLEN  156



>emb|CDY41020.1| BnaC05g14780D [Brassica napus]
Length=64

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 7/57 (12%)
 Frame = +2

Query  701  MFVCRSGFAPSPSLRD-----TFQESRMEKLLRTILSKKIYPQNPSRAASLKRFLEN  856
            MFVC SGF   P L D     +F  +RMEK+LRTIL+KKI+PQ+ +  A  K++LEN
Sbjct  1    MFVCTSGFKTPPPLLDLSRGDSFPNTRMEKMLRTILNKKIHPQSSNNTA--KKYLEN  55



>gb|EYU28317.1| hypothetical protein MIMGU_mgv1a026132mg, partial [Erythranthe 
guttata]
Length=214

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 85/193 (44%), Gaps = 37/193 (19%)
 Frame = +2

Query  263  SFLAIGTLGNNDPPESARKPekneiiveegeeeeQCSSPDLAEFTPEEVGKLQKALTKLL  442
            + LAIGT GNN                +    EE C+     E   +E+  L+  L   +
Sbjct  15   TLLAIGTFGNN------------LKNSDMVNIEESCNED---EDVDQEL--LRHLLNNQV  57

Query  443  SRKPASKGEAQTNADLPLDRFLNCPSSLEVDRRLSNTSAANSLYDCDEDEIDRTIRAIIG  622
            S  P+  G    N +   ++FL      E +  + + + A+ + D           A++ 
Sbjct  58   SLDPSFSGHQSNNYNPTTEKFLAILEEEEEEIIVDSITDASQVKD-----------ALLR  106

Query  623  RCKDVCEKNKQHKSIGKKSVSFLVKKMFVCRSGFAPS----PSLRD-----TFQESRMEK  775
            R +       +  ++ KKSVSFL+K+  +C  GF  S    P L+D     T   SRMEK
Sbjct  107  RREKGAPSENRGNAMYKKSVSFLIKRALLCGGGFVHSPVINPVLKDPFTDLTLDHSRMEK  166

Query  776  LLRTILSKKIYPQ  814
            +LRT+L KK YPQ
Sbjct  167  ILRTMLRKKKYPQ  179



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3273381520216