BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16989_g1_i2 len=1182 path=[1160:0-668 3040:669-1181]

Length=1182
                                                                      Score     E

ref|XP_009594126.1|  PREDICTED: WAT1-related protein At3g28050-li...    367   2e-121   
ref|XP_009767073.1|  PREDICTED: WAT1-related protein At3g28050-like     367   6e-121   
ref|XP_009594124.1|  PREDICTED: WAT1-related protein At3g28050-li...    363   2e-119   
ref|XP_004238687.1|  PREDICTED: WAT1-related protein At3g28050-like     340   2e-110   
ref|XP_006355989.1|  PREDICTED: WAT1-related protein At5g40240-like     338   7e-110   
ref|XP_002266639.2|  PREDICTED: WAT1-related protein At5g40210-like     325   8e-105   Vitis vinifera
ref|XP_002265468.2|  PREDICTED: WAT1-related protein At5g40240-li...    324   2e-104   Vitis vinifera
gb|KHN00335.1|  Auxin-induced protein 5NG4                              322   1e-103   
ref|XP_003519813.1|  PREDICTED: WAT1-related protein At3g28050-like     322   2e-103   
gb|AFK41997.1|  unknown                                                 322   2e-103   
ref|XP_003613285.1|  Auxin-induced protein 5NG4                         321   3e-103   
gb|AFK41851.1|  unknown                                                 318   3e-102   
gb|AFK49074.1|  unknown                                                 318   5e-102   
emb|CBI32117.3|  unnamed protein product                                311   6e-100   
gb|KDP21320.1|  hypothetical protein JCGZ_21791                         312   7e-100   
ref|XP_006483805.1|  PREDICTED: WAT1-related protein At3g28050-li...    313   7e-100   
ref|XP_003613286.1|  Auxin-induced protein 5NG4                         311   3e-99    
ref|XP_002266096.1|  PREDICTED: WAT1-related protein At5g40240          309   2e-98    Vitis vinifera
gb|KDO82537.1|  hypothetical protein CISIN_1g018663mg                   308   3e-98    
ref|XP_007044589.1|  Auxin-induced protein 5NG4, putative               305   4e-97    
gb|KDO82548.1|  hypothetical protein CISIN_1g018256mg                   305   5e-97    
ref|XP_002531390.1|  Auxin-induced protein 5NG4, putative               305   5e-97    Ricinus communis
ref|XP_003613292.1|  Auxin-induced protein 5NG4                         304   1e-96    
ref|XP_004489865.1|  PREDICTED: WAT1-related protein At3g28050-like     301   1e-95    
gb|AES96246.2|  auxin-induced 5NG4-like protein                         299   2e-94    
ref|XP_007044594.1|  Nodulin MtN21 /EamA-like transporter family ...    296   2e-93    
gb|AEX97055.1|  auxin-induced nodulin                                   293   2e-92    
ref|XP_002531388.1|  Auxin-induced protein 5NG4, putative               293   2e-92    Ricinus communis
ref|XP_006484313.1|  PREDICTED: uncharacterized protein LOC102615432    303   1e-91    
ref|XP_007224366.1|  hypothetical protein PRUPE_ppa020906mg             291   3e-91    
ref|XP_006483806.1|  PREDICTED: WAT1-related protein At3g28050-li...    289   6e-91    
ref|XP_008221769.1|  PREDICTED: WAT1-related protein At4g15540-like     288   6e-90    
ref|XP_003517735.1|  PREDICTED: WAT1-related protein At5g40210          286   1e-89    
ref|XP_003517734.1|  PREDICTED: WAT1-related protein At3g28050-like     286   1e-89    
gb|KDO82538.1|  hypothetical protein CISIN_1g018663mg                   285   2e-89    
ref|XP_010653215.1|  PREDICTED: WAT1-related protein At5g40240-li...    277   3e-87    
ref|XP_002266139.1|  PREDICTED: WAT1-related protein At5g40240          278   1e-86    Vitis vinifera
emb|CAN67884.1|  hypothetical protein VITISV_015327                     277   3e-86    Vitis vinifera
ref|XP_003613291.1|  Auxin-induced protein 5NG4                         276   5e-86    
ref|XP_008221761.1|  PREDICTED: WAT1-related protein At3g28050-li...    274   7e-85    
ref|XP_003613288.1|  Auxin-induced protein 5NG4                         273   1e-84    
ref|XP_007137544.1|  hypothetical protein PHAVU_009G135600g             273   2e-84    
gb|KDO82549.1|  hypothetical protein CISIN_1g018256mg                   271   4e-84    
gb|KDP21318.1|  hypothetical protein JCGZ_21789                         271   8e-84    
ref|XP_008221765.1|  PREDICTED: WAT1-related protein At5g40240-like     271   1e-83    
ref|XP_007224400.1|  hypothetical protein PRUPE_ppa021705mg             270   2e-83    
ref|XP_004304594.1|  PREDICTED: auxin-induced protein 5NG4-like         269   7e-83    
ref|XP_007157478.1|  hypothetical protein PHAVU_002G073000g             269   8e-83    
ref|XP_003523396.1|  PREDICTED: WAT1-related protein At3g28050-like     268   8e-83    
ref|NP_001241291.1|  uncharacterized protein LOC100804032               268   1e-82    
ref|XP_007222235.1|  hypothetical protein PRUPE_ppa007913mg             268   2e-82    
ref|XP_009360476.1|  PREDICTED: WAT1-related protein At5g40240-like     266   7e-82    
ref|XP_007044593.1|  Nodulin MtN21 /EamA-like transporter family ...    265   1e-81    
ref|XP_009594127.1|  PREDICTED: WAT1-related protein At3g28050-like     263   1e-81    
ref|XP_008389607.1|  PREDICTED: WAT1-related protein At5g40240-like     266   1e-81    
ref|XP_006483798.1|  PREDICTED: WAT1-related protein At3g28050-li...    265   1e-81    
ref|XP_011025524.1|  PREDICTED: WAT1-related protein At3g28050-li...    265   3e-81    
ref|XP_006581027.1|  PREDICTED: uncharacterized protein LOC100804...    264   4e-81    
ref|XP_010272001.1|  PREDICTED: WAT1-related protein At5g40240-li...    264   6e-81    
gb|KHG19084.1|  Auxin-induced protein 5NG4                              264   7e-81    
ref|XP_009761504.1|  PREDICTED: WAT1-related protein At3g28050-like     264   1e-80    
ref|XP_010271999.1|  PREDICTED: WAT1-related protein At5g40240-li...    264   1e-80    
gb|KHG19083.1|  Auxin-induced protein 5NG4                              263   1e-80    
ref|XP_002311582.1|  hypothetical protein POPTR_0008s14510g             262   4e-80    Populus trichocarpa [western balsam poplar]
ref|XP_010046651.1|  PREDICTED: WAT1-related protein At4g15540-like     263   5e-80    
ref|XP_006338539.1|  PREDICTED: WAT1-related protein At3g28050-li...    262   6e-80    
ref|XP_004232282.1|  PREDICTED: WAT1-related protein At3g28050-like     261   2e-79    
ref|XP_003543391.2|  PREDICTED: WAT1-related protein At5g40230-li...    261   2e-79    
ref|XP_006355963.1|  PREDICTED: WAT1-related protein At3g28050-like     259   2e-79    
gb|KCW86748.1|  hypothetical protein EUGRSUZ_B03358                     256   4e-79    
ref|XP_010029213.1|  PREDICTED: WAT1-related protein At3g28050-like     259   4e-79    
ref|XP_010254351.1|  PREDICTED: WAT1-related protein At4g15540-like     265   4e-79    
ref|XP_010653186.1|  PREDICTED: WAT1-related protein At3g28050          259   5e-79    
gb|KHN44249.1|  Auxin-induced protein 5NG4                              259   5e-79    
ref|XP_007137543.1|  hypothetical protein PHAVU_009G135500g             258   6e-79    
ref|XP_007163931.1|  hypothetical protein PHAVU_L004700g                255   9e-79    
ref|XP_010043808.1|  PREDICTED: WAT1-related protein At5g40240-like     258   1e-78    
ref|XP_010682604.1|  PREDICTED: WAT1-related protein At3g28050-li...    258   1e-78    
ref|XP_002531394.1|  Auxin-induced protein 5NG4, putative               258   1e-78    Ricinus communis
ref|XP_003602166.1|  Auxin-induced protein 5NG4                         258   1e-78    
ref|XP_003613294.1|  Auxin-induced protein 5NG4                         254   2e-78    
ref|XP_007215585.1|  hypothetical protein PRUPE_ppa007567mg             257   2e-78    
ref|XP_003553931.1|  PREDICTED: WAT1-related protein At5g40230 is...    258   3e-78    
ref|XP_004297653.1|  PREDICTED: auxin-induced protein 5NG4-like         257   3e-78    
ref|XP_010043800.1|  PREDICTED: WAT1-related protein At5g40240-like     257   3e-78    
ref|XP_006338537.1|  PREDICTED: WAT1-related protein At3g28050-like     257   4e-78    
ref|XP_009363570.1|  PREDICTED: uncharacterized protein LOC103953544    266   8e-78    
ref|XP_006581617.1|  PREDICTED: WAT1-related protein At3g28050-like     255   1e-77    
ref|XP_006470389.1|  PREDICTED: WAT1-related protein At3g28050-like     256   1e-77    
ref|XP_008230645.1|  PREDICTED: WAT1-related protein At3g28050-like     256   1e-77    
gb|KCW85792.1|  hypothetical protein EUGRSUZ_B02544                     257   2e-77    
gb|KHN23420.1|  Auxin-induced protein 5NG4                              254   2e-77    
ref|XP_008348038.1|  PREDICTED: WAT1-related protein At3g28050-like     255   2e-77    
ref|XP_008458740.1|  PREDICTED: WAT1-related protein At3g28050-like     255   3e-77    
gb|KCW85805.1|  hypothetical protein EUGRSUZ_B02552                     254   5e-77    
emb|CBI34955.3|  unnamed protein product                                253   5e-77    
ref|XP_006483800.1|  PREDICTED: WAT1-related protein At3g28050-li...    253   8e-77    
ref|XP_002279762.1|  PREDICTED: WAT1-related protein At3g28050          253   9e-77    Vitis vinifera
ref|XP_006574595.1|  PREDICTED: WAT1-related protein At3g28050-like     253   9e-77    
ref|XP_004142351.1|  PREDICTED: auxin-induced protein 5NG4-like         254   1e-76    
ref|XP_009349860.1|  PREDICTED: WAT1-related protein At3g28050-like     253   1e-76    
ref|XP_009599994.1|  PREDICTED: WAT1-related protein At3g28050-like     253   1e-76    
ref|XP_004239354.1|  PREDICTED: WAT1-related protein At3g28050-li...    252   1e-76    
gb|KHN00334.1|  Auxin-induced protein 5NG4                              253   1e-76    
emb|CDP02142.1|  unnamed protein product                                252   2e-76    
ref|XP_011045221.1|  PREDICTED: WAT1-related protein At3g28050-li...    252   3e-76    
ref|XP_009344542.1|  PREDICTED: WAT1-related protein At3g28050-like     251   7e-76    
gb|KDP45393.1|  hypothetical protein JCGZ_09642                         251   8e-76    
ref|XP_006355962.1|  PREDICTED: WAT1-related protein At3g28050-like     250   8e-76    
ref|XP_006369957.1|  nodulin MtN21 family protein                       251   9e-76    
ref|XP_009348031.1|  PREDICTED: WAT1-related protein At3g28050-like     250   2e-75    
ref|XP_007151110.1|  hypothetical protein PHAVU_004G018700g             250   2e-75    
gb|KDP21319.1|  hypothetical protein JCGZ_21790                         266   2e-75    
ref|XP_007031406.1|  Nodulin MtN21 /EamA transporter family protein     248   5e-75    
ref|XP_008221767.1|  PREDICTED: WAT1-related protein At5g40210-li...    248   6e-75    
ref|XP_011045220.1|  PREDICTED: WAT1-related protein At3g28050-li...    249   6e-75    
ref|XP_007031395.1|  Nodulin MtN21 /EamA-like transporter family ...    249   8e-75    
ref|XP_007036148.1|  Nodulin MtN21 /EamA-like transporter family ...    248   1e-74    
ref|XP_007044598.1|  Nodulin MtN21 /EamA-like transporter family ...    246   1e-74    
ref|XP_011028603.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    247   2e-74    
gb|EYU22475.1|  hypothetical protein MIMGU_mgv1a009299mg                247   2e-74    
ref|XP_007036147.1|  Nodulin MtN21 /EamA-like transporter family ...    248   3e-74    
ref|XP_009360473.1|  PREDICTED: WAT1-related protein At5g40240-li...    246   3e-74    
ref|XP_007209260.1|  hypothetical protein PRUPE_ppa007344mg             247   4e-74    
emb|CDP00195.1|  unnamed protein product                                246   4e-74    
ref|XP_003516812.1|  PREDICTED: WAT1-related protein At3g28050-like     246   7e-74    
ref|XP_011086526.1|  PREDICTED: WAT1-related protein At3g28050-li...    245   7e-74    
ref|XP_008340346.1|  PREDICTED: WAT1-related protein At4g15540-like     246   8e-74    
emb|CAN71719.1|  hypothetical protein VITISV_034106                     245   8e-74    Vitis vinifera
ref|XP_009629024.1|  PREDICTED: WAT1-related protein At3g28050-like     245   9e-74    
ref|XP_004502588.1|  PREDICTED: WAT1-related protein At5g40240-li...    245   1e-73    
ref|XP_002875422.1|  predicted protein                                  245   2e-73    
ref|XP_009761506.1|  PREDICTED: WAT1-related protein At5g40240-li...    244   3e-73    
ref|XP_008239731.1|  PREDICTED: WAT1-related protein At5g40240-like     245   4e-73    
ref|XP_002299184.1|  hypothetical protein POPTR_0001s06940g             243   6e-73    Populus trichocarpa [western balsam poplar]
ref|XP_006483801.1|  PREDICTED: WAT1-related protein At3g28050-li...    243   6e-73    
gb|KGN52391.1|  hypothetical protein Csa_5G630930                       243   6e-73    
ref|XP_010528268.1|  PREDICTED: WAT1-related protein At3g28050          243   8e-73    
ref|XP_009790539.1|  PREDICTED: WAT1-related protein At3g28050-like     243   1e-72    
ref|XP_010111736.1|  Auxin-induced protein 5NG4                         243   1e-72    
gb|KHN01750.1|  Auxin-induced protein 5NG4                              243   1e-72    
ref|XP_011086524.1|  PREDICTED: WAT1-related protein At3g28050-like     242   2e-72    
ref|XP_006593634.1|  PREDICTED: WAT1-related protein At5g40230-li...    241   3e-72    
gb|KHN44251.1|  Auxin-induced protein 5NG4                              241   3e-72    
ref|XP_008221766.1|  PREDICTED: WAT1-related protein At5g40210-li...    241   4e-72    
ref|NP_001239940.1|  uncharacterized protein LOC100814137               241   5e-72    
ref|XP_004304597.1|  PREDICTED: auxin-induced protein 5NG4-like         241   5e-72    
ref|XP_007044590.1|  Auxin-induced protein 5NG4, putative               240   8e-72    
ref|XP_011071065.1|  PREDICTED: WAT1-related protein At3g28050-li...    240   9e-72    
ref|XP_010100500.1|  Auxin-induced protein 5NG4                         239   2e-71    
ref|XP_010425589.1|  PREDICTED: WAT1-related protein At5g40210-li...    239   2e-71    
ref|XP_002517375.1|  Auxin-induced protein 5NG4, putative               241   2e-71    Ricinus communis
ref|XP_010043809.1|  PREDICTED: WAT1-related protein At4g15540-li...    239   3e-71    
ref|XP_011025493.1|  PREDICTED: WAT1-related protein At3g28050-li...    240   3e-71    
gb|KHG29548.1|  Auxin-induced 5NG4                                      238   3e-71    
ref|XP_004489873.1|  PREDICTED: WAT1-related protein At3g28070-li...    238   4e-71    
ref|XP_011034696.1|  PREDICTED: WAT1-related protein At3g28050-li...    238   5e-71    
ref|XP_003553929.1|  PREDICTED: WAT1-related protein At3g28050-like     238   5e-71    
ref|XP_009761505.1|  PREDICTED: WAT1-related protein At5g40240-li...    238   7e-71    
ref|XP_010031130.1|  PREDICTED: WAT1-related protein At3g28050-li...    238   7e-71    
ref|XP_007044597.1|  Nodulin MtN21 /EamA-like transporter family ...    233   2e-70    
ref|XP_006338541.1|  PREDICTED: WAT1-related protein At5g40240-like     236   3e-70    
ref|NP_566831.1|  nodulin MtN21-like transporter UMAMIT41               236   4e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007224712.1|  hypothetical protein PRUPE_ppa025053mg             236   5e-70    
ref|XP_004238690.2|  PREDICTED: WAT1-related protein At1g21890-like     244   5e-70    
ref|XP_004300887.1|  PREDICTED: auxin-induced protein 5NG4-like         236   5e-70    
ref|XP_002283377.1|  PREDICTED: WAT1-related protein At3g28050-like     236   6e-70    Vitis vinifera
ref|XP_007216831.1|  hypothetical protein PRUPE_ppa022659mg             235   6e-70    
gb|KCW87484.1|  hypothetical protein EUGRSUZ_B03946                     235   7e-70    
gb|KCW87483.1|  hypothetical protein EUGRSUZ_B03945                     235   9e-70    
emb|CBI34954.3|  unnamed protein product                                234   1e-69    
ref|XP_008230953.1|  PREDICTED: uncharacterized protein LOC103330182    244   1e-69    
gb|KDO82546.1|  hypothetical protein CISIN_1g018663mg                   230   1e-69    
gb|AES96253.2|  nodulin MtN21/EamA-like transporter family protein      234   2e-69    
ref|XP_007227338.1|  hypothetical protein PRUPE_ppa015719mg             234   2e-69    
ref|XP_002279776.1|  PREDICTED: WAT1-related protein At5g40230          234   3e-69    Vitis vinifera
ref|XP_010514518.1|  PREDICTED: WAT1-related protein At3g28050-like     233   5e-69    
ref|XP_008221764.1|  PREDICTED: WAT1-related protein At5g40240-like     233   7e-69    
gb|AFK39191.1|  unknown                                                 233   7e-69    
ref|XP_002875421.1|  nodulin MtN21 family protein                       233   9e-69    
gb|KFK33720.1|  hypothetical protein AALP_AA5G051200                    232   1e-68    
ref|XP_010320601.1|  PREDICTED: WAT1-related protein At3g28050-li...    229   1e-68    
gb|AAM65952.1|  nodulin MtN21-like protein                              232   2e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008221768.1|  PREDICTED: WAT1-related protein At3g28050-like     231   2e-68    
ref|XP_010528266.1|  PREDICTED: WAT1-related protein At5g40210-like     231   2e-68    
ref|XP_010502812.1|  PREDICTED: WAT1-related protein At3g28050          232   2e-68    
ref|XP_009111588.1|  PREDICTED: WAT1-related protein At3g28050-like     231   3e-68    
ref|XP_008230644.1|  PREDICTED: WAT1-related protein At5g40240-like     231   3e-68    
ref|XP_009599993.1|  PREDICTED: WAT1-related protein At3g28050-like     231   3e-68    
ref|XP_002303950.2|  hypothetical protein POPTR_0003s19220g             231   3e-68    Populus trichocarpa [western balsam poplar]
ref|XP_003608949.1|  Auxin-induced protein 5NG4                         231   3e-68    
ref|XP_011071067.1|  PREDICTED: WAT1-related protein At3g28050-li...    231   3e-68    
ref|XP_006446450.1|  hypothetical protein CICLE_v10017903mg             233   4e-68    
emb|CDX85184.1|  BnaC07g24950D                                          231   4e-68    
emb|CDP16602.1|  unnamed protein product                                230   4e-68    
gb|KDO66260.1|  hypothetical protein CISIN_1g019712mg                   230   5e-68    
ref|XP_010264833.1|  PREDICTED: WAT1-related protein At4g15540-like     231   8e-68    
gb|KDP45391.1|  hypothetical protein JCGZ_09640                         229   9e-68    
gb|KEH16737.1|  nodulin MtN21/EamA-like transporter family protein      230   1e-67    
ref|XP_002531393.1|  Auxin-induced protein 5NG4, putative               229   1e-67    Ricinus communis
gb|KHG27655.1|  Auxin-induced 5NG4                                      229   1e-67    
gb|KDP31133.1|  hypothetical protein JCGZ_11509                         229   2e-67    
gb|EYU44714.1|  hypothetical protein MIMGU_mgv1a008681mg                229   2e-67    
ref|XP_009151897.1|  PREDICTED: WAT1-related protein At5g40210          229   3e-67    
gb|KDO82559.1|  hypothetical protein CISIN_1g022220mg                   227   3e-67    
gb|KFK33719.1|  hypothetical protein AALP_AA5G051100                    229   3e-67    
ref|XP_010425588.1|  PREDICTED: WAT1-related protein At3g28050-like     229   3e-67    
emb|CAN62735.1|  hypothetical protein VITISV_027749                     236   4e-67    Vitis vinifera
ref|XP_004232283.1|  PREDICTED: WAT1-related protein At5g40240-like     228   4e-67    
gb|KDP45389.1|  hypothetical protein JCGZ_09638                         228   4e-67    
ref|XP_006470391.1|  PREDICTED: WAT1-related protein At5g40240-like     228   5e-67    
ref|XP_002517371.1|  conserved hypothetical protein                     228   5e-67    Ricinus communis
emb|CDY04005.1|  BnaC02g37200D                                          228   7e-67    
ref|XP_003613295.1|  Auxin-induced protein 5NG4                         234   8e-67    
ref|XP_006395380.1|  hypothetical protein EUTSA_v10004446mg             227   1e-66    
gb|KHN09903.1|  Auxin-induced protein 5NG4-like protein                 227   1e-66    
ref|XP_007031399.1|  Nodulin MtN21 /EamA-like transporter family ...    227   2e-66    
ref|XP_010043799.1|  PREDICTED: WAT1-related protein At5g40240-like     226   2e-66    
ref|XP_004508845.1|  PREDICTED: WAT1-related protein At5g40240-like     226   2e-66    
ref|XP_010046740.1|  PREDICTED: uncharacterized protein LOC104435740    235   2e-66    
emb|CDY20031.1|  BnaA09g02200D                                          226   2e-66    
emb|CDY00140.1|  BnaC09g01610D                                          226   2e-66    
ref|XP_011086525.1|  PREDICTED: WAT1-related protein At3g28050-like     226   2e-66    
ref|XP_011020453.1|  PREDICTED: WAT1-related protein At3g28050-like     226   3e-66    
gb|KHN23566.1|  Auxin-induced protein 5NG4                              226   3e-66    
ref|XP_002322156.2|  hypothetical protein POPTR_0015s08450g             222   5e-66    Populus trichocarpa [western balsam poplar]
ref|XP_006286126.1|  hypothetical protein CARUB_v10007676mg             225   5e-66    
emb|CDX86451.1|  BnaA06g31680D                                          228   5e-66    
emb|CDY66864.1|  BnaCnng52640D                                          225   5e-66    
dbj|BAB10904.1|  nodulin-like protein                                   224   7e-66    Arabidopsis thaliana [mouse-ear cress]
gb|KHG04184.1|  Auxin-induced 5NG4                                      225   7e-66    
ref|XP_007031402.1|  Nodulin MtN21 /EamA-like transporter family ...    224   9e-66    
emb|CBI15069.3|  unnamed protein product                                223   1e-65    
emb|CDY11676.1|  BnaC06g12840D                                          224   1e-65    
ref|NP_198839.1|  nodulin MtN21 /EamA-like transporter family pro...    224   1e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006470385.1|  PREDICTED: WAT1-related protein At4g15540-like     229   2e-65    
gb|AES96252.2|  nodulin MtN21/EamA-like transporter family protein      222   2e-65    
ref|XP_009129384.1|  PREDICTED: WAT1-related protein At3g28050 is...    224   2e-65    
ref|XP_010555908.1|  PREDICTED: WAT1-related protein At3g28130-like     223   3e-65    
gb|EYU29711.1|  hypothetical protein MIMGU_mgv1a009127mg                223   3e-65    
ref|XP_010031116.1|  PREDICTED: WAT1-related protein At3g28050-li...    223   4e-65    
ref|XP_006476741.1|  PREDICTED: WAT1-related protein At5g40240-li...    223   6e-65    
ref|XP_008348035.1|  PREDICTED: WAT1-related protein At5g40240-li...    222   7e-65    
ref|XP_007226752.1|  hypothetical protein PRUPE_ppa018854mg             221   1e-64    
ref|XP_010031126.1|  PREDICTED: WAT1-related protein At3g28050-like     222   1e-64    
ref|XP_007151109.1|  hypothetical protein PHAVU_004G018600g             221   1e-64    
ref|XP_011098767.1|  PREDICTED: WAT1-related protein At5g40240-like     221   2e-64    
ref|XP_002868665.1|  hypothetical protein ARALYDRAFT_330483             221   2e-64    
ref|XP_006470392.1|  PREDICTED: WAT1-related protein At5g40240-like     221   2e-64    
ref|XP_007217782.1|  hypothetical protein PRUPE_ppa020036mg             221   2e-64    
ref|XP_010031132.1|  PREDICTED: WAT1-related protein At3g28050-li...    220   2e-64    
gb|KDO66278.1|  hypothetical protein CISIN_1g019098mg                   220   2e-64    
ref|XP_007031403.1|  Nodulin MtN21 /EamA-like transporter family ...    221   3e-64    
ref|XP_009125128.1|  PREDICTED: WAT1-related protein At5g40240-like     221   3e-64    
ref|XP_006483808.1|  PREDICTED: WAT1-related protein At3g28050-li...    217   4e-64    
ref|XP_002868667.1|  nodulin MtN21 family protein                       219   5e-64    
ref|XP_011087083.1|  PREDICTED: WAT1-related protein At3g28050-like     219   5e-64    
ref|XP_004304595.1|  PREDICTED: auxin-induced protein 5NG4-like         219   6e-64    
ref|XP_008356601.1|  PREDICTED: WAT1-related protein At3g28050-like     218   6e-64    
gb|KEH24886.1|  nodulin MtN21/EamA-like transporter family protein      220   6e-64    
ref|XP_006470384.1|  PREDICTED: WAT1-related protein At3g28050-like     219   9e-64    
ref|XP_006603829.1|  PREDICTED: WAT1-related protein At5g40230 is...    219   9e-64    
ref|XP_010450712.1|  PREDICTED: WAT1-related protein At5g40230 is...    219   1e-63    
ref|XP_010425595.1|  PREDICTED: WAT1-related protein At3g28100-li...    219   1e-63    
ref|XP_010031134.1|  PREDICTED: WAT1-related protein At3g28050-li...    219   1e-63    
gb|KDO82550.1|  hypothetical protein CISIN_1g018400mg                   218   2e-63    
ref|XP_010450705.1|  PREDICTED: WAT1-related protein At5g40230 is...    218   2e-63    
gb|ABK93545.1|  unknown                                                 215   2e-63    Populus trichocarpa [western balsam poplar]
gb|KCW50391.1|  hypothetical protein EUGRSUZ_J00146                     218   3e-63    
ref|XP_002875424.1|  predicted protein                                  218   3e-63    
ref|XP_008443490.1|  PREDICTED: WAT1-related protein At5g40230-li...    218   4e-63    
ref|XP_006405518.1|  hypothetical protein EUTSA_v10027803mg             218   4e-63    
ref|XP_008443486.1|  PREDICTED: WAT1-related protein At5g40230-li...    218   5e-63    
gb|KEH24884.1|  nodulin MtN21/EamA-like transporter family protein      218   6e-63    
ref|XP_010435923.1|  PREDICTED: WAT1-related protein At5g40230-li...    217   6e-63    
ref|XP_006603827.1|  PREDICTED: WAT1-related protein At5g40230 is...    219   6e-63    
ref|XP_010435922.1|  PREDICTED: WAT1-related protein At5g40230-li...    217   6e-63    
ref|NP_568578.1|  nodulin MtN21 /EamA-like transporter family pro...    216   7e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010045320.1|  PREDICTED: WAT1-related protein At5g40240-like     217   7e-63    
emb|CDP04676.1|  unnamed protein product                                218   9e-63    
ref|XP_003519811.1|  PREDICTED: WAT1-related protein At5g40240-li...    216   1e-62    
ref|XP_007157479.1|  hypothetical protein PHAVU_002G073100g             216   1e-62    
ref|XP_009797459.1|  PREDICTED: WAT1-related protein At4g15540-li...    216   1e-62    
ref|XP_006573058.1|  PREDICTED: WAT1-related protein At5g40240 is...    216   1e-62    
emb|CDX67449.1|  BnaA07g14890D                                          216   1e-62    
gb|KCW85790.1|  hypothetical protein EUGRSUZ_B02542                     215   1e-62    
gb|KDO82541.1|  hypothetical protein CISIN_1g018663mg                   213   2e-62    
gb|KFK33141.1|  hypothetical protein AALP_AA6G336300                    216   2e-62    
ref|XP_003517737.1|  PREDICTED: WAT1-related protein At5g40240 is...    215   3e-62    
ref|XP_008341732.1|  PREDICTED: WAT1-related protein At5g40240-like     216   3e-62    
ref|NP_198840.2|  nodulin MtN21 /EamA-like transporter family pro...    216   3e-62    
ref|NP_001190441.1|  nodulin MtN21 /EamA-like transporter family ...    216   4e-62    
gb|KDO82540.1|  hypothetical protein CISIN_1g018663mg                   212   5e-62    
ref|XP_010441134.1|  PREDICTED: WAT1-related protein At5g40230-like     216   5e-62    
ref|XP_002531389.1|  conserved hypothetical protein                     213   6e-62    
emb|CDP00194.1|  unnamed protein product                                213   6e-62    
gb|KEH24890.1|  nodulin MtN21/EamA-like transporter family protein      213   6e-62    
gb|KCW85789.1|  hypothetical protein EUGRSUZ_B02542                     214   6e-62    
ref|XP_011098514.1|  PREDICTED: WAT1-related protein At3g28050-li...    215   7e-62    
emb|CDY49754.1|  BnaA02g29170D                                          214   7e-62    
ref|XP_002875423.1|  hypothetical protein ARALYDRAFT_484593             214   1e-61    
ref|XP_006355988.1|  PREDICTED: WAT1-related protein At4g15540-like     211   1e-61    
gb|KDO66275.1|  hypothetical protein CISIN_1g018934mg                   214   1e-61    
ref|XP_009129382.1|  PREDICTED: WAT1-related protein At3g28100          214   1e-61    
ref|XP_011098513.1|  PREDICTED: WAT1-related protein At3g28050-li...    216   1e-61    
ref|XP_007155399.1|  hypothetical protein PHAVU_003G198100g             214   1e-61    
ref|XP_004304599.1|  PREDICTED: auxin-induced protein 5NG4-like         214   2e-61    
ref|XP_009139980.1|  PREDICTED: WAT1-related protein At5g40240-li...    214   2e-61    
ref|XP_009360475.1|  PREDICTED: WAT1-related protein At5g40240-li...    213   2e-61    
emb|CDY36827.1|  BnaC04g32200D                                          213   2e-61    
ref|XP_008353406.1|  PREDICTED: WAT1-related protein At5g40240-like     214   2e-61    
ref|XP_006470490.1|  PREDICTED: WAT1-related protein At5g40240-like     213   3e-61    
emb|CDP04678.1|  unnamed protein product                                213   3e-61    
emb|CDY11678.1|  BnaC06g12860D                                          213   3e-61    
ref|XP_010502814.1|  PREDICTED: WAT1-related protein At3g28070          213   4e-61    
ref|XP_009360474.1|  PREDICTED: WAT1-related protein At5g40240-li...    212   4e-61    
ref|XP_006405532.1|  hypothetical protein EUTSA_v10027820mg             212   4e-61    
emb|CDX99641.1|  BnaC04g33980D                                          212   4e-61    
ref|XP_004502590.1|  PREDICTED: WAT1-related protein At5g40240-li...    211   5e-61    
ref|XP_010441137.1|  PREDICTED: WAT1-related protein At5g40240-like     213   5e-61    
ref|XP_010450700.1|  PREDICTED: WAT1-related protein At5g40240-like     212   6e-61    
gb|EPS67353.1|  hypothetical protein M569_07421                         211   7e-61    
ref|XP_009125131.1|  PREDICTED: WAT1-related protein At5g40240-like     212   7e-61    
ref|XP_009125129.1|  PREDICTED: WAT1-related protein At5g40240-like     212   8e-61    
ref|XP_006284071.1|  hypothetical protein CARUB_v10005197mg             211   8e-61    
ref|XP_010435926.1|  PREDICTED: WAT1-related protein At5g40240 is...    211   1e-60    
ref|XP_006470386.1|  PREDICTED: WAT1-related protein At5g40240-li...    212   1e-60    
ref|XP_006283966.1|  hypothetical protein CARUB_v10005089mg             211   1e-60    
ref|XP_010514520.1|  PREDICTED: WAT1-related protein At3g28100          211   1e-60    
gb|KEH24885.1|  nodulin MtN21/EamA-like transporter family protein      211   1e-60    
ref|XP_006470387.1|  PREDICTED: WAT1-related protein At5g40240-li...    211   2e-60    
ref|XP_009140232.1|  PREDICTED: WAT1-related protein At4g15540          211   2e-60    
ref|XP_009349859.1|  PREDICTED: WAT1-related protein At5g40240-like     211   2e-60    
emb|CDX67448.1|  BnaA07g14880D                                          219   2e-60    
ref|XP_006476742.1|  PREDICTED: WAT1-related protein At5g40240-li...    210   2e-60    
gb|KCW50392.1|  hypothetical protein EUGRSUZ_J00146                     210   3e-60    
gb|KDO82557.1|  hypothetical protein CISIN_1g018400mg                   208   5e-60    
ref|XP_009129385.1|  PREDICTED: WAT1-related protein At3g28050 is...    207   5e-60    
gb|KDO66276.1|  hypothetical protein CISIN_1g018934mg                   209   6e-60    
ref|XP_006291390.1|  hypothetical protein CARUB_v10017528mg             209   1e-59    
ref|XP_002870232.1|  hypothetical protein ARALYDRAFT_493329             208   1e-59    
ref|XP_010450715.1|  PREDICTED: WAT1-related protein At5g40210-li...    208   1e-59    
ref|XP_009344537.1|  PREDICTED: WAT1-related protein At5g40210-like     208   1e-59    
gb|KDP45392.1|  hypothetical protein JCGZ_09641                         207   1e-59    
ref|XP_004304596.1|  PREDICTED: auxin-induced protein 5NG4-like         208   1e-59    
ref|XP_004502589.1|  PREDICTED: WAT1-related protein At5g40240-li...    207   2e-59    
ref|XP_009139978.1|  PREDICTED: WAT1-related protein At5g40230          208   2e-59    
gb|AFK37412.1|  unknown                                                 208   2e-59    
ref|XP_004514450.1|  PREDICTED: WAT1-related protein At3g28050-li...    208   2e-59    
ref|XP_010667883.1|  PREDICTED: WAT1-related protein At3g28050-like     208   3e-59    
ref|XP_004514451.1|  PREDICTED: WAT1-related protein At3g28050-li...    207   3e-59    
ref|XP_008341477.1|  PREDICTED: WAT1-related protein At5g40240-like     207   4e-59    
ref|XP_009139982.1|  PREDICTED: WAT1-related protein At5g40240-like     209   4e-59    
ref|XP_002868664.1|  nodulin MtN21 family protein                       207   4e-59    
emb|CDY11677.1|  BnaC06g12850D                                          207   4e-59    
ref|XP_010425592.1|  PREDICTED: WAT1-related protein At3g28070-like     207   4e-59    
ref|XP_006586196.1|  PREDICTED: WAT1-related protein At5g40240-li...    207   6e-59    
emb|CDY15933.1|  BnaA04g11780D                                          206   6e-59    
ref|XP_002517372.1|  Auxin-induced protein 5NG4, putative               206   1e-58    
gb|KEH16738.1|  nodulin MtN21/EamA-like transporter family protein      203   1e-58    
ref|XP_008458741.1|  PREDICTED: WAT1-related protein At3g28050-li...    205   2e-58    
emb|CDP04677.1|  unnamed protein product                                206   2e-58    
ref|XP_010514521.1|  PREDICTED: WAT1-related protein At3g28070-li...    205   3e-58    
ref|NP_189446.2|  nodulin MtN21 /EamA-like transporter family pro...    205   3e-58    
ref|XP_010425593.1|  PREDICTED: WAT1-related protein At3g28070 is...    204   3e-58    
ref|XP_007031400.1|  Nodulin MtN21 /EamA-like transporter family ...    204   4e-58    
ref|XP_006395378.1|  hypothetical protein EUTSA_v10004485mg             204   4e-58    
ref|XP_004514449.1|  PREDICTED: WAT1-related protein At3g28050-li...    205   4e-58    
ref|XP_010111739.1|  Auxin-induced protein 5NG4                         208   8e-58    
ref|XP_006405526.1|  hypothetical protein EUTSA_v10027804mg             204   8e-58    
ref|XP_004498806.1|  PREDICTED: WAT1-related protein At5g40240-li...    204   9e-58    
gb|AAM67276.1|  contains similarity to integral membrane protein ...    204   1e-57    
ref|XP_009140233.1|  PREDICTED: WAT1-related protein At5g40240-li...    204   1e-57    
ref|XP_010450716.1|  PREDICTED: WAT1-related protein At5g40210 is...    203   1e-57    
ref|XP_010441140.1|  PREDICTED: WAT1-related protein At5g40210-like     203   1e-57    
ref|NP_974371.2|  WAT1-related protein                                  203   2e-57    
ref|XP_010435932.1|  PREDICTED: WAT1-related protein At5g40210-li...    202   2e-57    
ref|XP_007031401.1|  Nodulin MtN21 /EamA-like transporter family ...    202   2e-57    
ref|NP_974370.1|  nodulin MtN21 /EamA-like transporter family pro...    200   2e-57    
ref|XP_008379799.1|  PREDICTED: WAT1-related protein At5g40240-like     209   3e-57    
ref|XP_002517373.1|  Auxin-induced protein 5NG4, putative               202   4e-57    
gb|KCW85808.1|  hypothetical protein EUGRSUZ_B02553                     199   4e-57    
ref|XP_004165822.1|  PREDICTED: auxin-induced protein 5NG4-like         201   5e-57    
ref|XP_003634251.2|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    203   5e-57    
ref|XP_011098512.1|  PREDICTED: WAT1-related protein At5g40240-like     202   5e-57    
ref|NP_189449.2|  nodulin MtN21-like transporter family protein U...    201   5e-57    
ref|XP_010111532.1|  Auxin-induced protein 5NG4                         202   6e-57    
ref|XP_010031127.1|  PREDICTED: WAT1-related protein At3g28050-like     202   6e-57    
ref|XP_006291278.1|  hypothetical protein CARUB_v10017409mg             202   6e-57    
ref|XP_010425596.1|  PREDICTED: WAT1-related protein At3g28100-li...    201   7e-57    
ref|XP_009344538.1|  PREDICTED: WAT1-related protein At5g40230-like     201   8e-57    
ref|XP_009151895.1|  PREDICTED: WAT1-related protein At3g28100-li...    202   8e-57    
ref|XP_007133643.1|  hypothetical protein PHAVU_011G196800g             202   1e-56    
emb|CDX85185.1|  BnaC07g24960D                                          201   1e-56    
ref|XP_009125127.1|  PREDICTED: WAT1-related protein At5g40230-like     201   1e-56    
ref|XP_006574594.1|  PREDICTED: WAT1-related protein At5g40240-li...    199   1e-56    
ref|XP_006286224.1|  hypothetical protein CARUB_v10007791mg             199   2e-56    
ref|XP_006291401.1|  hypothetical protein CARUB_v10017539mg             200   2e-56    
ref|XP_007044599.1|  Nodulin MtN21 /EamA-like transporter family ...    197   3e-56    
ref|NP_566832.1|  MtN21-like transporter family protein UMAMIT47        200   3e-56    
ref|XP_004489874.1|  PREDICTED: WAT1-related protein At3g28070-li...    198   3e-56    
ref|XP_010507084.1|  PREDICTED: WAT1-related protein At3g28070-like     199   4e-56    
ref|XP_006483802.1|  PREDICTED: WAT1-related protein At3g28050-li...    196   5e-56    
ref|XP_010514523.1|  PREDICTED: WAT1-related protein At3g28130          198   5e-56    
ref|XP_010031121.1|  PREDICTED: WAT1-related protein At3g28050-li...    199   5e-56    
ref|XP_010031125.1|  PREDICTED: WAT1-related protein At3g28050-li...    197   5e-56    
gb|KEH24888.1|  nodulin MtN21/EamA-like transporter family protein      199   7e-56    
ref|XP_011034699.1|  PREDICTED: WAT1-related protein At3g28050-li...    197   7e-56    
ref|XP_004142470.1|  PREDICTED: auxin-induced protein 5NG4-like         198   8e-56    
gb|KEH24883.1|  nodulin MtN21/EamA-like transporter family protein      201   9e-56    
dbj|BAB10902.1|  nodulin-like protein                                   197   1e-55    
ref|XP_010028080.1|  PREDICTED: WAT1-related protein At3g28050-like     198   1e-55    
emb|CAH58631.1|  nodulin-like protein                                   198   1e-55    
emb|CDP04675.1|  unnamed protein product                                198   2e-55    
gb|AAL86328.1|  unknown protein                                         196   2e-55    
ref|XP_006405529.1|  hypothetical protein EUTSA_v10027813mg             197   3e-55    
gb|KCW87481.1|  hypothetical protein EUGRSUZ_B03944                     194   3e-55    
ref|XP_009627376.1|  PREDICTED: WAT1-related protein At4g15540-like     195   3e-55    
ref|XP_003588861.1|  Auxin-induced protein 5NG4                         197   3e-55    
ref|NP_567469.2|  nodulin MtN21-like transporter UMAMIT38               196   3e-55    
gb|KCW85791.1|  hypothetical protein EUGRSUZ_B02543                     195   5e-55    
ref|XP_010320599.1|  PREDICTED: WAT1-related protein At3g28050-li...    195   6e-55    
ref|XP_010440289.1|  PREDICTED: WAT1-related protein At4g15540          197   6e-55    
ref|XP_010528267.1|  PREDICTED: WAT1-related protein At5g40210-like     196   7e-55    
ref|XP_010434958.1|  PREDICTED: WAT1-related protein At4g15540-li...    196   8e-55    
ref|XP_010912076.1|  PREDICTED: uncharacterized protein LOC105038087    203   9e-55    
emb|CDY44583.1|  BnaA04g10070D                                          207   1e-54    
ref|XP_006470492.1|  PREDICTED: WAT1-related protein At5g40240-like     192   1e-54    
gb|EPS63472.1|  hypothetical protein M569_11314                         194   1e-54    
ref|XP_006470491.1|  PREDICTED: WAT1-related protein At5g40240-like     193   1e-54    
dbj|BAB01131.1|  unnamed protein product                                192   2e-54    
gb|KFK33144.1|  hypothetical protein AALP_AA6G336700                    193   2e-54    
gb|KHG09563.1|  Auxin-induced 5NG4                                      196   2e-54    
gb|KEH24887.1|  nodulin MtN21/EamA-like transporter family protein      201   2e-54    
gb|KEH39875.1|  nodulin MtN21/EamA-like transporter family protein      197   3e-54    
ref|XP_008811231.1|  PREDICTED: WAT1-related protein At5g64700-li...    194   3e-54    
ref|XP_008811232.1|  PREDICTED: WAT1-related protein At5g64700-li...    194   4e-54    
ref|XP_010653180.1|  PREDICTED: WAT1-related protein At1g70260          194   4e-54    
ref|XP_010031119.1|  PREDICTED: WAT1-related protein At3g28050-like     194   4e-54    
ref|XP_004491753.1|  PREDICTED: WAT1-related protein At3g28050-like     192   5e-54    
ref|XP_004304598.1|  PREDICTED: auxin-induced protein 5NG4-like         192   7e-54    
ref|XP_002875426.1|  predicted protein                                  190   1e-53    
ref|XP_004502587.1|  PREDICTED: WAT1-related protein At1g70260-like     193   1e-53    
ref|XP_011069610.1|  PREDICTED: WAT1-related protein At1g43650-like     192   1e-53    
ref|XP_010111531.1|  Auxin-induced protein 5NG4                         192   1e-53    
ref|NP_850642.1|  MtN21-like transporter family protein UMAMIT47        192   1e-53    
ref|XP_004498807.1|  PREDICTED: WAT1-related protein At5g40240-li...    191   2e-53    
ref|XP_010434959.1|  PREDICTED: WAT1-related protein At4g15540-li...    192   2e-53    
ref|XP_009767374.1|  PREDICTED: WAT1-related protein At4g08300-like     193   2e-53    
gb|KHG08817.1|  Auxin-induced 5NG4                                      191   2e-53    
ref|XP_004141080.1|  PREDICTED: auxin-induced protein 5NG4-like         192   3e-53    
ref|XP_006601010.1|  PREDICTED: WAT1-related protein At3g28050-like     189   3e-53    
ref|XP_007157481.1|  hypothetical protein PHAVU_002G073200g             192   3e-53    
ref|XP_008445949.1|  PREDICTED: WAT1-related protein At5g07050          192   4e-53    
ref|XP_006604312.1|  PREDICTED: WAT1-related protein At5g07050-like     192   5e-53    
ref|XP_009623146.1|  PREDICTED: WAT1-related protein At4g08300 is...    192   5e-53    
ref|XP_009623147.1|  PREDICTED: WAT1-related protein At4g08300 is...    192   5e-53    
gb|KCW50389.1|  hypothetical protein EUGRSUZ_J00145                     190   6e-53    
ref|XP_009599917.1|  PREDICTED: WAT1-related protein At1g70260-like     191   7e-53    
ref|XP_006482028.1|  PREDICTED: WAT1-related protein At5g07050-like     192   9e-53    
ref|XP_004250321.2|  PREDICTED: WAT1-related protein At4g08300-like     192   9e-53    
gb|ABK25095.1|  unknown                                                 191   1e-52    
ref|XP_006405519.1|  hypothetical protein EUTSA_v10027803mg             188   1e-52    
emb|CDX67447.1|  BnaA07g14870D                                          193   1e-52    
ref|XP_006291555.1|  hypothetical protein CARUB_v10017711mg             189   1e-52    
ref|XP_010260944.1|  PREDICTED: WAT1-related protein At5g64700-like     190   1e-52    
ref|XP_006351896.1|  PREDICTED: WAT1-related protein At4g08300-like     190   1e-52    
ref|XP_002315812.2|  nodulin MtN21 family protein                       190   1e-52    
ref|XP_009139981.1|  PREDICTED: WAT1-related protein At5g40240-li...    188   2e-52    
emb|CDY44581.1|  BnaA04g10090D                                          189   2e-52    
ref|XP_008353011.1|  PREDICTED: WAT1-related protein At5g40240-like     186   2e-52    
ref|NP_001242267.1|  uncharacterized protein LOC100811617               191   2e-52    
ref|XP_008348036.1|  PREDICTED: WAT1-related protein At3g28050-li...    189   2e-52    
ref|XP_010434961.1|  PREDICTED: WAT1-related protein At4g15540-li...    189   2e-52    
ref|XP_010912430.1|  PREDICTED: WAT1-related protein At5g64700-like     189   3e-52    
ref|XP_006430497.1|  hypothetical protein CICLE_v10012013mg             189   3e-52    
ref|XP_006405533.1|  hypothetical protein EUTSA_v10027830mg             189   3e-52    
ref|XP_010434960.1|  PREDICTED: WAT1-related protein At4g15540-li...    189   3e-52    
ref|XP_004151540.1|  PREDICTED: auxin-induced protein 5NG4-like         190   3e-52    
emb|CDP00196.1|  unnamed protein product                                189   6e-52    
ref|XP_006471332.1|  PREDICTED: WAT1-related protein At5g07050-like     189   8e-52    
ref|XP_006470388.1|  PREDICTED: WAT1-related protein At5g40240-li...    187   8e-52    
ref|XP_002323220.2|  hypothetical protein POPTR_0016s03120g             189   8e-52    
ref|XP_006579558.1|  PREDICTED: WAT1-related protein At3g28050-like     188   8e-52    
gb|KDP32785.1|  hypothetical protein JCGZ_12077                         188   9e-52    
gb|KFK25097.1|  hypothetical protein AALP_AA8G066000                    189   9e-52    
ref|XP_010434957.1|  PREDICTED: WAT1-related protein At4g15540-li...    187   1e-51    
gb|AET01174.2|  nodulin MtN21/EamA-like transporter family protein      188   1e-51    
gb|EYU20823.1|  hypothetical protein MIMGU_mgv1a008005mg                188   1e-51    
ref|XP_010319590.1|  PREDICTED: WAT1-related protein At1g70260-like     187   1e-51    
ref|XP_010434956.1|  PREDICTED: WAT1-related protein At4g15540-li...    187   1e-51    
gb|KHN32576.1|  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase...    189   1e-51    
gb|KHF98992.1|  Auxin-induced 5NG4                                      184   1e-51    
ref|XP_006432378.1|  hypothetical protein CICLE_v10001335mg             188   2e-51    
ref|XP_010111743.1|  hypothetical protein L484_008401                   186   2e-51    
ref|XP_010091381.1|  Auxin-induced protein 5NG4                         187   2e-51    
ref|XP_002308862.2|  hypothetical protein POPTR_0006s03200g             188   2e-51    
ref|NP_566833.1|  WAT1-related protein                                  184   2e-51    
ref|XP_010468810.1|  PREDICTED: WAT1-related protein At4g15540-like     187   2e-51    
ref|XP_011021652.1|  PREDICTED: WAT1-related protein At1g70260-like     187   2e-51    



>ref|XP_009594126.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Nicotiana 
tomentosiformis]
Length=352

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 187/330 (57%), Positives = 248/330 (75%), Gaps = 7/330 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTLNK ATTRGMSNF+F+ YSNALAL FLLPST +YHR+ P   L F +F R+ + ALLS
Sbjct  23    NTLNKAATTRGMSNFVFIFYSNALALFFLLPSTFIYHRIKPCRKLYFSMFCRMFLLALLS  82

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q L Y GIEYS+PTLASAM DL+PAFTF+ A++AGME L LK +SS+AK IGTI L+
Sbjct  83    CSVQILLYFGIEYSNPTLASAMTDLVPAFTFLIALIAGMEKLGLKVKSSMAKFIGTITLL  142

Query  513   TGAFVITFYKGPPLL----LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              GA ++TFY+GPP+      F  +++  L+  +SNWI+G F+L  ++  +++L++VQAWI
Sbjct  143   IGALLMTFYRGPPIFSNKSKFSKSFHQLLITTKSNWIIGGFLLGAANFLLALLYIVQAWI  202

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             + D+P E M+T +TC LVTI+SA+  + AERN ++W+L+PD+ELI ICY AI+MV  RS+
Sbjct  203   INDFPEEFMVTTVTCGLVTIMSAVVGLFAERNPSSWRLKPDLELITICYAAILMVFLRSL  262

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             +Y WA++KKGPVFV M  PLGMVAAVI+GVTFL D L+ G+VIG +IIA GFY+VMWGKA
Sbjct  263   IYVWALKKKGPVFVVMVKPLGMVAAVILGVTFLGDVLHVGNVIGGTIIAFGFYSVMWGKA  322

Query  1041  ME--VKENIETNIDNSNEKVPLLPPNKGDS  1124
              E    E+I  +  ++   VPLL   + DS
Sbjct  323   KEEICVEDIGMDSGSATTTVPLL-SRQSDS  351



>ref|XP_009767073.1| PREDICTED: WAT1-related protein At3g28050-like [Nicotiana sylvestris]
Length=352

 Score =   367 bits (941),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 186/330 (56%), Positives = 247/330 (75%), Gaps = 6/330 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTLNK ATTRGMSNF+F+ YSNALAL FLLPST ++HR+ P   L F +F R+ + ALLS
Sbjct  23    NTLNKAATTRGMSNFVFIFYSNALALFFLLPSTFIHHRIRPCRKLNFSMFCRMLLLALLS  82

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q L Y GIEYS+PTLASAM DL+PAFTF+ A +AGME L LK +SSLAK IGTI L+
Sbjct  83    CSVQILLYFGIEYSNPTLASAMTDLVPAFTFLIAAIAGMEKLGLKVKSSLAKFIGTITLL  142

Query  513   TGAFVITFYKGPPLLL----FQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              GA ++TFY+GPP+      F   ++  L+  +SNWILG F+L +++  +++L++VQAWI
Sbjct  143   IGALIVTFYRGPPIFFNKSKFPKYFHQLLITTKSNWILGGFLLGSANFLLALLYIVQAWI  202

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             + D+P E M+T +TC LVTI+SA+  +IAE N ++W+L+PD+ELI ICY AI+MV  RS+
Sbjct  203   INDFPEEFMVTTVTCGLVTIMSAVVGLIAEPNPSSWRLKPDLELITICYAAILMVFLRSL  262

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             ++ WA++KKGPVFV M  PLGMVAAVI+GVTFL D L+ G+VIG +IIALGFY+VMWGKA
Sbjct  263   IFVWALKKKGPVFVVMVKPLGMVAAVILGVTFLGDVLHVGNVIGGTIIALGFYSVMWGKA  322

Query  1041  ME--VKENIETNIDNSNEKVPLLPPNKGDS  1124
              E    E+I  +  ++   VPLL     ++
Sbjct  323   KEEICVEDIGMDSGSATTTVPLLHRQSDNA  352



>ref|XP_009594124.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009594125.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Nicotiana 
tomentosiformis]
Length=353

 Score =   363 bits (931),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 248/331 (75%), Gaps = 8/331 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYH-RLMPPPVLTFGIFGRICITALL  329
             NTLNK ATTRGMSNF+F+ YSNALAL FLLPST +YH R+ P   L F +F R+ + ALL
Sbjct  23    NTLNKAATTRGMSNFVFIFYSNALALFFLLPSTFIYHSRIKPCRKLYFSMFCRMFLLALL  82

Query  330   SYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVL  509
             S + Q L Y GIEYS+PTLASAM DL+PAFTF+ A++AGME L LK +SS+AK IGTI L
Sbjct  83    SCSVQILLYFGIEYSNPTLASAMTDLVPAFTFLIALIAGMEKLGLKVKSSMAKFIGTITL  142

Query  510   ITGAFVITFYKGPPLL----LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
             + GA ++TFY+GPP+      F  +++  L+  +SNWI+G F+L  ++  +++L++VQAW
Sbjct  143   LIGALLMTFYRGPPIFSNKSKFSKSFHQLLITTKSNWIIGGFLLGAANFLLALLYIVQAW  202

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I+ D+P E M+T +TC LVTI+SA+  + AERN ++W+L+PD+ELI ICY AI+MV  RS
Sbjct  203   IINDFPEEFMVTTVTCGLVTIMSAVVGLFAERNPSSWRLKPDLELITICYAAILMVFLRS  262

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             ++Y WA++KKGPVFV M  PLGMVAAVI+GVTFL D L+ G+VIG +IIA GFY+VMWGK
Sbjct  263   LIYVWALKKKGPVFVVMVKPLGMVAAVILGVTFLGDVLHVGNVIGGTIIAFGFYSVMWGK  322

Query  1038  AME--VKENIETNIDNSNEKVPLLPPNKGDS  1124
             A E    E+I  +  ++   VPLL   + DS
Sbjct  323   AKEEICVEDIGMDSGSATTTVPLL-SRQSDS  352



>ref|XP_004238687.1| PREDICTED: WAT1-related protein At3g28050-like [Solanum lycopersicum]
Length=350

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/329 (54%), Positives = 241/329 (73%), Gaps = 7/329 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTLNK ATTRGMSNF+F+ Y+NALAL FL+PST +YHR+ P   L F IF R+ + A LS
Sbjct  23    NTLNKAATTRGMSNFVFIFYANALALFFLVPSTFIYHRMRPCRKLNFSIFSRMILIAFLS  82

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q L Y GI YS+P LASAM D+IPAFTF+ AV+AGME L LK +SSLAK IGTI+LI
Sbjct  83    CSVQILWYFGIGYSNPILASAMTDVIPAFTFLIAVIAGMEKLGLKLKSSLAKFIGTIILI  142

Query  513   TGAFVITFYKGPPLLLFQ-----HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
              GA ++TFY GPP+   Q     + ++   +  +SNWILG F+L T++L +++L++VQAW
Sbjct  143   IGALLMTFYIGPPIFSNQSITPLNNFHQLQISTKSNWILGGFLLATANLLLAILYIVQAW  202

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
              + DYP E ++T +TC LVTI+S +  +IAE+N+++W+L+PD+ELI +CY AI+M+  RS
Sbjct  203   TINDYPEEFVVTTVTCGLVTIISGVVGLIAEQNLSSWRLKPDLELITVCYAAILMIVLRS  262

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             +V+ WA++KKGPVFV M  PLGM+ AVIMGV FL D L+ G++IG  IIALGFY+VMWGK
Sbjct  263   LVFIWALKKKGPVFVVMIKPLGMIVAVIMGVIFLGDVLHVGNIIGGMIIALGFYSVMWGK  322

Query  1038  AMEVKENIETNIDNSNEKVPLLPPNKGDS  1124
             + E  E    +I   + +V LL     ++
Sbjct  323   SKE--EMCVEDITKDSTRVSLLHRQSDNN  349



>ref|XP_006355989.1| PREDICTED: WAT1-related protein At5g40240-like [Solanum tuberosum]
Length=340

 Score =   338 bits (866),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 176/329 (53%), Positives = 240/329 (73%), Gaps = 7/329 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTLNK ATTRGMSNF+F+ Y+NALAL FL+PST +YHR+ P   L F IF R+ + A LS
Sbjct  13    NTLNKAATTRGMSNFVFIFYANALALFFLVPSTFIYHRMRPCRKLNFSIFSRMILLAFLS  72

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q L   GI YS+P LASAM D++PAFTF+ AV+AGME L L+ +SSLAK IGT +LI
Sbjct  73    CSVQILLCFGIGYSNPILASAMTDVVPAFTFLIAVIAGMEKLGLRLKSSLAKFIGTTILI  132

Query  513   TGAFVITFYKGPPLLLFQ-----HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
              GA ++TFY+GPP+   Q     + ++   +  +SNWILG F+L T++L +++L++VQAW
Sbjct  133   LGALLMTFYRGPPIFSNQSITPSNNFHQLHISTKSNWILGGFLLATANLLLAILYIVQAW  192

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
              + DYP E ++T +TC LVTI+S +  +IAE+N+++W+L+PD+ELI +CY AI+M+  RS
Sbjct  193   TINDYPEEFVVTTVTCGLVTIISGVVGLIAEQNLSSWRLKPDLELITVCYAAILMIVLRS  252

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             +V+ WA++KKGPVFV M  PLGM+AAVIMGV FL D L+ G++IG  IIALGFY VMWGK
Sbjct  253   LVFIWALKKKGPVFVVMIKPLGMIAAVIMGVIFLGDVLHVGNIIGGMIIALGFYCVMWGK  312

Query  1038  AMEVKENIETNIDNSNEKVPLLPPNKGDS  1124
             A E  E    +I   + +V LL     ++
Sbjct  313   AEE--EMCVKDISKDSTRVSLLHRQSDNN  339



>ref|XP_002266639.2| PREDICTED: WAT1-related protein At5g40210-like [Vitis vinifera]
 emb|CBI32109.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   325 bits (833),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 171/324 (53%), Positives = 233/324 (72%), Gaps = 8/324 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NT++K A +RGMSNF+FV+YSN  A+ FLL S +L+HR   PP LT  I  RI +  L+S
Sbjct  21    NTISKAAMSRGMSNFVFVVYSNTFAIPFLLLSCLLFHRRKTPPPLTTSILCRIFVLGLIS  80

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q   Y+GI YSSPTLASAM DL+PAFTFI A++  ME L L+ RSS AKSIGTI+ I
Sbjct  81    CSIQMFMYVGIRYSSPTLASAMTDLVPAFTFILAIITRMENLDLRVRSSRAKSIGTIMSI  140

Query  513   TGAFVITFYKGPPL----LLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
             TGA  +T Y+GPP+    L       N  LPQ SNW++G  +   ++  +++LF+ Q  I
Sbjct  141   TGALTMTMYEGPPVAFTSLTSTKLNGNVTLPQ-SNWVIGGILSAIAAFMLAVLFVFQTSI  199

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             ++ YP ELM+T+I C  V + S+I +++AERN +AW+LRPD+ELIAI Y+A+++VG RSV
Sbjct  200   IRAYPAELMVTLICCTFVAMQSSIVSLMAERNPSAWRLRPDIELIAIVYSAVLVVGLRSV  259

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
               AW +R+KGP F AMF P+G++ AV+MGVTFL D LY GSV+GA+IIA+GFYTVMWGK 
Sbjct  260   ASAWVMRRKGPFFAAMFKPVGIIIAVVMGVTFLGDTLYLGSVVGAAIIAIGFYTVMWGKD  319

Query  1041  ME--VKENIETN-IDNSNEKVPLL  1103
              E  + E++  + +++S+  VPLL
Sbjct  320   KEETLLEDVPAHGMESSSHNVPLL  343



>ref|XP_002265468.2| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Vitis 
vinifera]
Length=348

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 172/329 (52%), Positives = 232/329 (71%), Gaps = 5/329 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +TL+K A  RGMS+F+FV+YSNAL++  LL   +L+HR   PP LT  I  RI I   +S
Sbjct  21    STLSKAAMRRGMSDFVFVVYSNALSVPILLFCCLLFHRRRFPPPLTLSILCRIFILGFIS  80

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q   ++GI YSSPTLASAM DL+PAFTFI A+++ ME L LK  S  AK IGTIV I
Sbjct  81    CSTQMFLFVGIRYSSPTLASAMTDLVPAFTFILAIISRMEKLDLKAGSCRAKCIGTIVSI  140

Query  513   TGAFVITFYKGPPLLLFQHAYY---NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
              GA ++T YKGP +      +     +L  Q SNW++G F+L  S++ I++ ++VQ  I+
Sbjct  141   IGALIVTIYKGPQIAFASSTFKILDENLRSQISNWVIGGFLLAISAVSIALFYVVQTSII  200

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +DYP ELMLT I    VT+ S+I ++IAER+ +AW+L+PD+ELIA+ Y+A++++ FR   
Sbjct  201   RDYPAELMLTFICHIFVTMQSSIVSLIAERDPSAWRLKPDVELIAVGYSAVLVLAFRGTA  260

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             +AW + KKGPVFVAMF P+ +V AV+MGVTFL D L+ GSVIGA+IIA GFYTVMWGKA 
Sbjct  261   HAWVLHKKGPVFVAMFKPVAIVIAVVMGVTFLGDVLHLGSVIGAAIIAFGFYTVMWGKAK  320

Query  1044  EVKENIETN-IDNSNEKVPLLPPNKGDSV  1127
             E  E++ T+ ID+S+ K PLL  NK   V
Sbjct  321   EEIEDMTTSGIDSSSHKDPLL-QNKSTQV  348



>gb|KHN00335.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=349

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 182/329 (55%), Positives = 227/329 (69%), Gaps = 16/329 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K A T GMSNF+F++YSN LAL FL+PST LYHR   PP +   I  RI + + LS
Sbjct  23    NTLIKAANTNGMSNFVFIVYSNFLALFFLIPSTFLYHRKRAPPPIPSSILWRIFLLSCLS  82

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A QTL Y GI YSSPTL SAM+DL+PAFTFIFA+++ ME L+LK RSS AK IGT++ I
Sbjct  83    TAVQTLTYTGIAYSSPTLNSAMSDLVPAFTFIFAIISRMENLNLKLRSSHAKIIGTVISI  142

Query  513   TGAFVITFYKGPPL---------LLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFL  665
              GA +IT YKG PL         L    AY    L  Q +WI+G F+L TSSL +S+LF+
Sbjct  143   AGALIITLYKGMPLTGSSMRNLVLGGSEAY----LSVQLDWIIGGFLLATSSLCLSVLFI  198

Query  666   VQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMV  845
             VQ WI+KDYP EL++T I C+ V ILS I A+ AE N  AW L+ + ELIA+ Y+AI +V
Sbjct  199   VQTWIIKDYPEELVVTTICCSPVVILSTIVALFAEANPRAWILKSNKELIAVFYSAIFVV  258

Query  846   GFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTV  1025
               RSVVY WA+RKKGPV+VAMF PLGMV A+ MGV FL + LY GS+IGA+ I +GFY V
Sbjct  259   SMRSVVYTWAMRKKGPVYVAMFSPLGMVIAIGMGVIFLGESLYLGSMIGAATIGIGFYAV  318

Query  1026  MWGKAMEVKENIETNIDN---SNEKVPLL  1103
             MW +A + K   E N ++   ++   PLL
Sbjct  319   MWAQAQDEKLVNEKNENHDFVTSSSAPLL  347



>ref|XP_003519813.1| PREDICTED: WAT1-related protein At3g28050-like [Glycine max]
Length=349

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 182/329 (55%), Positives = 226/329 (69%), Gaps = 16/329 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K A T GMSNF+F++YSN LAL FL+PST LYHR   PP +   I  RI +   LS
Sbjct  23    NTLIKAANTNGMSNFVFIVYSNFLALFFLIPSTFLYHRKRAPPPIPSSILWRIFLLCCLS  82

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A QTL Y GI YSSPTL SAM+DL+PAFTFIFA+++ ME L+LK RSS AK IGT++ I
Sbjct  83    TAVQTLTYTGIAYSSPTLNSAMSDLVPAFTFIFAIISRMENLNLKLRSSHAKIIGTVISI  142

Query  513   TGAFVITFYKGPPL---------LLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFL  665
              GA +IT YKG PL         L    AY    L  Q +WI+G F+L TSSL +S+LF+
Sbjct  143   AGALIITLYKGMPLTGSSMRNLVLGGSEAY----LSVQLDWIIGGFLLATSSLCLSVLFI  198

Query  666   VQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMV  845
             VQ WI+KDYP EL++T I C+ V ILS I A+ AE N  AW L+ + ELIA+ Y+AI +V
Sbjct  199   VQTWIIKDYPEELVVTTICCSPVVILSTIVALFAEANPRAWILKSNKELIAVFYSAIFVV  258

Query  846   GFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTV  1025
               RSVVY WA+RKKGPV+VAMF PLGMV A+ MGV FL + LY GS+IGA+ I +GFY V
Sbjct  259   SMRSVVYTWAMRKKGPVYVAMFSPLGMVIAIGMGVIFLGESLYLGSMIGAATIGIGFYAV  318

Query  1026  MWGKAMEVKENIETNIDN---SNEKVPLL  1103
             MW +A + K   E N ++   ++   PLL
Sbjct  319   MWAQAQDEKLVNEKNENHDFVTSSSAPLL  347



>gb|AFK41997.1| unknown [Lotus japonicus]
Length=346

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/331 (53%), Positives = 231/331 (70%), Gaps = 14/331 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  G+SN++F++YSN LAL FLLP+TIL+HR   PP +   I  RI + + LS
Sbjct  23    NTLVKSATDSGLSNYVFIVYSNLLALCFLLPATILHHRKSAPPPIPSSILRRIFLLSCLS  82

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A QTL Y GI YSSPTLASAM DL+PAFTF  AV++ ME L+LK  SS AK +GT+V I
Sbjct  83    TAVQTLLYNGIGYSSPTLASAMIDLVPAFTFTLAVISRMENLNLKLHSSQAKIVGTLVSI  142

Query  513   TGAFVITFYKGPPLLLFQHAYYN-------SLLPQQSNWILGSFILVTSSLFISMLFLVQ  671
              GA ++T Y+G P++  + +  N       + L  QSNWILG F+L T+   +S+L++VQ
Sbjct  143   AGALILTLYQGMPII--RGSMQNLVLGGSGTYLSVQSNWILGGFLLATACFIVSVLYIVQ  200

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
              WI+++YP EL++T + C++V +LSAI  +IAE    AW LRPD EL+A+CY+AI +V  
Sbjct  201   TWIMREYPEELVVTTVCCSMVVVLSAIVGLIAEGTSRAWILRPDKELVAVCYSAIFVVTM  260

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
             RSVVYAWA RKKGP++VAMF PLGMV AV++GV FL D LY GS+IGA IIA+GFY V+W
Sbjct  261   RSVVYAWAFRKKGPIYVAMFSPLGMVIAVVLGVLFLGDILYLGSLIGAVIIAIGFYGVIW  320

Query  1032  GKAMEVKENIETNIDNSNEKVPLLPPNKGDS  1124
              +A E     E +  +S+   PL+     D+
Sbjct  321   AQAQE-----ENDFASSSSSAPLIYSKGIDA  346



>ref|XP_003613285.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES96243.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=344

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 173/311 (56%), Positives = 216/311 (69%), Gaps = 5/311 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  GMS F+F  YSN  AL FLLP T  YHR   PP ++  I  R+ + + LS
Sbjct  23    NTLIKAATNDGMSIFVFTFYSNLFALCFLLPLTFFYHRKRAPPSISSSILCRMFLLSCLS  82

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A Q L   GIE SSPTLASAM DL+PAFTFI A+++ ME L+LK  SS AK IGT+V I
Sbjct  83    TAVQILTNTGIECSSPTLASAMLDLLPAFTFILALISRMENLNLKHHSSQAKIIGTVVSI  142

Query  513   TGAFVITFYKGPPLL--LFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
              GA  +T YKG PL+   FQ+    +    L  +S+WILG+F+L T+S  +S+L++VQ W
Sbjct  143   AGALTVTLYKGIPLISDAFQNIEIGASGIHLSVKSDWILGAFLLATASFCLSVLYIVQTW  202

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I++DYP EL++T I C++V ILSAI A+IAE N   W LRPD EL+A+CY+AI +V  RS
Sbjct  203   IIRDYPEELVVTSICCSMVVILSAIVALIAEGNSKVWILRPDRELVAVCYSAICVVSMRS  262

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             VVY WA RKKGP++VAMF PLGMV A+ MGV FL D LY GS+IGA+IIA+GFY VMW +
Sbjct  263   VVYTWAFRKKGPIYVAMFNPLGMVIALGMGVIFLGDSLYLGSMIGAAIIAIGFYAVMWAQ  322

Query  1038  AMEVKENIETN  1070
             A E     E  
Sbjct  323   AQEEHTTCENK  333



>gb|AFK41851.1| unknown [Medicago truncatula]
Length=344

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 215/311 (69%), Gaps = 5/311 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  G S F+F  YSN  AL FLLP T  YHR   PP ++  I  R+ + + LS
Sbjct  23    NTLIKAATNDGTSIFVFTFYSNLFALCFLLPLTFFYHRKRAPPSISSSILCRMFLLSCLS  82

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A Q L   GIE SSPTLASAM DL+PAFTFI A+++ ME L+LK  SS AK IGT+V I
Sbjct  83    TAVQILTNTGIECSSPTLASAMLDLLPAFTFILALISRMENLNLKHHSSQAKIIGTVVSI  142

Query  513   TGAFVITFYKGPPLL--LFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
              GA  +T YKG PL+   FQ+    +    L  +S+WILG+F+L T+S  +S+L++VQ W
Sbjct  143   AGALTVTLYKGIPLISDAFQNIEIGASGIHLSVKSDWILGAFLLATASFCLSVLYIVQTW  202

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I++DYP EL++T I C++V ILSAI A+IAE N   W LRPD EL+A+CY+AI +V  RS
Sbjct  203   IIRDYPEELVVTSICCSMVVILSAIVALIAEGNSKVWILRPDRELVAVCYSAICVVSMRS  262

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             VVY WA RKKGP++VAMF PLGMV A+ MGV FL D LY GS+IGA+IIA+GFY VMW +
Sbjct  263   VVYTWAFRKKGPIYVAMFNPLGMVIALGMGVIFLGDSLYLGSMIGAAIIAIGFYAVMWAQ  322

Query  1038  AMEVKENIETN  1070
             A E     E  
Sbjct  323   AQEEHTTCENK  333



>gb|AFK49074.1| unknown [Medicago truncatula]
Length=350

 Score =   318 bits (815),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 218/311 (70%), Gaps = 5/311 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +TL K AT  GMS FIF++YSN LAL FLLPST+ +HR   PP ++  IF RI +   L 
Sbjct  23    DTLMKAATKDGMSIFIFIVYSNLLALCFLLPSTLFHHRKRAPPPISTSIFCRIFVFGCLR  82

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A QTL   GI +SSPTLASAM D++PAFTFI A+++ ME+L++K+ SS AK IGT+V I
Sbjct  83    TATQTLMASGIRFSSPTLASAMVDIVPAFTFILAIISRMEVLNMKKHSSQAKVIGTVVSI  142

Query  513   TGAFVITFYKGPPLL--LFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
              GA V+TFYKG PL+    QH    +    L  +S+WILG+F+L  +   +S+LF+VQ W
Sbjct  143   AGALVVTFYKGMPLINDAIQHIEIGASGIYLLGKSDWILGAFLLAVACFCLSLLFIVQTW  202

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I+KDYP EL++T I C  V I+S I A+IAE N  AW+LRPD EL+++CY+A   V  ++
Sbjct  203   IVKDYPEELVITTICCCFVVIISTIVALIAEGNSKAWRLRPDKELLSVCYSAAFAVSLKN  262

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             VV  WA RKKGP++VA F PL +V A+ MGV FL D+LY GSVIGA+II +GFY V+W K
Sbjct  263   VVNTWACRKKGPIYVATFNPLRVVIALGMGVIFLGDNLYLGSVIGAAIIVIGFYAVIWAK  322

Query  1038  AMEVKENIETN  1070
             A E +   E N
Sbjct  323   AQEEQTTSENN  333



>emb|CBI32117.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   311 bits (798),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 166/318 (52%), Positives = 224/318 (70%), Gaps = 5/318 (2%)
 Frame = +3

Query  186   MSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAGQTLQYIGI  365
             MS+F+FV+YSNAL++  LL   +L+HR   PP LT  I  RI I   +S + Q   ++GI
Sbjct  1     MSDFVFVVYSNALSVPILLFCCLLFHRRRFPPPLTLSILCRIFILGFISCSTQMFLFVGI  60

Query  366   EYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAFVITFYKG  545
              YSSPTLASAM DL+PAFTFI A+++ ME L LK  S  AK IGTIV I GA ++T YKG
Sbjct  61    RYSSPTLASAMTDLVPAFTFILAIISRMEKLDLKAGSCRAKCIGTIVSIIGALIVTIYKG  120

Query  546   PPLLLFQHAYY---NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPGELMLTV  716
             P +      +     +L  Q SNW++G F+L  S++ I++ ++VQ  I++DYP ELMLT 
Sbjct  121   PQIAFASSTFKILDENLRSQISNWVIGGFLLAISAVSIALFYVVQTSIIRDYPAELMLTF  180

Query  717   ITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAVRKKGPV  896
             I    VT+ S+I ++IAER+ +AW+L+PD+ELIA+ Y+A++++ FR   +AW + KKGPV
Sbjct  181   ICHIFVTMQSSIVSLIAERDPSAWRLKPDVELIAVGYSAVLVLAFRGTAHAWVLHKKGPV  240

Query  897   FVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKENIETN-I  1073
             FVAMF P+ +V AV+MGVTFL D L+ GSVIGA+IIA GFYTVMWGKA E  E++ T+ I
Sbjct  241   FVAMFKPVAIVIAVVMGVTFLGDVLHLGSVIGAAIIAFGFYTVMWGKAKEEIEDMTTSGI  300

Query  1074  DNSNEKVPLLPPNKGDSV  1127
             D+S+ K PLL  NK   V
Sbjct  301   DSSSHKDPLL-QNKSTQV  317



>gb|KDP21320.1| hypothetical protein JCGZ_21791 [Jatropha curcas]
Length=345

 Score =   312 bits (800),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 164/329 (50%), Positives = 229/329 (70%), Gaps = 7/329 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +T+ K A  +GMS F++++YSNA AL  LLPS+ +++R   PP L   IF RI + +++S
Sbjct  12    STIMKAAMNKGMSQFVYIVYSNAFALFILLPSSFIFYRERSPPKLNACIFSRILLLSIVS  71

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             ++ QTL   GI+YSSPTL +AMADL PAFT + +V+  ME L  + +SS AKSIGTI+ +
Sbjct  72    FSIQTLFNTGIKYSSPTLCTAMADLTPAFTVLLSVIFRMEKLEFRLQSSQAKSIGTIISV  131

Query  513   TGAFVITFYKGPPLLLFQHAYY--NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILK  686
              GA +++ YKG  L++   AY   + LL   SNW++G       +L ++ L++VQ WILK
Sbjct  132   AGALIVSLYKGQ-LIIANVAYQIDDQLLLLSSNWVIGGIFCAVGALCLASLYIVQTWILK  190

Query  687   DYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVY  866
             +YP ELM+T+I+C  VT+LSA+ ++I E++ NAW L+PD+EL AI  +AI  V  RSVV+
Sbjct  191   EYPTELMVTLISCIFVTLLSAVVSLIVEKDSNAWILKPDVELTAILCSAIFAVSLRSVVH  250

Query  867   AWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME  1046
             AWA R+KGP++ AMF PL MV A  MGV+FL D+LY GSVIG  IIALGFYTV+WGK+ E
Sbjct  251   AWACREKGPLYTAMFKPLRMVIATFMGVSFLADNLYVGSVIGGIIIALGFYTVIWGKSQE  310

Query  1047  VKENIET----NIDNSNEKVPLLPPNKGD  1121
              K + E     N+D+S+ K+PLL     D
Sbjct  311   EKMDEEDKGNPNLDSSSHKIPLLRNKSTD  339



>ref|XP_006483805.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Citrus 
sinensis]
Length=352

 Score =   313 bits (801),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 223/323 (69%), Gaps = 6/323 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalall-fllPSTILYHRLMPPPVLTFGIFGRICITALL  329
             +TLNK A  +G S+F+ ++YSNA A +  LLPST +Y+R    P LT  I  +I    L+
Sbjct  21    STLNKAAMNKGTSDFVLIVYSNAFAAIFILLPSTFIYYRNRTRPPLTVSIICKIFGLGLI  80

Query  330   SYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVL  509
             S   QT  Y+GI YSSPTL+SA+ DL PAFTFI A+++ ME L L+ +SSLAKSIGT+V 
Sbjct  81    SCCVQTCLYVGIGYSSPTLSSAIVDLTPAFTFILALISRMEKLDLRVQSSLAKSIGTMVS  140

Query  510   ITGAFVITFYKGPPLLLFQHA--YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
             I GA  +T YKGP L+    +   +N L   Q NWI+G  +L  SS F+S+L++VQ  I+
Sbjct  141   IAGALTVTLYKGPALVSMSSSSNLHNELRSPQKNWIIGGLVLAASSFFLSLLYIVQTSII  200

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             ++YP ELM T I C  VTI S + A+IAERN N+W+L+PDMELIAI  +A   V  RS+ 
Sbjct  201   REYPEELMATFICCVFVTIQSTVVALIAERNPNSWRLKPDMELIAIGCSAFFAVALRSLA  260

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA  KKGPV+V+M+ PLG+V A+IMGVT L D LY GSV+GA+I+A GFY+V+WG++ 
Sbjct  261   HTWACHKKGPVYVSMYKPLGIVFAIIMGVTLLGDTLYLGSVVGATIVAFGFYSVIWGQSE  320

Query  1044  EVKENIETNID---NSNEKVPLL  1103
             E K   + +ID   +S+ K PLL
Sbjct  321   EEKMIDDKDIDSLKSSSPKAPLL  343



>ref|XP_003613286.1| Auxin-induced protein 5NG4 [Medicago truncatula]
Length=356

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 216/323 (67%), Gaps = 17/323 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  GMS F+F  YSN  AL FLLP T  YHR   PP ++  I  R+ + + LS
Sbjct  23    NTLIKAATNDGMSIFVFTFYSNLFALCFLLPLTFFYHRKRAPPSISSSILCRMFLLSCLS  82

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A Q L   GIE SSPTLASAM DL+PAFTFI A+++ ME L+LK  SS AK IGT+V I
Sbjct  83    TAVQILTNTGIECSSPTLASAMLDLLPAFTFILALISRMENLNLKHHSSQAKIIGTVVSI  142

Query  513   TGAFVITFYKGPPLL--LFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQ--  671
              GA  +T YKG PL+   FQ+    +    L  +S+WILG+F+L T+S  +S+L++VQ  
Sbjct  143   AGALTVTLYKGIPLISDAFQNIEIGASGIHLSVKSDWILGAFLLATASFCLSVLYIVQVN  202

Query  672   ----------AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAI  821
                        WI++DYP EL++T I C++V ILSAI A+IAE N   W LRPD EL+A+
Sbjct  203   KSFRILYPLRTWIIRDYPEELVVTSICCSMVVILSAIVALIAEGNSKVWILRPDRELVAV  262

Query  822   CYNAIIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASI  1001
             CY+AI +V  RSVVY WA RKKGP++VAMF PLGMV A+ MGV FL D LY GS+IGA+I
Sbjct  263   CYSAICVVSMRSVVYTWAFRKKGPIYVAMFNPLGMVIALGMGVIFLGDSLYLGSMIGAAI  322

Query  1002  IALGFYTVMWGKAMEVKENIETN  1070
             IA+GFY VMW +A E     E  
Sbjct  323   IAIGFYAVMWAQAQEEHTTCENK  345



>ref|XP_002266096.1| PREDICTED: WAT1-related protein At5g40240 [Vitis vinifera]
 emb|CBI32110.3| unnamed protein product [Vitis vinifera]
Length=351

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/331 (51%), Positives = 232/331 (70%), Gaps = 9/331 (3%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL+K A  RGMS+++FV+YSNALA+  L   ++L+HR   PP LT  I  RI +  L+S 
Sbjct  23    TLSKAAMRRGMSDYVFVVYSNALAVPVLFLCSLLFHRRRSPPPLTPSILCRIFLLGLVSC  82

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             + Q L++IGI YSSPTLASAM +LIPAFT++ A+V  ME L LK +SS AK +GT+V + 
Sbjct  83    SLQMLKFIGIGYSSPTLASAMTNLIPAFTYVLAIVTRMEKLDLKVKSSRAKCLGTLVSVA  142

Query  516   GAFVITFYKGPPLLLFQHA----YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
             GA +IT YKGP +           +N LLP+ SNWI+G F+   ++  +++L + Q  I+
Sbjct  143   GALLITIYKGPGIEFASTTPSMLNHNLLLPR-SNWIIGGFLTAAAAFMVAVLLVFQTSII  201

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +DYP EL++T+I+    T+ S++ ++IAER+ +AW+LR DMELIA+ Y+ I +V  R  V
Sbjct  202   RDYPAELIVTLISHIFATMQSSLVSLIAERDPSAWRLRLDMELIAVGYSGIFVVALRGAV  261

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             YAW + +KGPVFVAMF P G+V AVIMGVTFL D L+ GSVIGA+IIALGFYTV+WGKA 
Sbjct  262   YAWVLHQKGPVFVAMFKPAGIVIAVIMGVTFLGDKLHLGSVIGAAIIALGFYTVVWGKAK  321

Query  1044  EVK--ENI-ETNIDNSNEKVPLLPPNKGDSV  1127
             E K  E+I    ++ S+ +VPLL  NK   V
Sbjct  322   EEKMAEDIAACGVNTSSHRVPLL-QNKSTEV  351



>gb|KDO82537.1| hypothetical protein CISIN_1g018663mg [Citrus sinensis]
Length=352

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 164/323 (51%), Positives = 221/323 (68%), Gaps = 6/323 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalall-fllPSTILYHRLMPPPVLTFGIFGRICITALL  329
             +TLNK A  +G S+F+ ++YSNA A +  LLPST +Y+R    P LT  I  +I    L+
Sbjct  21    STLNKAAMNKGTSDFVLIVYSNAFAAIFILLPSTFIYYRNRTRPPLTVSIICKIFGLGLI  80

Query  330   SYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVL  509
             S   QT  Y+GI YSSPTL+SA+ DL PAFTFI A+++ ME L L+ +SSLAKSIGT+V 
Sbjct  81    SCCVQTCLYVGIGYSSPTLSSAIVDLTPAFTFILALISRMEKLDLRVQSSLAKSIGTMVS  140

Query  510   ITGAFVITFYKGPPLLLFQHA--YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
             I GA  +T YKGP L+    +   +N L   Q NWI+G  +L   S F+S+L++VQ  I+
Sbjct  141   IAGALTVTLYKGPALVSMSSSSNLHNELRSPQKNWIIGGLVLAAGSFFLSLLYIVQTSII  200

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             ++YP ELM T I C  VTI S + A+IAERN N+W+L+PD ELIAI  +A   V  RS+ 
Sbjct  201   REYPEELMATFICCVFVTIQSTVVALIAERNPNSWRLKPDTELIAIGCSAFFAVALRSLA  260

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA  KKGPV+V+M+ PLG+V A+IMGVT L D LY GSV+GA+I+A GFY+V+WG++ 
Sbjct  261   HTWACHKKGPVYVSMYKPLGIVFAIIMGVTLLGDTLYLGSVVGATIVAFGFYSVIWGQSE  320

Query  1044  EVKENIETNID---NSNEKVPLL  1103
             E K   + +ID   +S+ K PLL
Sbjct  321   EEKMIDDKDIDSLKSSSPKAPLL  343



>ref|XP_007044589.1| Auxin-induced protein 5NG4, putative [Theobroma cacao]
 gb|EOY00421.1| Auxin-induced protein 5NG4, putative [Theobroma cacao]
Length=350

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 228/330 (69%), Gaps = 11/330 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NT+NK A  RG+S+F+ VLYSN LA+  L P   +++R   PP+LT+    +I +  +LS
Sbjct  21    NTVNKAAMNRGLSDFVLVLYSNILAIFILAPCIFIFYRKRTPPLLTWSSICKIFLLGVLS  80

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             YAGQ   Y G+ Y SPTLASAMADL PAFTF+F++++ ME L L  +SS AKS+GT+V I
Sbjct  81    YAGQICAYTGLGYGSPTLASAMADLSPAFTFLFSIISRMEKLDLGIKSSQAKSLGTLVSI  140

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQ-----QSNWILGSFILVTSSLFISMLFLVQAW  677
             +GA V+T YKG PL        N LL +     QSNW++G   L + S+  +++  VQ W
Sbjct  141   SGALVVTLYKGLPLT--STPSNNRLLGELLLIPQSNWVIGGIFLASHSVIFAIILNVQTW  198

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I++ YP E+++T+I    V ILS++ ++I E++ NAW+L  +MELIAI Y A   V FRS
Sbjct  199   IIRRYPAEMIVTLICSIFVCILSSLVSLIVEKDPNAWRLGLNMELIAIVYTAAFAVAFRS  258

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             VV+ WA+R+KGP++VAMF PLGMV A+ MGVT L D LY GS++GA+IIA+GFY V+WG+
Sbjct  259   VVHKWALRRKGPIYVAMFKPLGMVIALAMGVTLLGDTLYLGSLLGAAIIAIGFYAVIWGQ  318

Query  1038  AMEVK--ENIET-NIDNSNEKVPLLPPNKG  1118
             + E K  E+ E  + + S+ K PLL P++G
Sbjct  319   SQEEKMVEDAEIYDSERSSAKDPLL-PDRG  347



>gb|KDO82548.1| hypothetical protein CISIN_1g018256mg [Citrus sinensis]
Length=359

 Score =   305 bits (782),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 218/323 (67%), Gaps = 6/323 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NT+ K A +RG S+FI V+YSN LA+  L+PS+ +++R   PP LT+ I  RI +  LLS
Sbjct  20    NTVTKAAMSRGASHFILVVYSNTLAIFLLVPSSFIFYRKRTPPQLTWSIVCRIFLLGLLS  79

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
               GQ   Y GIE  SP LASAM DL P FTFI A++  ME L L+ +SS AKS GT++LI
Sbjct  80    CCGQMFHYFGIENGSPALASAMIDLTPGFTFILAIIFRMEKLELRVQSSQAKSFGTVLLI  139

Query  513   TGAFVITFYKGPPLLLF--QHAYYNSL--LPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              GA ++T YKG P+     ++   N L  LP  SNW +G   L   S+ +++ ++VQAWI
Sbjct  140   GGALIVTLYKGLPITSAPSKNKLINELVQLPL-SNWTIGGIFLAAHSVILAIYYIVQAWI  198

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             ++DYP ELM+T+I    VTILS+  +++AE+N NAW+LRPD+EL+AI Y+AI  V  RSV
Sbjct  199   VRDYPAELMVTLICSIFVTILSSAVSLVAEKNPNAWRLRPDIELMAIGYSAIFAVSVRSV  258

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
              + WA+RKKGPV+V+MF PLGMV A++ G+ FL D LY GS +GA+ IALGFY V+WG+A
Sbjct  259   FHTWALRKKGPVYVSMFKPLGMVVALVFGIAFLGDTLYLGSFVGAATIALGFYAVIWGQA  318

Query  1041  MEVK-ENIETNIDNSNEKVPLLP  1106
              E K +   T I       P +P
Sbjct  319   KEEKMDEDHTEISGFKPSSPCVP  341



>ref|XP_002531390.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF30974.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=354

 Score =   305 bits (782),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 222/332 (67%), Gaps = 8/332 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NT+ K A ++GMS++I V+YSN +A+  LL S+++++R    P +T  I  RI + +LLS
Sbjct  24    NTVTKAAMSKGMSHYILVVYSNMIAISLLLSSSLIFYRKRIAPAITLSIICRIFVLSLLS  83

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              AGQ   YIGI YSSPTLASAM DL PAFTFI  V + ME L L+ +S  AKSIGT+VLI
Sbjct  84    CAGQVFTYIGIGYSSPTLASAMIDLTPAFTFILGVFSRMERLDLRIKSGQAKSIGTMVLI  143

Query  513   TGAFVITFYKGPPLLLFQHA----YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              G  V T YKG P+     +    +   L    SNW +G F L   S+ ++++F++Q WI
Sbjct  144   IGGLVFTLYKGLPITGISSSGDELHKEMLFLSPSNWAIGGFFLAAHSIILALIFVIQTWI  203

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             ++DYP  L+  + TC  VTILSA  +++AE++ NAW+++PD++LI+I + A+  V  RSV
Sbjct  204   IRDYPSVLITNLFTCTFVTILSASVSLVAEKDPNAWRIKPDIQLISIGFTAVFAVSLRSV  263

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             V+ WA  KKGPV+ +MF P+GMV AV MGV+FL D LY GSVIGA IIA GFY VMWGK 
Sbjct  264   VHTWACHKKGPVYTSMFKPIGMVIAVFMGVSFLGDTLYLGSVIGAVIIAFGFYAVMWGKT  323

Query  1041  ME---VKENIETNIDNSNEKVPLLPPNKGDSV  1127
              E   V++  + + + S+ K PLL  NK  SV
Sbjct  324   QEENTVEDKEDCSFEPSSPKAPLL-QNKSTSV  354



>ref|XP_003613292.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES96250.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=350

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 212/303 (70%), Gaps = 5/303 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
              TL K AT  GMS FIF+ YSN LAL FLLPST+ +HR   PP ++  IF R+ +   L 
Sbjct  23    ETLMKSATKDGMSIFIFIFYSNLLALCFLLPSTLFHHRKRAPPPISTSIFCRLLLLGCLK  82

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A QTL   GI++SSP LASA+ +L+PAFTFI A+++ ME+L++K+ SS AK IGT+V I
Sbjct  83    TATQTLMTSGIKFSSPALASAIVNLVPAFTFILAIISRMEVLNMKKHSSQAKVIGTVVSI  142

Query  513   TGAFVITFYKGPPLLL-----FQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
              GA V+TFYKG PL+       +       L  +S+WI+G+F++   S  +S+LF+VQ W
Sbjct  143   AGALVVTFYKGIPLINDAIKNIEMGASGIFLLGKSDWIIGAFLVAVGSFCLSLLFIVQTW  202

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I++DYP EL++  I C  V I+S I A+IAE N NAW+LRPD EL+++CY+A  +   ++
Sbjct  203   IVRDYPEELVINTICCCFVVIISTIVALIAEGNSNAWRLRPDKELLSVCYSATFVESLKN  262

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             V+  WA RKKGP++VAMF PL +V A+ MGV FL D+LY GS+IGA+II +GFY V+W K
Sbjct  263   VIQTWACRKKGPIYVAMFKPLRVVIALSMGVIFLGDNLYLGSMIGAAIIVIGFYAVIWAK  322

Query  1038  AME  1046
             A E
Sbjct  323   AQE  325



>ref|XP_004489865.1| PREDICTED: WAT1-related protein At3g28050-like [Cicer arietinum]
Length=349

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 170/328 (52%), Positives = 221/328 (67%), Gaps = 9/328 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +TL K A+  GMS F+F  YSN LAL FL+PST LYHR   PP ++  I  R+ + + LS
Sbjct  24    DTLMKAASKDGMSIFVFNFYSNLLALSFLVPSTFLYHRKRAPPPISTSILCRLFLISCLS  83

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                QTL   GI YSSP+LASAM DL+PAFTFIFAV++ ME L+LK   S AK IGT+V I
Sbjct  84    TTVQTLMNTGIRYSSPSLASAMVDLVPAFTFIFAVISRMENLNLKHHISQAKVIGTMVSI  143

Query  513   TGAFVITFYKGPPLL--LFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
              GA ++T YKG  L+   F+     +    L  +S WILG+F+L T+S+ +S+LF+VQ W
Sbjct  144   AGALIVTLYKGKSLIGDAFKSTEMRASGIYLLDKSEWILGAFLLATASITLSLLFIVQTW  203

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
              +KDYP EL++T I C  V I +AI A+I E    AW L+ DMEL+++ Y+AI +V  RS
Sbjct  204   TIKDYPEELVVTTICCFFVVIQTAIVALIVEGISKAWTLKADMELVSVLYSAIFVVAMRS  263

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             VVY WA RKKGP++VAMF PL +  A  MGV FLRD+LY GS+IGA+IIA+GFY VMW +
Sbjct  264   VVYTWAFRKKGPIYVAMFNPLKVAIAFGMGVIFLRDNLYLGSMIGAAIIAIGFYVVMWAQ  323

Query  1038  AMEVKENIETNIDNSNEKVPLLPPNKGD  1121
             A E +   E ++  S+   PLL   K D
Sbjct  324   AQE-EHTSENHLPPSS--APLL-STKSD  347



>gb|AES96246.2| auxin-induced 5NG4-like protein [Medicago truncatula]
Length=349

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 167/328 (51%), Positives = 222/328 (68%), Gaps = 6/328 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +TL K AT  GMS FIF+ YSN LAL FLLPST+ +HR   PP ++  IF R+ + + L 
Sbjct  22    DTLMKSATKDGMSIFIFIFYSNILALCFLLPSTLFHHRKRSPPPISTSIFCRMLLLSCLF  81

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A Q L   GI YSSPTLASAM DL+PAFTFI AV++ ME+L++K+ SS AK IGT+V I
Sbjct  82    TAVQILMNTGIGYSSPTLASAMVDLVPAFTFILAVISRMEVLNMKKHSSQAKIIGTLVSI  141

Query  513   TGAFVITFYKGPPLL--LFQHAYYNSL---LPQQSNWILGSFILVTSSLFISMLFLVQAW  677
              GA  +T YKG PL+   FQ+    +    L  +S+WI+G+F+L T+S  +S+LF+ + W
Sbjct  142   VGALTVTLYKGMPLINGAFQNIEMGATEIYLLGKSDWIIGAFLLATASFLLSVLFITETW  201

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
              +K YP EL++T I  +LV I S I A+I E N NAW L+P+ EL+A+C++AI +V  RS
Sbjct  202   TIKAYPEELLVTSICISLVVIQSGIVALIVEGNSNAWILKPNKELVAVCFSAIFVVSLRS  261

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             VV  WA RKKGP++VAMF PL +V A+ MG+ FL ++LY GS+IGASII +GFY VMW +
Sbjct  262   VVNKWAFRKKGPIYVAMFNPLRVVIALGMGILFLGNNLYLGSMIGASIIVIGFYAVMWAQ  321

Query  1038  AMEVKENIETNIDNSNEKVPLLPPNKGD  1121
             A E     E +   S+   PLL     D
Sbjct  322   AQEEHTTSENDFLPSSS-TPLLSTKNID  348



>ref|XP_007044594.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
 ref|XP_007044596.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
 gb|EOY00426.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
 gb|EOY00428.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
Length=350

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/327 (49%), Positives = 212/327 (65%), Gaps = 6/327 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             + K A + GMSNF+FV YSNALA L LLPS+ L+HR   PP LTF I     +  LL   
Sbjct  25    MGKAAMSHGMSNFVFVFYSNALASLILLPSSFLFHRSERPP-LTFSILCWFFLLGLLGCF  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI YSSPTL +AM +LIP  TF+FAV   ME L L   SS AKS+GTIV I G
Sbjct  84    AQIFGYAGIYYSSPTLGTAMLNLIPGLTFLFAVAFRMEKLHLGSSSSQAKSLGTIVSIAG  143

Query  519   AFVITFYKGPPLLLFQHAYY--NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             AFV+TFYKGP +L+        +  L QQSNW+ G F+L    LF S   +VQA +LK +
Sbjct  144   AFVVTFYKGPSILMSSSRASSSHQFLLQQSNWVFGGFLLAADCLFASAWLIVQASVLKKF  203

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P EL++    C  VT+ SAI  ++ ER++++W  +PD+ L+A+ Y+A+    F+  V  W
Sbjct  204   PAELIVVFYYCFFVTLQSAIVCLVMERDLSSWSFKPDVRLVAVLYSAVFGSAFQLGVSTW  263

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              + + GPVFVAMF PLG+V +VIMGV FL D  Y GS++GA +I  GFY+VMWGKA E K
Sbjct  264   CLHRTGPVFVAMFKPLGIVISVIMGVIFLGDTFYLGSLLGAIVIVAGFYSVMWGKAKEGK  323

Query  1053  ENIETN---IDNSNEKVPLLPPNKGDS  1124
              ++      +++S++KVPLLP N G++
Sbjct  324   IDVYAQGMRLESSSQKVPLLPNNTGET  350



>gb|AEX97055.1| auxin-induced nodulin [Copaifera officinalis]
Length=347

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 161/306 (53%), Positives = 209/306 (68%), Gaps = 1/306 (0%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NT+ K A T GMSNF++V+YSN LAL  L+PS++LYHR    P LT  I  R+ +    +
Sbjct  21    NTMIKSANTNGMSNFVYVVYSNFLALCILVPSSLLYHRKKAAPPLTVSIVCRMFLVGFFA  80

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + QTL Y GI YSSPTL+ +  DLIPAFTF+ AVV+ ME L+ K + S AK +GT+V I
Sbjct  81    SSAQTLMYTGIGYSSPTLSCSQVDLIPAFTFLIAVVSRMENLNPKLKGSQAKMVGTVVSI  140

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             TGA ++T YKG PL    +  + +L   +SNW+LG  +L  +SL  S + ++Q WI+K+Y
Sbjct  141   TGALIVTLYKGLPLT-GAYQLHETLRSPKSNWLLGGLLLAVASLGNSFVLVIQTWIIKEY  199

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P EL++T I+C    I+S I A+IAE+N  AW L  DMEL+AI + AI +V  RSVV  W
Sbjct  200   PTELVVTTISCGFAVIVSTIIAVIAEKNPKAWSLHLDMELLAIIFCAIFVVSIRSVVQTW  259

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
             A RKKGP++VAMF PLGMV AV MG  FL D LY GS+IGA +IA+GFY V+WGKA E K
Sbjct  260   ACRKKGPLYVAMFNPLGMVIAVGMGFIFLGDALYLGSIIGAGVIAVGFYAVLWGKAQEEK  319

Query  1053  ENIETN  1070
                E N
Sbjct  320   MLDEKN  325



>ref|XP_002531388.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF30972.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=348

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 214/327 (65%), Gaps = 4/327 (1%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NT+ K A +RGMS F++ +YSNA ALL L+PS+ +++R  P P LT  I  R  +  LLS
Sbjct  21    NTMMKAAMSRGMSQFVYTVYSNAFALLILIPSSFIFYRRRPRPQLTVSIIFRTFLLGLLS  80

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q     G++YSSPTL++AM DL PAFTF+ A+++ ME L  K +S+ AKSIGTIV +
Sbjct  81    CCVQMFMNTGVKYSSPTLSAAMIDLTPAFTFLLAIISRMEKLDYKSQSTQAKSIGTIVSV  140

Query  513   TGAFVITFYKGPPLLLF---QHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
              GA ++T YKG P+       ++    LL   S W+ G       +L +++L++VQ WIL
Sbjct  141   AGALIVTLYKGQPITTLPSESNSLNQPLLLLSSTWVTGGIFCTAGALCLALLYIVQTWIL  200

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             KD P EL++T I C  VT+LS+I A++AE+++++W L+PD+ELIA   +A+  V  RSVV
Sbjct  201   KDCPAELIITCIACFFVTVLSSIVALVAEKDISSWILKPDIELIATFCSAVFAVSIRSVV  260

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             +AWA RKKGP++ +MF PLG++ A  +G  FL D LY GSVIG  IIALGFY+V+WGKA 
Sbjct  261   HAWACRKKGPLYASMFKPLGIIIATFLGFYFLGDTLYDGSVIGGIIIALGFYSVLWGKAQ  320

Query  1044  EVK-ENIETNIDNSNEKVPLLPPNKGD  1121
             E K    E N    +   P  P  +GD
Sbjct  321   EEKMGKDERNSSFESSASPKAPLLRGD  347



>ref|XP_006484313.1| PREDICTED: uncharacterized protein LOC102615432 [Citrus sinensis]
Length=739

 Score =   303 bits (775),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/323 (50%), Positives = 218/323 (67%), Gaps = 6/323 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NT+ K A +RG S+FI V+YSN LA+  L+PS+ +++R    P LT+ I  RI +  LLS
Sbjct  20    NTVTKAAMSRGASHFILVVYSNMLAIFLLVPSSFIFYRKRTRPQLTWSIVCRIFLLGLLS  79

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
               GQ   Y GIE  SP LASAM DL P FTFI A++  ME L L+ +SS AKS GT++LI
Sbjct  80    CCGQMFHYFGIENGSPALASAMIDLTPGFTFILAIIFRMEKLELRVQSSQAKSFGTVLLI  139

Query  513   TGAFVITFYKGPPLLLF--QHAYYNSL--LPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              GA ++T YKG P+     ++   N L  LP  SNW +G   L   S+ +++ ++VQAWI
Sbjct  140   GGALIVTLYKGLPITSAPSKNKLINELVQLPL-SNWTIGGIFLAAHSVILAIYYIVQAWI  198

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             ++DYP ELM+T+I    VTILS+  +++AE+N NAW+LRPD+EL+AI Y+AI  V  RSV
Sbjct  199   VRDYPAELMITLICSIFVTILSSAVSLVAEKNPNAWRLRPDIELMAIGYSAIFAVSVRSV  258

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             ++ WA+RKKGPV+V+MF PLGMV A++ G+ FL D LY GS +GA+ IALGFY V+WG+A
Sbjct  259   LHTWALRKKGPVYVSMFKPLGMVVALVFGIAFLGDTLYLGSFVGAATIALGFYAVIWGQA  318

Query  1041  MEVK-ENIETNIDNSNEKVPLLP  1106
              E K +   T I       P +P
Sbjct  319   KEEKMDEDHTEISGFKPSSPCVP  341


 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 129/319 (40%), Positives = 194/319 (61%), Gaps = 7/319 (2%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAGQ  344
             K A ++G++ ++ ++YS+AL+ LF L  + L+HR    P LT  I     + ++   + Q
Sbjct  415   KAAMSKGINKYVIIVYSDALSSLFFLFCSFLFHR-SERPQLTLSILCSFFLLSVFGCSSQ  473

Query  345   TLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAF  524
                ++GI+YSSPTL++AM +LIPAFTF+ A++  +E L+ + +SS AKS+GT   I GAF
Sbjct  474   IFSFVGIQYSSPTLSTAMLNLIPAFTFVLAIIFRLEKLNWENKSSQAKSLGTFASIGGAF  533

Query  525   VITFYKGPPL---LLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYP  695
             V+TFYKGPPL   L    +    LL  Q +WILG F L   +   S  F++QA IL+ + 
Sbjct  534   VVTFYKGPPLIGELSHSDSPRRLLLSPQLSWILGGFFLAAEAFMNSAWFILQALILRKFA  593

Query  696   GELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWA  875
               L++        TILS   A+I     + WKL  D+ L+A+ Y+A+I  GFR  +  W 
Sbjct  594   AVLIIMFYLFFFNTILSTAFALIVVSEPSDWKLGLDIGLVAVLYSAVIGTGFRVGLCTWC  653

Query  876   VRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKE  1055
             + + GP++V+MF PL +V +++M V  + D    GS+IGA II  GFY VMWGK+ E K 
Sbjct  654   LSRTGPLYVSMFKPLAIVFSIVMDVVIVGDAFCLGSLIGAMIIVAGFYAVMWGKSKEEKT  713

Query  1056  NIET---NIDNSNEKVPLL  1103
               +    ++++S EKVPLL
Sbjct  714   TEDCGLGSVNSSREKVPLL  732



>ref|XP_007224366.1| hypothetical protein PRUPE_ppa020906mg [Prunus persica]
 gb|EMJ25565.1| hypothetical protein PRUPE_ppa020906mg [Prunus persica]
Length=360

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 154/331 (47%), Positives = 219/331 (66%), Gaps = 11/331 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             N L+K A  +GMSNF+FV+Y+NALAL  LLPS+  ++R    P L++ +  ++ + + +S
Sbjct  12    NILSKAAMKKGMSNFVFVVYANALALFVLLPSSFFFYRRRTYPPLSWSLICKLFLVSFMS  71

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q L++IGI YSSPT+ASAM DL+PAFTFI AV+ GMEIL L+  S  AK IGT+V I
Sbjct  72    SGAQLLKFIGINYSSPTMASAMIDLMPAFTFILAVITGMEILDLRITSRQAKCIGTVVSI  131

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQ-----SNWILGSFILVTSSLFISMLFLVQAW  677
             +GA ++T YKG PL+    ++   +  Q      +NW +G  +L   S  ++M+ + + W
Sbjct  132   SGALMLTLYKGLPLIRADASHSKLISLQLLLSSQTNWFIGGIVLAFQSFLLAMMHIAETW  191

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             +++DYP  LM+T I C  VTI SA  ++IA + +NAWKL+PD+ELIAI YNA   V  R+
Sbjct  192   VIRDYPAVLMVTTIRCIFVTIQSAAISLIAVKGLNAWKLKPDIELIAIGYNATFEVMLRT  251

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
              ++ WA+  KGPV+VAMF PLG+V A+ +GV FL D LY G ++GA+I  +GFY V+WGK
Sbjct  252   GIHLWAMNIKGPVYVAMFKPLGLVMALFVGVAFLGDTLYLGRLLGAAITVVGFYAVIWGK  311

Query  1038  AMEVKENIETNIDNS------NEKVPLLPPN  1112
             A E KE  + +   S      +E  PLLP +
Sbjct  312   AQEEKEKAQNDQTRSFESFPQSEAEPLLPKH  342



>ref|XP_006483806.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Citrus 
sinensis]
Length=325

 Score =   289 bits (739),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 160/321 (50%), Positives = 212/321 (66%), Gaps = 29/321 (9%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalall-fllPSTILYHRLMPPPVLTFGIFGRICITALL  329
             +TLNK A  +G S+F+ ++YSNA A +  LLPST +Y+R    P LT  I  +I    L+
Sbjct  21    STLNKAAMNKGTSDFVLIVYSNAFAAIFILLPSTFIYYRNRTRPPLTVSIICKIFGLGLI  80

Query  330   SYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVL  509
             S   QT  Y+GI YSSPTL+SA+ DL PAFTFI A+++ ME L L+ +SSLAKSIGT+V 
Sbjct  81    SCCVQTCLYVGIGYSSPTLSSAIVDLTPAFTFILALISRMEKLDLRVQSSLAKSIGTMVS  140

Query  510   ITGAFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             I GA  +T YKGP L                         VTSS F+S+L++VQ  I+++
Sbjct  141   IAGALTVTLYKGPAL-------------------------VTSSFFLSLLYIVQTSIIRE  175

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP ELM T I C  VTI S + A+IAERN N+W+L+PDMELIAI  +A   V  RS+ + 
Sbjct  176   YPEELMATFICCVFVTIQSTVVALIAERNPNSWRLKPDMELIAIGCSAFFAVALRSLAHT  235

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             WA  KKGPV+V+M+ PLG+V A+IMGVT L D LY GSV+GA+I+A GFY+V+WG++ E 
Sbjct  236   WACHKKGPVYVSMYKPLGIVFAIIMGVTLLGDTLYLGSVVGATIVAFGFYSVIWGQSEEE  295

Query  1050  KENIETNID---NSNEKVPLL  1103
             K   + +ID   +S+ K PLL
Sbjct  296   KMIDDKDIDSLKSSSPKAPLL  316



>ref|XP_008221769.1| PREDICTED: WAT1-related protein At4g15540-like [Prunus mume]
Length=370

 Score =   288 bits (736),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 155/332 (47%), Positives = 220/332 (66%), Gaps = 13/332 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             N L+K A  +GMS+F+FV+Y+NALAL  LLPS+  ++R    P L++    ++ + + +S
Sbjct  22    NILSKAAMKKGMSDFVFVVYANALALFVLLPSSFFFYRRRTYPPLSWSFICKLFLVSFMS  81

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q L++IGI YSSPT+ASAM DL+PAFTFI AV+ GMEIL L+  S  AK IGT+V I
Sbjct  82    SSAQLLRFIGINYSSPTMASAMIDLMPAFTFILAVITGMEILDLRITSRQAKCIGTVVSI  141

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQ------SNWILGSFILVTSSLFISMLFLVQA  674
             +GA ++T YKG PL+    A +N L+  Q      +NW +G  +L   S  ++M+ + + 
Sbjct  142   SGALMLTLYKGLPLIR-ADASHNKLISLQLLLSSQTNWFIGGIVLAFQSFLLAMMHITET  200

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
             W+++DYP  LM+T I C  VTI SA  ++I  + +NAWKL+PD+ELIAI YNA   V  R
Sbjct  201   WVIRDYPAVLMVTTIRCIFVTIQSAAISLITVKGLNAWKLKPDIELIAIGYNATFEVMLR  260

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
             + ++ WA+  KGPV+VAMF PLG+V A+ +GV FL D LY G ++GA+I  +GFY V+WG
Sbjct  261   AGIHLWALNIKGPVYVAMFKPLGLVMALFVGVAFLGDTLYLGRLLGAAITVVGFYAVIWG  320

Query  1035  KAMEVKENIETNIDNS------NEKVPLLPPN  1112
             KA E KE  + +   S      +E  PLLP +
Sbjct  321   KAQEEKEKAQNDQTGSFESFPQSEAEPLLPKH  352



>ref|XP_003517735.1| PREDICTED: WAT1-related protein At5g40210 [Glycine max]
 gb|KHN09904.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=352

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 169/330 (51%), Positives = 216/330 (65%), Gaps = 6/330 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K   ++GMSNF+FV YSN LA +FLL +T + HR   P  +T  I  RI + +LLS
Sbjct  20    NTLIKANMSKGMSNFVFVAYSNLLAFVFLLLATTIRHRNRAPTPITNSIIFRIFLISLLS  79

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + QTL YIG+ YSSPTL S M DL+PA+TFI A+V+ ME L LK RS  AKSIGT+V I
Sbjct  80    VSVQTLYYIGLGYSSPTLGSTMEDLVPAYTFIIAIVSRMEKLDLKLRSCWAKSIGTVVSI  139

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
              GA  +T YKG P+     +    L  Q S W+LG F+L   +   S+  ++Q W +KDY
Sbjct  140   VGALTVTLYKGLPMTSGLVSNDVILSSQPSKWLLGGFLLAIGTFCGSVSLVIQTWTIKDY  199

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P EL+L  I+ +   ILS I A +AE N  AW L+PDM+L+ I Y+AI ++  RSVVYAW
Sbjct  200   PEELILITISTSFSVILSFITAFVAEENPKAWILKPDMKLVCIFYSAIFVMSTRSVVYAW  259

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
             A RKKG V+VAMF PL +V A+ MGV FL D LY GS+IGA+IIA+GFY V+WG+A E K
Sbjct  260   ACRKKGAVYVAMFSPLEIVIALAMGVAFLGDALYLGSMIGAAIIAVGFYGVIWGQAQEEK  319

Query  1053  ---ENIE---TNIDNSNEKVPLLPPNKGDS  1124
                EN E       +S+E   LL  +KG S
Sbjct  320   IVCENYEISTIISSSSSEAALLLDQSKGKS  349



>ref|XP_003517734.1| PREDICTED: WAT1-related protein At3g28050-like [Glycine max]
 gb|KHN09906.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=353

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 213/332 (64%), Gaps = 11/332 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NT+ K + ++GMS F+FV YSN  A  FLL +T + HR   P  +   I  RI +  LLS
Sbjct  21    NTMIKASLSKGMSIFVFVAYSNLFAFCFLLQATTIRHRNRAPTPINNSILFRIFVLGLLS  80

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + QTL Y G+ YSSPTL S M DLIPA+TFI A+++ ME L LK +S  AKSIGT++ I
Sbjct  81    VSIQTLIYTGLGYSSPTLTSTMEDLIPAYTFIIAIISRMEKLDLKLQSCQAKSIGTVISI  140

Query  513   TGAFVITFYKGPPL---LLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
              GA ++T YKG P+   ++  + + +S   QQS W+LG F+L     F S+  ++Q W +
Sbjct  141   AGALIMTLYKGLPMTSDVMPNNVFLSS---QQSKWLLGGFLLAVGCFFCSISLVIQTWTI  197

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             KDYP ELML  I+ +L  ILS I A IAE N  AW L+ DMEL+ I Y+AI ++  R+VV
Sbjct  198   KDYPEELMLITISTSLSVILSFIVAFIAEENPKAWTLKLDMELVCILYSAIFVMSTRNVV  257

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
               WA RKKGPV+VAMF PLG+V A+ MG+ FL D LY GS+IGA+IIA+GFY V WG+A 
Sbjct  258   NVWACRKKGPVYVAMFSPLGIVIALAMGIVFLGDALYLGSLIGAAIIAIGFYAVTWGQAQ  317

Query  1044  EVKENIETN-----IDNSNEKVPLLPPNKGDS  1124
             E     E +     I + + + PLL     DS
Sbjct  318   EETMGYEKHGTCSIISSPSSETPLLLNKSKDS  349



>gb|KDO82538.1| hypothetical protein CISIN_1g018663mg [Citrus sinensis]
Length=325

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/321 (49%), Positives = 210/321 (65%), Gaps = 29/321 (9%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalall-fllPSTILYHRLMPPPVLTFGIFGRICITALL  329
             +TLNK A  +G S+F+ ++YSNA A +  LLPST +Y+R    P LT  I  +I    L+
Sbjct  21    STLNKAAMNKGTSDFVLIVYSNAFAAIFILLPSTFIYYRNRTRPPLTVSIICKIFGLGLI  80

Query  330   SYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVL  509
             S   QT  Y+GI YSSPTL+SA+ DL PAFTFI A+++ ME L L+ +SSLAKSIGT+V 
Sbjct  81    SCCVQTCLYVGIGYSSPTLSSAIVDLTPAFTFILALISRMEKLDLRVQSSLAKSIGTMVS  140

Query  510   ITGAFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             I GA  +T YKGP L                         VT S F+S+L++VQ  I+++
Sbjct  141   IAGALTVTLYKGPAL-------------------------VTGSFFLSLLYIVQTSIIRE  175

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP ELM T I C  VTI S + A+IAERN N+W+L+PD ELIAI  +A   V  RS+ + 
Sbjct  176   YPEELMATFICCVFVTIQSTVVALIAERNPNSWRLKPDTELIAIGCSAFFAVALRSLAHT  235

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             WA  KKGPV+V+M+ PLG+V A+IMGVT L D LY GSV+GA+I+A GFY+V+WG++ E 
Sbjct  236   WACHKKGPVYVSMYKPLGIVFAIIMGVTLLGDTLYLGSVVGATIVAFGFYSVIWGQSEEE  295

Query  1050  KENIETNID---NSNEKVPLL  1103
             K   + +ID   +S+ K PLL
Sbjct  296   KMIDDKDIDSLKSSSPKAPLL  316



>ref|XP_010653215.1| PREDICTED: WAT1-related protein At5g40240-like isoform X2 [Vitis 
vinifera]
Length=264

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 190/262 (73%), Gaps = 5/262 (2%)
 Frame = +3

Query  354   YIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAFVIT  533
             ++GI YSSPTLASAM DL+PAFTFI A+++ ME L LK  S  AK IGTIV I GA ++T
Sbjct  4     FVGIRYSSPTLASAMTDLVPAFTFILAIISRMEKLDLKAGSCRAKCIGTIVSIIGALIVT  63

Query  534   FYKGPPLLLFQHAYY---NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPGEL  704
              YKGP +      +     +L  Q SNW++G F+L  S++ I++ ++VQ  I++DYP EL
Sbjct  64    IYKGPQIAFASSTFKILDENLRSQISNWVIGGFLLAISAVSIALFYVVQTSIIRDYPAEL  123

Query  705   MLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAVRK  884
             MLT I    VT+ S+I ++IAER+ +AW+L+PD+ELIA+ Y+A++++ FR   +AW + K
Sbjct  124   MLTFICHIFVTMQSSIVSLIAERDPSAWRLKPDVELIAVGYSAVLVLAFRGTAHAWVLHK  183

Query  885   KGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKENIE  1064
             KGPVFVAMF P+ +V AV+MGVTFL D L+ GSVIGA+IIA GFYTVMWGKA E  E++ 
Sbjct  184   KGPVFVAMFKPVAIVIAVVMGVTFLGDVLHLGSVIGAAIIAFGFYTVMWGKAKEEIEDMT  243

Query  1065  TN-IDNSNEKVPLLPPNKGDSV  1127
             T+ ID+S+ K PLL  NK   V
Sbjct  244   TSGIDSSSHKDPLL-QNKSTQV  264



>ref|XP_002266139.1| PREDICTED: WAT1-related protein At5g40240 [Vitis vinifera]
 emb|CBI32108.3| unnamed protein product [Vitis vinifera]
Length=346

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/323 (47%), Positives = 215/323 (67%), Gaps = 8/323 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K+A + G+S+F+ VLYSNA++ + LLP ++L+HR  P P LTF I  R  + AL+   
Sbjct  27    VSKMAMSNGLSSFVLVLYSNAISAVILLPLSLLFHR-SPRPPLTFSILCRFFLLALIGCF  85

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y G++YSSPTL SAM +L+PAFTFI AV+  ME L LK+ SSLAKS+G +V + G
Sbjct  86    AQIFGYAGVQYSSPTLGSAMLNLVPAFTFILAVICRMEKLELKKSSSLAKSVGALVSVAG  145

Query  519   AFVITFYKGPPLLLFQHAYY--NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             AFV+TFYKGPP++         N +   QS+W+LG F+L   SL  SM +++QA ILK +
Sbjct  146   AFVVTFYKGPPIMFSSSFSDSSNQIFSSQSHWVLGGFLLADESLLASMWYILQATILKKH  205

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P  L +T   C  ++I+S   +++AER+ +AW+L+ D+ L+A+ Y+AI+    R  +  W
Sbjct  206   PAVLTITFFYCFFISIISLAISLVAERDPSAWRLKLDVGLLAVLYSAIVGNVIRISMCTW  265

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              VR+ GP+F +MF PLG+V A +MGV F  D L+ GS++GA II  GFY VMWGKA E +
Sbjct  266   CVRRAGPLFCSMFKPLGIVFAFVMGVIFSGDALHLGSLVGAIIIVTGFYAVMWGKAKEAE  325

Query  1053  ENIETNIDNSNEKVPLLPPNKGD  1121
             E     ++ S  KVPLL  N+ D
Sbjct  326   EG---RLECS-RKVPLL-QNQTD  343



>emb|CAN67884.1| hypothetical protein VITISV_015327 [Vitis vinifera]
Length=336

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 152/295 (52%), Positives = 205/295 (69%), Gaps = 10/295 (3%)
 Frame = +3

Query  264   RLMPPPVLTFGIFGRICITALLSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVA  443
             R  PPP LT  I  RI +  L+S + Q L++IGI YSSPTLASAM +LIPAFT++ A+V 
Sbjct  45    RRSPPP-LTPSILCRIFLLGLVSCSLQMLKFIGIGYSSPTLASAMTNLIPAFTYVLAIVT  103

Query  444   GMEILSLKERSSLAKSIGTIVLITGAFVITFYKGPPLLLFQHA----YYNSLLPQQSNWI  611
              ME L LK +SS AK +GT+V + GA +IT YKGP +           +N LLP+ SNWI
Sbjct  104   RMEKLDLKVKSSRAKCLGTLVSVAGALLITIYKGPGIEFASTTPSMLNHNLLLPR-SNWI  162

Query  612   LGSFILVTSSLFISMLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWK  791
             +G F+   ++  +++L + Q  I++DYP EL++T+I+    T+ S++ ++IAER+ +AW+
Sbjct  163   IGGFLTAAAAFMVAVLLVFQTSIIRDYPAELIVTLISHIFATMQSSLVSLIAERDPSAWR  222

Query  792   LRPDMELIAICYNAIIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDL  971
             LR DMELIA+ Y+ I +V  R  VYAW + +KGPVFVAMF P G+V AVIMGVTFL D L
Sbjct  223   LRLDMELIAVGYSGIFVVALRGAVYAWVLHQKGPVFVAMFKPAGIVIAVIMGVTFLGDKL  282

Query  972   YTGSVIGASIIALGFYTVMWGKAMEVK--ENI-ETNIDNSNEKVPLLPPNKGDSV  1127
             + GSVIGA+IIALGFYTV+WGKA E K  E+I    ++ S+ +VPLL  NK   V
Sbjct  283   HLGSVIGAAIIALGFYTVVWGKAKEEKMAEDIAACGVNTSSHRVPLL-QNKSTEV  336



>ref|XP_003613291.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES96249.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=337

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 207/311 (67%), Gaps = 18/311 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +TL K AT  GMS FIF++YSN LAL FLLPST+ +HR   PP ++  IF RI +   L 
Sbjct  23    DTLMKAATKDGMSIFIFIVYSNLLALCFLLPSTLFHHRKRAPPPISTSIFCRIFVFGCLR  82

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A QTL   GI +SSPTLASAM D++PAFTFI A+++ ME+L++K+ SS AK IGT+V I
Sbjct  83    TATQTLMASGIRFSSPTLASAMVDIVPAFTFILAIISRMEVLNMKKHSSQAKVIGTVVSI  142

Query  513   TGAFVITFYKGPPLL--LFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
              GA V+TFYKG PL+    QH    +    L  +S+WILG+F+L  +   +S+LF+VQ W
Sbjct  143   AGALVVTFYKGMPLINDAIQHIEIGASGIYLLGKSDWILGAFLLAVACFCLSLLFIVQTW  202

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I+KDYP EL++T I C  V I+S I A+IAE N  AW+LRPD EL+++CY+A  +V  R+
Sbjct  203   IVKDYPEELVITTICCCFVVIISTIVALIAEGNSKAWRLRPDKELLSVCYSAAFVVSLRN  262

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             VV  WA RKKGP++VA F PL +V A+ + +              A+II +GFY V+W K
Sbjct  263   VVNTWACRKKGPIYVATFNPLRVVIALGIVIG-------------AAIIVIGFYAVIWAK  309

Query  1038  AMEVKENIETN  1070
             A E +   E N
Sbjct  310   AQEEQTTSENN  320



>ref|XP_008221761.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Prunus 
mume]
 ref|XP_008221762.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Prunus 
mume]
Length=351

 Score =   274 bits (700),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 148/324 (46%), Positives = 210/324 (65%), Gaps = 7/324 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++KVA + GMSN IF+ YSNALA L LLP ++ +HR   PP LTF       +  L+ + 
Sbjct  25    VSKVAMSNGMSNLIFLCYSNALAALILLPISLAFHRSERPP-LTFSTLCWFFLLGLIGFM  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI  SSPTL++AM +LIPAFTFI AV+  ME +  +  SSLAK++GTIV I+G
Sbjct  84    AQFFGYAGINLSSPTLSTAMLNLIPAFTFILAVIFRMERIDGRSSSSLAKTLGTIVSISG  143

Query  519   AFVITFYKGPPLLLFQHA---YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF++T YKGPPLL+        +N L  +QSNW+LG   +  + +  S   +VQA +LK 
Sbjct  144   AFIVTLYKGPPLLMTSSTDILSHNQLFSEQSNWVLGGVCIALNCVLASSWLIVQASVLKK  203

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP EL++    C  V I S + ++  ER+++AW+L+P + LIA+ Y+ +    F+  V  
Sbjct  204   YPAELIMVFYYCFFVAIQSVVVSLTVERDLSAWELKPKIRLIAVLYSGVFGSAFQVGVST  263

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + + GPVFVAMF PLG+V  V +GVTFL D  Y GS+IGA +I +GFY+VMWGK+ E 
Sbjct  264   WCLHRTGPVFVAMFKPLGIVITVFVGVTFLGDTFYLGSLIGAIVIVIGFYSVMWGKSKEE  323

Query  1050  KENIET---NIDNSNEKVPLLPPN  1112
             K + +T   ++ +S ++VPLL  +
Sbjct  324   KMDDDTGARSVASSRQRVPLLQSH  347



>ref|XP_003613288.1| Auxin-induced protein 5NG4 [Medicago truncatula]
Length=331

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 160/328 (49%), Positives = 209/328 (64%), Gaps = 24/328 (7%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +TL K AT  GMS FIF+ YSN LAL FLLPST+ +HR   PP ++  IF R+ + + L 
Sbjct  22    DTLMKSATKDGMSIFIFIFYSNILALCFLLPSTLFHHRKRSPPPISTSIFCRMLLLSCLF  81

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A Q L   GI YSSPTLASAM DL+PAFTFI AV++ ME+L++K+ SS AK IGT+V I
Sbjct  82    TAVQILMNTGIGYSSPTLASAMVDLVPAFTFILAVISRMEVLNMKKHSSQAKIIGTLVSI  141

Query  513   TGAFVITFYKGPPLL--LFQHAYYNSL---LPQQSNWILGSFILVTSSLFISMLFLVQAW  677
              GA  +T YKG PL+   FQ+    +    L  +S+WI+G+                  W
Sbjct  142   VGALTVTLYKGMPLINGAFQNIEMGATEIYLLGKSDWIIGT------------------W  183

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
              +K YP EL++T I  +LV I S I A+I E N NAW L+P+ EL+A+C++AI +V  RS
Sbjct  184   TIKAYPEELLVTSICISLVVIQSGIVALIVEGNSNAWILKPNKELVAVCFSAIFVVSLRS  243

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             VV  WA RKKGP++VAMF PL +V A+ MG+ FL ++LY GS+IGASII +GFY VMW +
Sbjct  244   VVNKWAFRKKGPIYVAMFNPLRVVIALGMGILFLGNNLYLGSMIGASIIVIGFYAVMWAQ  303

Query  1038  AMEVKENIETNIDNSNEKVPLLPPNKGD  1121
             A E     E +   S+   PLL     D
Sbjct  304   AQEEHTTSENDFLPSSS-TPLLSTKNID  330



>ref|XP_007137544.1| hypothetical protein PHAVU_009G135600g [Phaseolus vulgaris]
 gb|ESW09538.1| hypothetical protein PHAVU_009G135600g [Phaseolus vulgaris]
Length=350

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/324 (47%), Positives = 219/324 (68%), Gaps = 10/324 (3%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             T++K A T+GM++F+FV+YSNA A   LLP T+ +HR    P LT+ I  +I    LLS 
Sbjct  22    TVSKAAMTKGMNDFVFVMYSNAFASFLLLPLTVFFHRKRDLPPLTYCIVAQIFFNGLLSC  81

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             + Q L++ GI +SSPTLA+AM+DLIPAFTFI A++  ME L  K  S+ AKSIGT + I 
Sbjct  82    SVQMLRFFGIGFSSPTLATAMSDLIPAFTFILAILFRMEKLDWKTNSTRAKSIGTFLSII  141

Query  516   GAFVITFYKGPPLLLFQHAYYNSLLP------QQSNWILGSFILVTSSLFISMLFLVQAW  677
             GA +IT YKG  ++  Q+   N L P      +Q +W++G+ +L   S+ +S+LF+VQ W
Sbjct  142   GALIITLYKGQAII--QNHPSNKLYPKNLVSSEQFDWVVGAVLLAGHSIVLSLLFIVQTW  199

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I+++YP EL++ +    LV +LS  A++I+  +  A +L  D++LIAI   AI  V FRS
Sbjct  200   IIRNYPAELVVVLTRGVLVALLSVPASLISVEDPKALRLGFDVQLIAIGCQAIFSVSFRS  259

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             VV+ W + KKGP++VAM+ P+G+V A IMG++FL D LY GSV+GA+I+ +GFY V+WGK
Sbjct  260   VVHIWVMGKKGPLYVAMYKPIGIVFAAIMGISFLGDSLYLGSVLGAAIVVIGFYAVLWGK  319

Query  1038  AME-VKENIETN-IDNSNEKVPLL  1103
             + E  KE  E   +++ +  VPLL
Sbjct  320   SQERTKEESEVQTLESYSPVVPLL  343



>gb|KDO82549.1| hypothetical protein CISIN_1g018256mg [Citrus sinensis]
Length=334

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 145/295 (49%), Positives = 198/295 (67%), Gaps = 5/295 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NT+ K A +RG S+FI V+YSN LA+  L+PS+ +++R   PP LT+ I  RI +  LLS
Sbjct  20    NTVTKAAMSRGASHFILVVYSNTLAIFLLVPSSFIFYRKRTPPQLTWSIVCRIFLLGLLS  79

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
               GQ   Y GIE  SP LASAM DL P FTFI A++  ME L L+ +SS AKS GT++LI
Sbjct  80    CCGQMFHYFGIENGSPALASAMIDLTPGFTFILAIIFRMEKLELRVQSSQAKSFGTVLLI  139

Query  513   TGAFVITFYKGPPLLLF--QHAYYNSL--LPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              GA ++T YKG P+     ++   N L  LP  SNW +G   L   S+ +++ ++VQAWI
Sbjct  140   GGALIVTLYKGLPITSAPSKNKLINELVQLPL-SNWTIGGIFLAAHSVILAIYYIVQAWI  198

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             ++DYP ELM+T+I    VTILS+  +++AE+N NAW+LRPD+EL+AI Y+AI  V  RSV
Sbjct  199   VRDYPAELMVTLICSIFVTILSSAVSLVAEKNPNAWRLRPDIELMAIGYSAIFAVSVRSV  258

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTV  1025
              + WA+RKKGPV+V+MF PLGMV A++ G+ FL D LY G  +   +  L F  +
Sbjct  259   FHTWALRKKGPVYVSMFKPLGMVVALVFGIAFLGDTLYLGRCVCMILRGLQFLRI  313



>gb|KDP21318.1| hypothetical protein JCGZ_21789 [Jatropha curcas]
Length=336

 Score =   271 bits (692),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 210/319 (66%), Gaps = 5/319 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K+A ++GMS+FIFV YSNALA + LLPS++L+HR   PP LTF I     +  L    
Sbjct  12    ISKIAMSKGMSSFIFVFYSNALASVILLPSSLLFHRSERPP-LTFPIICGFFVLGLSGCL  70

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
                  Y GI  SSPTL +AM +L+P  TFI AV   ME L+ +  S+LAKSIGTIV + G
Sbjct  71    ANFFGYAGINLSSPTLGTAMLNLVPGLTFILAVAFRMEKLNWRTSSTLAKSIGTIVSVGG  130

Query  519   AFVITFYKGPPLLLFQH-AYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYP  695
             AF++T+YKGPP+L+       + LL Q SNW++G  +L    +  S   ++QA+ILK YP
Sbjct  131   AFILTYYKGPPVLMTPPLNTSHGLLVQLSNWVIGGLLLAVDCVMTSSWVIIQAFILKKYP  190

Query  696   GELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWA  875
              EL++    C  VTI SAI  +I ER+ +AW LRP++ L+A+ Y+ +    F+  + +W 
Sbjct  191   AELIVVFFYCFFVTIQSAIVCLIIERDPSAWSLRPNIRLVAVLYSGVFGSAFQVGICSWC  250

Query  876   VRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKE  1055
             +R+ GPVF++MF PLG+V A  +G+ FL D LY G + GA++I +GFY+V+WGKA E K 
Sbjct  251   LRQTGPVFISMFKPLGIVIAAAVGILFLGDTLYLGCLAGATVIVIGFYSVLWGKANEQKM  310

Query  1056  NIETN---IDNSNEKVPLL  1103
              I+     I++S++KVPLL
Sbjct  311   GIDAGAKTIESSSQKVPLL  329



>ref|XP_008221765.1| PREDICTED: WAT1-related protein At5g40240-like [Prunus mume]
Length=350

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 210/321 (65%), Gaps = 8/321 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L+K A + GMSN IFV YSNALA L LLP+++ +HR  PP  LTF +     +  L+ + 
Sbjct  25    LSKAAMSTGMSNLIFVFYSNALASLILLPTSLAFHRSRPP--LTFSVLCWFFLLGLIGFV  82

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q + Y GI YSSPTL +AM +L+PAFTFI AV+  ME +  +  S+LAKS+G ++ I+G
Sbjct  83    AQFVGYAGINYSSPTLGTAMLNLLPAFTFILAVIFRMETVDWRSSSTLAKSLGAMLSISG  142

Query  519   AFVITFYKGPPLLLFQHA---YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF++T YKGP LLL        +  L  QQSNW++G  +L+   +  S  +++QA ++K 
Sbjct  143   AFIVTLYKGPALLLTSSTDILSHKQLFSQQSNWVIGGILLLVYCVLASSSYIIQASVIKK  202

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP EL++    C  V I + + ++I E +++AW L+P M LIA+ Y+A+    F   V  
Sbjct  203   YPAELIMVFYYCFFVAIQAVVVSLIVETDLSAWSLKPKMRLIAVVYSAVFGSTFTIGVTT  262

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + + GPVF+AMF PLG++ AV +GVTF+ D  Y GS++GA +I +GFY+VMWGKA E 
Sbjct  263   WCLHRAGPVFIAMFKPLGIIVAVSIGVTFVGDTFYLGSLVGAIVIVIGFYSVMWGKANEE  322

Query  1050  KEN--IET-NIDNSNEKVPLL  1103
             K +   ET ++  SN++VPLL
Sbjct  323   KMDGGAETKSLATSNQRVPLL  343



>ref|XP_007224400.1| hypothetical protein PRUPE_ppa021705mg [Prunus persica]
 gb|EMJ25599.1| hypothetical protein PRUPE_ppa021705mg [Prunus persica]
Length=350

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 210/321 (65%), Gaps = 8/321 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L+K A + GMSN IFV YSNALA L LLP+++ +HR  PP  LTF +     +  L+ + 
Sbjct  25    LSKAAMSTGMSNLIFVFYSNALAALILLPTSLAFHRSRPP--LTFPVLCWFFLLGLIGFV  82

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q + Y GI YSSPTL +AM +L+PAFT I AV+  ME +  +  S+LAKS+GT++ I+G
Sbjct  83    AQFVGYAGINYSSPTLGTAMLNLLPAFTCILAVIFRMETVDWRSSSTLAKSLGTMLSISG  142

Query  519   AFVITFYKGPPLLLFQHA---YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF++T YKGP LLL        Y  L  QQSNW++G  +L+   +  S  +++QA ++K 
Sbjct  143   AFIVTLYKGPALLLTSSTDILSYKQLFSQQSNWVIGGILLLVYCVLASSSYIIQASVIKK  202

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP EL++    C  V I + + ++I E +++AW L+P M LIA+ Y+A+    F   V  
Sbjct  203   YPAELIMVFYYCFFVAIQAVVVSLIVETDLSAWSLKPKMRLIAVVYSAVFGSTFTIGVTT  262

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + + GPVF+AMF PLG++ AV +GVTF+ D  Y GS++GA +I +GFY+VMWGKA E 
Sbjct  263   WCLHRAGPVFIAMFKPLGIIVAVSIGVTFVGDTFYLGSLVGAIVIVIGFYSVMWGKANEE  322

Query  1050  KEN--IET-NIDNSNEKVPLL  1103
             K +   ET ++  SN++VPLL
Sbjct  323   KMDGGAETKSLATSNQRVPLL  343



>ref|XP_004304594.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=356

 Score =   269 bits (687),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 148/333 (44%), Positives = 216/333 (65%), Gaps = 11/333 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RGMS  +FV+YS ++A L LLP+  + HR    P L F I  +I +  L+ 
Sbjct  27    NTLFKAATNRGMSYHVFVVYSYSIAALALLPAPFISHRSRRLPPLNFSIMSKILLLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + Y GI YSSPTLASA+++L+PAFTFI A++  +E ++LK RSS AK IGTIV +
Sbjct  87    SSSQIMGYTGISYSSPTLASAISNLVPAFTFILAIIFRLEEVALKSRSSQAKIIGTIVSL  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLL----PQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              GAFV+T YKGP +         SLL        +W++G  ++    + +++ ++VQA I
Sbjct  147   AGAFVVTLYKGPQISFTGQT--QSLLLNSPASNPDWVIGGLLITAEYILVTLWYIVQARI  204

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             +K+YP EL +      +V+I++AI  +I ER+ NAW+LRPDM L++I  + ++     + 
Sbjct  205   MKEYPNELTVIFFYNVIVSIVAAIVGLITERDPNAWRLRPDMSLVSILCSGLLNSLLNNS  264

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             V+ W +R KGPV+V MF PL +  AV+MGVTFL D LY GS++GA+II++GFYTV+WGKA
Sbjct  265   VHTWTLRVKGPVYVTMFKPLSIAIAVVMGVTFLGDTLYLGSLLGAAIISVGFYTVLWGKA  324

Query  1041  MEVKENIETNIDN----SNEKVPLLPPNKGDSV  1127
              E +   ++  D+    S+ K PLL   K ++V
Sbjct  325   KE-ESGDDSGADSLESPSSNKAPLLQTYKTENV  356



>ref|XP_007157478.1| hypothetical protein PHAVU_002G073000g [Phaseolus vulgaris]
 gb|ESW29472.1| hypothetical protein PHAVU_002G073000g [Phaseolus vulgaris]
Length=354

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 153/308 (50%), Positives = 198/308 (64%), Gaps = 4/308 (1%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K   ++GMSN++FV YSN L    LL +T L++R   P  L   I  R  +    S
Sbjct  21    NTLVKANMSKGMSNYVFVAYSNLLGFCLLLIATTLHYRNRYPTPLNNSILFRTFLIGFFS  80

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                QTL Y GI YSSP L+SA+ DL+PAFTF+ A+V  ME ++LK RS  AKSIGT+V I
Sbjct  81    VFIQTLYYAGIGYSSPVLSSAIEDLLPAFTFVIAIVFRMEKVALKVRSWQAKSIGTVVSI  140

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLL--PQQSNWILGSFILVTSSLFISMLFLVQAWILK  686
              GA  +T YKG  L L      N+LL   QQS W+LG F+L   +L  S+  ++Q W +K
Sbjct  141   GGALTVTLYKG--LALTTGVMPNNLLLSSQQSEWLLGGFLLAAGTLCCSVSLVIQTWTIK  198

Query  687   DYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVY  866
             +YP ELML  I  +   +LS + A +AE+N  AW ++ DMEL+ I Y AI+MV  R+VV 
Sbjct  199   EYPEELMLITIATSFSVVLSFVVASVAEQNPKAWIVKLDMELVCILYAAIVMVSTRNVVC  258

Query  867   AWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME  1046
             AWA RKKG V+VAMF PLG+V A+ MG  FL D LY GSVIG +IIA+GFY V+WG+A E
Sbjct  259   AWACRKKGAVYVAMFNPLGIVIALAMGTVFLGDTLYLGSVIGGAIIAIGFYAVIWGQAQE  318

Query  1047  VKENIETN  1070
                  +T+
Sbjct  319   ENMTCKTH  326



>ref|XP_003523396.1| PREDICTED: WAT1-related protein At3g28050-like [Glycine max]
Length=351

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 148/324 (46%), Positives = 214/324 (66%), Gaps = 10/324 (3%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             T++K A  +GM++F+FV+YSNA A   LLP T +++R    P LT+ I G++ I   LS 
Sbjct  22    TVSKAAMKKGMNDFVFVMYSNAFATCLLLPITFIFYRKRALPPLTYFIVGQLFINGFLSC  81

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             + Q L++ GI Y SPTLA+AM+DLIPAFTFI A+V  MEIL  K  S+ AKSIGT+V I 
Sbjct  82    SVQMLRFFGIGYGSPTLATAMSDLIPAFTFILAIVFRMEILDWKTNSTRAKSIGTLVSIA  141

Query  516   GAFVITFYKGPPLLLFQHAYYNSLLP------QQSNWILGSFILVTSSLFISMLFLVQAW  677
             GA +IT YKG  ++   +   N L P      +Q +W++G+ +L   S  +S+LF+VQ W
Sbjct  142   GALIITLYKGQAVI--NNHPSNKLFPKKHVSSEQFDWVIGAVLLAGHSFVLSLLFIVQTW  199

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I+++YP EL++ +    LV +LS   ++I+  +  A +L  D+ LIAI   AI  V  RS
Sbjct  200   IIRNYPAELVIVLTRGTLVAMLSIPPSLISVTDPKALRLGFDVNLIAIALQAIFGVSLRS  259

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             +V+ W + KKGP++VAMF P+G++ AVIMG+ FL D +Y GSV+GA+I+ +GFY V+WGK
Sbjct  260   IVHIWVMSKKGPLYVAMFKPIGIIFAVIMGIAFLGDSIYLGSVLGAAIVVIGFYAVIWGK  319

Query  1038  AME-VKENIETNIDNSNEKVPLLP  1106
             + E  KE  E   D+S    P++P
Sbjct  320   SQEQAKEECEVY-DDSESYSPVVP  342



>ref|NP_001241291.1| uncharacterized protein LOC100804032 [Glycine max]
 gb|ACU22695.1| unknown [Glycine max]
 gb|KHN23419.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=350

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 150/328 (46%), Positives = 215/328 (66%), Gaps = 10/328 (3%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             T++K A  +GM++F+FV+YSNA A   LLP T  ++R  P P LT+ I  ++ I   LS 
Sbjct  22    TVSKAAMKKGMNDFVFVMYSNAFATCLLLPITFFFYRKRPLPPLTYFIVAQLFINGFLSC  81

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             + Q L++ GI YSSPTLA+AM+DLIPAFTFI A+V  ME L  K  S+ AKSIGT+V IT
Sbjct  82    SVQMLRFFGIGYSSPTLATAMSDLIPAFTFILAIVFRMEKLDWKTNSTRAKSIGTLVSIT  141

Query  516   GAFVITFYKGPPLLLFQHAYYNSLLP------QQSNWILGSFILVTSSLFISMLFLVQAW  677
             GA +IT YKG  ++   +   N L P      +Q +W++G+ +L   S  +S+LF+VQ W
Sbjct  142   GALIITLYKGQAII--NNHPSNKLFPKNLNSSEQFDWVVGAVLLAGHSFVLSLLFIVQTW  199

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I+++YP EL++ V    LV +LS   ++I+  +    +L  D+ LIAI   AI  V  RS
Sbjct  200   IIRNYPAELVIVVTRGILVAMLSIPPSLISVTDPKDLRLGFDVHLIAIALQAIFGVSLRS  259

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             +V+ W + KKGP++VAMF P+G++ AVIMG+ FL D +Y GSV+GA+I+ +GFY V+WGK
Sbjct  260   IVHIWVMSKKGPLYVAMFKPIGIIFAVIMGIAFLGDSIYLGSVLGAAIVVIGFYAVIWGK  319

Query  1038  AME-VKENIET-NIDNSNEKVPLLPPNK  1115
             + E  KE  E  + ++ +  VPLL   K
Sbjct  320   SQEQAKEECEVYDSESYSPVVPLLKKKK  347



>ref|XP_007222235.1| hypothetical protein PRUPE_ppa007913mg [Prunus persica]
 gb|EMJ23434.1| hypothetical protein PRUPE_ppa007913mg [Prunus persica]
Length=351

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/324 (45%), Positives = 208/324 (64%), Gaps = 7/324 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K+A + GMSN IF+ YSNALA L LLP ++ +HR   PP LTF       +  L+ + 
Sbjct  25    VSKLAMSNGMSNLIFLCYSNALAALILLPISLAFHRSERPP-LTFSTLCWFFLLGLIGFM  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI  SSPTL++AM +LIPAFTFI AV+  ME +  +  SSLAK++GTIV I+G
Sbjct  84    AQFFGYAGINLSSPTLSTAMLNLIPAFTFILAVIFRMERIDGRSSSSLAKTLGTIVSISG  143

Query  519   AFVITFYKGPPLLLFQHA---YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF++T YKGPPLL+        +N L  +QSNW+LG   +  + +  S   +VQA +LK 
Sbjct  144   AFIVTLYKGPPLLMTSSTDILSHNQLFLEQSNWVLGGMCIALNCVLASSWLIVQASVLKK  203

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP EL++    C  V I S + ++  ER+++AW+L+P + LIA+ Y+ +    F+  V  
Sbjct  204   YPAELIMVFYYCFFVAIQSVVVSLTVERDLSAWELKPKIRLIAVLYSGVFGSAFQVGVST  263

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + + GPVFVA+F PLG+V  V +G TFL D  Y GS+IGA +I +GFY+VMWGKA E 
Sbjct  264   WCLHRTGPVFVAIFKPLGIVITVFVGATFLGDTFYLGSLIGAIVIVMGFYSVMWGKAKEE  323

Query  1050  KENIET---NIDNSNEKVPLLPPN  1112
             K + +    ++ +S ++VPLL  +
Sbjct  324   KMDDDAGARSVASSRQRVPLLQSH  347



>ref|XP_009360476.1| PREDICTED: WAT1-related protein At5g40240-like [Pyrus x bretschneideri]
Length=354

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 211/327 (65%), Gaps = 10/327 (3%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K+A + GMSN IF+ YSNALA L LLP ++++HR   PP LT  I G   +  L+ + 
Sbjct  25    ISKIAMSNGMSNLIFLCYSNALAALILLPISLVFHRSERPP-LTLSIIGWFFLLGLIGFM  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q L Y GI YSSPTL++AM +LIPAFTF+ AV+  ME + ++  SSLAK++GTIV I+G
Sbjct  84    AQFLGYAGINYSSPTLSTAMLNLIPAFTFVLAVIFRMERIDMRSFSSLAKTLGTIVSISG  143

Query  519   AFVITFYKGPPLL------LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
             AF++T YKGPP+L      +     +  L+ ++SNW+LG   +  + +  S   +VQA +
Sbjct  144   AFIVTLYKGPPILKASSTVMTDVLSHKQLISERSNWVLGGVCVAANCVLASAWIIVQASV  203

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             LK Y  EL++    C  V I S + + I ER++ +W+L P +  IA+ Y+A+    F+  
Sbjct  204   LKKYRAELIMVFYYCFFVAIQSVVVSSILERDLRSWELTPKIRWIAVLYSAVFGSAFQVG  263

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             V  W +R+ GPVFVAMF PLG++  V +GVTFL D  Y GS+IGA +I +GFY+VMWGKA
Sbjct  264   VSTWCLRRTGPVFVAMFKPLGIIVTVFIGVTFLGDTFYLGSLIGAIVIVIGFYSVMWGKA  323

Query  1041  MEVK---ENIETNIDNSNEKVPLLPPN  1112
              E K   +  E ++ +  ++VPLL  +
Sbjct  324   NEEKMDEDAGEESLASIKQQVPLLQSH  350



>ref|XP_007044593.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 ref|XP_007044595.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY00425.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY00427.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
Length=326

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 198/327 (61%), Gaps = 30/327 (9%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             + K A + GMSNF+FV YSNALA L LLPS+ L+HR   PP LTF I     +  LL   
Sbjct  25    MGKAAMSHGMSNFVFVFYSNALASLILLPSSFLFHRSERPP-LTFSILCWFFLLGLLGCF  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI YSSPTL +AM +LIP  TF+FAV   ME L L   SS AKS+GTIV I G
Sbjct  84    AQIFGYAGIYYSSPTLGTAMLNLIPGLTFLFAVAFRMEKLHLGSSSSQAKSLGTIVSIAG  143

Query  519   AFVITFYKGPPLLLFQHAYY--NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             AFV+TFYKGP +L+        +  L QQSNW+ G F+L    LF S   +VQ       
Sbjct  144   AFVVTFYKGPSILMSSSRASSSHQFLLQQSNWVFGGFLLAADCLFASAWLIVQ-------  196

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
                              SAI  ++ ER++++W  +PD+ L+A+ Y+A+    F+  V  W
Sbjct  197   -----------------SAIVCLVMERDLSSWSFKPDVRLVAVLYSAVFGSAFQLGVSTW  239

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              + + GPVFVAMF PLG+V +VIMGV FL D  Y GS++GA +I  GFY+VMWGKA E K
Sbjct  240   CLHRTGPVFVAMFKPLGIVISVIMGVIFLGDTFYLGSLLGAIVIVAGFYSVMWGKAKEGK  299

Query  1053  ENIETN---IDNSNEKVPLLPPNKGDS  1124
              ++      +++S++KVPLLP N G++
Sbjct  300   IDVYAQGMRLESSSQKVPLLPNNTGET  326



>ref|XP_009594127.1| PREDICTED: WAT1-related protein At3g28050-like [Nicotiana tomentosiformis]
Length=288

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 180/242 (74%), Gaps = 19/242 (8%)
 Frame = +3

Query  153  NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRI-------  311
            NTLNK AT +GMSNF+FVLYSNALALL LLPST +YHR  P   LTF ++ RI       
Sbjct  17   NTLNKSATNKGMSNFVFVLYSNALALLVLLPSTFIYHRSKPCAKLTFSVWYRIFFLLFSG  76

Query  312  ------C-ITALLSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKE  470
                  C + ++ + +GQTL Y+GI+YSSPTLASA+ DL+PAFTFI AV+ GME L L+ 
Sbjct  77   INLITCCLVNSVNNCSGQTLFYVGIQYSSPTLASAIVDLVPAFTFIVAVILGMERLVLRA  136

Query  471  RSSLAKSIGTIVLITGAFVITFYKGPPLLLFQHAYYNS-----LLPQQSNWILGSFILVT  635
            +SSLAKS+GTI+LITGAFV+TFYKGP +   +   +N      LL  QSNWI+GS +L T
Sbjct  137  KSSLAKSVGTIILITGAFVMTFYKGPAIFSHESVVHNRNIGQPLLSTQSNWIIGSSLLTT  196

Query  636  SSLFISMLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELI  815
            +S  +S+L++VQAWI+KDYP ELM+TVI C  VTILS + A+IAE++ NAWK+RPD++LI
Sbjct  197  ASFLVSLLYIVQAWIMKDYPQELMVTVIACGFVTILSFVVALIAEKDPNAWKIRPDLKLI  256

Query  816  AI  821
             I
Sbjct  257  QI  258



>ref|XP_008389607.1| PREDICTED: WAT1-related protein At5g40240-like [Malus domestica]
Length=354

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/327 (44%), Positives = 211/327 (65%), Gaps = 10/327 (3%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K+A + GMSN IF+ YSNALA L LLP ++++HR   PP LT  I G   +  L+ + 
Sbjct  25    ISKIAMSNGMSNLIFLCYSNALAALILLPISLVFHRSERPP-LTISIIGWFFLLGLIGFM  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q L Y GI +SSPTL++AM +LIPAFTF+ AV+  ME + ++  SSLAK++GTIV I+G
Sbjct  84    AQFLGYAGINFSSPTLSTAMLNLIPAFTFVLAVIFRMERIDMRSFSSLAKTVGTIVSISG  143

Query  519   AFVITFYKGPPLLLFQHAY------YNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
             AF++T YKGPP+L    +       +  L+ ++SNW+LG   +  + +  S   +VQA +
Sbjct  144   AFIVTLYKGPPILKTSSSVMTDVLSHKQLISERSNWVLGGVCVAANCVLASAWIIVQASV  203

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             LK Y  EL++    C  V I S + + I ER++ +W+L P +  IA+ Y+A+    F+  
Sbjct  204   LKKYRAELIMVFYYCFFVAIQSVVVSSILERDLRSWELTPKIRWIAVLYSAVFGSAFQVG  263

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             V  W +R+ GPVFVAMF PLG++  V +GVTFL D  Y GS+IGA +I +GFY+VMWGKA
Sbjct  264   VSTWCLRRTGPVFVAMFKPLGIIVTVFIGVTFLGDTFYLGSLIGAIVIVIGFYSVMWGKA  323

Query  1041  MEVK---ENIETNIDNSNEKVPLLPPN  1112
              E K   +  E ++ +  ++VPLL  +
Sbjct  324   NEEKMDEDAGEESLASIKQQVPLLQSH  350



>ref|XP_006483798.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Citrus 
sinensis]
Length=350

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 203/322 (63%), Gaps = 6/322 (2%)
 Frame = +3

Query  162   NKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAG  341
              K A + GMSN +FV YSNA A L LLP+++L+HR   PP LT  I     +   L  + 
Sbjct  26    GKAAMSDGMSNLVFVFYSNAFASLVLLPASLLFHRSQIPP-LTLPILSAFFLLGFLGTSS  84

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
             Q   Y GI YSSPTL++AM +L+P FTFI A++ GME L  K  SSLAKS+GTIVLITGA
Sbjct  85    QFFGYAGIYYSSPTLSTAMLNLVPGFTFILAIIFGMEKLDWKSSSSLAKSVGTIVLITGA  144

Query  522   FVITFYKGPPLLLFQHAYYNSL--LPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYP  695
             F++ + KGP LL+       SL     Q+NW++G  +L    +F S   +VQA ILK + 
Sbjct  145   FIMAYCKGPHLLMTSSPPNLSLQFFVPQTNWVIGGLLLAIDCVFTSAWLIVQASILKKFS  204

Query  696   GELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWA  875
              EL++    C  V I SAI  ++ ER++++W L+P + L+A+ Y+A+    F+  V  W 
Sbjct  205   AELIVVFFYCFFVAIQSAILCLVMERDLSSWSLKPGVRLVAVLYSAVFGSAFQVGVCTWC  264

Query  876   VRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKE  1055
             + + GPVFVAMF PLG+V + ++G  FL + +Y G  IGA++I  GFY+VMWGKA E   
Sbjct  265   LHRTGPVFVAMFKPLGIVISAVVGTIFLGETVYLGRFIGAAVIVTGFYSVMWGKAKEGNS  324

Query  1056  NIETNI---DNSNEKVPLLPPN  1112
              +ET +   ++S++K PLL  N
Sbjct  325   GVETGVRSLESSSQKDPLLQNN  346



>ref|XP_011025524.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Populus 
euphratica]
 ref|XP_011025530.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Populus 
euphratica]
Length=351

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 147/327 (45%), Positives = 199/327 (61%), Gaps = 6/327 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L+K A + GM+NFIFVLYSNALA L LLPS+   HR   PP LTF I     +  L  + 
Sbjct  25    LSKAAMSDGMTNFIFVLYSNALASLILLPSSFFLHRSERPP-LTFPILCGFFLLGLFGWL  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI  SS TL +AM +LIP  TFI AV   ME L  +  S+L KS GT+V + G
Sbjct  84    AQIFGYAGINLSSATLGTAMLNLIPGLTFILAVAFRMEKLDWRSSSALVKSTGTVVSVAG  143

Query  519   AFVITFYKGPPLLLFQHAYY--NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             AF++ +YKGPPLL+        + LL QQ NWI+G  +L    +  S   ++QA ILK Y
Sbjct  144   AFIVCYYKGPPLLMAPSTSNLPHELLSQQQNWIIGGLLLAVDCVMASAWLIIQALILKKY  203

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P EL++    C  VTILS I  +  ER+  AW L+P +  IA+ Y+ +    F+  +  W
Sbjct  204   PAELIVVFFYCFSVTILSTIVCLFMERDPGAWSLKPTVRWIAVVYSGVFGSAFQVGISTW  263

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              + K GPVFVAMF PLG+V A  +    LRD LY GS++GA++I +GFY+VMWGKA E K
Sbjct  264   CLHKTGPVFVAMFKPLGIVIAAAVSTICLRDTLYLGSLVGATVIVIGFYSVMWGKAKEEK  323

Query  1053  ENIETNI---DNSNEKVPLLPPNKGDS  1124
               ++  +   ++S++KVPLL  +  ++
Sbjct  324   VGVDDGVRSFESSSQKVPLLQSHTEET  350



>ref|XP_006581027.1| PREDICTED: uncharacterized protein LOC100804032 isoform X1 [Glycine 
max]
Length=348

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 150/328 (46%), Positives = 214/328 (65%), Gaps = 12/328 (4%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             T++K A  +GM++F+FV+YSNA A   LLP T  ++R  P P LT+ I  ++ I   LS 
Sbjct  22    TVSKAAMKKGMNDFVFVMYSNAFATCLLLPITFFFYRKRPLPPLTYFIVAQLFINGFLSV  81

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
               Q L++ GI YSSPTLA+AM+DLIPAFTFI A+V  ME L  K  S+ AKSIGT+V IT
Sbjct  82    --QMLRFFGIGYSSPTLATAMSDLIPAFTFILAIVFRMEKLDWKTNSTRAKSIGTLVSIT  139

Query  516   GAFVITFYKGPPLLLFQHAYYNSLLP------QQSNWILGSFILVTSSLFISMLFLVQAW  677
             GA +IT YKG  ++   +   N L P      +Q +W++G+ +L   S  +S+LF+VQ W
Sbjct  140   GALIITLYKGQAII--NNHPSNKLFPKNLNSSEQFDWVVGAVLLAGHSFVLSLLFIVQTW  197

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I+++YP EL++ V    LV +LS   ++I+  +    +L  D+ LIAI   AI  V  RS
Sbjct  198   IIRNYPAELVIVVTRGILVAMLSIPPSLISVTDPKDLRLGFDVHLIAIALQAIFGVSLRS  257

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             +V+ W + KKGP++VAMF P+G++ AVIMG+ FL D +Y GSV+GA+I+ +GFY V+WGK
Sbjct  258   IVHIWVMSKKGPLYVAMFKPIGIIFAVIMGIAFLGDSIYLGSVLGAAIVVIGFYAVIWGK  317

Query  1038  AME-VKENIET-NIDNSNEKVPLLPPNK  1115
             + E  KE  E  + ++ +  VPLL   K
Sbjct  318   SQEQAKEECEVYDSESYSPVVPLLKKKK  345



>ref|XP_010272001.1| PREDICTED: WAT1-related protein At5g40240-like isoform X2 [Nelumbo 
nucifera]
Length=349

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 204/322 (63%), Gaps = 8/322 (2%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL+K +  RGMSNFIFV+YS ALA L LLPS     R   PP+ T  +  R+ +  L+ Y
Sbjct  29    TLSKASMLRGMSNFIFVMYSYALATLLLLPSAFFCRRATLPPI-TVSLLCRLFLLGLIGY  87

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
               Q   Y GI YSSPTLASAM++LIPAFTFI A++  ME L L+  +S AKS+GT+V I 
Sbjct  88    LVQVFAYTGINYSSPTLASAMSNLIPAFTFILAIIFRMEKLDLRSSNSQAKSLGTLVSIA  147

Query  516   GAFVITFYKGPPLLLF----QHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
             GAFV+T YKGP +L         + +  LP  SNW++G   +    L  ++ ++ QA I+
Sbjct  148   GAFVVTLYKGPSILTTPSPSDSPHLHLFLPN-SNWVIGGLFVAADCLLSALWYIFQASIV  206

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             K+YP E  L        TI SAI  ++ ER  + W+LR D+EL  I Y+A+   GF   V
Sbjct  207   KEYPQEFTLIFFYSFFATIQSAIVCLLVEREPSKWRLRLDLELFTIVYSAVFGFGFSVGV  266

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
               W +RKKGP FVAMF PLG+V AV++G+ FL D L+ GSVIG+ IIALGFY VMWGKA 
Sbjct  267   QTWCLRKKGPFFVAMFRPLGIVIAVVLGIIFLGDILHIGSVIGSVIIALGFYAVMWGKAQ  326

Query  1044  EVK--ENIETNIDNSNEKVPLL  1103
             E K  +   ++++ SN+  PLL
Sbjct  327   EDKLVDGEFSSLEPSNQSAPLL  348



>gb|KHG19084.1| Auxin-induced protein 5NG4 [Gossypium arboreum]
Length=359

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 153/328 (47%), Positives = 211/328 (64%), Gaps = 6/328 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             + K A + GM NF+FV YSNALA L LLP++ L+HR   PP LTF I     +  LL   
Sbjct  26    MGKAAMSHGMPNFVFVFYSNALASLILLPASFLFHRSHLPP-LTFSILCWFFLLGLLGCF  84

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI YSSPTLA+AM +LIP  TFI AV   ME L+L+  +S AKS+GTIV I G
Sbjct  85    AQISGYAGIYYSSPTLATAMLNLIPGLTFILAVAFRMETLNLRSSTSQAKSLGTIVSIAG  144

Query  519   AFVITFYKGPPLLLF--QHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             AF++TFYKGP LL+     +  + LL QQSNW++G F+L    +F S   +VQA +LK +
Sbjct  145   AFIVTFYKGPSLLMAPSHSSSPHLLLGQQSNWVIGGFLLAADCVFASAWLIVQASVLKKF  204

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P EL +    C  VT+ S I  +I   +++AW  +PD+ L+A+ Y+A+    F+  V  W
Sbjct  205   PAELFVVFYYCFFVTLQSGIICLIMGGDLSAWSFKPDVRLVAVIYSAVFGSAFQLGVSTW  264

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              + + GPVFV+MF PLG+V +V++GV FL D  + GS++GA +I  GFY+VMWGKA E K
Sbjct  265   CMHRTGPVFVSMFKPLGIVVSVVIGVIFLGDTFFLGSLVGAIVIVTGFYSVMWGKAKEGK  324

Query  1053  ENIETN---IDNSNEKVPLLPPNKGDSV  1127
              +++T     ++S++KV LL  N G+ V
Sbjct  325   LDVQTQGMMSESSSQKVALLSNNTGEPV  352



>ref|XP_009761504.1| PREDICTED: WAT1-related protein At3g28050-like [Nicotiana sylvestris]
Length=368

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/336 (44%), Positives = 207/336 (62%), Gaps = 11/336 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTIL--YHRLMPPPVLTFGIFGRICITAL  326
             NTL K AT +GMSN +FV+YS  LA + LLPS       RL+PP  L   I  +I +  +
Sbjct  34    NTLYKAATNKGMSNHVFVVYSYGLAAVLLLPSPFFSTRSRLLPP--LNCSILAKIFLLGV  91

Query  327   LSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIV  506
             +    Q + Y GI YSSPTLASA+++L+PAFTF+ AV+  ME + LK  S+ AK +GT+V
Sbjct  92    IGCTSQIMGYTGINYSSPTLASAISNLVPAFTFVLAVIFRMEKIELKRSSTRAKVLGTVV  151

Query  507   LITGAFVITFYKGPPLLL----FQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQA  674
              I GAFV+T YKGP LL+      +  Y  L   QSNW+LG   L T    + M ++VQ 
Sbjct  152   SIAGAFVVTLYKGPKLLVAITSTPNLLYQPLSSSQSNWMLGGLFLTTEYFLVPMWYIVQT  211

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
             WI+K+YP E+ +       V  L+AI     E + + W+++PD+ L +I  + I+     
Sbjct  212   WIMKEYPAEVTVVFFYNLCVCCLAAIVGFFTEPDSSKWRIKPDIALASILCSGILGSSLN  271

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
             + ++ WA+R KGPV+VAMF PL +  AV MGV  L D LY GSV+GA++IA+GFYTVMWG
Sbjct  272   NTIHTWALRVKGPVYVAMFKPLSIAIAVAMGVIILGDTLYLGSVLGATVIAIGFYTVMWG  331

Query  1035  KAMEVKENIETNID---NSNEKVPLLPPNKGDSV*N  1133
             KA E+ E   ++ D   +S +K PLL   K + + N
Sbjct  332   KAKEMPEYDGSSDDLESSSAQKFPLLHNYKNEVISN  367



>ref|XP_010271999.1| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Nelumbo 
nucifera]
Length=386

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 204/322 (63%), Gaps = 8/322 (2%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL+K +  RGMSNFIFV+YS ALA L LLPS     R   PP+ T  +  R+ +  L+ Y
Sbjct  66    TLSKASMLRGMSNFIFVMYSYALATLLLLPSAFFCRRATLPPI-TVSLLCRLFLLGLIGY  124

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
               Q   Y GI YSSPTLASAM++LIPAFTFI A++  ME L L+  +S AKS+GT+V I 
Sbjct  125   LVQVFAYTGINYSSPTLASAMSNLIPAFTFILAIIFRMEKLDLRSSNSQAKSLGTLVSIA  184

Query  516   GAFVITFYKGPPLLLF----QHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
             GAFV+T YKGP +L         + +  LP  SNW++G   +    L  ++ ++ QA I+
Sbjct  185   GAFVVTLYKGPSILTTPSPSDSPHLHLFLPN-SNWVIGGLFVAADCLLSALWYIFQASIV  243

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             K+YP E  L        TI SAI  ++ ER  + W+LR D+EL  I Y+A+   GF   V
Sbjct  244   KEYPQEFTLIFFYSFFATIQSAIVCLLVEREPSKWRLRLDLELFTIVYSAVFGFGFSVGV  303

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
               W +RKKGP FVAMF PLG+V AV++G+ FL D L+ GSVIG+ IIALGFY VMWGKA 
Sbjct  304   QTWCLRKKGPFFVAMFRPLGIVIAVVLGIIFLGDILHIGSVIGSVIIALGFYAVMWGKAQ  363

Query  1044  EVK--ENIETNIDNSNEKVPLL  1103
             E K  +   ++++ SN+  PLL
Sbjct  364   EDKLVDGEFSSLEPSNQSAPLL  385



>gb|KHG19083.1| Auxin-induced protein 5NG4 [Gossypium arboreum]
Length=351

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 152/326 (47%), Positives = 210/326 (64%), Gaps = 6/326 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             + K A + GM NF+FV YSNALA L LLP++ L+HR   PP LTF I     +  LL   
Sbjct  26    MGKAAMSHGMPNFVFVFYSNALASLILLPASFLFHRSHLPP-LTFSILCWFFLLGLLGCF  84

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI YSSPTLA+AM +LIP  TFI AV   ME L+L+  +S AKS+GTIV I G
Sbjct  85    AQISGYAGIYYSSPTLATAMLNLIPGLTFILAVAFRMETLNLRSSTSQAKSLGTIVSIAG  144

Query  519   AFVITFYKGPPLLLF--QHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             AF++TFYKGP LL+     +  + LL QQSNW++G F+L    +F S   +VQA +LK +
Sbjct  145   AFIVTFYKGPSLLMAPSHSSSPHLLLGQQSNWVIGGFLLAADCVFASAWLIVQASVLKKF  204

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P EL +    C  VT+ S I  +I   +++AW  +PD+ L+A+ Y+A+    F+  V  W
Sbjct  205   PAELFVVFYYCFFVTLQSGIICLIMGGDLSAWSFKPDVRLVAVIYSAVFGSAFQLGVSTW  264

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              + + GPVFV+MF PLG+V +V++GV FL D  + GS++GA +I  GFY+VMWGKA E K
Sbjct  265   CMHRTGPVFVSMFKPLGIVVSVVIGVIFLGDTFFLGSLVGAIVIVTGFYSVMWGKAKEGK  324

Query  1053  ENIETN---IDNSNEKVPLLPPNKGD  1121
              +++T     ++S++KV LL  N G+
Sbjct  325   LDVQTQGMMSESSSQKVALLSNNTGE  350



>ref|XP_002311582.1| hypothetical protein POPTR_0008s14510g [Populus trichocarpa]
 gb|EEE88949.1| hypothetical protein POPTR_0008s14510g [Populus trichocarpa]
Length=355

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 153/336 (46%), Positives = 203/336 (60%), Gaps = 19/336 (6%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTF---------GIFGRI  311
             L+K A + GM+NFIFVLYSNALA L LLPS+   HR   PP LTF         G+FG  
Sbjct  25    LSKAAMSDGMTNFIFVLYSNALASLILLPSSFFLHRSERPP-LTFPILCGFFLLGLFGY-  82

Query  312   CITALLSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKS  491
                A+L Y      Y GI  SS TL +AM +LIP  TFI AV   ME L  K  S+L KS
Sbjct  83    ---AILIYFDFIFGYAGINLSSATLGTAMLNLIPGLTFILAVAFRMEKLDWKSSSALVKS  139

Query  492   IGTIVLITGAFVITFYKGPPLLLFQHAYY--NSLLPQQSNWILGSFILVTSSLFISMLFL  665
              GTIV + GAF++ +YKGPPLL+        + LL QQ NWI+G  +L    +  S   +
Sbjct  140   TGTIVSVAGAFIVCYYKGPPLLMAPSTSNLPHELLSQQQNWIIGGLLLAVDCVMASAWLI  199

Query  666   VQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMV  845
             +QA ILK YP EL++    C  VTILS I  +  ER+  AW L+P +  IA+ Y+ +   
Sbjct  200   IQALILKKYPAELIVVFFYCFSVTILSTIVCLFMERDPGAWSLKPTVRWIAVVYSGVFGS  259

Query  846   GFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTV  1025
              F+  V  W + K GPVFVAMF PLG+V A  + +  LRD LY GS++GA++I +GFY+V
Sbjct  260   AFQVGVSTWCLHKTGPVFVAMFKPLGIVIAAAVSIICLRDTLYLGSLVGATVIVIGFYSV  319

Query  1026  MWGKAMEVKENIETNI---DNSNEKVPLLPPNKGDS  1124
             MWGKA E K  ++  +   ++S++KVPLL  +  ++
Sbjct  320   MWGKAKEEKVGVDDGVRSFESSSQKVPLLQSHTEET  355



>ref|XP_010046651.1| PREDICTED: WAT1-related protein At4g15540-like [Eucalyptus grandis]
Length=388

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 175/250 (70%), Gaps = 1/250 (0%)
 Frame = +3

Query  306   RICITALLSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLA  485
             RI + +L++   Q L ++GI YSSPTLAS M DL PAFTFI A+++ ME + L+ +SS+A
Sbjct  113   RIFLLSLIATCLQLLMFVGIGYSSPTLASVMTDLTPAFTFILALISRMEKIDLRVQSSMA  172

Query  486   KSIGTIVLITGAFVITFYKGPPLLLFQHAYYNSL-LPQQSNWILGSFILVTSSLFISMLF  662
             K +GTIV I GA  +T YKG PL     +    L L  QS+WI G F+L  ++  +S+L 
Sbjct  173   KLVGTIVCIAGALTVTLYKGLPLTNGSPSMPQELPLQLQSSWIFGGFLLACAAFLVSLLL  232

Query  663   LVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIM  842
             +VQ WI+KDYP ELMLT++ C +VTI S I A+I E++VNAWKL+PD+EL+ I Y+A  +
Sbjct  233   VVQTWIVKDYPAELMLTLLACVVVTIQSTIVALIVEKDVNAWKLKPDIELMTIVYSAFFV  292

Query  843   VGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYT  1022
             V  RSV + W  + KGP++++M  PLGM+ A +MGV+ L D LY GSVIG  IIA GFY 
Sbjct  293   VSIRSVTHTWVCKTKGPLYLSMIKPLGMIIASVMGVSLLGDTLYLGSVIGGIIIAFGFYA  352

Query  1023  VMWGKAMEVK  1052
             V+WGKA E K
Sbjct  353   VVWGKAQEEK  362



>ref|XP_006338539.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006338540.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Solanum 
tuberosum]
Length=367

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 211/338 (62%), Gaps = 14/338 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMSN +FV+YS+ LA L LLPS     R    P L   IF +I +  ++ 
Sbjct  32    NTLYKAATNKGMSNHVFVVYSHCLAALLLLPSPFFSARSRILPPLNCSIFAKIFLLGVIG  91

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q +  IGI Y+SPTLASA+++L+PAFTF+ AV+  ME + LK  ++ AK +GT+V I
Sbjct  92    CTSQIMGKIGIIYASPTLASAISNLVPAFTFVLAVIFRMEKIQLKRSTTRAKVLGTVVSI  151

Query  513   TGAFVITFYKGP---------PLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFL  665
              GAFV+T YKGP         P LL QH   +S    QSNW+LG   L T    + M ++
Sbjct  152   AGAFVVTIYKGPKILVPTTSTPNLLRQHQPLSS---SQSNWMLGGLFLTTEYFLVPMWYI  208

Query  666   VQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMV  845
             VQ WI+K YP E+ +       V+IL+ I   ++E + N W ++PD+ L +I  + I+  
Sbjct  209   VQTWIMKVYPAEVTVVFFYNLTVSILAGIVGFLSEPDSNKWIIKPDIALASILCSGILGS  268

Query  846   GFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTV  1025
                + ++ WA+R KGPV+V MF PL +  AV MGV FL D LY GS++GA+IIA+GFYTV
Sbjct  269   SLYNTIHIWALRVKGPVYVGMFKPLSIAIAVAMGVIFLGDTLYLGSILGATIIAIGFYTV  328

Query  1026  MWGKAMEVKE-NIETNIDNS-NEKVPLLPPNKGDSV*N  1133
             MWGKA E+ E N  +++++S ++K PLL   K + + N
Sbjct  329   MWGKAKEMPEYNDSSDLESSPDQKFPLLHNFKNEDISN  366



>ref|XP_004232282.1| PREDICTED: WAT1-related protein At3g28050-like [Solanum lycopersicum]
Length=364

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/333 (44%), Positives = 209/333 (63%), Gaps = 6/333 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMSN +FV+YS  LA L LLPS     R    P L   I  +I +  ++ 
Sbjct  31    NTLYKAATNKGMSNHVFVVYSYGLAALLLLPSPFFSTRSRILPPLNCSILAKIFLLGVIG  90

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q + Y GI Y+SPTLASA+++L+PAFTF+ AV+  ME + LK  ++ AK +GT+V I
Sbjct  91    CTSQIMGYTGIIYASPTLASAISNLVPAFTFVLAVIFRMEKIQLKRSTTRAKVLGTVVSI  150

Query  513   TGAFVITFYKGPPLLLFQHAYYN----SLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              GAFV+T YKGP +L+   A  N     L   QSNW+LG   L T    + M ++VQ WI
Sbjct  151   AGAFVVTLYKGPKILVPTTATPNLLRQPLSSSQSNWMLGGLFLTTEYFLVPMWYIVQTWI  210

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             +K YP E+ +       V+IL+AI   ++E + N W ++PD+ L +I  + I+     + 
Sbjct  211   MKVYPAEVTVVFFYNLTVSILAAIVGFLSEPDSNKWIIKPDIALASILCSGILGSSLNNT  270

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             ++ WA+R KGPV+VAMF PL +  AV MGV  L D LY GS++GA++IA+GFYTVMWGKA
Sbjct  271   IHTWALRVKGPVYVAMFKPLSIAIAVAMGVILLGDTLYLGSIVGATVIAIGFYTVMWGKA  330

Query  1041  MEVKE-NIETNIDNS-NEKVPLLPPNKGDSV*N  1133
              E+ E N  +++++S ++K PLL   K + + N
Sbjct  331   KEMSEYNDSSDLESSPDQKFPLLHNYKNEGISN  363



>ref|XP_003543391.2| PREDICTED: WAT1-related protein At5g40230-like isoform X1 [Glycine 
max]
 gb|KHN13303.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=373

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/330 (44%), Positives = 212/330 (64%), Gaps = 15/330 (5%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL K AT +GMSN++FV Y+ ++ALL LLP T  Y R    P L+F I  +I +  ++  
Sbjct  29    TLFKAATLQGMSNYVFVTYAYSVALLVLLPVTFFYRRSRVVPPLSFSILSKIALLGVIGS  88

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             + Q L Y GI YSSPTL+SA+++L PAFTF+ AV+  ME +++K R++ AK +G+I+ I 
Sbjct  89    SSQILGYAGIRYSSPTLSSAISNLTPAFTFMLAVICRMEKIAVKRRTTQAKILGSIISIL  148

Query  516   GAFVITFYKGPPLLLFQHAYYNSLLPQQS--------NWILGSFILVTSSLFISMLFLVQ  671
             GAFV+TFYKG  +++  ++  +  LPQ +        NW++G  +L   ++ +++ F+ Q
Sbjct  149   GAFVVTFYKGQSIIIADNSP-SIQLPQSNGILTSVDRNWVIGGLLLTACNILLTVWFVYQ  207

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
               ILK++P EL +         I+++I  ++ E+N +AWK+RPD+ LI+I    I     
Sbjct  208   VEILKEFPDELTMVFFYNLCAAIVASIIGLLGEKNSSAWKIRPDISLISIVCTGIFNKFL  267

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
              S +YAW +  KGPV+VAMF PL +V AV MGV FL D LY GS+IGA+II++GFYTVMW
Sbjct  268   SSAIYAWGIHLKGPVYVAMFKPLSIVIAVAMGVMFLGDSLYVGSIIGATIISIGFYTVMW  327

Query  1032  GKAMEVK------ENIETNIDNSNEKVPLL  1103
             GKA E K      EN+ +   +  E +PLL
Sbjct  328   GKATEQKEEEEEEENVGSQESSITENIPLL  357



>ref|XP_006355963.1| PREDICTED: WAT1-related protein At3g28050-like [Solanum tuberosum]
Length=345

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/320 (46%), Positives = 204/320 (64%), Gaps = 16/320 (5%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPSTIL----YHRLMPPPVLTFGIFGRICITALLS  332
             K+A ++G+S+FI V+YSNA+A L L P +I       R  P   LTF +F RI + AL+ 
Sbjct  31    KIAMSKGLSSFIIVVYSNAIATLILFPPSIFIFITRSRRRP---LTFSVFWRILLLALIG  87

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             Y GQ   Y+GI YSSPTLA+AM +LIP FTFI A+   ME+++ K  SS AK  GT VLI
Sbjct  88    YFGQICDYVGISYSSPTLATAMLNLIPGFTFILAITFRMEVINWKSWSSYAKVFGTFVLI  147

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
              GAFV+TFYKGPP++   + +  S    Q NWILG  IL   S+  S+ +++QA ILK Y
Sbjct  148   GGAFVLTFYKGPPII---NQHLTSTFSSQQNWILGGVILACESMSASLWYIIQASILKIY  204

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
               E+++  +    VTI+SA+ +++ ERN NAW + PD+ LIAI Y+ I+ + FRS +  W
Sbjct  205   QEEMIIVCLYSFFVTIISALISLLVERNPNAWMIYPDIRLIAILYSGIVGIAFRSCMTTW  264

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV-  1049
              ++K  P+FV+MF P  +V A+++G    RD  Y GS++G+    +GFY VMWGK  E  
Sbjct  265   CLKKTDPLFVSMFKPFAIVFALLIGTFCFRDVFYLGSLVGSVTTVIGFYGVMWGKTQEKY  324

Query  1050  --KENIETNIDNSNEKVPLL  1103
                 N+ET  +N+   VPLL
Sbjct  325   YEGNNLETLAENN---VPLL  341



>gb|KCW86748.1| hypothetical protein EUGRSUZ_B03358 [Eucalyptus grandis]
Length=261

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 166/234 (71%), Gaps = 1/234 (0%)
 Frame = +3

Query  354   YIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAFVIT  533
             ++GI YSSPTLAS M DL PAFTFI A+++ ME + L+ +SS+AK +GTIV I GA  +T
Sbjct  2     FVGIGYSSPTLASVMTDLTPAFTFILALISRMEKIDLRVQSSMAKLVGTIVCIAGALTVT  61

Query  534   FYKGPPLLLFQHAYYNSL-LPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPGELML  710
              YKG PL     +    L L  QS+WI G F+L  ++  +S+L +VQ WI+KDYP ELML
Sbjct  62    LYKGLPLTNGSPSMPQELPLQLQSSWIFGGFLLACAAFLVSLLLVVQTWIVKDYPAELML  121

Query  711   TVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAVRKKG  890
             T++ C +VTI S I A+I E++VNAWKL+PD+EL+ I Y+A  +V  RSV + W  + KG
Sbjct  122   TLLACVVVTIQSTIVALIVEKDVNAWKLKPDIELMTIVYSAFFVVSIRSVTHTWVCKTKG  181

Query  891   PVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
             P++++M  PLGM+ A +MGV+ L D LY GSVIG  IIA GFY V+WGKA E K
Sbjct  182   PLYLSMIKPLGMIIASVMGVSLLGDTLYLGSVIGGIIIAFGFYAVVWGKAQEEK  235



>ref|XP_010029213.1| PREDICTED: WAT1-related protein At3g28050-like [Eucalyptus grandis]
 gb|KCW56072.1| hypothetical protein EUGRSUZ_I01830 [Eucalyptus grandis]
Length=356

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 146/333 (44%), Positives = 217/333 (65%), Gaps = 11/333 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RGM+  +F++Y+ A+A L LLP+ ++  +    P L+  I  +I +  L+ 
Sbjct  27    NTLYKAATLRGMNYHVFIVYAYAIAALVLLPAAVISRKSRTLPPLSRPILAKIVLLGLVG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q L Y GI +SSPTLASA+++L PAFTFI A++  ME +SLK RSS AK IGTIV I
Sbjct  87    SSSQILGYTGINFSSPTLASAISNLTPAFTFILAILFRMEYISLKRRSSQAKIIGTIVSI  146

Query  513   TGAFVITFYKGPPLLLFQH---AYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
             +GAFV+T Y GPP+++      + + +L      WI+G  +L    + +++ ++VQA I+
Sbjct  147   SGAFVVTLYIGPPIIIGTKPSPSLHQNLHSTNMGWIIGGSLLTAEYVLVTLWYIVQAQIM  206

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             K+YP EL +  +   +V+ ++A  A+I ER++NAW++R D+ L+++  + +   G  + V
Sbjct  207   KEYPDELTVVFLYNLIVSFVAATVALITERDLNAWRVR-DIGLVSVICSGVFGSGLNNSV  265

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             +AWA+R KGP + A+F PL +  AV MGV FL D L+ GS+IG +II+ GFYTVMWGKA 
Sbjct  266   HAWAIRLKGPFYAALFKPLSIAIAVAMGVFFLGDTLHLGSLIGVTIISFGFYTVMWGKAK  325

Query  1044  EVKENIETNIDNS-----NEKVPLLPPNKGDSV  1127
             E  +NIE   +N      +EKVPLL  +K D V
Sbjct  326   E--QNIEEAGENRPVSIPSEKVPLLQNHKVDEV  356



>ref|XP_010254351.1| PREDICTED: WAT1-related protein At4g15540-like [Nelumbo nucifera]
Length=551

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 149/331 (45%), Positives = 208/331 (63%), Gaps = 14/331 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSN-alallfllPST--ILYHRLMPPPVLTFGIFGRICITA  323
             +TL+K A  RGMSNF+F+LYS     LL LLPS   I  HR      LTF I  +I +  
Sbjct  221   STLSKAAMRRGMSNFVFILYSYILATLLLLLPSVFVICRHRATHAAPLTFSILCKIFLLG  280

Query  324   LLSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTI  503
             L     Q LQ+ GI  SSPTL+SA+ + +PAF FI A++  ME LSLK     AK +GT+
Sbjct  281   LAGCTAQILQFEGIRSSSPTLSSAVDNTLPAFVFILALIFRMERLSLKSSYGQAKLLGTL  340

Query  504   VLITGAFVITFYKGPPLLLF--------QHAYYNSLLPQQSNWILGSFILVTSSLFISML  659
             V +TGAFV+TFY+GP ++           H +   LL  +S+W+ G F+L   +L ++ L
Sbjct  341   VSVTGAFVVTFYRGPSIIRTSSTSNSSDHHHHQQLLLFPKSSWVFGGFLLSLHTLVVAFL  400

Query  660   FLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAII  839
              ++QA I+ DY  E  +    C   +I + + +++AER+ +AW+LRP++ELIAI Y AI 
Sbjct  401   HIIQASIVNDYQAEFPIAFFYCFFASIQTTLISLVAERDPSAWRLRPNLELIAIIYAAIF  460

Query  840   MVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFY  1019
                 RS+V  W + K GPV+VAMF P G+V AV+   TFLRD LY GSV+G++II++GFY
Sbjct  461   GCAIRSLVNLWCLGKNGPVYVAMFKPFGIVIAVVTSSTFLRDSLYLGSVVGSAIISVGFY  520

Query  1020  TVMWGKAME---VKENIETNIDNSNEKVPLL  1103
              VMWGKA E    K+  E ++ ++ E+VPLL
Sbjct  521   AVMWGKAKEWKIAKDIEEYSLMSTTERVPLL  551


 Score =   107 bits (267),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 84/133 (63%), Gaps = 5/133 (4%)
 Frame = +3

Query  447  MEILSLKERSSLAKSIGTIVLITGAFVITFYKGPPLLLFQH-----AYYNSLLPQQSNWI  611
            ME L+LK     AK +GT+V ITGAFV+T YKGP + +        A+   LL  +SNW+
Sbjct  1    MEPLALKSSYGRAKLLGTLVSITGAFVVTLYKGPSIFISNSSASNLAHQRFLLSPKSNWV  60

Query  612  LGSFILVTSSLFISMLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWK  791
             G F+L    L ++ LF++QA I+KDY  E  +T   C   +I +A  ++IAE++ +AW 
Sbjct  61   FGGFLLSLHILALAFLFIIQASIVKDYQAEFSITFFYCFFGSIPTAFISVIAEKDPSAWI  120

Query  792  LRPDMELIAICYN  830
            LRP++ELIAI Y+
Sbjct  121  LRPNLELIAIIYS  133



>ref|XP_010653186.1| PREDICTED: WAT1-related protein At3g28050 [Vitis vinifera]
 ref|XP_010653192.1| PREDICTED: WAT1-related protein At3g28050 [Vitis vinifera]
 emb|CBI32107.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 150/320 (47%), Positives = 205/320 (64%), Gaps = 8/320 (3%)
 Frame = +3

Query  162   NKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAG  341
             +K A + GM N +F+LYSN LA L LLPS +L+HR  P P LTF +     + ALL +  
Sbjct  26    SKAAISSGMPNLVFILYSNTLASLILLPSCLLFHR-SPRPQLTFSLLSGFFLLALLGFFA  84

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
             Q   Y GI+YSS TL +AM +L+P FTFI A++  ME L  +  SS+AKS+GT+V I GA
Sbjct  85    QIFGYAGIQYSSATLGTAMLNLVPGFTFILAIIFRMERLDWRG-SSMAKSMGTVVSIAGA  143

Query  522   FVITFYKGPPLLLFQHA--YYNSL-LPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             F++TFYKG P+L+      + + L L QQSNW+ G  +L    +  S   ++QA ILK Y
Sbjct  144   FIVTFYKGSPILMTPSPSNFPDQLFLSQQSNWVFGGLLLAADCVMSSAWLILQASILKKY  203

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P EL++    C  V I SA A++I ER   AW L+P    IA+ Y+ +    F+     W
Sbjct  204   PAELIINFYYCFFVAIQSAAASLIMERGPGAWSLKPSTRFIAVMYSGVFGYVFQVGAITW  263

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              V +KGPVFVAMF P+G+V AV MGV FL D  Y GS+IGA++I +GFY+VMWGKA E K
Sbjct  264   CVHQKGPVFVAMFKPVGIVVAVAMGVIFLGDTFYMGSLIGATVIVIGFYSVMWGKAKEEK  323

Query  1053  --ENIE-TNIDNSNEKVPLL  1103
               E+I   +++++++K PLL
Sbjct  324   IDEDIGMRSLESTSQKAPLL  343



>gb|KHN44249.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=350

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 147/330 (45%), Positives = 217/330 (66%), Gaps = 12/330 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL+K A  +GM++F+F++YSNA A   LL   + ++R    P L+    G   +  +LS
Sbjct  21    NTLSKAAMKKGMNDFVFIMYSNAFAACLLLLLALFFYRKRTLPPLSCNTLGLFLVVGMLS  80

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q++++ GI YSSPTLASA++DL+PAFTFI AV+  ME L  K  S+LAKSIGT+V I
Sbjct  81    CINQSIKFFGIGYSSPTLASALSDLVPAFTFILAVIFRMEKLDWKANSTLAKSIGTVVSI  140

Query  513   TGAFVITFYKG-------PPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQ  671
              GA +++ YKG       PP  LF     +S+   Q +W+ G+ +L   S F+S+ +++ 
Sbjct  141   AGALLLSLYKGQAIINNNPPFKLFPQKLVSSM---QFDWVFGALLLAAHSCFLSINYILL  197

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
               I+++YP EL++ +   AL +ILS  AA+I+ +++ A +L  +MELIAI  +AI ++ F
Sbjct  198   TRIVREYPAELVVVLSRIALTSILSVPAALISVKDLKALRLGFNMELIAIGCSAIFVLSF  257

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
             R V++ W + K+GPV+VAMF PL +V AVI+GVTFL D LY GSVIGA+II +GFY V+W
Sbjct  258   RGVIHIWIMGKRGPVYVAMFKPLEIVFAVILGVTFLGDSLYIGSVIGAAIIVVGFYAVIW  317

Query  1032  GKAME-VKENIETNIDNS-NEKVPLLPPNK  1115
             GK+ E V+E+       S + +VPLL   +
Sbjct  318   GKSQEKVEEDCTVYSSESYDNEVPLLQNKR  347



>ref|XP_007137543.1| hypothetical protein PHAVU_009G135500g [Phaseolus vulgaris]
 gb|ESW09537.1| hypothetical protein PHAVU_009G135500g [Phaseolus vulgaris]
Length=352

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 195/303 (64%), Gaps = 4/303 (1%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L+K A ++GM+NFIF+ YSNA+A L LLP + L HR   PP+ TF       + ALL Y 
Sbjct  24    LSKQAMSQGMTNFIFIFYSNAIAALLLLPISFLIHRFERPPI-TFSTLCGFFLLALLGYL  82

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI Y S TL+++M +L+P FTFI AV+  ME L  ++ SSLAKS+GTIV I+G
Sbjct  83    AQAFGYAGIYYGSATLSTSMLNLVPGFTFILAVLFRMEQLDWRKFSSLAKSLGTIVSISG  142

Query  519   AFVITFYKGPPLLLFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF++T YKGP LLL   +  +S   L    SNWIL    L    +  S   ++QA ILK 
Sbjct  143   AFIVTLYKGPALLLGVSSANSSPKPLFTDDSNWILAGLFLAADCVMASAYIILQASILKK  202

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP EL++    C  V I SA+  ++ ER+++AW L P + L+A+ Y+ ++   F+  + +
Sbjct  203   YPAELIVVFFYCFFVAIQSAVTCLVVERDISAWSLEPKLRLLAVLYSGVMGSAFQVGIIS  262

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + K GPVFV+MF PLG+V +V++GV FL D  Y GS+IGA +I  GFY+V+WGKA ++
Sbjct  263   WCLHKTGPVFVSMFKPLGIVISVVLGVLFLGDAFYLGSLIGAIVIVAGFYSVLWGKAEDI  322

Query  1050  KEN  1058
             K+ 
Sbjct  323   KDG  325



>ref|XP_007163931.1| hypothetical protein PHAVU_L004700g [Phaseolus vulgaris]
 gb|ESW35925.1| hypothetical protein PHAVU_L004700g [Phaseolus vulgaris]
Length=265

 Score =   255 bits (652),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 175/257 (68%), Gaps = 7/257 (3%)
 Frame = +3

Query  354   YIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAFVIT  533
             Y GI YSSPTL SAM DL+PAFTFIFA+++ ME L+LK++S  AK IGT++ I GAF++T
Sbjct  2     YTGISYSSPTLCSAMVDLVPAFTFIFALISRMENLNLKQQSCQAKVIGTVISIAGAFIVT  61

Query  534   FYKGPPLLLFQHAYY---NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPGEL  704
              YKG PL    +  +    + L  QSNWI+G F+L T+SL IS+L +VQ   +K+YP EL
Sbjct  62    LYKGTPLNFSLNVVFGGKETYLSVQSNWIIGGFLLATASLCISVLLIVQTSAVKEYPEEL  121

Query  705   MLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAVRK  884
             ++T I C++V ILSAI A+ AE N  AW L    E IA+ Y+AI +V  RSVV  W  RK
Sbjct  122   VITSICCSMVVILSAIVALFAEGNPKAWILTSHKEFIAVFYSAIFVVSTRSVVCTWGCRK  181

Query  885   KGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKENIE  1064
             KGPV+VAMF PLGMV A+ MGV FL ++LY GSVIGA  I +GFY++MW  A + K   E
Sbjct  182   KGPVYVAMFNPLGMVIALGMGVIFLGENLYLGSVIGAGTIGIGFYSMMWAHAEDDKVGNE  241

Query  1065  TNIDN----SNEKVPLL  1103
              N +     S+   PLL
Sbjct  242   NNENRDLVTSSSSAPLL  258



>ref|XP_010043808.1| PREDICTED: WAT1-related protein At5g40240-like [Eucalyptus grandis]
 gb|KCW85806.1| hypothetical protein EUGRSUZ_B02552 [Eucalyptus grandis]
Length=343

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 204/326 (63%), Gaps = 12/326 (4%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K   + GMSN +FV YSNA A L LLP+++++HR   PP LT  +  +  +  LL   
Sbjct  12    VSKAVMSNGMSNLVFVFYSNAFASLILLPASLIFHRSGRPP-LTPSLVLQFFVLGLLGCL  70

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q L Y GI YSSPTL SA+ +L+PAFTF+ A++  +E L+    SSLAK  GTIV + G
Sbjct  71    AQILGYAGINYSSPTLGSALLNLVPAFTFLLAIIFRLERLNWSSSSSLAKCAGTIVCVAG  130

Query  519   AFVITFYKGPPLL------LFQHAY--YNSLLPQQSNWILGSFILVTSSLFISMLFLVQA  674
             AFV+T YKGP ++      L    +  ++ LL  +SNW+LG  +LV   +  S   +VQA
Sbjct  131   AFVVTLYKGPAIVTSSLSNLHNEVFNLHHKLLTPESNWVLGGLLLVADCVMASSWLIVQA  190

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
              +LK YP EL++    C  V I SA  ++  ER  +AW L+ +M L+A+ Y+A+    F+
Sbjct  191   SVLKKYPAELIIVFFYCFFVAIQSAAISLFVERKSSAWSLKDNMRLMAVLYSAVFGSAFQ  250

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
               V  W + + GPVFV+MF PLG+V A + GV FL D+ Y GS++G+  I +GFY+VMWG
Sbjct  251   VGVSTWCLHRTGPVFVSMFKPLGIVIAAVAGVLFLGDNFYLGSLVGSVAIVVGFYSVMWG  310

Query  1035  KAMEVKENIET---NIDNSNEKVPLL  1103
             KA E K+++     N++ + +KVPLL
Sbjct  311   KAKEQKKDLAISVGNVEPNKKKVPLL  336



>ref|XP_010682604.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682605.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682606.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682607.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=356

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/332 (43%), Positives = 204/332 (61%), Gaps = 7/332 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K A + GMS F+FV YSNA A L LLP +  +HR    P LTF + G   + AL    
Sbjct  24    ISKQAMSAGMSTFVFVCYSNAFASLILLPFSFFFHRSEQRPQLTFSLLGWFFLLALSGCL  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI YSSPTL +AM +L+P  TF+ A++  ME L++++ S LAK +G +VLI G
Sbjct  84    AQLFGYTGINYSSPTLGTAMLNLVPGLTFLLAIIFRMEKLNIRKISCLAKLVGAMVLIAG  143

Query  519   AFVITFYKGPPLL---LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AFV T Y+GPPLL   +  H +  S++ + + WILG   L    +  S   ++QA ILK 
Sbjct  144   AFVATLYEGPPLLNRPVSLHTHQLSIIGEHTRWILGGSFLAVDCVMASSWAIIQAIILKK  203

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP EL++    C  +T+ S I  +I ERN++AW L+  M L+A+ Y+A+     +  + +
Sbjct  204   YPAELIVVFFYCFFITLQSGIVTVILERNLSAWSLKSTMRLLAVLYSAVFGSALQVGLCS  263

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W +RKKGPVFV MF PLG+  A + GV F  D LY GS++G  II  GFY+VMWGKA E 
Sbjct  264   WCLRKKGPVFVCMFKPLGIAIAAVAGVVFFGDTLYLGSLLGIIIIVFGFYSVMWGKAKEE  323

Query  1050  KENIET---NIDNSNEKVPLLPPNKGDSV*NF  1136
             K+  ++   ++ +  +KVPLL  +  ++V NF
Sbjct  324   KKINDSQFGSLQSPTQKVPLLANHAKETV-NF  354



>ref|XP_002531394.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF30978.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=349

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 145/326 (44%), Positives = 202/326 (62%), Gaps = 5/326 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++KVA ++GMS+FIFV YSNALA L LLP ++L+ R   PP LTF I     +  L    
Sbjct  25    ISKVAMSKGMSSFIFVCYSNALASLILLPFSLLHRRTERPP-LTFSIVCGFFLLGLFGCL  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI  SSPTL +AM +L+P  TFI AV   ME L  +  SSLAKS+GTI+ + G
Sbjct  84    AQFFGYAGINLSSPTLGTAMLNLVPGLTFILAVAFRMEKLDGRTSSSLAKSMGTIISVGG  143

Query  519   AFVITFYKGPPLLLFQH-AYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYP  695
             AF++T+YKGP +LL       + LL Q SNWI+G  +L    +  S   ++QA ILK YP
Sbjct  144   AFILTYYKGPLVLLTPSLNSSHQLLTQPSNWIIGGLLLAADCVMTSAWIIIQALILKIYP  203

Query  696   GELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWA  875
              EL++    C  VTILSAI  ++ ER+ +AW L P++ L+++ Y+ +     +  +  W 
Sbjct  204   AELIIVFFYCFFVTILSAIVCLVVERDPSAWSLIPNIRLVSVLYSGVFGSALQVGISTWC  263

Query  876   VRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKE  1055
             +R+ GPVFV+MF PLG++ A  +GV  L D LY GS+IG  I  +G+YTVMWG+A E  +
Sbjct  264   LRQTGPVFVSMFKPLGIIIAAAVGVICLGDTLYLGSIIGTVICGMGYYTVMWGQAREDGK  323

Query  1056  NIETNI---DNSNEKVPLLPPNKGDS  1124
                 ++   D S+EKVPLL     ++
Sbjct  324   QKPHDVERADTSDEKVPLLQDQDAEA  349



>ref|XP_003602166.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES72417.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=345

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/326 (43%), Positives = 198/326 (61%), Gaps = 7/326 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L+K   ++GM++FIF+ YSN +A L LLPS+   HR   PP+ TF       I  LL Y 
Sbjct  24    LSKQVMSQGMTSFIFIFYSNTIAALVLLPSSFFIHRFQRPPI-TFSTLSGFFILGLLGYL  82

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI YSS TLA+AM +L+P FTFI AV+  ME L  +  SSLAKS+GTIV I G
Sbjct  83    AQVFGYAGINYSSSTLATAMLNLVPGFTFILAVLFRMEELDWRSPSSLAKSLGTIVSIAG  142

Query  519   AFVITFYKGPPLLLF---QHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF+ T YKG  LL      +     L  Q S+WILG   L    +  S   +VQA ILK 
Sbjct  143   AFIATLYKGAALLKGPSPANFSQQPLFSQDSDWILGGLFLAADCVMASSFTIVQASILKK  202

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP  L++    C  V ILSA+  +  ER+++AW L P + L+++ Y+ +    F+  V  
Sbjct  203   YPAGLIVVFFYCFFVAILSAVTCLAVERDISAWSLEPKLRLLSVLYSGVFGSAFQVGVTT  262

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + + GPVFV+MF P+G+V +V++GV FL D  Y GS+IGA++I +GFY+V+WGK+ ++
Sbjct  263   WCLHQTGPVFVSMFKPIGIVISVVIGVLFLGDAFYLGSLIGATVIVIGFYSVLWGKSKDI  322

Query  1050  KENIETNIDNSNEKVPLLPPNKGDSV  1127
             +     ++++  ++ PLL  N  + V
Sbjct  323   EAR---SLESRGKQTPLLKENSSEDV  345



>ref|XP_003613294.1| Auxin-induced protein 5NG4 [Medicago truncatula]
Length=262

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 170/234 (73%), Gaps = 5/234 (2%)
 Frame = +3

Query  360   GIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAFVITFY  539
             GI++SSP LASA+ +L+PAFTFI A+++ ME+L++K+ SS AK IGT+V I GA V+TFY
Sbjct  4     GIKFSSPALASAIVNLVPAFTFILAIISRMEVLNMKKHSSQAKVIGTVVSIAGALVVTFY  63

Query  540   KGPPLLL-----FQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPGEL  704
             KG PL+       +       L  +S+WI+G+F++   S  +S+LF+VQ WI++DYP EL
Sbjct  64    KGIPLINDAIKNIEMGASGIFLLGKSDWIIGAFLVAVGSFCLSLLFIVQTWIVRDYPEEL  123

Query  705   MLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAVRK  884
             ++  I C  V I+S I A+IAE N NAW+LRPD EL+++CY+A  +   ++V+  WA RK
Sbjct  124   VINTICCCFVVIISTIVALIAEGNSNAWRLRPDKELLSVCYSATFVESLKNVIQTWACRK  183

Query  885   KGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME  1046
             KGP++VAMF PL +V A+ MGV FL D+LY GS+IGA+II +GFY V+W KA E
Sbjct  184   KGPIYVAMFKPLRVVIALSMGVIFLGDNLYLGSMIGAAIIVIGFYAVIWAKAQE  237



>ref|XP_007215585.1| hypothetical protein PRUPE_ppa007567mg [Prunus persica]
 gb|EMJ16784.1| hypothetical protein PRUPE_ppa007567mg [Prunus persica]
Length=363

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 147/330 (45%), Positives = 209/330 (63%), Gaps = 15/330 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RGMS  +FV+YS ++A LFLLP+  + +R    P L F I  ++ +  L+ 
Sbjct  27    NTLFKAATLRGMSYHVFVVYSYSVAALFLLPAPFISNRSRVLPPLNFSIMSKVLLLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + Y GI +SSPTLASA+++L+PAFTFI AV+  ME  +L+ RSS AK +GTIV +
Sbjct  87    SSSQIMGYTGINFSSPTLASAISNLVPAFTFILAVIFRMESAALRSRSSQAKILGTIVSL  146

Query  513   TGAFVITFYKGPPLLL--------FQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLV  668
              GAFV+T YKGPPL+               N   P  SNW+LG  +L    + + + ++V
Sbjct  147   AGAFVVTLYKGPPLVFPHQSPSISLHQPLLNPTTPTNSNWVLGGLLLTAEYILVPLWYIV  206

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             QA I+K+YP EL +       V +++ + A+I E N +AWKLRP++ L++I  + +    
Sbjct  207   QAQIMKEYPNELTVIFFYNVCVGVVAGVVALITEPNSSAWKLRPNVALVSILCSGLFGSF  266

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
               + V+ WA+R KGPV+V MF PL M  AV MGV FL D L+ GS++GA+II++GFYTV+
Sbjct  267   LNNTVHTWALRLKGPVYVTMFKPLSMAIAVAMGVIFLGDTLHLGSLVGATIISIGFYTVL  326

Query  1029  WGKAMEVKENIETNIDNSNE-----KVPLL  1103
             WGKA E  E +E ++ +S E     K PLL
Sbjct  327   WGKAKE--EAVEDSVADSLEAPSAHKAPLL  354



>ref|XP_003553931.1| PREDICTED: WAT1-related protein At5g40230 isoform X1 [Glycine 
max]
 gb|KHN23569.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=373

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/330 (43%), Positives = 210/330 (64%), Gaps = 15/330 (5%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL K AT +GMSN++FV Y+ ++A L LLP T  Y R    P LTF I  +I +  ++  
Sbjct  29    TLFKAATLQGMSNYVFVTYAYSVAFLVLLPVTFFYRRSRVVPPLTFSILSKIALLGVIGC  88

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             + Q L Y GI YSSPTL+SA+++L PAFTF+ AV+  ME +++K R++ AK +G+I+ + 
Sbjct  89    SSQILGYAGIRYSSPTLSSAISNLTPAFTFVLAVICRMEKIAVKRRTTQAKILGSIISVL  148

Query  516   GAFVITFYKGPPLLLFQHAYYNSLLPQQS--------NWILGSFILVTSSLFISMLFLVQ  671
             GAFV+TFYKG  +++  ++  +  LPQ +        NW++G  +L   ++ +++ F+ Q
Sbjct  149   GAFVVTFYKGQSVIIADNSP-SIQLPQSNGILTSVDRNWVIGGLLLTACNILLTVWFVYQ  207

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
               ILK++P EL +         I+++I  ++ E+N +AWK+RPD+ LI+I    I     
Sbjct  208   VEILKEFPDELSMVFFYNLCAAIVASIVGLLGEKNSSAWKIRPDISLISIVCTGIFNKFL  267

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
              S +YAW +  KGPV+VAMF PL +V AV MGV FL D LY GS+IGA+II++GFYTVMW
Sbjct  268   SSAIYAWGIHLKGPVYVAMFKPLSIVIAVAMGVMFLGDSLYVGSIIGATIISIGFYTVMW  327

Query  1032  GKA------MEVKENIETNIDNSNEKVPLL  1103
             GKA         +EN+ +   +  E VPLL
Sbjct  328   GKATEQKEEEGEEENVGSQESSITENVPLL  357



>ref|XP_004297653.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=352

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 140/321 (44%), Positives = 199/321 (62%), Gaps = 6/321 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K A + GM+  IFV YSNALA   LLP+++L+HR    P +TF I     +  LL + 
Sbjct  25    VSKAAMSTGMNMLIFVCYSNALAAFVLLPTSLLFHRSTERPPITFSILCWFFLLGLLGFM  84

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q + Y GI YSSPTL +AM +LIPAFTF+ AV+  ME +  +  S+LAK++GTIV I+G
Sbjct  85    AQLIGYAGINYSSPTLGTAMLNLIPAFTFVLAVIFRMEKIDGRSCSTLAKTLGTIVSISG  144

Query  519   AFVITFYKGPPLLL---FQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF++T YKGPPLL+        +N L   QSNW++G  +L    +  +   ++QA +LK 
Sbjct  145   AFIVTLYKGPPLLMTASVDMLSHNQLFLPQSNWVIGGMLLGLHCVVAAAWLIIQASVLKK  204

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP EL++    C  V I S +     ER+++AW L   +   A+ Y+ +    F+  V  
Sbjct  205   YPAELIIVFYYCFFVAIQSVVVLWFVERDLSAWALNSRLRFFAVLYSGVFGSAFQVGVST  264

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + + GPVFV+MF PLG+V AV +GV FL D  Y GS+IGAS+I  GFY+V+WGKA E 
Sbjct  265   WCLNRTGPVFVSMFKPLGIVVAVAIGVIFLGDTFYLGSLIGASVIVTGFYSVIWGKANEE  324

Query  1050  KENIET---NIDNSNEKVPLL  1103
             K N E    ++ +  ++VPLL
Sbjct  325   KMNDEAGAGSLTSKKQRVPLL  345



>ref|XP_010043800.1| PREDICTED: WAT1-related protein At5g40240-like [Eucalyptus grandis]
Length=359

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 202/329 (61%), Gaps = 15/329 (5%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K   + GMSN +FV YSNA A L LLP+++++HR   PP LT  +  +  +  LL   
Sbjct  25    VSKAVMSNGMSNLVFVFYSNAFASLILLPASLIFHRSGRPP-LTPSLVLQFFVLGLLGCL  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q L Y GI YSSPTL SA+ +L+PAFTF+ A++  +E L     SSLAK  GTIV I G
Sbjct  84    AQILGYAGINYSSPTLGSALLNLVPAFTFVLAIICRLERLDWSSSSSLAKCAGTIVCIAG  143

Query  519   AFVITFYKGPPLL---------LFQHAY--YNSLLPQQSNWILGSFILVTSSLFISMLFL  665
             AFV+T YKGP ++         L    +  ++ LL  +SNW+LG   LV   +  S   +
Sbjct  144   AFVVTLYKGPAIVTTSTSSLSNLHNEVFNLHHKLLTPESNWVLGGLFLVADCVMTSSWLI  203

Query  666   VQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMV  845
             VQA +LK YP EL++    C  V I SA  +   ER  +AW L+ +M L+A+ Y+A+   
Sbjct  204   VQASVLKKYPAELIIVFFYCFFVAIQSAAISFFVERKSSAWSLKDNMRLMAVLYSAVFGS  263

Query  846   GFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTV  1025
              F+  V  W + + GPVFV+MF PLG+V A + GV FL D+ Y GS++G+  IA+GFY+V
Sbjct  264   AFQVGVSTWCLHRTGPVFVSMFKPLGIVIAAVAGVLFLGDNFYLGSLVGSVAIAVGFYSV  323

Query  1026  MWGKAMEVKENIETNIDN---SNEKVPLL  1103
             MWGKA E K+++  ++ +   + +KVPLL
Sbjct  324   MWGKAKEEKKDLVISVGDVKLNKKKVPLL  352



>ref|XP_006338537.1| PREDICTED: WAT1-related protein At3g28050-like [Solanum tuberosum]
Length=365

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 148/334 (44%), Positives = 210/334 (63%), Gaps = 8/334 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMSN +FV+YS  LA L LLPS     R    P L   I  +I +  ++ 
Sbjct  32    NTLYKAATNKGMSNHVFVVYSYGLAALLLLPSPFFSARSRILPPLNCSILAKIFLLGVIG  91

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q + Y GI Y+SPTLASA+++L+PAFTF+ AV+  ME + LK  ++ AK +GT+V I
Sbjct  92    CTSQIMGYTGIIYASPTLASAISNLVPAFTFVLAVIFRMEKIQLKRSTTRAKVLGTVVSI  151

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQ-----QSNWILGSFILVTSSLFISMLFLVQAW  677
              GAFV+T YKGP +L+   +  N LL Q     QSNW+LG   L T    + M ++VQ W
Sbjct  152   AGAFVVTLYKGPKILVPTTSTPN-LLRQPLGSSQSNWMLGGLFLTTEYFLVPMWYIVQTW  210

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I+K YP E+ +       V+IL+ I   ++E + N W ++PD+ L +I  + I+     +
Sbjct  211   IMKVYPAEVTVVFFYNLTVSILAGIVGFLSEPDSNKWIIKPDIALASILCSGILGSSLNN  270

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
              ++ WA+R KGPV+VAMF PL +  AV MGV  L D LY GS++GA+IIA+GFYTVMWGK
Sbjct  271   TIHTWALRVKGPVYVAMFKPLSIAIAVAMGVILLGDTLYLGSILGATIIAIGFYTVMWGK  330

Query  1038  AMEVKE-NIETNIDNS-NEKVPLLPPNKGDSV*N  1133
             A E+ E N  +++++S ++K PLL   K + + N
Sbjct  331   AKEMPEYNDSSDLESSPDQKFPLLHNFKNEGISN  364



>ref|XP_009363570.1| PREDICTED: uncharacterized protein LOC103953544 [Pyrus x bretschneideri]
Length=742

 Score =   266 bits (680),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 210/327 (64%), Gaps = 10/327 (3%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K+A + GMSN IF+ YSNALA L LLP ++++HR   PP LT  I G   +  L+ + 
Sbjct  413   ISKIAMSNGMSNLIFLCYSNALAALILLPISLVFHRSERPP-LTLSIIGWFFLLGLIGFM  471

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q L Y GI YSSPTL++AM +LIPAFTF+ AV+  ME + ++  SSLAK++GTIV I+G
Sbjct  472   AQFLGYAGINYSSPTLSTAMLNLIPAFTFVLAVIFRMERIDMRSFSSLAKTLGTIVSISG  531

Query  519   AFVITFYKGPPLLLFQHAY------YNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
             AF++T YKGPP+L            +  L+ ++SNW+LG   +  + +  S   +VQA +
Sbjct  532   AFIVTLYKGPPILKASSTVMTDVLSHKQLISERSNWVLGGVCVAANCVLASAWIIVQASV  591

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             LK Y  EL++    C  V I S + + I ER++ +W+L P +  IA+ Y+A+    F+  
Sbjct  592   LKKYRAELIMVFYYCFFVAIQSVVVSSILERDLRSWELTPKIRWIAVLYSAVFGSAFQVG  651

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             V  W +R+ GPVFVAMF PLG++  V +GVTFL D  Y GS+IGA +I +GFY+VMWGKA
Sbjct  652   VSTWCLRRTGPVFVAMFKPLGIIVTVFIGVTFLGDTFYLGSLIGAIVIVIGFYSVMWGKA  711

Query  1041  MEVK---ENIETNIDNSNEKVPLLPPN  1112
              E K   +  E ++ +  ++VPLL  +
Sbjct  712   NEEKMDEDAGEESLASIKQQVPLLQSH  738


 Score =   246 bits (629),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 198/329 (60%), Gaps = 15/329 (5%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             +NK A + G + +I V+Y N +A L LLPS +++HR   PP LTF I  RI +  L   +
Sbjct  27    VNKAAMSTGTNAYIIVVYGNTIAALILLPSALIFHRSERPP-LTFSILCRIFLLGLFCCS  85

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q    IGIEYSSPTL++AM +LIPAFTFI A++  ME ++ +  SS AK  GT++ I G
Sbjct  86    AQIFGNIGIEYSSPTLSTAMLNLIPAFTFILAIIFRMETVNWRSSSSQAKVFGTVMSIGG  145

Query  519   AFVITFYKGPPLLLFQHAYYNSLL----PQQSNWILGSFILVTSSLFISMLFLVQAWILK  686
             AFV+TFYKG P++    +  NSL       +SNWILG   L   +  IS+ +++QA ++K
Sbjct  146   AFVVTFYKGLPIIRLSSSLPNSLYQIFSSSRSNWILGGLFLAVHAFSISLWYILQATVVK  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVY  866
              YP  L+     C   TI SAI A+IA R+ +AW++R D+ LIA  Y  I+       V 
Sbjct  206   KYPAILLSVFFQCLFATIQSAIFALIAVRDASAWEIRLDVGLIAALYTGIVATVLYFSVI  265

Query  867   AWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME  1046
              W V K G  + +MF P+G++  VIMG  FL D +Y GS++GA+II  GFY +MWGKA E
Sbjct  266   VWCVEKVGAFYCSMFKPIGIIFGVIMGAIFLGDSVYIGSLVGAAIIVTGFYAMMWGKATE  325

Query  1047  VK----ENIETNIDNSNEKVPLLPPNKGD  1121
              K    E+++ N      K+PLL     D
Sbjct  326   EKLIEIESLDQN------KLPLLQNGIQD  348



>ref|XP_006581617.1| PREDICTED: WAT1-related protein At3g28050-like [Glycine max]
Length=350

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/326 (42%), Positives = 204/326 (63%), Gaps = 5/326 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L+K    +GM+NFIF+ YSN++  L LLP ++L HR   PP+ TF       + ALL Y 
Sbjct  24    LSKQVMAQGMTNFIFIFYSNSIGALLLLPISLLIHRFERPPI-TFSTLCGFFLLALLGYL  82

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI Y S TL++++ +L+P FTFI AV+  ME L  ++ SSLAK +GTIV I G
Sbjct  83    AQAFGYAGIYYGSATLSTSILNLVPGFTFILAVLFRMEKLDWRKLSSLAKLLGTIVSIAG  142

Query  519   AFVITFYKGPPLLLFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF++T YKGP LL+   +   S   LL + SNWIL    L    +  S   +VQA ILK 
Sbjct  143   AFIVTLYKGPALLMGVSSANTSQQPLLSEDSNWILAGLFLAADCVMASAYIIVQASILKK  202

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP EL++    C  V I SA+  ++ ER+++AW L P + L+A+ Y+ +    F+  +  
Sbjct  203   YPAELIVVFFYCFFVAIQSAVTCLVVERDISAWSLEPKLRLLAVLYSGVFGSAFQVGIIC  262

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + + GPVFV+MF PLG++ +V++GV FL D  Y GS+IGA++I +GFY+V+WGKA ++
Sbjct  263   WCLHQTGPVFVSMFKPLGILISVVLGVLFLGDAFYLGSLIGATVIVVGFYSVLWGKAKDI  322

Query  1050  KENIETNIDNSNEKVPLLPPNKGDSV  1127
              E+   ++++  ++ PLL  N  + +
Sbjct  323   -EDAGLSLESKGKQAPLLEENSHEDI  347



>ref|XP_006470389.1| PREDICTED: WAT1-related protein At3g28050-like [Citrus sinensis]
Length=359

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/335 (43%), Positives = 209/335 (62%), Gaps = 14/335 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT++GMS+F+FV+YS  +A L LLP+    +R    P  TF I  +I +  L+ 
Sbjct  29    NTLFKAATSKGMSHFVFVVYSYGVAALVLLPAPFFSYRSRVLPPFTFSILCKIGLLGLIG  88

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + Y GI YSSPTLASA+++L PAFTF+ A++  ME ++ ++ SS AK +GTIV I
Sbjct  89    SSSQIMGYTGINYSSPTLASAISNLTPAFTFVLAIIFRMEKVACRKASSQAKVLGTIVSI  148

Query  513   TGAFVITFYKGP-------PLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQ  671
              GAF++T YKGP       P +   HA  +S     SNW +G   L    + + + ++VQ
Sbjct  149   AGAFIVTLYKGPRITTIASPKVSLSHALRSS----NSNWAVGGLFLTAEYILVPLWYIVQ  204

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
               I+K+YP EL +  +    V+ ++AI  +I ER+  AWK+ P + L ++  + +     
Sbjct  205   TQIMKEYPAELTVVFLYNLCVSFVAAIVGLITERDSMAWKVGPGIALASVMCSGLFGSCM  264

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
              + V+ WA+R KGPVFVAMF PL +  AV MGV FL D LY GS++GA+II+LGFYTVMW
Sbjct  265   NNSVHTWALRLKGPVFVAMFKPLSIAIAVAMGVIFLGDTLYLGSLVGATIISLGFYTVMW  324

Query  1032  GKAM-EVKEN--IETNIDNSNEKVPLLPPNKGDSV  1127
             GKA  EV E+  +++    + +KVPLL   K + V
Sbjct  325   GKAKEEVSEDPGVDSQESAAAQKVPLLQSRKNELV  359



>ref|XP_008230645.1| PREDICTED: WAT1-related protein At3g28050-like [Prunus mume]
Length=363

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/330 (44%), Positives = 210/330 (64%), Gaps = 15/330 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RGMS  +FV+YS ++A LFLLP+  + +R    P L F I  ++ +  ++ 
Sbjct  27    NTLFKAATLRGMSYHVFVVYSYSVAALFLLPAPFISNRSRVLPPLNFSIMSKVLLLGIIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + Y GI +SSPTLASA+++L+PAFTFI A++  ME  +L+ RSS AK +GTIV +
Sbjct  87    SSSQIMGYTGINFSSPTLASAISNLVPAFTFILAIIFRMESAALRSRSSQAKILGTIVSL  146

Query  513   TGAFVITFYKGPPLLL--------FQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLV  668
              GAFV+T YKGPP++               NS  P  SNW+LG  +L    + + + ++V
Sbjct  147   AGAFVVTLYKGPPIVFPHQSPSISLHQPLLNSTPPTNSNWVLGGLLLTAEYILVPLWYIV  206

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             QA I+K+YP EL +       V +++ + A+I E N +AWKLRP++ L++I  + +    
Sbjct  207   QAQIMKEYPNELTVIFFYNVCVGVVAGVVALITEPNSSAWKLRPNVALVSILCSGLFGSF  266

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
               + V+ WA+R KGPV+V MF PL M  AV MGV FL D L+ GS++GA+II++GFYTV+
Sbjct  267   LNNTVHTWALRLKGPVYVTMFKPLSMAIAVAMGVIFLGDTLHLGSLVGATIISIGFYTVL  326

Query  1029  WGKAMEVKENIETNIDNSNE-----KVPLL  1103
             WGKA E  E +E ++ +S E     K PLL
Sbjct  327   WGKAKE--EAVEDSVADSLEAPSAHKAPLL  354



>gb|KCW85792.1| hypothetical protein EUGRSUZ_B02544 [Eucalyptus grandis]
Length=422

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 202/329 (61%), Gaps = 15/329 (5%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K   + GMSN +FV YSNA A L LLP+++++HR   PP LT  +  +  +  LL   
Sbjct  88    VSKAVMSNGMSNLVFVFYSNAFASLILLPASLIFHRSGRPP-LTPSLVLQFFVLGLLGCL  146

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q L Y GI YSSPTL SA+ +L+PAFTF+ A++  +E L     SSLAK  GTIV I G
Sbjct  147   AQILGYAGINYSSPTLGSALLNLVPAFTFVLAIICRLERLDWSSSSSLAKCAGTIVCIAG  206

Query  519   AFVITFYKGPPLL---------LFQHAY--YNSLLPQQSNWILGSFILVTSSLFISMLFL  665
             AFV+T YKGP ++         L    +  ++ LL  +SNW+LG   LV   +  S   +
Sbjct  207   AFVVTLYKGPAIVTTSTSSLSNLHNEVFNLHHKLLTPESNWVLGGLFLVADCVMTSSWLI  266

Query  666   VQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMV  845
             VQA +LK YP EL++    C  V I SA  +   ER  +AW L+ +M L+A+ Y+A+   
Sbjct  267   VQASVLKKYPAELIIVFFYCFFVAIQSAAISFFVERKSSAWSLKDNMRLMAVLYSAVFGS  326

Query  846   GFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTV  1025
              F+  V  W + + GPVFV+MF PLG+V A + GV FL D+ Y GS++G+  IA+GFY+V
Sbjct  327   AFQVGVSTWCLHRTGPVFVSMFKPLGIVIAAVAGVLFLGDNFYLGSLVGSVAIAVGFYSV  386

Query  1026  MWGKAMEVKENIETNIDN---SNEKVPLL  1103
             MWGKA E K+++  ++ +   + +KVPLL
Sbjct  387   MWGKAKEEKKDLVISVGDVKLNKKKVPLL  415



>gb|KHN23420.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=347

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/326 (42%), Positives = 205/326 (63%), Gaps = 8/326 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L+K    +GM+NFIF+ YSN++  L LLP ++L HR   PP+     F  +C   LL+  
Sbjct  24    LSKQVMAQGMTNFIFIFYSNSIGALLLLPISLLIHRFERPPI----TFSTLCGFFLLALL  79

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
             GQ   Y GI Y S TL++++ +L+P FTFI AV+  ME L  ++ SSLAK +GTIV I G
Sbjct  80    GQAFGYAGIYYGSATLSTSILNLVPGFTFILAVLFRMEKLDWRKLSSLAKLLGTIVSIAG  139

Query  519   AFVITFYKGPPLLLFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF++T YKGP LL+   +  +S   LL + SNWIL    L    +  S   +VQA ILK 
Sbjct  140   AFIVTLYKGPALLMGVSSANSSQQPLLSEDSNWILAGLFLAADCVMASAYIIVQASILKK  199

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP EL++    C  V I SA+  ++ ER+++AW L P + L+A+ Y+ +    F+  +  
Sbjct  200   YPAELIVVFFYCFFVAIQSAVTCLVVERDISAWSLEPKLRLLAVLYSGVFGSAFQVGIIC  259

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + + GPVFV+MF PLG++ +V++GV FL D  Y GS+IGA++I +GFY+V+WGKA ++
Sbjct  260   WCLHQTGPVFVSMFKPLGILISVVLGVLFLGDAFYLGSLIGATVIVVGFYSVLWGKAKDI  319

Query  1050  KENIETNIDNSNEKVPLLPPNKGDSV  1127
              E+   ++++  ++ PLL  N  + +
Sbjct  320   -EDAGLSLESKGKQAPLLEENSHEDI  344



>ref|XP_008348038.1| PREDICTED: WAT1-related protein At3g28050-like [Malus domestica]
Length=363

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/334 (42%), Positives = 209/334 (63%), Gaps = 11/334 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  GMS  +FV+YS ++A   L+P+  + HR    P L F I  ++ +  L+ 
Sbjct  29    NTLFKAATLNGMSYHVFVVYSYSIAAFVLIPAPFISHRSRVLPPLNFSIMSKVLLLGLIG  88

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + Y GI YSSPTLASA+++L+PAFTFI A++  +E  +L++RSS AK +GT+V +
Sbjct  89    SSSQIMGYTGINYSSPTLASAISNLVPAFTFILAIIFRLESAALRKRSSQAKILGTVVSL  148

Query  513   TGAFVITFYKGPPLLLFQHAYYNSL-------LPQQSNWILGSFILVTSSLFISMLFLVQ  671
              GAFV+T YKGPP++    +   SL        P   NWI+G  +L    + + + ++VQ
Sbjct  149   AGAFVVTLYKGPPIVFANQSQSLSLHQPLLNSTPTNPNWIVGGLLLTAEYILVPLWYIVQ  208

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
             A I+K+YP EL +       V  +SA  A+I E N +AWKLRPD+ L+++  + +     
Sbjct  209   AQIMKEYPNELTVIFFYNVCVVAVSAAVALITEPNSSAWKLRPDIALLSVLCSGLFGSFL  268

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
              + V+ W +R KGPVFV MF PL M  AV MGV FLRD L+ GS++GA+II++GFYTV+W
Sbjct  269   NNAVHTWVLRLKGPVFVTMFKPLSMAIAVAMGVAFLRDTLHLGSLVGATIISIGFYTVLW  328

Query  1032  GKAMEV--KENIETNID--NSNEKVPLLPPNKGD  1121
             GK  E   +E++  +++  ++  K PLL   K +
Sbjct  329   GKTKEEAGEESVPASLESPSTTHKAPLLQNYKNE  362



>ref|XP_008458740.1| PREDICTED: WAT1-related protein At3g28050-like [Cucumis melo]
Length=377

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 145/338 (43%), Positives = 204/338 (60%), Gaps = 21/338 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  GMS+ +FV+YS + A L LLPS  +  R    P L F +  +I +  L+ 
Sbjct  29    NTLFKAATATGMSHHVFVVYSYSFAALLLLPSPFISRRSTRLPPLNFSVISKIALLGLIG  88

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q + Y GI YSSPTLASA+++L+PAFTFI A++  ME + LK  SS AK +GTI+ I
Sbjct  89    SCSQIMGYTGINYSSPTLASAISNLVPAFTFILAIIFRMEKVVLKSNSSQAKVMGTIISI  148

Query  513   TGAFVITFYKGPPLL--------LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLV  668
             +GAFV+TFYKGP ++        L  H     L    SNW++GS +L    + + + ++V
Sbjct  149   SGAFVVTFYKGPRIIFSSSPTISLSLHHNSQQLSSSDSNWVIGSLLLTAEYILVPLWYIV  208

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             Q  I+K+YP E  +       V I++A    I E++ +AW LR +  L ++  + +    
Sbjct  209   QTKIMKEYPEEATVVFFYNLTVGIIAAFVGFILEKDPSAWILRQNTALASVLCSGLFGSC  268

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
               + V+ WA+R KGPVFVAMF PL +V A++MGV FL D LY GS+IGASII++GFYTVM
Sbjct  269   LNNTVHTWALRLKGPVFVAMFKPLSIVVAIVMGVLFLGDSLYLGSLIGASIISIGFYTVM  328

Query  1029  WGKAME------------VKENIETNID-NSNEKVPLL  1103
             WGKA E               N++ N + N +++VPLL
Sbjct  329   WGKAKEEMGVGEEKQEGHSHNNLDGNKESNEDQRVPLL  366



>gb|KCW85805.1| hypothetical protein EUGRSUZ_B02552 [Eucalyptus grandis]
Length=377

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 141/337 (42%), Positives = 205/337 (61%), Gaps = 16/337 (5%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K   + GMSN +FV YSNA A L LLP+++++HR   PP LT  +  +  +  LL   
Sbjct  12    VSKAVMSNGMSNLVFVFYSNAFASLILLPASLIFHRSGRPP-LTPSLVLQFFVLGLLGCL  70

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q L Y GI YSSPTL SA+ +L+PAFTF+ A++  +E L+    SSLAK  GTIV + G
Sbjct  71    AQILGYAGINYSSPTLGSALLNLVPAFTFLLAIIFRLERLNWSSSSSLAKCAGTIVCVAG  130

Query  519   AFVITFYKGPPLL------LFQHAY--YNSLLPQQSNWILGSFILVTSSLFISMLFLVQA  674
             AFV+T YKGP ++      L    +  ++ LL  +SNW+LG  +LV   +  S   +VQA
Sbjct  131   AFVVTLYKGPAIVTSSLSNLHNEVFNLHHKLLTPESNWVLGGLLLVADCVMASSWLIVQA  190

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
              +LK YP EL++    C  V I SA  ++  ER  +AW L+ +M L+A+ Y+A+    F+
Sbjct  191   SVLKKYPAELIIVFFYCFFVAIQSAAISLFVERKSSAWSLKDNMRLMAVLYSAVFGSAFQ  250

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
               V  W + + GPVFV+MF PLG+V A + GV FL D+ Y GS++G+  I +GFY+VMWG
Sbjct  251   VGVSTWCLHRTGPVFVSMFKPLGIVIAAVAGVLFLGDNFYLGSLVGSVAIVVGFYSVMWG  310

Query  1035  KAMEVKENIETNIDNSNEKVPLLPPNKGDSV*NFPKI  1145
             KA E K+++  ++ N       + PNK   +  +P I
Sbjct  311   KAKEQKKDLAISVGN-------VEPNKKKKMILYPYI  340



>emb|CBI34955.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   253 bits (647),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 210/334 (63%), Gaps = 9/334 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RG++  +FV+Y+  +A L LLPS  + HR    P L+F +  +I +  L+ 
Sbjct  12    NTLYKAATLRGLNYHVFVVYAYGIAALVLLPSPFITHRRGVLPPLSFPVLCKIFVLGLIG  71

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A QT+ Y GI  SSPTLASA+++L+PAFTFI AV+  ME L+L+  SS AK IGTIV I
Sbjct  72    CASQTMGYRGINISSPTLASAISNLVPAFTFILAVIFRMEKLALRSSSSQAKIIGTIVSI  131

Query  513   TGAFVITFYKGPPLLLFQ------HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQA  674
             +GAFV+T YKGPP++L        H   + L   +S+WI+G+  L        + ++VQA
Sbjct  132   SGAFVVTLYKGPPIILTPSPSISLHQPPHPLRSSESSWIIGALFLSVEYFLTPVWYIVQA  191

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
              I+K+YP E  +       V++L+AI  ++ E N + W +RP + L +I  + I      
Sbjct  192   HIIKEYPSEPTVVFFYNLFVSLLAAIVGLVTEPNSSVWIVRPRIALASIVCSGIFGSFLG  251

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
             + ++ WA+R KGPV+VAMF PL ++ AV MGV  L D LY GSVIGA+II +GFYTVMWG
Sbjct  252   NTIHTWAIRMKGPVYVAMFKPLAIIIAVTMGVALLGDSLYLGSVIGATIITMGFYTVMWG  311

Query  1035  KAME--VKENIETNIDN-SNEKVPLLPPNKGDSV  1127
             KA E  V++    ++++ S +K PLL   K + +
Sbjct  312   KAQEDMVEDCTIGSLESPSAQKAPLLQNYKTEEI  345



>ref|XP_006483800.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Citrus 
sinensis]
Length=350

 Score =   253 bits (646),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 141/328 (43%), Positives = 200/328 (61%), Gaps = 18/328 (5%)
 Frame = +3

Query  162   NKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAG  341
              K A + GMSN +FV YS A A L LLP+++L+HR   PP LT  I     +   L  + 
Sbjct  26    GKAAMSDGMSNLVFVFYSKAFASLVLLPASLLFHRSRIPP-LTLPILSAFFLLGFLGTSS  84

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
             Q     GI YSSPTL++AM +L+P FTFI A++  ME L  +  SSLAKS+GTIVLITGA
Sbjct  85    QFFGNAGIYYSSPTLSTAMLNLVPGFTFILAIIFRMEKLDWRSSSSLAKSVGTIVLITGA  144

Query  522   FVITFYKGPPLLLFQHAYYNSLLPQ--------QSNWILGSFILVTSSLFISMLFLVQAW  677
             F++T+YKG  LL+       SL P         Q+NW++G  +L    +F S   +VQA 
Sbjct  145   FIMTYYKGTHLLM------TSLPPNLSLQFFVPQTNWVVGGLLLAVDCVFTSAWLIVQAS  198

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             ILK +  E ++    C  V I SAI  ++ ER++++W L+P + L+A+ Y+A+    F+ 
Sbjct  199   ILKKFSAEFIVVFFYCFFVAIQSAIFCLVMERDLSSWSLKPGVRLVAVLYSAVFGSAFQV  258

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
              V  W + + GPVFVAMF PLG++ +  +G  FL + +Y G  IGA++I  GFY+VMWGK
Sbjct  259   GVCTWCLHRTGPVFVAMFKPLGVIISAAVGTIFLGETVYLGRFIGAAVIVTGFYSVMWGK  318

Query  1038  AMEVKENIETNI---DNSNEKVPLLPPN  1112
             A E    +ET +   ++S++K PLL  N
Sbjct  319   AKEGNSGVETGVRSLESSSQKDPLLQNN  346



>ref|XP_002279762.1| PREDICTED: WAT1-related protein At3g28050 [Vitis vinifera]
Length=360

 Score =   253 bits (647),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 210/334 (63%), Gaps = 9/334 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RG++  +FV+Y+  +A L LLPS  + HR    P L+F +  +I +  L+ 
Sbjct  27    NTLYKAATLRGLNYHVFVVYAYGIAALVLLPSPFITHRRGVLPPLSFPVLCKIFVLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A QT+ Y GI  SSPTLASA+++L+PAFTFI AV+  ME L+L+  SS AK IGTIV I
Sbjct  87    CASQTMGYRGINISSPTLASAISNLVPAFTFILAVIFRMEKLALRSSSSQAKIIGTIVSI  146

Query  513   TGAFVITFYKGPPLLLFQ------HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQA  674
             +GAFV+T YKGPP++L        H   + L   +S+WI+G+  L        + ++VQA
Sbjct  147   SGAFVVTLYKGPPIILTPSPSISLHQPPHPLRSSESSWIIGALFLSVEYFLTPVWYIVQA  206

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
              I+K+YP E  +       V++L+AI  ++ E N + W +RP + L +I  + I      
Sbjct  207   HIIKEYPSEPTVVFFYNLFVSLLAAIVGLVTEPNSSVWIVRPRIALASIVCSGIFGSFLG  266

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
             + ++ WA+R KGPV+VAMF PL ++ AV MGV  L D LY GSVIGA+II +GFYTVMWG
Sbjct  267   NTIHTWAIRMKGPVYVAMFKPLAIIIAVTMGVALLGDSLYLGSVIGATIITMGFYTVMWG  326

Query  1035  KAME--VKENIETNIDN-SNEKVPLLPPNKGDSV  1127
             KA E  V++    ++++ S +K PLL   K + +
Sbjct  327   KAQEDMVEDCTIGSLESPSAQKAPLLQNYKTEEI  360



>ref|XP_006574595.1| PREDICTED: WAT1-related protein At3g28050-like [Glycine max]
Length=355

 Score =   253 bits (646),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 150/298 (50%), Positives = 196/298 (66%), Gaps = 0/298 (0%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K + ++GMS F++V YSN L   FLL +T + HR   P  +   I  RI +  LLS
Sbjct  21    NTLIKASMSKGMSIFVYVAYSNLLGFCFLLLATTIRHRNRAPTPINNSILFRIFVLGLLS  80

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                QTL Y G+ YSSPTL S M D++PA+TFI A++  ME L LK +S  AKSIGT+V I
Sbjct  81    VTIQTLIYTGLGYSSPTLTSTMEDIVPAYTFIIAIICRMERLDLKLQSCQAKSIGTVVSI  140

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
              GA ++T YKG P+ +        L  QQS W+LG F+L       S+  ++Q W +KDY
Sbjct  141   AGALIMTLYKGLPMTIDVMPNNAFLSSQQSKWLLGGFLLAVGCFCGSVSLVIQTWTIKDY  200

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P ELML  I+ +   ILS I A IAE N  AW L+ DMEL+ I Y+ I+++  R+VVY W
Sbjct  201   PEELMLITISSSFSVILSFIVAFIAEENPKAWILKLDMELVCIFYSGIVVMSTRNVVYVW  260

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME  1046
             A RKKGPV+VAMF PLG+V A+ MG+ FL D LY GS+IGA+IIA+GFY V+WG+A +
Sbjct  261   ACRKKGPVYVAMFSPLGIVIALAMGIVFLGDALYLGSIIGAAIIAIGFYAVIWGQAQQ  318



>ref|XP_004142351.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=377

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/338 (43%), Positives = 204/338 (60%), Gaps = 21/338 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  GMS+ +FV+YS + A L LLPS  +       P L F I  +I +  L+ 
Sbjct  29    NTLFKAATAAGMSHHVFVVYSYSFAALLLLPSPFISRTSTRLPPLNFSITSKIALLGLIG  88

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q + Y GI YSSPTLASA+++L+PAFTFI A++  ME + LK  SS AK +GTI+ I
Sbjct  89    SCSQIMGYTGINYSSPTLASAISNLVPAFTFILAIIFRMEKVVLKSNSSQAKVMGTIISI  148

Query  513   TGAFVITFYKGPPLL--------LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLV  668
             +GAFV+TFYKGP ++        L  H     L    SNW++GS +L    + + + ++V
Sbjct  149   SGAFVVTFYKGPRIIFSSSPTISLSLHHNSQQLSSSDSNWVIGSLLLTAEYILVPLWYIV  208

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             Q  I+K+YP E  +       V I++A   +I E++ +AW LR +  L +I  + +    
Sbjct  209   QTKIMKEYPEEATVVFFYNLTVAIIAAFVGLILEKDPSAWILRQNTALASILCSGLFGSC  268

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
               + V+ WA+R KGPVFVAMF PL +V A++MGV FL D LY GS+IGASII++GFYTVM
Sbjct  269   LNNTVHTWALRLKGPVFVAMFKPLSIVVAIVMGVLFLGDSLYLGSLIGASIISIGFYTVM  328

Query  1029  WGKAME------------VKENIETNID-NSNEKVPLL  1103
             WGKA E               N++ N + N +++VPLL
Sbjct  329   WGKAKEEMGVGEEKQEGHSHNNLDGNKESNEDQRVPLL  366



>ref|XP_009349860.1| PREDICTED: WAT1-related protein At3g28050-like [Pyrus x bretschneideri]
Length=364

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/335 (42%), Positives = 205/335 (61%), Gaps = 12/335 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  GMS  +FV+YS ++A   L+P+  +  R    P L F I  +I +  L+ 
Sbjct  29    NTLFKAATLNGMSYHVFVVYSYSVAAFVLIPAPFVSRRSRVLPPLNFSIMSKILLLGLIG  88

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + Y GI YSSPTLASA+++L+PAFTFI A++  +E  +L+ RSS AK +GTIV +
Sbjct  89    SSSQIMGYTGINYSSPTLASAISNLVPAFTFILAIIVRLESTALRSRSSQAKILGTIVSL  148

Query  513   TGAFVITFYKGPPLLL--------FQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLV  668
              GAFV+T YKGPP++               NS  P  SNWI+G  +L    + + + ++V
Sbjct  149   AGAFVVTLYKGPPIVFANQSQSISLHQPLLNSPPPTNSNWIIGGLLLTAEYILVPLWYIV  208

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             QA I+KDYP EL +       V  +SA  A+I E N +AWKLRPD+ L++I  + +    
Sbjct  209   QAQIMKDYPNELTVIFFYNVCVVAVSAAVALITEPNSSAWKLRPDIALLSILCSGLFGSF  268

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
               + V+ W +R KGPV+V MF PL M  AV++GV FL D L+ GS++GA+II+ GFY V+
Sbjct  269   LNNAVHTWVLRLKGPVYVTMFKPLSMAIAVVLGVVFLHDTLHLGSLVGATIISFGFYAVL  328

Query  1029  WGKAMEV--KENIETNID--NSNEKVPLLPPNKGD  1121
             WGK  E   +E + T+++  ++  K PLL   K +
Sbjct  329   WGKTKEEVGEEPVATSLESPSTTHKAPLLQNYKNE  363



>ref|XP_009599994.1| PREDICTED: WAT1-related protein At3g28050-like [Nicotiana tomentosiformis]
Length=367

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 148/333 (44%), Positives = 204/333 (61%), Gaps = 6/333 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMSN +FV+YS  LA + LLPS     R    P L   I  +I +  ++ 
Sbjct  34    NTLYKAATNKGMSNHVFVVYSYGLAAVLLLPSPFFSTRSRVLPPLNCSILAKIFLLGVIG  93

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q + Y GI YSSPTLASA+++L+PAFTF+ AV   ME + LK  S+ AK +GT+V I
Sbjct  94    CTSQIMGYTGINYSSPTLASAISNLVPAFTFVLAVTFRMEKIELKRSSTRAKVLGTVVSI  153

Query  513   TGAFVITFYKGPPLLLFQHAYYN----SLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              GAFV+T YKGP LL+   +  N    SL   QSNW+LG   L T    + M ++VQ WI
Sbjct  154   AGAFVVTLYKGPKLLVAITSTPNFLSQSLRSSQSNWMLGGLFLTTEYFLVPMWYIVQTWI  213

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             +K+YP E+ +       V+ L+AI     E + N W+++PD+ L++I  + I+     + 
Sbjct  214   MKEYPAEVTVVFFYNLCVSCLAAIVGFFTEPDSNKWRIKPDIALVSILCSGILGSSLNNT  273

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             ++ WA+R KGPV+VAMF PL +  AV MGV  L D LY GSV+GA++IA+GFYTVMWGKA
Sbjct  274   IHTWALRVKGPVYVAMFKPLSIAIAVAMGVIILGDTLYLGSVLGATVIAIGFYTVMWGKA  333

Query  1041  MEVKE--NIETNIDNSNEKVPLLPPNKGDSV*N  1133
              E+ E  +      +S +K PLL   K + + N
Sbjct  334   KEMPEYDDSSDLESSSAQKFPLLHNYKNEGISN  366



>ref|XP_004239354.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Solanum 
lycopersicum]
Length=345

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 143/320 (45%), Positives = 201/320 (63%), Gaps = 12/320 (4%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYH--RLMPPPVLTFGIFGRICITALLS  332
             ++K+A ++G+S+FI V+YSNA+A L L P +I     R    P LTF    RI + AL  
Sbjct  29    ISKIAMSKGLSSFIIVVYSNAVATLILFPPSIFIFITRSRSHP-LTFSAIWRILMLALNG  87

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
               GQ   Y+GI YSSPTLA+AM +LIP FTFI A+   ME+++ K  SS AK+ GT V I
Sbjct  88    CFGQICDYVGISYSSPTLATAMLNLIPGFTFILAITFRMEVINWKSWSSYAKAFGTFVSI  147

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
              GAFV+TFYKGPP++   + +  S    Q NWILG  IL   S+  S+ +++QA ILK Y
Sbjct  148   GGAFVLTFYKGPPII---NQHLTSTFSSQQNWILGGVILACESMSTSLWYIIQASILKIY  204

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
               E+++  + C  VTI+S + +++ ERN NAW +  D+ LIAI Y+ II + FRS +  W
Sbjct  205   QEEMVIVCLYCFFVTIISTLISLVVERNTNAWIIYLDIRLIAILYSGIIGIAFRSCMTTW  264

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV-  1049
              ++K  P+FV+MF P  +V A+++G    RD  Y GS++G+    +GFY VMWGK  E  
Sbjct  265   CLKKTDPLFVSMFKPFAIVFAILIGTFCFRDAFYLGSLVGSVTTVIGFYAVMWGKTQEKY  324

Query  1050  --KENIETNIDNSNEKVPLL  1103
                 N+ET  +N+   VPLL
Sbjct  325   YEGNNLETLAENN---VPLL  341



>gb|KHN00334.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=355

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 150/298 (50%), Positives = 196/298 (66%), Gaps = 0/298 (0%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K + ++GMS F++V YSN L   FLL +T + HR   P  +   I  RI +  LLS
Sbjct  21    NTLIKASMSKGMSIFVYVAYSNLLGFCFLLLATTIRHRNRAPTPINNSILFRIFVLGLLS  80

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                QTL Y G+ YSSPTL S M D++PA+TFI A++  ME L LK +S  AKSIGT+V I
Sbjct  81    VTIQTLIYTGLGYSSPTLTSTMEDIVPAYTFIIAIICRMERLDLKLQSCQAKSIGTVVSI  140

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
              GA ++T YKG P+ +        L  QQS W+LG F+L       S+  ++Q W +KDY
Sbjct  141   AGALIMTLYKGLPMTIDVMPNNVFLSSQQSKWLLGGFLLAVGCFCGSVSLVIQTWTIKDY  200

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P ELML  I+ +   ILS I A IAE N  AW L+ DMEL+ I Y+ I+++  R+VVY W
Sbjct  201   PEELMLITISSSFSVILSFIVAFIAEENPKAWILKLDMELVCIFYSGIVVMSTRNVVYVW  260

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME  1046
             A RKKGPV+VAMF PLG+V A+ MG+ FL D LY GS+IGA+IIA+GFY V+WG+A +
Sbjct  261   ACRKKGPVYVAMFSPLGIVIALAMGIVFLGDALYLGSIIGAAIIAIGFYAVIWGQAQQ  318



>emb|CDP02142.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 204/330 (62%), Gaps = 19/330 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYS-NalallfllPSTILY-----HRLMPPPVLTFGIFGRIC  314
             NTL K AT +GMS+ +F++YS    A L LLPST  +      RL  PP L F I  +I 
Sbjct  12    NTLFKAATVKGMSHHVFIVYSYALAAALLLLPSTFFFINRSNSRLDLPP-LKFSILSKIF  70

Query  315   ITALLSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSI  494
             +  L+    Q + Y GI YSSPTLASA+++L+PAFTFI A++  ME L+ +  SS AK +
Sbjct  71    LLGLIGCTSQIMGYTGINYSSPTLASAISNLVPAFTFILAILFRMEKLAFRSSSSQAKVL  130

Query  495   GTIVLITGAFVITFYKGPPLLLF------QHAYYNSLLPQQSNWILGSFILVTSSLFISM  656
             GT++ I+GAFV+T YKGP + L       QH     L   QSNW LG   L    + + M
Sbjct  131   GTVLSISGAFVVTLYKGPGIKLTNTIPIPQH-----LHTAQSNWELGGLFLTAEYILVPM  185

Query  657   LFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAI  836
              ++ QA I+K+YP E+ +       V+IL+A A +  E +++ WK+RP+M L +I  + I
Sbjct  186   WYIAQAQIMKEYPAEITVVFFYNLFVSILAAFAGIFMEPDLSRWKIRPNMALASIICSGI  245

Query  837   IMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGF  1016
                   + ++ WA+R KGPV+VAMF PL +V AV MGV  L D LY GS++GA++IALGF
Sbjct  246   FGSFLNNTIHTWALRLKGPVYVAMFKPLSIVIAVAMGVIILGDALYLGSILGATVIALGF  305

Query  1017  YTVMWGKAMEVKENIETNIDNS-NEKVPLL  1103
             YTVMWGK  E  E  +  ++ S N K+PLL
Sbjct  306   YTVMWGKTKEEMEECDDILETSANHKLPLL  335



>ref|XP_011045221.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Populus 
euphratica]
Length=362

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 202/323 (63%), Gaps = 6/323 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  GMS  +FV Y+ A+A + LLP+  + HR    P L+F +  +I +  L+ 
Sbjct  27    NTLFKAATLAGMSYHVFVPYAYAVAAVVLLPAPFVSHRSRVLPPLSFSVLSKIALLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + Y GI YSSPTLASA+++L PAFTFIFA++  ME ++L+  SS AK +GTI+ I
Sbjct  87    SSSQIMGYTGINYSSPTLASAISNLTPAFTFIFAIIFRMERVALRRTSSQAKLLGTILSI  146

Query  513   TGAFVITFYKGPPLLLFQHA---YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
              GAFV+T YKGPP+++  ++       L    SNWILG  +L    + + + +++Q  I+
Sbjct  147   AGAFVVTLYKGPPIIISSNSSVPLSQHLHSTNSNWILGGILLTAEYVLVPLWYILQTQIM  206

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             K+YP EL +       V+I+ AI A+I E   +AW +RP++ L +I  + +      + V
Sbjct  207   KEYPAELTVVFFYNLTVSIIGAIVALITEGTSSAWLVRPNIALASILCSGLFGSCLNNTV  266

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+  KGPVFVAMF PL +  AV MGV FL D LY GS+IGA+II++GFYTVMWGKA 
Sbjct  267   HTWALHLKGPVFVAMFKPLSIAIAVAMGVMFLGDTLYLGSLIGATIISIGFYTVMWGKAK  326

Query  1044  EV---KENIETNIDNSNEKVPLL  1103
             E      N      +  +KVPLL
Sbjct  327   EELGDDCNAAKPESSCAQKVPLL  349



>ref|XP_009344542.1| PREDICTED: WAT1-related protein At3g28050-like [Pyrus x bretschneideri]
 ref|XP_009344560.1| PREDICTED: WAT1-related protein At3g28050-like [Pyrus x bretschneideri]
Length=363

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 141/328 (43%), Positives = 206/328 (63%), Gaps = 11/328 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  GMS  +FV+YS ++A   L+P+  + HR    P L F I  ++ +  L+ 
Sbjct  29    NTLFKAATLNGMSYHVFVVYSYSVAAFVLIPAPFVSHRSRVLPPLNFSIMSKVLLLGLIG  88

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + Y GI YSSPTLASA+++L+PAFTFI A++  +E  +L++RSS AK +GTIV +
Sbjct  89    SSSQIMGYTGINYSSPTLASAISNLVPAFTFILAIIFRLESAALRKRSSQAKILGTIVSL  148

Query  513   TGAFVITFYKGPPLLLFQHAYYNSL-------LPQQSNWILGSFILVTSSLFISMLFLVQ  671
              GAFV+T YKGP ++    +   SL        P   NWI+G  +L    + + + ++VQ
Sbjct  149   AGAFVVTLYKGPSIVFANRSQSLSLHQPLLNSTPTNPNWIVGGLLLTAEYILVPLWYIVQ  208

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
             A I+K+YP EL +       V  +SA  A++ E N +AWKLRPD+ L++I  + +     
Sbjct  209   AQIMKEYPNELTVIFFYNVCVVAVSAAVALVTEPNSSAWKLRPDIALLSILCSGLFGSCL  268

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
              + V+ W +R KGPVFV MF PL M  AV MGV FLRD LY GS++GA+II++GFYTV+W
Sbjct  269   NNAVHTWVLRLKGPVFVTMFKPLSMAIAVAMGVAFLRDTLYLGSLVGATIISIGFYTVLW  328

Query  1032  GKAMEV--KENIETNID--NSNEKVPLL  1103
             GK  E   +E++  +++  ++  K PLL
Sbjct  329   GKTKEDAGEESVAASLESPSTTHKAPLL  356



>gb|KDP45393.1| hypothetical protein JCGZ_09642 [Jatropha curcas]
Length=354

 Score =   251 bits (640),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 147/329 (45%), Positives = 202/329 (61%), Gaps = 6/329 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GM+  IF++YS A+A L LLP+  + +R    P L F I  +I +  L+ 
Sbjct  28    NTLYKAATLKGMNYHIFIVYSYAIAALVLLPAPFISYRSRVLPPLNFSIMRKIALLGLIG  87

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q L Y GI YSSPTL+SA+++L PAFTFI A++ GME + L+ RSS AK IGTIV I
Sbjct  88    SSSQILGYTGINYSSPTLSSAISNLTPAFTFILAIIFGMERVGLRRRSSQAKVIGTIVSI  147

Query  513   TGAFVITFYKGPPLLLFQH---AYYNSLLPQQS-NWILGSFILVTSSLFISMLFLVQAWI  680
              GAFV+T Y+GPP+++      + Y  LL   + NWILG   L    + + + ++VQ  I
Sbjct  148   AGAFVVTLYRGPPIVIVSSPSVSLYQPLLHSSNPNWILGGIFLTGEYILVPLWYIVQTQI  207

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             +K+YP EL +       V+I++A  A+  E   +AW +RP + L ++  + +      + 
Sbjct  208   MKEYPAELTVVFFYNLTVSIIAAFVALFTEGATSAWIVRPSIALASVVCSGLFGSCLNNT  267

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             V+ WA+  KGPVFVAMF PL +  AV MG  FL D LY GS+ GA+II++GFYTVMWGKA
Sbjct  268   VHTWALHLKGPVFVAMFKPLSIAIAVAMGAMFLGDSLYLGSLSGATIISIGFYTVMWGKA  327

Query  1041  MEVKENIETNIDNSNEKVPLLPPNKGDSV  1127
              E  E  E     S  KVPLL   K + V
Sbjct  328   KE--EFSEDPQPPSTHKVPLLQNYKEELV  354



>ref|XP_006355962.1| PREDICTED: WAT1-related protein At3g28050-like [Solanum tuberosum]
Length=349

 Score =   250 bits (639),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 142/323 (44%), Positives = 192/323 (59%), Gaps = 3/323 (1%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             + K A + GM+NF FV YSN LA L LLPS   Y    PP  L F +     +  +L  +
Sbjct  27    VGKKAMSAGMTNFTFVFYSNTLAALILLPSLFFYRSTRPP--LNFSLICWFFLLGVLGCS  84

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI Y+S + ASAM +LIP FTFI AV+  ME L  +  S+L KSIGTIV I G
Sbjct  85    AQLTGYTGINYTSASFASAMLNLIPGFTFILAVIFRMEKLDCRSTSTLIKSIGTIVSIAG  144

Query  519   AFVITFYKGPPLLLFQHAY-YNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYP  695
             AF  T YKGP +LL   +   N L  Q+++WI+G   LV   +  S+  +VQA +L+ YP
Sbjct  145   AFTATLYKGPQILLTSSSKPQNYLHFQETDWIIGGLYLVVDCVVSSLYLIVQASVLQKYP  204

Query  696   GELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWA  875
              EL++    C   +I+SAI ++  +RN+NAW L+P   L A+ Y+ I    F+  V  W 
Sbjct  205   VELIVVFFYCFFASIISAIVSLFMDRNLNAWLLQPGTRLFAVLYSGIFGSAFQVSVMFWC  264

Query  876   VRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKE  1055
             +R+KGP+FVAMF PLG+V A  +G+ FL D  Y GS++G+ II +GFY VMWGK  E K 
Sbjct  265   IRRKGPLFVAMFHPLGIVIAAALGIIFLGDIFYLGSLMGSIIIVVGFYAVMWGKTKEDKV  324

Query  1056  NIETNIDNSNEKVPLLPPNKGDS  1124
             + +    N N K PLL     ++
Sbjct  325   DEDKLTRNINSKSPLLEIKDAET  347



>ref|XP_006369957.1| nodulin MtN21 family protein [Populus trichocarpa]
 gb|ERP66526.1| nodulin MtN21 family protein [Populus trichocarpa]
Length=362

 Score =   251 bits (640),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 205/323 (63%), Gaps = 6/323 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT+ GMS  +FV Y+ A+A L LLP+  + HR    P L+F I  +I +  L+ 
Sbjct  27    NTLFKAATSAGMSYHVFVPYAYAVAALVLLPAPFVSHRSRVLPPLSFSILSKIALLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + + GI+YSSP LASA+++L PAFTFIFA++  ME ++L+  SS AK +GTI+ I
Sbjct  87    SSSQIMGFTGIKYSSPALASAISNLTPAFTFIFAIIFRMERVALRRTSSQAKLLGTILSI  146

Query  513   TGAFVITFYKGPPLLLFQHA---YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
              GAFV+T YKGPP+++  ++       L    SNWI+G  +L    + + + +++Q  I+
Sbjct  147   AGAFVVTLYKGPPIIISPNSSIPLSQHLHSTNSNWIVGGILLTAEYVLVPLWYILQTQIM  206

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             K+YP EL +       V+I++AI A+I E   +AW +RP++ L +I  + ++     + V
Sbjct  207   KEYPAELTVVFFYNLTVSIIAAIVALITEGTSSAWLVRPNIALASILCSGLLGSCLNNTV  266

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+  KGPVFVAMF PL +  AV MGV FL D LY GSVIGA+II++GFYTVMWGKA 
Sbjct  267   HTWALHLKGPVFVAMFKPLSIAIAVAMGVMFLGDILYLGSVIGATIISIGFYTVMWGKAT  326

Query  1044  EV---KENIETNIDNSNEKVPLL  1103
             E      N      +  +KVPLL
Sbjct  327   EELGDDCNAAKPESSCAQKVPLL  349



>ref|XP_009348031.1| PREDICTED: WAT1-related protein At3g28050-like [Pyrus x bretschneideri]
Length=364

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 141/335 (42%), Positives = 204/335 (61%), Gaps = 12/335 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  GMS  +FV+YS ++A   L+P+  +  R    P L F I  +I +  L+ 
Sbjct  29    NTLFKAATLNGMSYHVFVVYSYSVAAFVLIPAPFVSRRSRVLPPLNFSIMSKILLLGLIG  88

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + Y GI YSSPTLASA+++L+PAFTFI A++  +E  +L+ RSS AK +GTIV +
Sbjct  89    SSSQIMGYTGINYSSPTLASAISNLVPAFTFILAIIVRLESTALRSRSSQAKILGTIVSL  148

Query  513   TGAFVITFYKGPPLLL--------FQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLV  668
              GAFV+T YKGPP++               NS  P  SNWI+G  +L    + + + ++V
Sbjct  149   AGAFVVTLYKGPPIVFANQSQSISLHQPLLNSPPPTNSNWIIGGLLLTAEYILVPLWYIV  208

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             QA I+KDYP EL +       V  +SA  A+I E N +AWKLRPD+ L++I  + +    
Sbjct  209   QAQIMKDYPNELTVIFFYNVCVVAVSAAVALITEPNSSAWKLRPDIALLSILCSGLFGSF  268

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
               + V+ W +R KGPV+V MF PL M  AV++GV FL   L+ GS++GA+II+ GFYTV+
Sbjct  269   LNNAVHTWVLRLKGPVYVTMFKPLSMAIAVVLGVVFLHATLHLGSLVGATIISFGFYTVL  328

Query  1029  WGKAMEV--KENIETNID--NSNEKVPLLPPNKGD  1121
             WGK  E   +E +  +++  ++  K PLL   K +
Sbjct  329   WGKTKEEVGEEPVANSLESPSTTHKAPLLQNYKNE  363



>ref|XP_007151110.1| hypothetical protein PHAVU_004G018700g [Phaseolus vulgaris]
 gb|ESW23104.1| hypothetical protein PHAVU_004G018700g [Phaseolus vulgaris]
Length=373

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/333 (43%), Positives = 212/333 (64%), Gaps = 13/333 (4%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL K AT +GMS+++FV Y+ +LA L LLP T+LY R    P L+F I  +I +  ++  
Sbjct  29    TLFKAATLQGMSSYVFVSYAYSLAFLVLLPVTLLYRRSRVVPPLSFSILSKIAVLGVIGC  88

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             + Q L Y+GI YSSPTL+SA+++L PAFTFI AV+  ME ++++ R++ AK  G+I+ I+
Sbjct  89    SSQILGYVGISYSSPTLSSAISNLAPAFTFILAVICRMEKIAIRSRTTQAKIWGSIISIS  148

Query  516   GAFVITFYKGPPLLL------FQHAYYNSLLPQ-QSNWILGSFILVTSSLFISMLFLVQA  674
             GAF++TF KG  +++       Q +  N +L     NW  G  +L   ++ +++ F++Q 
Sbjct  149   GAFIVTFCKGQSIIIADNSPSIQLSQSNGILTSVDRNWAFGGLLLTGCNILLTIWFVLQV  208

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
              ILK++P EL +         I+++I  +I E+N +AWK+RPD+ LI+I    I      
Sbjct  209   EILKEFPDELTMVFFYNLCAAIVASIVGLIGEKNSSAWKIRPDITLISIVCTGIFNKFLS  268

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
             S +YAW +  KGPV+VAMF PL +V AV MGV FL D LY GS+IGA+ I++GFY+VMWG
Sbjct  269   SAIYAWGIHLKGPVYVAMFKPLSIVIAVAMGVMFLGDTLYVGSLIGATTISIGFYSVMWG  328

Query  1035  KAMEVKENIETNIDNSN------EKVPLLPPNK  1115
             KA E KE+ E   D S+      E VPLL  ++
Sbjct  329   KATEQKEDEEREEDVSSQESAITENVPLLQSHE  361



>gb|KDP21319.1| hypothetical protein JCGZ_21790 [Jatropha curcas]
Length=1728

 Score =   266 bits (681),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 157/354 (44%), Positives = 219/354 (62%), Gaps = 36/354 (10%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +T+ K A  + MS  I  +YS A A+  LLPS+ +++R   PP L   IF RI + +++S
Sbjct  791   STIMKAAMNKSMSQDI--VYSMAFAIFILLPSSFIFYRERSPPKLNACIFSRILLLSIVS  848

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSL----------------  464
             ++ Q L   GI+YSSPTL +AM DL PAFTF+ +V+     LSL                
Sbjct  849   FSIQMLFNTGIKYSSPTLCTAMTDLTPAFTFLLSVIFSALFLSLVYDSVDGFHELRWAIQ  908

Query  465   -------------KERSSLAKSIGTIVLITGAFVITFYKGPPLLLFQHAYYNS-LLPQQS  602
                          + +SS AKSIGTIV + GA ++T YKG  +     +  +  LL   S
Sbjct  909   RRNGGVRMGKLEFRLQSSQAKSIGTIVSVAGALIVTLYKGQLITANVASQIDEQLLLLSS  968

Query  603   NWILGSFILVTSSLFISMLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVN  782
             NW++G       +L +++ ++VQ WILK+YP ELM+TV+TC  VT+LSA+ ++I E++ N
Sbjct  969   NWVIGGIFCAVGALCLALFYIVQTWILKEYPAELMVTVLTCISVTLLSAVVSLILEKHPN  1028

Query  783   AWKLRPDMELIAICYNAIIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLR  962
             AW L+PD+ELIAI  +AI  +  R+VV+AWA  KKGP++ AMF PLG+V A  MG  FL 
Sbjct  1029  AWILKPDVELIAILCSAIFALSLRNVVHAWACHKKGPLYTAMFKPLGIVIATFMGFFFLG  1088

Query  963   DDLYTGSVIGASIIALGFYTVMWGKAMEVKENIET----NIDNSNEKVPLLPPN  1112
             D+LY GSVIG  IIALGFYTV+WGK+ E K N E     N+++S+ K+PLL  N
Sbjct  1089  DNLYVGSVIGGIIIALGFYTVIWGKSQEEKMNEEGKGNPNLESSSHKIPLLRNN  1142


 Score =   200 bits (508),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/262 (42%), Positives = 156/262 (60%), Gaps = 35/262 (13%)
 Frame = +3

Query  300  FGRICITALLSYAG---QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKE  470
            F  IC   LLS  G   Q   Y G++YSS TL +AM +LIPAFTFI A++  +E +  + 
Sbjct  302  FSLICSFFLLSLFGLGIQIFGYTGLQYSSATLGTAMLNLIPAFTFICAIIFRLEEVDCRS  361

Query  471  RSSLAKSIGTIVLITGAFVITFYKGPPLLLFQHAYYNSLLPQQSN--WILGSFILVTSSL  644
            +SS+AK +GTI+ I GA+++ FYKGP L     ++ +  L   S   WI+G F     +L
Sbjct  362  KSSIAKCLGTIISIGGAYLVIFYKGPSLFRSSTSHIHRQLLHSSPLLWIIGGFSFAAKAL  421

Query  645  FISMLFLVQ------------------------AWILKDYPGELMLTVITCALVTILSAI  752
              S +F+++                         WI++DYP E+++T+I C  VTILSAI
Sbjct  422  LDSAVFILEILVLPPSNWAIGGFFLAVHSFILATWIIRDYPSEIIITLINCCFVTILSAI  481

Query  753  AAMIAERNVNAWKLRPDMELIAICYN------AIIMVGFRSVVYAWAVRKKGPVFVAMFI  914
              +IAE+++NAWK+RPD+ L+AI ++      A+  V  RSVV+ WA  K+GPV+ +MF 
Sbjct  482  VTLIAEKDLNAWKIRPDIGLVAIGFSVSVEKQAVFAVSLRSVVHTWACHKRGPVYTSMFK  541

Query  915  PLGMVAAVIMGVTFLRDDLYTG  980
            PLGM  AV MGV+F+ D LY G
Sbjct  542  PLGMAIAVFMGVSFIGDTLYLG  563


 Score =   195 bits (495),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 150/232 (65%), Gaps = 4/232 (2%)
 Frame = +3

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
               L Y G+++SSPTL + M +L+PAFTFIFA++  ME L LK  SSLAK IGT+V I+GA
Sbjct  1164  HALNYAGVQFSSPTLCTTMLNLVPAFTFIFALLFRMEKLDLKSSSSLAKFIGTVVSISGA  1223

Query  522   FVITFYKGPPLLL---FQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             F +T YKG P ++   F    +  LL ++ NWILG F+  T ++  S+ +++QA ILK Y
Sbjct  1224  FTVTIYKGLPFIIMPSFDGLNHQLLLSEEGNWILGGFLSATHAMMSSLWYILQASILKKY  1283

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
                L++         ILSA+ ++  E +  AW+LR DM L+++ Y+A +   FR  +   
Sbjct  1284  TSVLIIVFFYSLFAAILSAVVSLTIE-DFGAWRLRTDMGLVSVIYSAGVGDVFRLGMTTL  1342

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
              VR  GPVFV+M  PLG+VAA +MG+ FL + L+ GSVIGA +IA GFY VM
Sbjct  1343  CVRMSGPVFVSMLKPLGIVAAALMGIIFLGNTLFLGSVIGAIVIAAGFYAVM  1394


 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 123/192 (64%), Gaps = 10/192 (5%)
 Frame = +3

Query  483   AKSIGTIVLITGAFVITFYKGPPLLLFQHAYYNSLLPQ-QSNWILGSFILVTSSLFISML  659
             AKSIGT V + GA ++T YKG P++    +  N  LP   SNW++ +      +L I++ 
Sbjct  603   AKSIGTTVSVAGALIVTLYKGQPIITNAASQVNEQLPLFYSNWVIVAIFCAVGALCIALF  662

Query  660   FLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAII  839
             ++VQ WILK+YP ELM+T+ITC  VT+LSA+  +I E++ NAW L PD+ELIAI  +A+ 
Sbjct  663   YIVQTWILKEYPAELMITMITCISVTLLSAVVPLILEKDPNAWMLMPDVELIAILCSAVS  722

Query  840   MVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTG---------SVIG  992
              V   +VV AWA R+KGP++ AMF  LGMV A+ MGV+FL D LY G         +++G
Sbjct  723   SVSLLNVVQAWACREKGPLYTAMFKLLGMVIAIFMGVSFLGDKLYVGRMWSPGVTAAMVG  782

Query  993   ASIIALGFYTVM  1028
                  +G  T+M
Sbjct  783   VEFTEVGISTIM  794



>ref|XP_007031406.1| Nodulin MtN21 /EamA transporter family protein [Theobroma cacao]
 gb|EOY02332.1| Nodulin MtN21 /EamA transporter family protein [Theobroma cacao]
Length=350

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 143/326 (44%), Positives = 205/326 (63%), Gaps = 8/326 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             + ++K A T+GMSN + V+Y NAL  L LLP  I       P  LTF +  R  +  L+ 
Sbjct  27    SVISKAALTKGMSNIVSVVYYNALGTLILLPYLIFCRNKQLP--LTFSLLWRFFLLGLIG  84

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              +GQ +   G++YSSPTL+SA+ +LIP FTF+ A +  ME L L+  SS AK++G +V +
Sbjct  85    SSGQIVYLTGVKYSSPTLSSALVNLIPIFTFLLAAIFRMEKLELRRSSSQAKALGAVVAV  144

Query  513   TGAFVITFYKGPPLLLFQHAY---YNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
             TGAFV+T YKGP +L+         N  L  QS WI+G F++V   L  +   +VQA  +
Sbjct  145   TGAFVVTLYKGPSVLMASSPSNFPQNLHLSDQSKWIIGGFLIVLVCLSSATWNVVQAATV  204

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             K+YP ++         +TI S + ++I ERN  AWKL+ ++E+ AI   AI    FR  +
Sbjct  205   KEYPDKMTTVFFYTFFITIQSLVFSLILERNPTAWKLKSNVEVAAIVCTAIFGSVFRIAI  264

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + W ++KKGPV+V+MF PLG+V AV++ V FL D LY GSVIG+ IIA+GFYTVMWG+A 
Sbjct  265   HTWCLQKKGPVYVSMFKPLGIVVAVVLTVIFLGDTLYLGSVIGSVIIAIGFYTVMWGRAK  324

Query  1044  E---VKENIETNIDNSNEKVPLLPPN  1112
             E   V EN  + +++S +K PL+P +
Sbjct  325   EKNMVLENEVSRLESSGQKDPLIPSS  350



>ref|XP_008221767.1| PREDICTED: WAT1-related protein At5g40210-like isoform X2 [Prunus 
mume]
Length=357

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 193/320 (60%), Gaps = 2/320 (1%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             +N+ A ++G + +I V+Y+N L+ L LLP  + +H     P LTF I     + AL   +
Sbjct  25    VNEAAMSKGSNKYIMVVYANGLSTLILLPPALFFHHRSGRPPLTFSILCGFFMLALFGCS  84

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y+GIEYSS TL +AM +LIPAFTFI A++  ME +  +  SS AK +GTI  I G
Sbjct  85    AQIFGYVGIEYSSATLGTAMLNLIPAFTFILAIIFRMEEVQWRSSSSKAKILGTIASIAG  144

Query  519   AFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPG  698
             AFV+TFYKG P++L   ++  +L   +SNW+LG   L   S   S+ +++QA  LK YP 
Sbjct  145   AFVVTFYKGQPIMLPPSSHPPNLFSSKSNWVLGGLFLAADSFSSSLWYILQASTLKKYPA  204

Query  699   ELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAV  878
              ++        +T+ SA+  +IA ++ +AW+LR DM LIA+ Y AI+ +G R  + AW V
Sbjct  205   VVVTVCFQSLFMTVQSALVTLIAVKDASAWELRLDMGLIAVLYTAIVSIGLRYTLTAWCV  264

Query  879   RKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK--  1052
              K G +F +MF PLG++  VIMG  FL D  Y GS++GA II  GFY VMWGKA E K  
Sbjct  265   WKAGALFCSMFKPLGIIFGVIMGAIFLGDPFYFGSLVGALIIVTGFYAVMWGKAKEEKLV  324

Query  1053  ENIETNIDNSNEKVPLLPPN  1112
             E         + KVPLL  N
Sbjct  325   EGGSRWESLGHNKVPLLQNN  344



>ref|XP_011045220.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Populus 
euphratica]
Length=377

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 148/338 (44%), Positives = 205/338 (61%), Gaps = 21/338 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  GMS  +FV Y+ A+A + LLP+  + HR    P L+F +  +I +  L+ 
Sbjct  27    NTLFKAATLAGMSYHVFVPYAYAVAAVVLLPAPFVSHRSRVLPPLSFSVLSKIALLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + Y GI YSSPTLASA+++L PAFTFIFA++  ME ++L+  SS AK +GTI+ I
Sbjct  87    SSSQIMGYTGINYSSPTLASAISNLTPAFTFIFAIIFRMERVALRRTSSQAKLLGTILSI  146

Query  513   TGAFVITFYKGPPLL--------LFQHAY---YNSLLP-------QQSNWILGSFILVTS  638
              GAFV+T YKGPP++        L QH      NS +P         SNWILG  +L   
Sbjct  147   AGAFVVTLYKGPPIIISSKSSVPLSQHLLIISSNSSVPLSQHLHSTNSNWILGGILLTAE  206

Query  639   SLFISMLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIA  818
              + + + +++Q  I+K+YP EL +       V+I+ AI A+I E   +AW +RP++ L +
Sbjct  207   YVLVPLWYILQTQIMKEYPAELTVVFFYNLTVSIIGAIVALITEGTSSAWLVRPNIALAS  266

Query  819   ICYNAIIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGAS  998
             I  + +      + V+ WA+  KGPVFVAMF PL +  AV MGV FL D LY GS+IGA+
Sbjct  267   ILCSGLFGSCLNNTVHTWALHLKGPVFVAMFKPLSIAIAVAMGVMFLGDTLYLGSLIGAT  326

Query  999   IIALGFYTVMWGKAMEV---KENIETNIDNSNEKVPLL  1103
             II++GFYTVMWGKA E      N      +  +KVPLL
Sbjct  327   IISIGFYTVMWGKAKEELGDDCNAAKPESSCAQKVPLL  364



>ref|XP_007031395.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY02321.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
Length=374

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 143/346 (41%), Positives = 203/346 (59%), Gaps = 21/346 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +FV+Y+ A+A L LLP+    +R    P L+F I  +I +  L+ 
Sbjct  29    NTLFKAATLKGMSYHVFVVYAYAIAALVLLPAPFFSYRSRVLPPLSFPILCKIGLLGLIG  88

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + Y GI YSSPTLASA+++L PAFTF+ A++  ME L  K  SS AK +GTI+ +
Sbjct  89    SSSQIMGYTGINYSSPTLASAISNLTPAFTFVLAIIFRMEKLVWKRTSSAAKVMGTIISV  148

Query  513   TGAFVITFYKGP-------PLLLFQHAY--------YNSLLPQQSNWILGSFILVTSSLF  647
             TGAFV+T YKGP       P +  Q           +  L     NW++G   L    + 
Sbjct  149   TGAFVVTLYKGPAIVIASTPSMSLQQPLNPSKSNLVFGGLHSANPNWVIGGVFLTAEYIL  208

Query  648   ISMLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICY  827
             + + ++VQ  I+K+YP EL +       V+ ++AI  + +ERN +AW++RPD+ L ++  
Sbjct  209   VPLWYIVQTQIMKEYPAELTVVFFYNLCVSFIAAIVGLASERNASAWRIRPDIALASVVC  268

Query  828   NAIIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIA  1007
             + +      + V+ WA+R KGPVFVAMF PL +  A  MGV FL D L+ GS+IGA+II+
Sbjct  269   SGLFGSCLNNTVHTWALRLKGPVFVAMFKPLSIAIAAAMGVMFLGDTLHLGSLIGATIIS  328

Query  1008  LGFYTVMWGKAME------VKENIETNIDNSNEKVPLLPPNKGDSV  1127
             +GFYTVMWGKA E      V     + +  S  KVPLL   K + V
Sbjct  329   IGFYTVMWGKAKEEMAEEYVSATDSSRVSPSAHKVPLLQSYKNEHV  374



>ref|XP_007036148.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
 gb|EOY20649.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
Length=359

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 140/326 (43%), Positives = 203/326 (62%), Gaps = 13/326 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
              TL+K A ++GMS+F+FV+YSNALA + L+P+   + R   PP+        +C   LLS
Sbjct  32    TTLSKAAMSKGMSHFVFVVYSNALASVILIPAAFFFTRKKRPPI----TLPLLCKFFLLS  87

Query  333   YAGQTLQ----YIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGT  500
              AG TL     + G+ YSSPTLASA+ +L+PAFTF+ AV+  ME L L    S  K +GT
Sbjct  88    IAGITLMQNCVFTGVSYSSPTLASALGNLVPAFTFLLAVIFRMEKLELTSSRSQIKILGT  147

Query  501   IVLITGAFVITFYKGPPLL---LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQ  671
             +V I+GA ++T YKG  +L       +  +++L   +NWI+G   L T+ L +S   + Q
Sbjct  148   LVSISGALIMTLYKGSAVLSPPAQPQSDPSAMLTTTNNWIIGGLFLATACLSLSTNIIGQ  207

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
             A ILK YP E++L    C   TI  A+ A++AERN NAWKL PD+EL+++ Y+A+     
Sbjct  208   AAILKGYPSEIVLVSFYCFFGTIQCALVALVAERNTNAWKLSPDIELVSVVYSALFGSVV  267

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
                V AW +R+KGPVFVAMF PL +  A  +G  FL + LY GS++GA+II  GFY V+W
Sbjct  268   TFAVLAWCIRRKGPVFVAMFKPLSIAIAAFLGFIFLGETLYVGSIVGAAIIVTGFYGVIW  327

Query  1032  GKAMEVKENIET--NIDNSNEKVPLL  1103
              ++ E ++ +     + +S+ K+PLL
Sbjct  328   AQSKEEEDEVANIHKLHSSSSKIPLL  353



>ref|XP_007044598.1| Nodulin MtN21 /EamA-like transporter family protein isoform 6, 
partial [Theobroma cacao]
 gb|EOY00430.1| Nodulin MtN21 /EamA-like transporter family protein isoform 6, 
partial [Theobroma cacao]
Length=309

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/279 (49%), Positives = 176/279 (63%), Gaps = 3/279 (1%)
 Frame = +3

Query  159  LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
            + K A + GMSNF+FV YSNALA L LLPS+ L+HR   PP LTF I     +  LL   
Sbjct  25   MGKAAMSHGMSNFVFVFYSNALASLILLPSSFLFHRSERPP-LTFSILCWFFLLGLLGCF  83

Query  339  GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
             Q   Y GI YSSPTL +AM +LIP  TF+FAV   ME L L   SS AKS+GTIV I G
Sbjct  84   AQIFGYAGIYYSSPTLGTAMLNLIPGLTFLFAVAFRMEKLHLGSSSSQAKSLGTIVSIAG  143

Query  519  AFVITFYKGPPLLLFQHAYY--NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
            AFV+TFYKGP +L+        +  L QQSNW+ G F+L    LF S   +VQA +LK +
Sbjct  144  AFVVTFYKGPSILMSSSRASSSHQFLLQQSNWVFGGFLLAADCLFASAWLIVQASVLKKF  203

Query  693  PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
            P EL++    C  VT+ SAI  ++ ER++++W  +PD+ L+A+ Y+A+    F+  V  W
Sbjct  204  PAELIVVFYYCFFVTLQSAIVCLVMERDLSSWSFKPDVRLVAVLYSAVFGSAFQLGVSTW  263

Query  873  AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVI  989
             + + GPVFVAMF PLG+V +VIMGV FL D  Y G  +
Sbjct  264  CLHRTGPVFVAMFKPLGIVISVIMGVIFLGDTFYLGRAL  302



>ref|XP_011028603.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At5g40240-like 
[Populus euphratica]
Length=352

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 148/325 (46%), Positives = 201/325 (62%), Gaps = 16/325 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
              TL+K A ++GMS F+FV+YSNALA L LLPS I Y    PP  +TF +   +C   LLS
Sbjct  27    TTLSKAAMSKGMSQFVFVVYSNALATLILLPSLIFYRTKRPP--VTFSL---LCKFFLLS  81

Query  333   YAGQTLQ----YIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGT  500
               G TL     + G+ YSSPTLASAM  LIPAFTF+ AV+  ME L  +   S  K +GT
Sbjct  82    LVGITLMQNCVFTGVSYSSPTLASAMGQLIPAFTFLLAVIFRMEKLHWRSSRSRIKIMGT  141

Query  501   IVLITGAFVITFYKGPPLLLFQHAYYNSLLPQ----QSNWILGSFILVTSSLFISMLFLV  668
             +V ++GA  IT YKGP +           +P      ++WI+G   LVT+ L IS+   +
Sbjct  142   LVSVSGALTITLYKGPAIGAITTQSNPEPIPSIMSTTNSWIIGGLFLVTADLCISIFTTL  201

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             QA ILK+YP E+ +    C   TI S+I ++IAERN NAWKLRPD+ELI+I Y+A++   
Sbjct  202   QAAILKEYPSEMAMVSFLCLFGTIQSSIVSLIAERNPNAWKLRPDIELISIIYSAVVGSV  261

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
                 V AW + KKGPVFVA+F P+G+  A  +GV FL D L+ GS++GA II  GFY V+
Sbjct  262   VTFGVTAWCIHKKGPVFVAIFKPVGIATAAFLGVIFLGDTLHVGSIVGAIIIVAGFYGVI  321

Query  1029  WGKAME---VKENIETNIDNSNEKV  1094
             W ++ E    K N   N+ + ++++
Sbjct  322   WAQSKEDEHSKVNGPRNLQSLSQRL  346



>gb|EYU22475.1| hypothetical protein MIMGU_mgv1a009299mg [Erythranthe guttata]
Length=347

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 198/323 (61%), Gaps = 11/323 (3%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K A   GM+N+ FV YSNALA L LLP ++L HR    P LTF +        +L   
Sbjct  27    ISKRAMATGMTNYTFVAYSNALAALILLPLSLLVHRSSTRPPLTFSLIWGFFSLGVLGCL  86

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI Y+S   ASAM +LIP FTFI AV+ GME L+ +  S LAK+IGT+V I G
Sbjct  87    AQLTGYTGINYTSAAFASAMLNLIPGFTFILAVIFGMEKLACRSSSFLAKAIGTVVSIAG  146

Query  519   AFVITFYKGPPLLLFQHA----YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILK  686
             AFV+T YKGP +L    +    Y N  LPQ SNWI+G   L       S   +VQA IL 
Sbjct  147   AFVVTLYKGPQILTLHSSSKLNYPNFYLPQ-SNWIIGGLFLAADCAVASGYIIVQALILA  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVY  866
              YP EL++    C    ILS I +++ +R+++AW L+P++ L A+ Y+ I    F+  V 
Sbjct  206   KYPAELIIVFFYCFFAAILSTIVSLVVDRDLSAWALQPNIRLFAVLYSGIFGSAFQVGVT  265

Query  867   AWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME  1046
             AW + KKGP+FVAMF PLG+V A  +G+ FL D LY G ++G+ II +GFY+VMWGKA E
Sbjct  266   AWCLHKKGPLFVAMFHPLGIVIAASLGIIFLGDILYLGILVGSIIIVIGFYSVMWGKAKE  325

Query  1047  VKENIETNIDNSNEKVPLLPPNK  1115
             VK      ++NS EK PLL  ++
Sbjct  326   VKV-----VENS-EKAPLLTTDE  342



>ref|XP_007036147.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY20648.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
Length=379

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 140/326 (43%), Positives = 203/326 (62%), Gaps = 13/326 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
              TL+K A ++GMS+F+FV+YSNALA + L+P+   + R   PP+        +C   LLS
Sbjct  52    TTLSKAAMSKGMSHFVFVVYSNALASVILIPAAFFFTRKKRPPI----TLPLLCKFFLLS  107

Query  333   YAGQTLQ----YIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGT  500
              AG TL     + G+ YSSPTLASA+ +L+PAFTF+ AV+  ME L L    S  K +GT
Sbjct  108   IAGITLMQNCVFTGVSYSSPTLASALGNLVPAFTFLLAVIFRMEKLELTSSRSQIKILGT  167

Query  501   IVLITGAFVITFYKGPPLL---LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQ  671
             +V I+GA ++T YKG  +L       +  +++L   +NWI+G   L T+ L +S   + Q
Sbjct  168   LVSISGALIMTLYKGSAVLSPPAQPQSDPSAMLTTTNNWIIGGLFLATACLSLSTNIIGQ  227

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
             A ILK YP E++L    C   TI  A+ A++AERN NAWKL PD+EL+++ Y+A+     
Sbjct  228   AAILKGYPSEIVLVSFYCFFGTIQCALVALVAERNTNAWKLSPDIELVSVVYSALFGSVV  287

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
                V AW +R+KGPVFVAMF PL +  A  +G  FL + LY GS++GA+II  GFY V+W
Sbjct  288   TFAVLAWCIRRKGPVFVAMFKPLSIAIAAFLGFIFLGETLYVGSIVGAAIIVTGFYGVIW  347

Query  1032  GKAMEVKENIET--NIDNSNEKVPLL  1103
              ++ E ++ +     + +S+ K+PLL
Sbjct  348   AQSKEEEDEVANIHKLHSSSSKIPLL  373



>ref|XP_009360473.1| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Pyrus 
x bretschneideri]
Length=356

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 198/329 (60%), Gaps = 15/329 (5%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             +NK A + G + +I V+Y N +A L LLPS +++HR   PP LTF I  RI +  L   +
Sbjct  27    VNKAAMSTGTNAYIIVVYGNTIAALILLPSALIFHRSERPP-LTFSILCRIFLLGLFCCS  85

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q    IGIEYSSPTL++AM +LIPAFTFI A++  ME ++ +  SS AK  GT++ I G
Sbjct  86    AQIFGNIGIEYSSPTLSTAMLNLIPAFTFILAIIFRMETVNWRSSSSQAKVFGTVMSIGG  145

Query  519   AFVITFYKGPPLLLFQHAYYNSLL----PQQSNWILGSFILVTSSLFISMLFLVQAWILK  686
             AFV+TFYKG P++    +  NSL       +SNWILG   L   +  IS+ +++QA ++K
Sbjct  146   AFVVTFYKGLPIIRLSSSLPNSLYQIFSSSRSNWILGGLFLAVHAFSISLWYILQATVVK  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVY  866
              YP  L+     C   TI SAI A+IA R+ +AW++R D+ LIA  Y  I+       V 
Sbjct  206   KYPAILLSVFFQCLFATIQSAIFALIAVRDASAWEIRLDVGLIAALYTGIVATVLYFSVI  265

Query  867   AWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME  1046
              W V K G  + +MF P+G++  VIMG  FL D +Y GS++GA+II  GFY +MWGKA E
Sbjct  266   VWCVEKVGAFYCSMFKPIGIIFGVIMGAIFLGDSVYIGSLVGAAIIVTGFYAMMWGKATE  325

Query  1047  VK----ENIETNIDNSNEKVPLLPPNKGD  1121
              K    E+++ N      K+PLL     D
Sbjct  326   EKLIEIESLDQN------KLPLLQNGIQD  348



>ref|XP_007209260.1| hypothetical protein PRUPE_ppa007344mg [Prunus persica]
 gb|EMJ10459.1| hypothetical protein PRUPE_ppa007344mg [Prunus persica]
Length=371

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 157/346 (45%), Positives = 211/346 (61%), Gaps = 37/346 (11%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
              TL+K A +RGMS+F+FV+YSNALA L LLPS+ + HR   PP LTF +   +C   LLS
Sbjct  27    TTLSKAAMSRGMSHFVFVVYSNALATLILLPSSFIIHRNKRPP-LTFSV---LCKFFLLS  82

Query  333   YAG----QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGT  500
              AG    Q   + G+ YSSPTLASA+++L+PAFTF  AVV  ME   L+   S  K +GT
Sbjct  83    LAGITVMQNCVFTGVSYSSPTLASALSNLVPAFTFFLAVVFRMEKFDLRNSRSQIKIMGT  142

Query  501   IVLITGAFVITFYKGPPL--LLFQHAYYNS-----LLPQQSNWILGSFILVTSSLFISML  659
             +V I+GA ++T YKGP +  L  Q A  +S     +L   +NW+ G   L T+SL +++ 
Sbjct  143   LVSISGALIVTLYKGPAVGFLPSQPAIDSSPPNPTMLTSMNNWVTGGLFLTTASLSLAIW  202

Query  660   FLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAII  839
                QA ILK YP E+ +    C   TI SAI  +I E+N N W LR DMELI+I Y+AI 
Sbjct  203   NTAQAAILKGYPSEMTVVSFYCFFGTIQSAILTLIVEKNPNVWALRLDMELISIVYSAI-  261

Query  840   MVGFRSVV----YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIA  1007
                F SV+      W ++KKGPV+VAMF PLG+  A +MG  FL D L+ GSVIGA +I 
Sbjct  262   ---FGSVITFSTLTWCIQKKGPVYVAMFKPLGIAIAALMGAIFLGDTLHIGSVIGALVIV  318

Query  1008  LGFYTVMWGKAME---------VKENIETN-----IDNSNEKVPLL  1103
             +GFY V+W ++ E          KE  ET+     + +S+++ PLL
Sbjct  319   VGFYGVIWAQSKEEKSLDQKRDEKEQGETHEVVDRLQSSSQRTPLL  364



>emb|CDP00195.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 140/329 (43%), Positives = 198/329 (60%), Gaps = 15/329 (5%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K A + GMS ++FV YSNALA L LLP++ L HR   PP LTF +     +  +L   
Sbjct  26    VSKEAMSNGMSKYLFVTYSNALASLILLPTSFLAHRSNRPP-LTFKLVSGFFLLGVLGCT  84

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI+Y+S + ASAM +LIP FTF+ AV+  ME +  +  S++AKSIGTIV I G
Sbjct  85    AQVTGYAGIDYTSASFASAMLNLIPGFTFVLAVIFRMEKVDCRTSSTIAKSIGTIVSIAG  144

Query  519   AFVITFYKGPPLLLFQHA---YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF++T YKG  +L+   +   +Y+ L  QQSNW+LG   L    L  SM  +VQA ILKD
Sbjct  145   AFILTLYKGLQILMASSSPITHYDLLNQQQSNWVLGGLFLAIDCLAASMFIIVQALILKD  204

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             +P +L++    C  V ILSA  ++++  N++AW L+P M L+ I Y+ I     +  +  
Sbjct  205   FPADLIMVFFYCFFVAILSAGISLVSGDNLSAWTLQPTMRLLTILYSGIFGSALQVSLST  264

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W V KKGP+FVAMF PLG+V A    +   +D  Y GS++G+ +I +GFY+VMWGKA E 
Sbjct  265   WCVHKKGPLFVAMFHPLGIVIAAAFNIIISKDAFYVGSLVGSILIVIGFYSVMWGKAREG  324

Query  1050  K-----------ENIETNIDNSNEKVPLL  1103
             K            +I T ++N   K  L+
Sbjct  325   KVVEDQLRGSTYVSIATEVENKEVKAGLV  353



>ref|XP_003516812.1| PREDICTED: WAT1-related protein At3g28050-like [Glycine max]
 gb|KHN18316.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=367

 Score =   246 bits (628),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 139/332 (42%), Positives = 205/332 (62%), Gaps = 8/332 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RGMS  +FV+Y+ A+A + L+P+  +  R    P L+F +  +I +  L+ 
Sbjct  27    NTLFKAATLRGMSYHVFVVYAYAVAAIVLIPAPFISQRSRVLPPLSFPLLRKIGLLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A Q + Y GI +SSPTL+SA+++L+PAFTF+ A++  ME + ++  S  AK +GTIV I
Sbjct  87    CASQIVGYTGINFSSPTLSSAISNLVPAFTFLLAIIFRMEKVIVRNTSCQAKVLGTIVSI  146

Query  513   TGAFVITFYKGPPLLLFQ------HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQA  674
             TGAFV+T YKGPP+++        H   N+L     +W +G  +L    + + + ++VQ 
Sbjct  147   TGAFVVTLYKGPPIIIVHTPSLSLHQPINTLNLVDPSWAIGGLLLTAEYILVPLWYIVQV  206

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
              I+K YP EL++       V+I++AI A+  E N  AWK+  D  L +I  + I      
Sbjct  207   QIMKVYPNELIVIFFYNLCVSIMAAIVAIFTETNAGAWKIGVDTALASIVCSGIFGSFVN  266

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
             +VV+ W +R KGPV+VAMF PL +  AV +GV FL D L+ GS++GA+II++GFYTVMWG
Sbjct  267   NVVHTWVLRIKGPVYVAMFKPLSIAIAVALGVMFLGDTLHLGSIVGATIISIGFYTVMWG  326

Query  1035  KAME--VKENIETNIDNSNEKVPLLPPNKGDS  1124
             KA E  V E++      + E VPLL   K D+
Sbjct  327   KATEENVGEDVPGQQSPTTENVPLLQSCKTDT  358



>ref|XP_011086526.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Sesamum 
indicum]
Length=351

 Score =   245 bits (626),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 134/321 (42%), Positives = 206/321 (64%), Gaps = 6/321 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K+A ++G+S +I  +YSN +A L L P+  L HR   PP L+F +  RI + A    +
Sbjct  31    VSKMAMSKGISFYILSVYSNGVATLILFPTAFLLHRSKRPP-LSFHVLCRIFLLASFGCS  89

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
                + Y G+ YSSPTL+SAMA+LIPAFT+I A++  ME + L++ S+++K +GT+V I+G
Sbjct  90    ADIVGYAGLSYSSPTLSSAMANLIPAFTYILAIIFRMEEVHLRKLSTISKVLGTLVSISG  149

Query  519   AFVITFYKGPPLL---LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF++TFYKGP ++   L   +     L Q  NW+LG      + L  ++  ++QA IL  
Sbjct  150   AFIVTFYKGPAIIGRTLTSGSSTLLYLQQTRNWVLGGLFTACACLLTALWCILQASILNM  209

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP E++   I C  VTI S + ++IAER+  AW +   + LIA+ Y AII + +R  V A
Sbjct  210   YPAEMIAVAIYCFFVTIQSLVVSLIAERDSTAWTIETKIGLIAVFYVAIINIAYRLYVTA  269

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + + GP+FV++F PL +V  V +GV F++DDLY GS++GA ++ +GFY VMWGKA E 
Sbjct  270   WCLWRTGPLFVSLFKPLTIVITVAIGVIFMKDDLYLGSLVGALVLVIGFYGVMWGKAKEG  329

Query  1050  KENIETNIDNSNEKVPLLPPN  1112
             +  +    ++S+ +VPLL  N
Sbjct  330   R--LYKGTESSDFEVPLLQEN  348



>ref|XP_008340346.1| PREDICTED: WAT1-related protein At4g15540-like [Malus domestica]
Length=380

 Score =   246 bits (628),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 202/324 (62%), Gaps = 16/324 (5%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             +NK A ++G + +I V+Y+NA++ L LLPS +++HR   PP LTF I  +I + AL    
Sbjct  56    VNKAAMSKGTNAYIIVVYANAVSALILLPSALIFHRSERPP-LTFSILCKIFLLALFCCT  114

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q    IGIEYSSPTL++AM +LIPAFTFI A++  ME +  +  SS AK +GTIV ITG
Sbjct  115   SQIFGNIGIEYSSPTLSTAMLNLIPAFTFILAIIFRMERVYWRSSSSQAKVLGTIVSITG  174

Query  519   AFVITFYKGPPLL---LFQHAYYNSLL--PQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
             AFV+TFYKG P++       +  N L+    +SNWILG   L   +L  S+ +++QA I+
Sbjct  175   AFVVTFYKGLPIIRLSSSLASLLNQLILSSSKSNWILGGXFLAADALSTSLWYILQATIV  234

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             K YP  + +    C   T+ SA   +IA R  +AW++R D+ +IAI Y  I+    R  +
Sbjct  235   KKYPAIVFIVFFQCLFATMQSAAFTLIAVRGASAWEIRLDVGIIAILYTGIVSTVLRYSL  294

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
               W V+K G  + +MF PLG++  VIMGV FL D +Y GS++GA+II  GFY +MWGKA 
Sbjct  295   VTWCVKKAGAFYCSMFKPLGIIFGVIMGVIFLGDSVYLGSLVGAAIIVTGFYAMMWGKAK  354

Query  1044  EVK----ENIETNIDNSNEKVPLL  1103
             E K    E+++ N      K+PLL
Sbjct  355   EEKLIEIESLDQN------KLPLL  372



>emb|CAN71719.1| hypothetical protein VITISV_034106 [Vitis vinifera]
Length=335

 Score =   245 bits (625),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 195/320 (61%), Gaps = 29/320 (9%)
 Frame = +3

Query  162   NKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAG  341
             +K A + GM N +F+LYSN LA L LLPS +L+H                      S+  
Sbjct  26    SKAAISSGMPNLVFILYSNTLASLILLPSCLLFH----------------------SFFA  63

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
             Q   Y GI+YSS TL +AM +L+P FTFI A++  ME L  +  SS+AKS+GT+V I GA
Sbjct  64    QIFGYAGIQYSSATLGTAMLNLVPGFTFILAIIFRMERLDWR-GSSMAKSMGTVVSIAGA  122

Query  522   FVITFYKGPPLLLFQHA--YYNSL-LPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             F++TFYKG P+L+      + + L L QQSNW+ G  +L    +  S   ++QA ILK Y
Sbjct  123   FIVTFYKGSPILMTPSPSNFPDQLFLSQQSNWVFGGLLLAADCVMSSAWLILQASILKKY  182

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P EL++    C  V I SA A++I ER   AW L+P    IA+ Y+ +    F+     W
Sbjct  183   PAELIINFYYCFFVAIQSAAASLIMERGPGAWSLKPSTRFIAVMYSGVFGYVFQVGAITW  242

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              V +KGPVFVAMF P+G+V A+ MGV FL D  Y GS+IGA++I +GFY+VMWGKA E K
Sbjct  243   CVHQKGPVFVAMFKPVGIVVAIAMGVIFLGDTFYMGSLIGATVIVIGFYSVMWGKAKEEK  302

Query  1053  --ENIET-NIDNSNEKVPLL  1103
               E+I   +++++++K PLL
Sbjct  303   IDEDIGVRSLESTSQKAPLL  322



>ref|XP_009629024.1| PREDICTED: WAT1-related protein At3g28050-like [Nicotiana tomentosiformis]
Length=356

 Score =   245 bits (626),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 138/324 (43%), Positives = 192/324 (59%), Gaps = 4/324 (1%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             + K A + GM+NF FV YSNALA L LLPS   Y  + PP  L F +     +  +L  +
Sbjct  33    VGKKAMSTGMTNFTFVFYSNALASLILLPSFFFYRSIRPP--LNFSLICGFFLLGVLGCS  90

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI Y+S + ASAM +LIP FTFI AV+  ME L  +  S+L KS+GT+V I G
Sbjct  91    AQLTGYAGINYTSASFASAMLNLIPGFTFILAVIFRMEKLDCRSTSTLIKSVGTVVSIAG  150

Query  519   AFVITFYKGPPLLLFQHAY--YNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             AF  T YKGP +LL   +    N L  Q+++W++G   LV   +  S   +VQA +LK Y
Sbjct  151   AFTATLYKGPQILLTSSSLKPQNYLHFQETDWVIGGLYLVVDCIAASAYLIVQASVLKSY  210

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P EL++    C   +ILSAI ++  + ++NAW L+P   L A+ Y+ +    F+  V  W
Sbjct  211   PVELIVVFFYCFFSSILSAIVSLFMDMDLNAWMLQPGTRLFAVLYSGVFGSAFQVSVMFW  270

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              VR++GP+FVAMF PLG+V A  +G+ FL D  Y GS++G+ +I +GFY VMWGK  E K
Sbjct  271   CVRRRGPLFVAMFHPLGIVIAAALGIIFLGDIFYLGSLVGSIVIVVGFYAVMWGKTQEKK  330

Query  1053  ENIETNIDNSNEKVPLLPPNKGDS  1124
              + +    N N K PLL     ++
Sbjct  331   VDEDHLSRNINSKAPLLQIKDAET  354



>ref|XP_004502588.1| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Cicer 
arietinum]
Length=345

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 199/330 (60%), Gaps = 15/330 (5%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L+K     GM++F+F+ YSN++A L LLPS+   HR   PP+ TF    R  I  LL Y 
Sbjct  24    LSKQVMAEGMTSFVFIFYSNSIAALILLPSSFFIHRFQRPPI-TFSTLSRFFILGLLGYL  82

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI YSS TL +AM +L+P FTFI A++ GME L  +  SSLAK +GTIV I+G
Sbjct  83    AQAFGYAGINYSSATLGTAMLNLVPGFTFILAILFGMEQLDWRSSSSLAKLLGTIVSISG  142

Query  519   AFVITFYKGPPLL-------LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
             AFV T YKG  LL       L QH  ++    Q SNWILG   L    +  S   +VQA 
Sbjct  143   AFVATLYKGVALLNGPSPANLSQHQVFS----QDSNWILGGLFLAADCVMASAFTIVQAS  198

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             +LK YP EL++    C  V ILSA+  ++ + ++ AW L P+  L+A+ Y+ +I   F+ 
Sbjct  199   VLKKYPAELIVVFFYCFFVAILSAMTCLVVKSDIGAWSLEPNFRLLAVLYSGVIGSAFQV  258

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
              V  W + + GPVFV+MF P+G+V +V++GV FL D  Y GS+IGA +I +GFY+V+WGK
Sbjct  259   GVITWCLHQTGPVFVSMFKPIGIVISVVIGVVFLGDAFYLGSLIGAVVIVIGFYSVLWGK  318

Query  1038  AMEVKENIETNIDNSNEKVPLLPPNKGDSV  1127
             + +++     ++++   +  LL  N  + +
Sbjct  319   SKDIEAR---SLESRGNQTLLLKDNSSEDI  345



>ref|XP_002875422.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51681.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/332 (43%), Positives = 210/332 (63%), Gaps = 19/332 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K A+++GMS+++F++YS  +  L LLPS  L HR    P L F +  ++ +  LL 
Sbjct  27    NTLFKAASSKGMSSYVFLVYSYGIGALLLLPSPFLTHRSRSLPPLKFSVLCKMGLLGLLG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  L Y GI+YSSPTLASAM++L PAFTF+FA++  ME +S+K+ SS+AK +GTIV I
Sbjct  87    CVYLMLGYTGIKYSSPTLASAMSNLTPAFTFLFALLFRMEKVSIKKNSSVAKVVGTIVCI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSL-----------LPQQSNWILGSFILVTSSLFISML  659
              GA V T Y GP  ++F  +  +S+            P  SNW++G  +L      I++ 
Sbjct  147   VGALVATLYHGP--IIFAASQPSSIYLPQPLLAPPSPPSNSNWVIGGGLLALEYTLIAVS  204

Query  660   FLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAER-NVNAWKLRPDMELIAICYNAI  836
             +++Q  I+++YP E  L +     V+I  A  ++ AE+ N +AW +R  + LI I    +
Sbjct  205   YIIQTHIMREYPSEFALALSHNVCVSISCAFVSLFAEKNNPSAWIMRSKIMLICIVATGM  264

Query  837   I-MVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALG  1013
             +   G+  VV +W VR KGPVF+AMF PL ++ AV++G  FL D LY GSVIG ++I++G
Sbjct  265   VNSTGY--VVESWTVRHKGPVFLAMFRPLSILTAVVLGAIFLGDSLYLGSVIGGTLISIG  322

Query  1014  FYTVMWGKAMEVKENIETNIDNS--NEKVPLL  1103
             FYTVMWGKA E K +IETN+  S  +++VPLL
Sbjct  323   FYTVMWGKAKEEKADIETNVATSSHSKRVPLL  354



>ref|XP_009761506.1| PREDICTED: WAT1-related protein At5g40240-like isoform X2 [Nicotiana 
sylvestris]
Length=358

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 202/326 (62%), Gaps = 10/326 (3%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRI-CITALLS  332
             TL K A   GMSN ++V+Y NAL    LLP  I +       ++T  I  R   +  L  
Sbjct  31    TLGKAAMNDGMSNLVYVVYYNALGTFLLLPFLIFHRCRSNMALITLSILWRFFLLGLLGI  90

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q L Y GI+YSSPTLA+A+ +L+P FTF+  ++  ME L +++ SS AKS+GTIV I
Sbjct  91    CLLQVLAYTGIKYSSPTLAAALGNLLPGFTFLLTIIFRMEKLDIRKASSQAKSLGTIVAI  150

Query  513   TGAFVITFYKGPPLL----LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              GA ++T YKGP +L    L   + ++SL  Q+SNW+LG  ++  + +  S   ++Q   
Sbjct  151   IGASIMTLYKGPRVLGSSNLHSDSSHHSLFSQESNWLLGGLLITITCIMSSGWNVLQTDT  210

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             +K YP ++ +   TC   +I  AI  ++ ERN  AW ++P + +IAI ++A+    FR  
Sbjct  211   VKKYPEQMTIVFFTCCFGSIQCAILTLVLERNPEAWMVKPGIGMIAIVFSAVSGSVFRYN  270

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             V  W + KKGP++VAMF PLGMV A I+G+ FL + L+ GSVIGA II+ GFY+V+WGKA
Sbjct  271   VLTWCLDKKGPLYVAMFKPLGMVIAAILGILFLTESLHLGSVIGAVIISAGFYSVLWGKA  330

Query  1041  MEVK-----ENIETNIDNSNEKVPLL  1103
              E+K     E+I + ID+S+++ PLL
Sbjct  331   KEIKSMLEIEDIVSGIDSSSQRSPLL  356



>ref|XP_008239731.1| PREDICTED: WAT1-related protein At5g40240-like [Prunus mume]
Length=399

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 156/346 (45%), Positives = 210/346 (61%), Gaps = 37/346 (11%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
              TL+K A +RGMS+F+FV+YSNALA L LLPS+ + HR   PP LTF +   +C   LLS
Sbjct  55    TTLSKAAMSRGMSHFVFVVYSNALATLILLPSSFIIHRNKRPP-LTFSV---LCKFFLLS  110

Query  333   YAG----QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGT  500
              AG    Q   + G+ YSSPTLASA+++L+PAFTF  AV+  ME   L+   S  K +GT
Sbjct  111   LAGITVMQNCVFAGVSYSSPTLASALSNLVPAFTFFLAVIFRMEKFDLRNSRSQIKIMGT  170

Query  501   IVLITGAFVITFYKGPPL--LLFQHAYYNS-----LLPQQSNWILGSFILVTSSLFISML  659
             +V I+GA ++T YKGP +  L  Q A  +S     +L   +NW++G   L T+SL +++ 
Sbjct  171   LVSISGALIVTLYKGPAVGFLPSQPAIDSSPPNPTMLTSMNNWVIGGLFLTTASLSLAVW  230

Query  660   FLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAII  839
                QA ILK YP E+ +    C   TI SAI  +I E+N   W LR DMELI+I Y+AI 
Sbjct  231   NTAQAAILKGYPSEMTVVSFYCFFGTIQSAILTLIVEKNPKVWALRLDMELISILYSAI-  289

Query  840   MVGFRSVV----YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIA  1007
                F SV+      W ++KKGPVFVAMF PLG+  A +MG  FL D L+ GSVIGA +I 
Sbjct  290   ---FGSVITFSTLTWCIQKKGPVFVAMFKPLGIAIAALMGAIFLGDTLHVGSVIGALVIV  346

Query  1008  LGFYTVMWGKAME---------VKENIETN-----IDNSNEKVPLL  1103
             +GFY V+W ++ E          KE  ET+     + +S++  PLL
Sbjct  347   VGFYGVIWAQSKEEKSLDQKRDEKEQGETHEVVDRLQSSSQSTPLL  392



>ref|XP_002299184.1| hypothetical protein POPTR_0001s06940g [Populus trichocarpa]
 gb|EEE83989.1| hypothetical protein POPTR_0001s06940g [Populus trichocarpa]
Length=355

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 196/328 (60%), Gaps = 7/328 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L K A + GMS+F+FVLYSNA+A L LLPS+ L+HR    P LT  I     +  L    
Sbjct  26    LGKAAMSNGMSSFVFVLYSNAIACLILLPSSFLFHRSSERPPLTLSIVSGFFLLGLFGCL  85

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
             GQ+  Y GI  SSPTL +AM +L+P  TFI A++  ME +  K  S+LAKS+GTIV I G
Sbjct  86    GQSFCYAGINLSSPTLGTAMLNLVPGLTFILAIIFRMENVDWKSYSTLAKSMGTIVSIGG  145

Query  519   AFVITFYKGPPLLLFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF++T YKGP LL    +   S   +L QQSNW+LG  ++       S   +VQA ILK 
Sbjct  146   AFIVTCYKGPLLLKALPSVTKSSHQVLLQQSNWVLGGLLMAVDCATASSWLIVQALILKK  205

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             Y  +L++        TILS+I +++ ER+ +AW L  ++ LIA+ ++ I+   F   V A
Sbjct  206   YSAKLIVVFFHFFFSTILSSIVSVVMERDPSAWSLNSNIRLIAVLFSGILGNAFEIGVTA  265

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W V K GPVFVA+F PLG+V A    V    D L  G VIGA++IA+GFY V+WGKA E 
Sbjct  266   WCVHKTGPVFVAIFAPLGIVIAAAASVICFGDALDLGIVIGAAVIAIGFYAVIWGKAQEE  325

Query  1050  KENIETNID----NSNEKVPLLPPNKGD  1121
              + +E   +    +S++KVP L     D
Sbjct  326   IKKVEDKENCGSASSSQKVPFLQNRSND  353



>ref|XP_006483801.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Citrus 
sinensis]
Length=349

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 137/329 (42%), Positives = 196/329 (60%), Gaps = 18/329 (5%)
 Frame = +3

Query  162   NKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAG  341
              K A + GMSN +FV YS A A L LLP+++L+HR   PP LT  I     +   L  + 
Sbjct  26    GKAAMSDGMSNLVFVFYSKAFASLVLLPASLLFHRSRIPP-LTLPILSAFFLLGFLGTSS  84

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
             Q     GI YSSPTL++AM +L+P FTFI A++  ME L  +  SSLAKS+GTIVLITGA
Sbjct  85    QFFGNAGIYYSSPTLSTAMLNLVPGFTFILAIIFRMEKLDWRSSSSLAKSVGTIVLITGA  144

Query  522   FVITFYKGPPLLLFQHAYYNSLLPQ--------QSNWILGSFILVTSSLFISMLFLVQAW  677
             F++T+YKG  LL+       SL P         Q+NW++G  +L    +F S   +VQA 
Sbjct  145   FIMTYYKGTHLLM------TSLPPNLSLQFFVPQTNWVVGGLLLAVDCVFTSAWLIVQAS  198

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             ILK +  E ++    C  V I SAI  ++ ER++++W L+P + L+A+ Y+A+    F+ 
Sbjct  199   ILKKFSAEFIVVFFYCFFVAIQSAIFCLVMERDLSSWSLKPGVRLVAVLYSAVFGSAFQV  258

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
              V  W + + GPVFVAMF PLG++ +  +G  FL + +Y GSVIGA I  +G+YTV WG 
Sbjct  259   GVCTWCLHRTGPVFVAMFKPLGVIISAAVGTIFLGETVYLGSVIGAVITGMGYYTVTWGN  318

Query  1038  AME---VKENIETNIDNSNEKVPLLPPNK  1115
               E   +++   +     ++KVPLL  + 
Sbjct  319   IREDELLRKGHNSKDAADDQKVPLLQEDS  347



>gb|KGN52391.1| hypothetical protein Csa_5G630930 [Cucumis sativus]
Length=338

 Score =   243 bits (619),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 139/327 (43%), Positives = 197/327 (60%), Gaps = 21/327 (6%)
 Frame = +3

Query  186   MSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAGQTLQYIGI  365
             MS+ +FV+YS + A L LLPS  +       P L F I  +I +  L+    Q + Y GI
Sbjct  1     MSHHVFVVYSYSFAALLLLPSPFISRTSTRLPPLNFSITSKIALLGLIGSCSQIMGYTGI  60

Query  366   EYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAFVITFYKG  545
              YSSPTLASA+++L+PAFTFI A++  ME + LK  SS AK +GTI+ I+GAFV+TFYKG
Sbjct  61    NYSSPTLASAISNLVPAFTFILAIIFRMEKVVLKSNSSQAKVMGTIISISGAFVVTFYKG  120

Query  546   PPLL--------LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPGE  701
             P ++        L  H     L    SNW++GS +L    + + + ++VQ  I+K+YP E
Sbjct  121   PRIIFSSSPTISLSLHHNSQQLSSSDSNWVIGSLLLTAEYILVPLWYIVQTKIMKEYPEE  180

Query  702   LMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAVR  881
               +       V I++A   +I E++ +AW LR +  L +I  + +      + V+ WA+R
Sbjct  181   ATVVFFYNLTVAIIAAFVGLILEKDPSAWILRQNTALASILCSGLFGSCLNNTVHTWALR  240

Query  882   KKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME-----  1046
              KGPVFVAMF PL +V A++MGV FL D LY GS+IGASII++GFYTVMWGKA E     
Sbjct  241   LKGPVFVAMFKPLSIVVAIVMGVLFLGDSLYLGSLIGASIISIGFYTVMWGKAKEEMGVG  300

Query  1047  -------VKENIETNID-NSNEKVPLL  1103
                       N++ N + N +++VPLL
Sbjct  301   EEKQEGHSHNNLDGNKESNEDQRVPLL  327



>ref|XP_010528268.1| PREDICTED: WAT1-related protein At3g28050 [Tarenaya hassleriana]
Length=364

 Score =   243 bits (620),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 144/336 (43%), Positives = 200/336 (60%), Gaps = 13/336 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GM   +F++YS ALA L LLPS     R    P L F I  +I +  L+ 
Sbjct  27    NTLFKAATLQGMDFHVFIVYSYALAALLLLPSIFFSSRSRALPPLRFSILRKILLLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  + Y GI YSSPTLASA+++L PAFTF+ AV+  ME +S K  SS+AK +GT V I
Sbjct  87    CCSNMMGYTGINYSSPTLASAISNLTPAFTFLLAVLFRMEEVSFKRSSSVAKMLGTAVSI  146

Query  513   TGAFVITFYKGPPLLLFQ----HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
             TGAFV+T YKGP ++           + L    +NW LG+  L      + + ++VQ  I
Sbjct  147   TGAFVVTLYKGPVVIALSPPSISLRLSRLQSPNANWTLGAAFLTVEYFLVPLWYIVQTQI  206

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWK---LRPDMELIAICYNAIIMVGF  851
             +++YP EL +  +  + V++ +AI  +  E N N+W    L+PD+ L +I  + +     
Sbjct  207   MREYPAELTVVCLYSSCVSLFTAIVTLFTEGNNNSWSMWMLKPDIALASIICSGLFGSCI  266

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
              + ++ WA+R KGP+FVAMF PL +  AV MGV FL D LY GS++GA+II +GFYTVMW
Sbjct  267   NNSIHTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLSDSLYLGSLVGATIITMGFYTVMW  326

Query  1032  GKAMEVK-----ENIETNIDNSNEKVPLLPPNKGDS  1124
             GKA E +      N E  +D S++KVPLL   K D 
Sbjct  327   GKAKEAEMAEGCNNNEGCLD-SSQKVPLLRSCKSDD  361



>ref|XP_009790539.1| PREDICTED: WAT1-related protein At3g28050-like [Nicotiana sylvestris]
Length=352

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 137/324 (42%), Positives = 189/324 (58%), Gaps = 4/324 (1%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             + K A + GM+NF FV YSNALA L LLPS   Y    PP  L F +     +  +L  +
Sbjct  29    VGKKAMSTGMTNFTFVFYSNALASLILLPSFFFYRSTRPP--LNFSLICGFFLLGVLGCS  86

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI Y+S + ASAM +LIP FTF+ AV+  ME L  +  S+L KS+GT+V I G
Sbjct  87    AQLTGYAGINYTSASFASAMLNLIPGFTFVLAVIFRMEKLDCRSTSTLIKSVGTVVSIAG  146

Query  519   AFVITFYKGPPLLLFQHAY--YNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             AF  T YKGP   L   +    N L  Q+++W++G   LV   +  S   +VQA ILK+Y
Sbjct  147   AFTATLYKGPQFFLSSSSLKPQNYLHFQETDWVIGGLYLVVDCIAASAYLIVQASILKNY  206

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P EL++    C   +ILSAI ++  + N+NAW L+    L A+ Y+ +    F+  V  W
Sbjct  207   PVELIVVFFYCFFSSILSAIVSLFMDMNINAWMLQSGTRLFAVLYSGVFGSAFQVSVMFW  266

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              VR++GP+FVAMF PLG+V A  +G+ FL D  Y GS++G+ +I +GFY VMWGK  E K
Sbjct  267   CVRRRGPLFVAMFHPLGIVIAAALGIIFLGDIFYLGSLVGSIVIVVGFYAVMWGKTQEKK  326

Query  1053  ENIETNIDNSNEKVPLLPPNKGDS  1124
              + +    N N K PLL     ++
Sbjct  327   VDEDHLSRNINSKAPLLQIKDAET  350



>ref|XP_010111736.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXC31598.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=362

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 138/330 (42%), Positives = 204/330 (62%), Gaps = 16/330 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +FV+Y+ A+A L LLP+    HR    P L F I  ++ +  L+ 
Sbjct  28    NTLFKAATLKGMSYHVFVVYAYAIAALVLLPAPFFSHRSRVLPPLNFSIMIKMGLLGLIG  87

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q + + GI YSSPTLASA+++L+PAFTFI A++  ME L+++  SS AK +GT+V I
Sbjct  88    CSSQIMGFTGINYSSPTLASAISNLVPAFTFILAIIFRMEKLAVRSTSSQAKMLGTVVSI  147

Query  513   TGAFVITFYKGPPL---------LLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFL  665
             TGAFV T Y+GPP+         L  QH   N     +SNW++G  +L    + + + ++
Sbjct  148   TGAFVATLYQGPPIISTRFSTISLHHQHLLQND---TKSNWVVGGLLLTAEYILVPLWYI  204

Query  666   VQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMV  845
             VQ  I+K+YP EL +       V+I++AI A+I E + +AWKL+  + ++++  + +   
Sbjct  205   VQTHIMKEYPNELSVVFFYNLSVSIMAAIVALIMETDSSAWKLKSSIAIVSVVCSGVFGS  264

Query  846   GFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTV  1025
                + V+ W +R KGPV+VAMF PL +  A  MG  FL + L+ GS+IGA+ I++GFYTV
Sbjct  265   FLNNTVHTWVLRVKGPVYVAMFKPLSIAIAAAMGFIFLGETLHLGSLIGATTISIGFYTV  324

Query  1026  MWGKAMEVKENIETNIDNSNEKVPLLPPNK  1115
             MWGKA   KE I T  D+  E +  LP +K
Sbjct  325   MWGKA---KEEINTE-DSQAESMGSLPTHK  350



>gb|KHN01750.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=371

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 139/339 (41%), Positives = 208/339 (61%), Gaps = 19/339 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHR----LMPPPVLTFGIFGRICIT  320
             NTL K AT RGMS  +FV+Y+ A+A + L+P   +  R    ++PP  L+F +  +I + 
Sbjct  28    NTLFKAATLRGMSYHVFVVYAYAVAAIVLIPGPFISQRCRSRVLPP--LSFPLLRKIGLL  85

Query  321   ALLSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGT  500
              L+  A Q + Y GI +SSPTL+SA+++L+PAFTF+ A++  ME + ++  +  AK +GT
Sbjct  86    GLIGCASQIVGYTGISFSSPTLSSAISNLVPAFTFLLAIIFRMEKVIVRNTTCQAKVLGT  145

Query  501   IVLITGAFVITFYKGPPLLLFQ------HAYYNSLLPQQSNWILGSFILVTSSLFISMLF  662
             IV ITGAFV+TFYKGPP+++        H   N+L     +W +G  +L    + + + +
Sbjct  146   IVSITGAFVVTFYKGPPIIIVHTPSLSLHQPINTLNSVDRSWAIGGLLLTAEYILVPLWY  205

Query  663   LVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIM  842
             +VQ  I+K YP EL +       VTI++AI A+  E N  AWK+  D  L +I  + I  
Sbjct  206   IVQVQIMKVYPNELTVIFFYNLCVTIMAAIVAIFTETNAGAWKIGLDTALASIVCSGIFG  265

Query  843   VGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYT  1022
                 + V+ W +R KGPV+VAMF PL +  AV +GV FL D L+ GS++GA++I++GFYT
Sbjct  266   SFVNNAVHTWVLRIKGPVYVAMFKPLSIAIAVALGVMFLGDTLHLGSLVGATVISIGFYT  325

Query  1023  VMWGKAMEVKENIETNIDN-----SNEKVPLLPPNKGDS  1124
             VMWGKA E  EN++ ++       + E VPLL   K D+
Sbjct  326   VMWGKATE--ENVDEDVPGQQSPPTTENVPLLQSYKTDT  362



>ref|XP_011086524.1| PREDICTED: WAT1-related protein At3g28050-like [Sesamum indicum]
Length=351

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/320 (43%), Positives = 210/320 (66%), Gaps = 5/320 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K+A ++G+S +I  +YSN  A L L P+  L+H    PP L+F +  RIC+ A     
Sbjct  31    ISKMAMSKGISFYILSVYSNGFATLILFPTAFLFHGSKRPP-LSFPVLWRICLLASFGCF  89

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              +   Y GI YSSPTL++AM +L+PAFT+I A++  ME + L++ S+++K  GT+V I+G
Sbjct  90    AEIGSYAGINYSSPTLSTAMLNLVPAFTYILAIIFRMEEVHLRKLSTISKVFGTLVSISG  149

Query  519   AFVITFYKGPPLL--LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             AF++TFYKGP ++  +   +     LPQ  NW+LG F+L  +S   +   ++QA ILK Y
Sbjct  150   AFIVTFYKGPAIIGAITSGSSTQLHLPQTQNWVLGGFLLACASFMTASWCILQASILKMY  209

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
               E+++    C  VTI S++ ++IAER++ AW++   + LIA+ Y+AII + +R  V AW
Sbjct  210   RAEMIVVAFYCCFVTIQSSLVSLIAERDLTAWRIETKIGLIAVFYSAIINIAYRLYVTAW  269

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              + + GP+FVA+F PL +V AV++GV F++D LY GS+IGA ++ +GFY VMWGKA E +
Sbjct  270   CLWRTGPLFVALFKPLTIVIAVVIGVIFMKDILYLGSLIGALVLIIGFYAVMWGKAKEGE  329

Query  1053  ENIETNIDNSNEKVPLLPPN  1112
              N  T  + S+ + PLL  N
Sbjct  330   LNKGT--EASSYEAPLLQEN  347



>ref|XP_006593634.1| PREDICTED: WAT1-related protein At5g40230-like isoform X2 [Glycine 
max]
Length=351

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 202/330 (61%), Gaps = 37/330 (11%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL K AT +GMSN++FV Y+ ++ALL LLP T  Y R                       
Sbjct  29    TLFKAATLQGMSNYVFVTYAYSVALLVLLPVTFFYRR----------------------S  66

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             + Q L Y GI YSSPTL+SA+++L PAFTF+ AV+  ME +++K R++ AK +G+I+ I 
Sbjct  67    SSQILGYAGIRYSSPTLSSAISNLTPAFTFMLAVICRMEKIAVKRRTTQAKILGSIISIL  126

Query  516   GAFVITFYKGPPLLLFQHAYYNSLLPQQS--------NWILGSFILVTSSLFISMLFLVQ  671
             GAFV+TFYKG  +++  ++  +  LPQ +        NW++G  +L   ++ +++ F+ Q
Sbjct  127   GAFVVTFYKGQSIIIADNSP-SIQLPQSNGILTSVDRNWVIGGLLLTACNILLTVWFVYQ  185

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
               ILK++P EL +         I+++I  ++ E+N +AWK+RPD+ LI+I    I     
Sbjct  186   VEILKEFPDELTMVFFYNLCAAIVASIIGLLGEKNSSAWKIRPDISLISIVCTGIFNKFL  245

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
              S +YAW +  KGPV+VAMF PL +V AV MGV FL D LY GS+IGA+II++GFYTVMW
Sbjct  246   SSAIYAWGIHLKGPVYVAMFKPLSIVIAVAMGVMFLGDSLYVGSIIGATIISIGFYTVMW  305

Query  1032  GKAMEVK------ENIETNIDNSNEKVPLL  1103
             GKA E K      EN+ +   +  E +PLL
Sbjct  306   GKATEQKEEEEEEENVGSQESSITENIPLL  335



>gb|KHN44251.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=330

 Score =   241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 200/318 (63%), Gaps = 19/318 (6%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             T++K A  +GM++F+FV+YSNA A   LLP T +++R    P LT+ I G++ I   LS 
Sbjct  22    TVSKAAMKKGMNDFVFVMYSNAFATCLLLPITFIFYRKRALPPLTYFIVGQLFINGFLSC  81

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             + Q L++ GI Y SPTLA+AM+DLIPAFTFI A+V  ME L  K  S+ AKSIGT+V I 
Sbjct  82    SVQMLRFFGIGYGSPTLATAMSDLIPAFTFILAIVFSMEKLDWKANSTQAKSIGTLVSIA  141

Query  516   GAFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYP  695
             GA +IT YKG  ++  ++   N L P++          V+S  F         WI+++YP
Sbjct  142   GALIITLYKGQAVI--KNHPSNKLFPKKH---------VSSEQF------DWTWIIRNYP  184

Query  696   GELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWA  875
              EL++ +    LV +LS   ++I+  +  A +L  D+ LIAI    I  V  RS+V+ W 
Sbjct  185   AELVIVLTRGTLVAMLSIPPSLISVTDPKALRLGFDVNLIAIALQTIFGVSLRSIVHIWV  244

Query  876   VRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME-VK  1052
             + KKGP++VAMF P+G++ AVIMG+ FL D +Y GSV+GA+I+ +GFY V+WGK+ E  K
Sbjct  245   MSKKGPLYVAMFKPIGIIFAVIMGIAFLGDSIYLGSVLGAAIVVIGFYAVIWGKSQEQAK  304

Query  1053  ENIETNIDNSNEKVPLLP  1106
             E  E   DNS    P++P
Sbjct  305   EECEV-YDNSESYSPVVP  321



>ref|XP_008221766.1| PREDICTED: WAT1-related protein At5g40210-like isoform X1 [Prunus 
mume]
Length=361

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/324 (43%), Positives = 192/324 (59%), Gaps = 6/324 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             +N+ A ++G + +I V+Y+N L+ L LLP  + +H     P LTF I     + AL   +
Sbjct  25    VNEAAMSKGSNKYIMVVYANGLSTLILLPPALFFHHRSGRPPLTFSILCGFFMLALFGCS  84

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y+GIEYSS TL +AM +LIPAFTFI A++  ME +  +  SS AK +GTI  I G
Sbjct  85    AQIFGYVGIEYSSATLGTAMLNLIPAFTFILAIIFRMEEVQWRSSSSKAKILGTIASIAG  144

Query  519   AFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPG  698
             AFV+TFYKG P++L   ++  +L   +SNW+LG   L   S   S+ +++QA  LK YP 
Sbjct  145   AFVVTFYKGQPIMLPPSSHPPNLFSSKSNWVLGGLFLAADSFSSSLWYILQASTLKKYPA  204

Query  699   ELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAV  878
              ++        +T+ SA+  +IA ++ +AW+LR DM LIA+ Y AI+ +G R  + AW V
Sbjct  205   VVVTVCFQSLFMTVQSALVTLIAVKDASAWELRLDMGLIAVLYTAIVSIGLRYTLTAWCV  264

Query  879   RKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGS----VIGASIIALGFYTVMWGKAME  1046
              K G +F +MF PLG++  VIMG  FL D  Y G     ++GA II  GFY VMWGKA E
Sbjct  265   WKAGALFCSMFKPLGIIFGVIMGAIFLGDPFYFGRYAQFLVGALIIVTGFYAVMWGKAKE  324

Query  1047  VK--ENIETNIDNSNEKVPLLPPN  1112
              K  E         + KVPLL  N
Sbjct  325   EKLVEGGSRWESLGHNKVPLLQNN  348



>ref|NP_001239940.1| uncharacterized protein LOC100814137 [Glycine max]
 gb|ACU20859.1| unknown [Glycine max]
Length=371

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 138/339 (41%), Positives = 208/339 (61%), Gaps = 19/339 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHR----LMPPPVLTFGIFGRICIT  320
             NTL K AT RGMS  +FV+Y+ A+A + L+P   +  R    ++PP  L+F +  +I + 
Sbjct  28    NTLFKAATLRGMSYHVFVVYAYAVAAIVLIPGPFISQRCRSRVLPP--LSFPLLRKIGLL  85

Query  321   ALLSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGT  500
              L+  A Q + Y GI +SSPTL+SA+++L+PAFTF+ A++  ME + ++  +  AK +GT
Sbjct  86    GLIGCASQIVGYTGISFSSPTLSSAISNLVPAFTFLLAIIFRMEKVIVRNTTCQAKVLGT  145

Query  501   IVLITGAFVITFYKGPPLLLFQ------HAYYNSLLPQQSNWILGSFILVTSSLFISMLF  662
             IV ITGAFV+TFYKGPP+++        H   N+L     +W +G  +L    + + + +
Sbjct  146   IVSITGAFVVTFYKGPPIIIVHTPSLSLHQPINTLNSVDRSWAIGGLLLTAEYILVPLWY  205

Query  663   LVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIM  842
             +VQ  I+K YP EL +       V+I++AI A+  E N  AWK+  D  L +I  + I  
Sbjct  206   IVQVQIMKVYPNELTVIFFYNLCVSIMAAIVAIFTETNAGAWKIGLDTALASIVCSGIFG  265

Query  843   VGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYT  1022
                 + V+ W +R KGPV+VAMF PL +  AV +GV FL D L+ GS++GA++I++GFYT
Sbjct  266   SFVNNAVHTWVLRIKGPVYVAMFKPLSIAIAVALGVMFLGDTLHLGSLVGATVISIGFYT  325

Query  1023  VMWGKAMEVKENIETNIDN-----SNEKVPLLPPNKGDS  1124
             VMWGKA E  EN++ ++       + E VPLL   K D+
Sbjct  326   VMWGKATE--ENVDEDVPGQQSPPTTENVPLLQSYKTDT  362



>ref|XP_004304597.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=356

 Score =   241 bits (614),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 135/328 (41%), Positives = 204/328 (62%), Gaps = 10/328 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +T++K A ++GMS+F+F++Y NAL  L L P  I       P  L+F +  R  +  L+ 
Sbjct  27    STISKAAMSKGMSHFVFIVYYNALGTLLLFPYFIFQRNKRAP--LSFKLIYRFFLLGLIG  84

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              +G+ L + G++YSSPTL++A+A+L P FTF+ AV+  ME L+L++ S  AKS+GTI+ +
Sbjct  85    SSGKILFFAGVKYSSPTLSAALANLTPIFTFLLAVIFRMEKLNLRQTSGQAKSLGTIISV  144

Query  513   TGAFVITFYKGPPLLL--FQHAYYNS--LLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              GA ++TFYKGP +L+   +HA + +  +  Q S W+ G  +L    +  S   + QA  
Sbjct  145   GGALIVTFYKGPAVLMASLKHAGFKNQHIHSQHSAWVFGGLLLAIQCVVSSSWNIAQAAT  204

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             +KDYP ++ +       +TI  ++ ++  E +N +AWKL P +E++AI Y AI +  FR 
Sbjct  205   VKDYPEKMTIVFFYTLFLTIQCSVISLFVEWKNPSAWKLEPGIEMVAIVYAAIFVSVFRI  264

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
              V+ W + KKGPV+VAMF PLG+  AV M V FL D LY GSVIG+ +I+LGFYTV+W +
Sbjct  265   GVHVWCLHKKGPVYVAMFKPLGIAIAVAMVVIFLGDTLYLGSVIGSVVISLGFYTVIWAQ  324

Query  1038  AMEVKENIETNIDNSN---EKVPLLPPN  1112
               E K   +  I  S    ++ PLLP N
Sbjct  325   IKEKKAVPDNEIQRSESSIQRAPLLPSN  352



>ref|XP_007044590.1| Auxin-induced protein 5NG4, putative [Theobroma cacao]
 gb|EOY00422.1| Auxin-induced protein 5NG4, putative [Theobroma cacao]
Length=354

 Score =   240 bits (613),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 202/321 (63%), Gaps = 6/321 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L K A + G++ ++ ++YSN L+ L LLP + ++HR M  P+ +  ++  I + AL+   
Sbjct  23    LTKAAMSSGVNKYVLIVYSNVLSSLILLPCSFIFHRSMHLPLNSSNLYRLIFLLALIGCV  82

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
             GQ   Y GI+YSSP LA+AM +L+PAFTFI A++  ME L  +  SS +K +GT++ ITG
Sbjct  83    GQLCGYAGIQYSSPALATAMLNLVPAFTFILAIICRMEKLKWRSISSQSKVLGTVISITG  142

Query  519   AFVITFYKGPPLLLFQHAY---YNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AFV+T YKGP +L  Q      +  L   Q NW+LG  +L   +L  S  +++Q  +LK 
Sbjct  143   AFVVTLYKGPTILSTQSLVVLPHQLLSSPQLNWVLGGLLLAAEALINSAWYIIQTLVLKK  202

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             +P  L +    C    ILS I ++I  R+ +AWKLRP + L+AI Y+AII   FR  + +
Sbjct  203   FPAVLTVMFYLCFFNAILSTIYSLILVRDPSAWKLRPGIGLVAILYSAIIATTFRISLCS  262

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME-  1046
             W + K GP++V+MF PL ++ A + G+ FL D +  GS+IGA II +GFY V+WGKA E 
Sbjct  263   WCLWKVGPLYVSMFKPLAVIFAAVTGIVFLGDAVSLGSLIGAVIIVIGFYAVLWGKANEE  322

Query  1047  -VKE-NIETNIDNSNEKVPLL  1103
              VKE N   +++  +EK+PLL
Sbjct  323   NVKEDNGVESLNPPSEKLPLL  343



>ref|XP_011071065.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Sesamum 
indicum]
Length=357

 Score =   240 bits (613),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 137/321 (43%), Positives = 199/321 (62%), Gaps = 6/321 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K A   GM+N+ FV YSNALA L LLP ++L HR    P L+F +        +L   
Sbjct  28    ISKRAMATGMTNYTFVAYSNALAALILLPLSLLVHRSSNRPPLSFLLVSGFFSLGVLGCL  87

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI Y+S   ASAM +LIP FTFI AV+  ME ++ +  S LAK+ GT+V I G
Sbjct  88    AQLTGYTGINYTSAEFASAMLNLIPGFTFILAVIFRMEKVACRSSSFLAKATGTVVSIAG  147

Query  519   AFVITFYKGPPLLLFQHA---YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AFV+T YKGP ++  Q +   +Y  +   Q +WILG   L    +  S   +VQA ILK+
Sbjct  148   AFVVTLYKGPQIMTRQASSKLHYEHMEIPQLSWILGGLFLTVDCVVSSGFIIVQASILKN  207

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP EL++    C    ILS + ++I +R+++AW L+P++ LIA+ Y+ I    F+  V  
Sbjct  208   YPAELIIVFFYCFFAAILSTVVSLIVDRDLSAWALQPNIRLIAVLYSGIFGSAFQVSVTT  267

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + ++GP+FVAMF PL +V A ++G  FL D LY GS++G+ II +GFY+VMWGKA EV
Sbjct  268   WCLHRRGPLFVAMFHPLSIVIAAVLGTIFLGDVLYLGSLVGSIIIVMGFYSVMWGKAKEV  327

Query  1050  K---ENIETNIDNSNEKVPLL  1103
             +    ++  + ++++EK PLL
Sbjct  328   EVIGNDLTRSCESTSEKAPLL  348



>ref|XP_010100500.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB82634.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=354

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 136/322 (42%), Positives = 191/322 (59%), Gaps = 5/322 (2%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAGQ  344
             K A + G + FI V+YSN ++ L LLP +  YHR    P +T  +FGR  + AL   +GQ
Sbjct  29    KTAMSHGTNKFIMVVYSNTISSLILLPCSFFYHR-SNRPSMTSSLFGRFFLLALFGCSGQ  87

Query  345   TLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAF  524
                Y+GIEYSSPTL + M +LIPAFTFI AV+  ME L  +  SS AK +GTI+ + GAF
Sbjct  88    IFGYVGIEYSSPTLGTTMFNLIPAFTFILAVIFRMETLYWRSSSSQAKILGTIMSMIGAF  147

Query  525   VITFYKGPPL---LLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYP  695
             V+ FYKGPP+   L   +     L    S+WILG F L +     S+ ++VQA   K YP
Sbjct  148   VVIFYKGPPVVKRLPISNLSNQLLFSSHSHWILGGFFLASDCFVSSLWYIVQASTQKKYP  207

Query  696   GELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWA  875
               L+  +   +L  ++SAI A+I  ++ +AWKL+ DM L++I + AI+    R  +  W 
Sbjct  208   AVLLAVLYQISLSAVMSAIFALIVVKDASAWKLKLDMGLVSILHTAIVSTVIRYSLITWC  267

Query  876   VRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKE  1055
             V K G  + AMF PLG++  V MG  FL +  Y GS+IGA+II  GFY VM GKA + +E
Sbjct  268   VSKAGAFYCAMFKPLGIIFTVFMGAIFLGESFYLGSLIGATIIVTGFYVVMRGKAKD-QE  326

Query  1056  NIETNIDNSNEKVPLLPPNKGD  1121
              ++++  + +   PLL     D
Sbjct  327   KVDSSESSLDHNSPLLLNKAQD  348



>ref|XP_010425589.1| PREDICTED: WAT1-related protein At5g40210-like isoform X1 [Camelina 
sativa]
 ref|XP_010425590.1| PREDICTED: WAT1-related protein At5g40210-like isoform X2 [Camelina 
sativa]
Length=362

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/329 (43%), Positives = 208/329 (63%), Gaps = 14/329 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K A+++GMS+++F++YS  +  L LLPS  + HR    P L F +  ++ +  LL 
Sbjct  27    NTLFKAASSKGMSSYVFLVYSYGIGALLLLPSPFITHRSRSLPPLKFSVLCKMGLLGLLG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  L Y GI+YSSPTLASAM++L PAFTFIFA++ GME +S+++ SS+AK +GTIV I
Sbjct  87    CVYLMLGYTGIKYSSPTLASAMSNLTPAFTFIFAILFGMEKVSMRKNSSVAKVVGTIVSI  146

Query  513   TGAFVITFYKGPPLLLF-QHAYY-------NSLLPQQSNWILGSFILVTSSLFISMLFLV  668
              GA V T Y GP +    Q + Y           P  +NW++G  +L      I++ +++
Sbjct  147   VGALVATLYHGPIIFTASQPSVYLPQPLTPPPSSPSNTNWVIGGGLLALEYTLIAVSYII  206

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAER-NVNAWKLRPDMELIAICYNAII-M  842
             Q  I+++YP E  L +     V++  A  ++ AE+ N +AW +R  + LI I    ++  
Sbjct  207   QTHIMREYPSEFALALSHNVCVSVSCAFVSLFAEKNNPSAWIMRSKIMLICIIATGMVNS  266

Query  843   VGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYT  1022
              G+  VV +W VR KGPVF+AMF PL ++ AV++G  FL D LY GSVIG ++I++GFYT
Sbjct  267   TGY--VVESWTVRHKGPVFLAMFRPLAILTAVVLGAIFLGDSLYLGSVIGGTLISIGFYT  324

Query  1023  VMWGKAMEVKENIETNIDNS--NEKVPLL  1103
             VMWGKA E K +IETN+  S  ++++PLL
Sbjct  325   VMWGKAKEEKADIETNVATSSNSKRIPLL  353



>ref|XP_002517375.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF44917.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=419

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/331 (43%), Positives = 209/331 (63%), Gaps = 6/331 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT  GM+  +F++Y+ A+A L LLP+  +  R    P L+F I  +I +  ++ 
Sbjct  89    NTLYKAATLEGMNYHVFIVYAYAIAALVLLPAPFISSRSRMLPPLSFSILCKIGLLGVIG  148

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              + Q L Y GI YSSPTL+SA+++L PAFTFI A++  ME +SL++RSS AK +GTIV I
Sbjct  149   SSSQILGYTGINYSSPTLSSAISNLTPAFTFILAIIFRMERVSLRKRSSQAKVLGTIVSI  208

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQS---NWILGSFILVTSSLFISMLFLVQAWIL  683
              GAFV+T YKGP + +    +     P +S   NWILG   L    + + + ++VQ  I+
Sbjct  209   AGAFVVTLYKGPLIFIASSPFIALDQPPRSSNPNWILGGIFLTAEYILVPLWYIVQTQIM  268

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             K+YP E+ +       V+ ++A+ A+I+E   +AW +RP + L +I  + +      + V
Sbjct  269   KEYPAEMTVVFFYNLTVSFIAAVVALISEGPSSAWVVRPGIALASIVCSGLFGSCLNNTV  328

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+  KGPVFVAMF PL +  AV MGV FL D L+ GS+IGA+II++GFYTVMWGKA 
Sbjct  329   HTWALHLKGPVFVAMFKPLSIAIAVAMGVMFLGDALHLGSLIGATIISIGFYTVMWGKAK  388

Query  1044  E--VKENIETNIDN-SNEKVPLLPPNKGDSV  1127
             E  +++   +++ + S +KVPLL   K + V
Sbjct  389   EEVIEDYGGSSLQSPSAQKVPLLQSYKDELV  419



>ref|XP_010043809.1| PREDICTED: WAT1-related protein At4g15540-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010043810.1| PREDICTED: WAT1-related protein At4g15540-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW85807.1| hypothetical protein EUGRSUZ_B02553 [Eucalyptus grandis]
Length=364

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 142/327 (43%), Positives = 205/327 (63%), Gaps = 14/327 (4%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPST-ILYHRLMPPPVLTFGIFGRICITALLSYAG  341
             K+A + G++ +    Y NAL+ L LLP   I+  R    P LTF +  +I + AL+  A 
Sbjct  31    KMAMSDGLNKYTLAFYCNALSSLVLLPCPFIISRRSGSCPPLTFTVLRKIFLLALVGSAS  90

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
             Q   Y GI+YSSP L +AM +LIPAFTFI AV++ ME ++ K  SS AK +GT+  I GA
Sbjct  91    QICGYAGIDYSSPVLGTAMMNLIPAFTFILAVISRMEKVNWKSSSSQAKLVGTVASILGA  150

Query  522   FVITFYKGPPLLL------FQHAYY-NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              VIT YKGP +L       F H  +  SLL +Q NW+LG F+L   +  +S+ F++QA+I
Sbjct  151   LVITVYKGPTVLRSPSLPSFVHPRHLVSLLSRQLNWVLGGFLLAAEAFLLSLWFIMQAFI  210

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             LKDYP  L +        TI S + ++I  R   +W L+ D+ LIAI Y++++   FR  
Sbjct  211   LKDYPVVLNIMFYLMFFATIFSGLLSIIMVREPQSWTLKLDVGLIAILYSSLVAGVFRVT  270

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             +  W ++K GPVFV+MF PLG+V AV +G  FL + L+ GS+IGA++IA+GFY VMWGK+
Sbjct  271   LCTWCLKKTGPVFVSMFKPLGIVFAVGLGFIFLGEKLHLGSLIGAAVIAMGFYAVMWGKS  330

Query  1041  MEVKENIET------NIDNSNEKVPLL  1103
              E ++ IE       ++ +S++K+PLL
Sbjct  331   REEEKIIEDSGGADGSLASSSQKIPLL  357



>ref|XP_011025493.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Populus 
euphratica]
 ref|XP_011025501.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Populus 
euphratica]
 ref|XP_011025509.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Populus 
euphratica]
 ref|XP_011025517.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Populus 
euphratica]
Length=403

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 147/379 (39%), Positives = 199/379 (53%), Gaps = 58/379 (15%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L+K A + GM+NFIFVLYSNALA L LLPS+   HR   PP LTF I     +  L  + 
Sbjct  25    LSKAAMSDGMTNFIFVLYSNALASLILLPSSFFLHRSERPP-LTFPILCGFFLLGLFGWL  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI  SS TL +AM +LIP  TFI AV   ME L  +  S+L KS GT+V + G
Sbjct  84    AQIFGYAGINLSSATLGTAMLNLIPGLTFILAVAFRMEKLDWRSSSALVKSTGTVVSVAG  143

Query  519   AFVITFYKGPPLLLFQHAYY--NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             AF++ +YKGPPLL+        + LL QQ NWI+G  +L    +  S   ++QA ILK Y
Sbjct  144   AFIVCYYKGPPLLMAPSTSNLPHELLSQQQNWIIGGLLLAVDCVMASAWLIIQALILKKY  203

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P EL++    C  VTILS I  +  ER+  AW L+P +  IA+ Y+ +    F+  +  W
Sbjct  204   PAELIVVFFYCFSVTILSTIVCLFMERDPGAWSLKPTVRWIAVVYSGVFGSAFQVGISTW  263

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTG------------------------  980
              + K GPVFVAMF PLG+V A  +    LRD LY G                        
Sbjct  264   CLHKTGPVFVAMFKPLGIVIAAAVSTICLRDTLYLGRYIFFFCLKVVIGLIFYRAAKLVL  323

Query  981   ----------------------------SVIGASIIALGFYTVMWGKAMEVKENIETNI-  1073
                                         S++GA++I +GFY+VMWGKA E K  ++  + 
Sbjct  324   FLPCYIIFLSIIKRRHKDPSFTILVEIFSLVGATVIVIGFYSVMWGKAKEEKVGVDDGVR  383

Query  1074  --DNSNEKVPLLPPNKGDS  1124
               ++S++KVPLL  +  ++
Sbjct  384   SFESSSQKVPLLQSHTEET  402



>gb|KHG29548.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=348

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 146/334 (44%), Positives = 201/334 (60%), Gaps = 22/334 (7%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPV-LTFGIFGRICITALL  329
             +TL+K A ++GMS+F+ V+YSNALA L LLP+   + R   PP+ L+F     +C    L
Sbjct  27    STLSKAAMSKGMSHFVLVVYSNALASLILLPAAFFFTRKKRPPITLSF-----LCKIFCL  81

Query  330   SYAGQTLQY----IGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIG  497
             S AG TL       G+ YSSPTLASA+A+LIPAFTF+ AV+  ME L LK   S  K +G
Sbjct  82    SIAGITLMQNCVITGVSYSSPTLASALANLIPAFTFLLAVIFRMEKLELKSPKSQIKVLG  141

Query  498   TIVLITGAFVITFYKGPPLLL-----FQHAYYNSLLPQQSNWILGSFILVTSSLFISMLF  662
             T+V I+GA ++T YKGPP+L        H   +++L   +NW++G   + T+SL +S   
Sbjct  142   TLVSISGALIMTLYKGPPVLSPPIQPHLHPSPSTMLTTSNNWLIGGLFIATASLSLSANI  201

Query  663   LVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIM  842
             + QA +LK YP E+ L    C   TI SA+  +I ER+ NAW L PD+ELI++ Y+A+  
Sbjct  202   VGQAAVLKGYPSEITLVSFYCLFGTIQSALVTLIFERDPNAWMLSPDIELISVVYSALFG  261

Query  843   VGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYT  1022
                   V AW +R+KGPVFVAMF PL +  A  +G  FL + LY GS++GA+II  GFY 
Sbjct  262   NVVTFGVQAWCIRRKGPVFVAMFKPLSIAIAAFLGFIFLGETLYIGSIVGAAIIVTGFYG  321

Query  1023  VMWGKAMEVKENIETNIDNSNEKVPLLPPNKGDS  1124
             V+W  A   KE +           PLL  +  D+
Sbjct  322   VIW--AQSDKEEV-----GKTTTTPLLDGHDADA  348



>ref|XP_004489873.1| PREDICTED: WAT1-related protein At3g28070-like isoform X1 [Cicer 
arietinum]
Length=343

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 191/315 (61%), Gaps = 6/315 (2%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAGQ  344
             KVA   GM+ ++ V+YS AL+ + LLP     HR   PP LTF       + AL   +GQ
Sbjct  29    KVAMKDGMNKYVMVVYSMALSSIMLLPLAFFIHRTDRPP-LTFSSLCSFFLLALFGTSGQ  87

Query  345   TLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAF  524
              + Y GIE SS TLASAM +LIPAFTF+ A++  MEIL+ +  SS AK IGTIV + GAF
Sbjct  88    IMTYAGIELSSATLASAMLNLIPAFTFVIALIFRMEILNWRHCSSQAKVIGTIVSMAGAF  147

Query  525   VITFYKGPPLLLFQHA-YYNSL-LPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPG  698
             V+ FYKGPP+     +  +N+L    Q NWI+G  +    SLF ++ ++ Q  + K YP 
Sbjct  148   VVIFYKGPPIFKIHSSNSFNTLQFSPQLNWIMGGLLCAGDSLFSAIWYIYQVSVTKKYPA  207

Query  699   ELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAV  878
              +++       + I S + A+I  R+ +AW+L+ DM LI I Y AI  +G R ++  W V
Sbjct  208   VIVIVFFQVFFIAIQSGVFALIVVRDPSAWELKLDMRLIVIFYQAIAAIGIRYLLQTWCV  267

Query  879   RKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKEN  1058
             ++ GP+F AMF P+G++  VIMG  FL +    GS+IGA II +GFY V WGKA E K +
Sbjct  268   QRAGPLFCAMFKPVGIIFTVIMGSIFLGEVFNLGSLIGAVIIVVGFYAVQWGKASEQKSH  327

Query  1059  IETNIDNSNEKVPLL  1103
                N D S+  VPLL
Sbjct  328   ---NFDTSSNVVPLL  339



>ref|XP_011034696.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Populus 
euphratica]
 ref|XP_011034697.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Populus 
euphratica]
 ref|XP_011034698.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Populus 
euphratica]
Length=355

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 143/328 (44%), Positives = 197/328 (60%), Gaps = 8/328 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L K A + GMS+F+FVLYSNA+A L LLPS  L+HR    P LT  I     +  L    
Sbjct  27    LGKAAMSNGMSSFVFVLYSNAIASLILLPS-FLFHRSSERPPLTLSIVSGFFLLGLFGCL  85

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
             GQ+  Y GI  SSPTL +AM +L+P  TF+ A++  ME +  K  S+LAKS+GT+V I G
Sbjct  86    GQSFCYAGINLSSPTLGTAMLNLVPGLTFMLAIIFRMENVDWKSYSTLAKSMGTVVSIGG  145

Query  519   AFVITFYKGPPLLLFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AF++T YKGP LL  + +   S   +L QQSNW+LG  ++V      S   +VQA ILK 
Sbjct  146   AFIVTCYKGPLLLKARPSVTKSSHQVLLQQSNWVLGGLLMVVDCATASSWLIVQALILKK  205

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             Y  +L++        TILS+I +++ ER+ +AW L  ++ LIA+ ++ I+   F   V A
Sbjct  206   YSAKLIVVFFHFFFSTILSSIVSVVMERDPSAWSLNSNIRLIAVLFSGILGNAFEIGVTA  265

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + K GPVFVA+F PLG+V A    V    D L  G V+GA+IIA+GFY V+WGKA E 
Sbjct  266   WCLHKTGPVFVAIFAPLGIVIAAAASVICFGDALDLGIVVGAAIIAIGFYAVIWGKAQEE  325

Query  1050  KENIETNID----NSNEKVPLLPPNKGD  1121
              + +E   +    +S++KVP L     D
Sbjct  326   IKKVEDKENCGSASSSQKVPFLQNRSND  353



>ref|XP_003553929.1| PREDICTED: WAT1-related protein At3g28050-like [Glycine max]
 gb|KHN23568.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=366

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 144/335 (43%), Positives = 202/335 (60%), Gaps = 14/335 (4%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHR--LMPPPVLTFGIFGRICITALL  329
             TL K AT +GM+N +F+ Y+ ALA + L+P T    R  ++P P L+F I  +I +  ++
Sbjct  29    TLFKAATLQGMNNHVFLAYAYALATIILIPITFFSRRSRVVPVPPLSFSIVSKIVLLGVI  88

Query  330   SYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVL  509
               + Q L Y GI YSSP LAS++ +L+PAFTFI AV+  ME L+ K RSS AK IG+I+ 
Sbjct  89    GSSSQVLGYAGISYSSPALASSIGNLVPAFTFILAVICRMEKLAAKSRSSQAKVIGSIIS  148

Query  510   ITGAFVITFYKGP---------PLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLF  662
             I GAFV+TFYKGP         PLLL Q    N L  +  +W +   +L+      S+ +
Sbjct  149   IAGAFVLTFYKGPSIINALTHLPLLLQQP--INFLKSEDESWAIAGILLIADYFLASVWY  206

Query  663   LVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIM  842
             +VQ  ILK +P EL          TILS      A  N +AWK+  D+ LI+I  + I  
Sbjct  207   IVQVDILKVFPDELTTVFFYNVTATILSTTVGFFAVPNASAWKIGLDISLISIVCSGIFG  266

Query  843   VGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYT  1022
                 +VVYAWA+  KGPV+V  F PL +V AV MGV FL D LY GSV+GA+I+++G Y 
Sbjct  267   KLMSNVVYAWALYLKGPVYVTSFKPLQIVIAVAMGVMFLDDSLYIGSVVGATIVSIGLYA  326

Query  1023  VMWGKAM-EVKENIETNIDNSNEKVPLLPPNKGDS  1124
             V+WGKA  E++E++ +    + E VPLL  ++ ++
Sbjct  327   VLWGKAKEEIEEDVGSQESPTIENVPLLQSHRTET  361



>ref|XP_009761505.1| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Nicotiana 
sylvestris]
Length=364

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 138/332 (42%), Positives = 202/332 (61%), Gaps = 16/332 (5%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRI-CITALLS  332
             TL K A   GMSN ++V+Y NAL    LLP  I +       ++T  I  R   +  L  
Sbjct  31    TLGKAAMNDGMSNLVYVVYYNALGTFLLLPFLIFHRCRSNMALITLSILWRFFLLGLLGI  90

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAG------MEILSLKERSSLAKSI  494
                Q L Y GI+YSSPTLA+A+ +L+P FTF+  ++        ME L +++ SS AKS+
Sbjct  91    CLLQVLAYTGIKYSSPTLAAALGNLLPGFTFLLTIIFSLFAIFRMEKLDIRKASSQAKSL  150

Query  495   GTIVLITGAFVITFYKGPPLL----LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLF  662
             GTIV I GA ++T YKGP +L    L   + ++SL  Q+SNW+LG  ++  + +  S   
Sbjct  151   GTIVAIIGASIMTLYKGPRVLGSSNLHSDSSHHSLFSQESNWLLGGLLITITCIMSSGWN  210

Query  663   LVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIM  842
             ++Q   +K YP ++ +   TC   +I  AI  ++ ERN  AW ++P + +IAI ++A+  
Sbjct  211   VLQTDTVKKYPEQMTIVFFTCCFGSIQCAILTLVLERNPEAWMVKPGIGMIAIVFSAVSG  270

Query  843   VGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYT  1022
               FR  V  W + KKGP++VAMF PLGMV A I+G+ FL + L+ GSVIGA II+ GFY+
Sbjct  271   SVFRYNVLTWCLDKKGPLYVAMFKPLGMVIAAILGILFLTESLHLGSVIGAVIISAGFYS  330

Query  1023  VMWGKAMEVK-----ENIETNIDNSNEKVPLL  1103
             V+WGKA E+K     E+I + ID+S+++ PLL
Sbjct  331   VLWGKAKEIKSMLEIEDIVSGIDSSSQRSPLL  362



>ref|XP_010031130.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010031131.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW50393.1| hypothetical protein EUGRSUZ_J00147 [Eucalyptus grandis]
Length=357

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 135/329 (41%), Positives = 205/329 (62%), Gaps = 8/329 (2%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL K AT+RG+S+ +F++Y+ A+++L LLP+  + +R    P L+  I  +I +  L+  
Sbjct  30    TLFKAATSRGLSHHVFLVYACAVSVLVLLPAPFMSYRSRALPPLSLAILAKIGLLGLIGG  89

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             + Q + Y GI +SSPTL SA+ +L PA TFI A++  ME +SLK  SS AK IGTI+ I+
Sbjct  90    SSQIMGYTGISFSSPTLGSALGNLTPALTFILAIIFRMEKVSLKRSSSQAKIIGTILSIS  149

Query  516   GAFVITFYKGPPLLLFQHAYYNSLLP----QQSNWILGSFILVTSSLFISMLFLVQAWIL  683
             GAF IT YKGPP++     +  S  P      SNW+LG   L+   +   + +++ A ++
Sbjct  150   GAFFITLYKGPPIITAALKWSLSFDPLLSSSSSNWVLGGIFLMAEYILTPIFYIIMAQMM  209

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +DYP EL +       V  ++AI A+ AE + NAW++  D+ L ++  + I +   R+ V
Sbjct  210   EDYPAELTVPFFYNFFVCFIAAIVALAAEHDANAWRVS-DIGLASVICSGIFVQCLRNCV  268

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+R KGP++VAMF P+ +V A +MG  FL D L  GS+IGA II++GFYTV+WGKA 
Sbjct  269   HTWAIRLKGPLYVAMFKPVSVVIAFVMGFFFLGDALCLGSLIGAIIISIGFYTVLWGKAK  328

Query  1044  -EVKENIETNIDNS--NEKVPLLPPNKGD  1121
              E  E    ++  S  ++KVPLLP ++  
Sbjct  329   EETNEESPESVAQSPPSQKVPLLPKHQSH  357



>ref|XP_007044597.1| Nodulin MtN21 /EamA-like transporter family protein isoform 5 
[Theobroma cacao]
 gb|EOY00429.1| Nodulin MtN21 /EamA-like transporter family protein isoform 5 
[Theobroma cacao]
Length=248

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 163/248 (66%), Gaps = 5/248 (2%)
 Frame = +3

Query  396   MADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAFVITFYKGPPLLLFQHAY  575
             M +LIP  TF+FAV   ME L L   SS AKS+GTIV I GAFV+TFYKGP +L+     
Sbjct  1     MLNLIPGLTFLFAVAFRMEKLHLGSSSSQAKSLGTIVSIAGAFVVTFYKGPSILMSSSRA  60

Query  576   Y--NSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPGELMLTVITCALVTILSA  749
                +  L QQSNW+ G F+L    LF S   +VQA +LK +P EL++    C  VT+ SA
Sbjct  61    SSSHQFLLQQSNWVFGGFLLAADCLFASAWLIVQASVLKKFPAELIVVFYYCFFVTLQSA  120

Query  750   IAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMV  929
             I  ++ ER++++W  +PD+ L+A+ Y+A+    F+  V  W + + GPVFVAMF PLG+V
Sbjct  121   IVCLVMERDLSSWSFKPDVRLVAVLYSAVFGSAFQLGVSTWCLHRTGPVFVAMFKPLGIV  180

Query  930   AAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKENIETN---IDNSNEKVPL  1100
              +VIMGV FL D  Y GS++GA +I  GFY+VMWGKA E K ++      +++S++KVPL
Sbjct  181   ISVIMGVIFLGDTFYLGSLLGAIVIVAGFYSVMWGKAKEGKIDVYAQGMRLESSSQKVPL  240

Query  1101  LPPNKGDS  1124
             LP N G++
Sbjct  241   LPNNTGET  248



>ref|XP_006338541.1| PREDICTED: WAT1-related protein At5g40240-like [Solanum tuberosum]
Length=352

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/327 (43%), Positives = 204/327 (62%), Gaps = 12/327 (4%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPV-LTFGIFGRICITALLS  332
             TL K A   G++N ++V+Y NAL  LFLLP  I +HRL    V +T  I  R  +  LL 
Sbjct  25    TLGKAAMNDGLNNLVYVVYYNALGTLFLLPCLI-FHRLRSNMVPITLPILWRFFLLGLLG  83

Query  333   YA-GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVL  509
                 Q + + GI+YS+PTLA+A+ +L+P FTF+ A++  ME L +++ SS AKS+GTIV 
Sbjct  84    ICLVQAVAFTGIKYSTPTLAAALGNLMPGFTFLLAIIFRMEKLDIRKASSQAKSVGTIVA  143

Query  510   ITGAFVITFYKGPPLL----LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
             I GA ++T YKGP +L        +++  +LPQ+SNWILG  ++ T+ +  S   ++Q  
Sbjct  144   IIGASIMTLYKGPRVLGSNLPSDSSHHELVLPQESNWILGGLLITTTCIMSSGWNILQTD  203

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
              +K YP  + +   TC   +I  AI  +  E N   W ++P + +IAI ++A+    FR 
Sbjct  204   TVKKYPEHMTIVFFTCFFGSIQCAILTLALESNPKTWMVKPGIGMIAIVFSAVSGNVFRY  263

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
              V  W + KKGP++VAMF PLGMV + I+G+ FL D L+ GSVIGA II+ GFY+V+WGK
Sbjct  264   NVLTWCLDKKGPLYVAMFKPLGMVISAILGIIFLADPLHLGSVIGAVIISAGFYSVLWGK  323

Query  1038  AMEVKENIETN-----IDNSNEKVPLL  1103
             A E+K  +E +     ID++N+  PLL
Sbjct  324   AKEIKSVLEVDDIVCVIDSTNQTCPLL  350



>ref|NP_566831.1| nodulin MtN21-like transporter UMAMIT41 [Arabidopsis thaliana]
 sp|Q94JU2.1|WTR18_ARATH RecName: Full=WAT1-related protein At3g28050 [Arabidopsis thaliana]
 gb|AAK50076.1|AF372936_1 AT3g28050/MMG15_6 [Arabidopsis thaliana]
 gb|AAM91350.1| At3g28050/MMG15_6 [Arabidopsis thaliana]
 gb|AEE77395.1| nodulin MtN21-like transporter UMAMIT41 [Arabidopsis thaliana]
Length=367

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 140/340 (41%), Positives = 203/340 (60%), Gaps = 17/340 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +F++YS  LA L LLPS     R    P + F I  +I +  ++ 
Sbjct  27    NTLFKAATLKGMSFHVFIVYSYGLAALLLLPSLFCSFRSRTLPPMNFSILYKIVLLGIIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  + Y GI YSSPTLASA+++L PAFTF+ AVV  ME +S K  SS+AK +GT+V I
Sbjct  87    CCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAVVFRMESVSFKRTSSVAKMLGTVVSI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQS--NWILGSFILVTSSLFISMLFLVQAWILK  686
              GAF++T Y G P+++ +     SL  Q +  NWILG+  L      + + ++VQ  I++
Sbjct  147   GGAFIVTLYNG-PVVIAKSPPSVSLRSQSTNPNWILGAGFLAVEYFCVPLWYIVQTQIMR  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAERN-VNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +YP E  +       V+  +A+  +  E N + AWK++P++ L++I  + +      + +
Sbjct  206   EYPAEFTVVCFYSIGVSFWTALVTLFTEGNDLGAWKIKPNIALVSIVCSGLFGSCINNTI  265

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+R KGP+FVAMF PL +  AV MGV FLRD LY GS+IGA++I +GFYTVMWGKA 
Sbjct  266   HTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLRDSLYIGSLIGATVITIGFYTVMWGKAK  325

Query  1044  E---VKENIETNIDNSNE----------KVPLLPPNKGDS  1124
             E   V+++ + N + +NE          K PLL   K D 
Sbjct  326   EVALVEDDNKANHEEANEADLDSPSGSQKAPLLESYKNDE  365



>ref|XP_007224712.1| hypothetical protein PRUPE_ppa025053mg [Prunus persica]
 gb|EMJ25911.1| hypothetical protein PRUPE_ppa025053mg [Prunus persica]
Length=350

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 136/320 (43%), Positives = 187/320 (58%), Gaps = 5/320 (2%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             +NK A ++G + +I V+Y+N L+ L LLP  + +H     P LTF I  R  + AL    
Sbjct  23    VNKAAMSKGSNKYIMVVYANGLSTLILLPPALFFHYRSGRPPLTFSILCRFFMLALF---  79

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
             G    Y+GIEYSS TL +AM +LIPAFTF  A++  ME +  +  SS AK +GT   I G
Sbjct  80    GLIFGYVGIEYSSATLGTAMLNLIPAFTFTLAIIFRMEKVQWRSSSSKAKILGTTASIAG  139

Query  519   AFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPG  698
             AFV+TFYKG P++L   ++  +L   +SNW+LG   L   S   S+ +++QA  LK YP 
Sbjct  140   AFVVTFYKGQPIMLLPSSHPPNLFSSKSNWVLGGLFLAADSFSSSLWYILQASTLKKYPA  199

Query  699   ELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAV  878
              +++        TI SA+  +IA ++ +AW+LR DM LIA+ Y AI+ +  R  +  W V
Sbjct  200   VVVIVCFQSLFTTIQSALFTLIAVKDASAWELRLDMGLIAVLYTAIVSIVLRYTLTTWCV  259

Query  879   RKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK--  1052
              K G +F +MF PLG++  VIMG  FL D  Y GS++GA +I  GFY VMWGKA E K  
Sbjct  260   WKAGALFCSMFKPLGIIFGVIMGAIFLGDPFYFGSLVGALMIVTGFYAVMWGKAKEEKLV  319

Query  1053  ENIETNIDNSNEKVPLLPPN  1112
             E            VPLL  N
Sbjct  320   EGGSRWESLGQNNVPLLQNN  339



>ref|XP_004238690.2| PREDICTED: WAT1-related protein At1g21890-like [Solanum lycopersicum]
Length=707

 Score =   244 bits (624),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 139/323 (43%), Positives = 187/323 (58%), Gaps = 3/323 (1%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             + K A + GM+NF FV YSN LA L LLPS   Y    PP  L F +     +  +L  +
Sbjct  385   VGKKAMSAGMTNFTFVFYSNTLAALILLPSFFFYRSTRPP--LNFSLISEFFLLGVLGCS  442

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI Y+S + ASAM +LIP FTFI AV+  ME L  +  S+L KSIGTIV I G
Sbjct  443   AQLTGYTGINYTSASFASAMLNLIPGFTFILAVIFRMEKLDCRSTSTLIKSIGTIVSIAG  502

Query  519   AFVITFYKGPPLLLFQHAY-YNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYP  695
             AF  T YKGP +LL   +   N L  Q+++WI+G   LV   +  S+  +VQA +LK YP
Sbjct  503   AFTATLYKGPQILLTSSSKPQNYLHFQETDWIIGGLYLVVDCVVSSLYLIVQASVLKKYP  562

Query  696   GELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWA  875
              EL++    C   +ILS   ++  + N NAW L+P   L A+ Y+ I    F+  V  W 
Sbjct  563   VELIVVFFYCFFASILSVTVSLFMDNNSNAWLLQPGTRLFAVLYSGIFGSAFQVSVMFWC  622

Query  876   VRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKE  1055
             +R+KGP+FVAMF PLG+V A  +G+ FL D  Y GS++G+ +I +GFY VMWGK  E   
Sbjct  623   IRRKGPLFVAMFHPLGIVIAAALGIIFLGDIFYLGSLVGSIVIVVGFYAVMWGKTKEDMV  682

Query  1056  NIETNIDNSNEKVPLLPPNKGDS  1124
             + +    N N K PLL     ++
Sbjct  683   DEDKLTRNINSKAPLLEIKDAET  705


 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/323 (39%), Positives = 195/323 (60%), Gaps = 11/323 (3%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPSTILYHR-LMPP--PVLTFGIFGRICITALLSY  335
             K A + GM+ F +  YS+A + L L+P +   HR  +PP  P   +G F    +  +L +
Sbjct  27    KGAMSTGMTTFTYTFYSSAFSTLLLIPISFFLHRSAIPPLWPTFLYGFF----LLGILGF  82

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
               Q L  +G++YSSP L++A+  L P FTFI AV+  ME    K  S++AK+IGT+V I 
Sbjct  83    LMQVLGLLGLQYSSPLLSTAILQLCPGFTFILAVILRMETFEYKSLSTMAKTIGTLVAII  142

Query  516   GAFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYP  695
             GAFV T YKGP +  F     N++L   S W +G  + +  S+  S+  + QA++LK YP
Sbjct  143   GAFVATLYKGPQV--FGINPLNTILTTPSAWAIGGLLTMICSIIASLFIISQAFVLKKYP  200

Query  696   GELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWA  875
              EL+L +     VTIL A+ ++I ER++N+W L P   L+A+ Y+ +    F+  + +W 
Sbjct  201   AELILMLFYSCCVTILCAVFSLIVERDLNSWSLSPHSRLMAVVYSGLFGNVFQVCIGSWC  260

Query  876   VRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKE  1055
             VR+KGP+FV MF PLG+V A+   + F+ + ++ GS++G+ II +GFY+VMWG++ E  +
Sbjct  261   VRRKGPLFVVMFHPLGIVIAMAASI-FMGEIIHVGSLVGSIIIVIGFYSVMWGQSKEWTK  319

Query  1056  NIETNIDNSNEKVPLLPPNKGDS  1124
               E N+ ++N K+P L     D 
Sbjct  320   K-EKNLRSNNNKIPFLQDKNDDD  341



>ref|XP_004300887.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 150/351 (43%), Positives = 204/351 (58%), Gaps = 47/351 (13%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
              TL+K A +RGMS+F+FV+YSNALA L L+PS+ + HR   PP LTF I   +C   LLS
Sbjct  22    TTLSKAAMSRGMSHFVFVVYSNALATLILIPSSFIIHRNKRPP-LTFSI---LCKFFLLS  77

Query  333   YAG----QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGT  500
              AG    Q   + G+ YSSPTLASAM++L+PAFTF  AV+  ME L L+   S  K IGT
Sbjct  78    LAGITVMQNCVFTGVSYSSPTLASAMSNLVPAFTFFLAVIFRMEKLDLRNSRSQIKIIGT  137

Query  501   IVLITGAFVITFYKGPPLLLFQHAYYNSLLPQQSN----------------WILGSFILV  632
             +V I+GA V+T YKG PLL           P QS                 WI+G   L 
Sbjct  138   LVSISGALVVTLYKGAPLL---------STPVQSTPDSSPSNTSSSTSMNNWIIGGLFLA  188

Query  633   TSSLFISMLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMEL  812
             T+S  +++    QA ILK YP E+ +        TI   I ++  ERN +AW L+PD+EL
Sbjct  189   TASSCLAIWNTAQAAILKGYPSEMTIVSFYSLFGTIQCTILSLFFERNPSAWTLKPDIEL  248

Query  813   IAICYNAIIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIG  992
             ++I Y+AI        V  W +++KGPVFVAMF PLG+  A ++G  FL ++L+ GS+IG
Sbjct  249   VSIFYSAICGGVVTFSVQTWCIKEKGPVFVAMFKPLGIAIAAMLGAIFLGEELHVGSLIG  308

Query  993   ASIIALGFYTVMWGKAME-------VKENIETNIDN-------SNEKVPLL  1103
             A +I +GFY V+W ++ E        KE+ E+  D+       S++K PLL
Sbjct  309   AVVIVVGFYGVIWAQSKEEKGLDLKTKEDGESQEDDEVDRLHSSSQKKPLL  359



>ref|XP_002283377.1| PREDICTED: WAT1-related protein At3g28050-like [Vitis vinifera]
Length=362

 Score =   236 bits (601),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 143/336 (43%), Positives = 195/336 (58%), Gaps = 16/336 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
              TL+K A +RGM  F+FV+YSNA A L L   + ++ R   PP+     F  +C   LLS
Sbjct  27    TTLSKAAMSRGMDRFVFVVYSNAFASLILFSISFIFLRTKRPPLS----FSLLCKFFLLS  82

Query  333   YAG----QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGT  500
              AG    Q   + G+ Y SPTL SAM++LIPAFTF+ AV   +E L L+   SL K +GT
Sbjct  83    LAGITVMQNCVFTGVSYGSPTLGSAMSNLIPAFTFLLAVAFRLENLDLRSSRSLIKILGT  142

Query  501   IVLITGAFVITFYKGPPLL--LFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFL  665
             +V I+GA ++T YKGPP+   L +    +S   L    +NW++G      + L IS+  +
Sbjct  143   LVSISGALIVTLYKGPPIGAGLIKSPSISSNDHLQKTANNWVIGGLFFAMAGLSISVWNI  202

Query  666   VQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMV  845
              QA IL+ YP E+ +         I  A  A+IA ++ NAWKLRPD ELI I Y+A+   
Sbjct  203   FQAPILRRYPSEITIVSFFTLFGAIQCAAVALIAVKDSNAWKLRPDFELITIIYSAVFGG  262

Query  846   GFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTV  1025
                  V  W +++KGPVFVA+F PLG+  A IMGV FL D LY GSVIGA II  GFY V
Sbjct  263   VVSFCVQTWCIKRKGPVFVAIFKPLGIGIAAIMGVIFLGDTLYIGSVIGAIIIVTGFYGV  322

Query  1026  MWGKAMEVKENIETNID---NSNEKVPLLPPNKGDS  1124
             MW +  E ++     +D   +++EK PLL   + + 
Sbjct  323   MWAQTKEGEKGEAQEVDGLPSTSEKAPLLQSRRDEQ  358



>ref|XP_007216831.1| hypothetical protein PRUPE_ppa022659mg [Prunus persica]
 gb|EMJ18030.1| hypothetical protein PRUPE_ppa022659mg [Prunus persica]
Length=343

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 139/335 (41%), Positives = 204/335 (61%), Gaps = 13/335 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +T++K A +RGMS ++FV+YSNALA L LLP  I   +   P  LT  +     +  L+ 
Sbjct  12    STISKAAMSRGMSTYVFVVYSNALATLLLLPCFIFQKK---PVSLTLSLLSGFFLLGLIG  68

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              +   L Y GI YSSPT+ASAM +LIP +TF+ A++  ME L L+  SS AK +GTIV +
Sbjct  69    SSSLILAYNGINYSSPTVASAMGNLIPIYTFVLAIIFRMEKLDLRRSSSQAKLLGTIVSV  128

Query  513   TGAFVITFYKGPPLLLFQH-------AYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQ  671
             +GAFV+  YKG  +LLF+         + N ++ Q S WI G   L  S L  ++  +VQ
Sbjct  129   SGAFVVILYKGSAILLFKALSPSNFPPHQNLIITQHSKWIFGGLFLALSCLLAAIWNIVQ  188

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
             A I+ + P ++ +       VTI   I ++I ERN N+W LRP++E+IAI  +A+    F
Sbjct  189   ASIVNNCPSKVTIVFFYTFFVTIQCTIFSLIVERNPNSWTLRPNIEMIAIVCSAVFGSVF  248

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
             R  V+ W + +KGP+FVAMF PLG+  A +M V FL + L+ GSVIG+ I+A+GFY +MW
Sbjct  249   RIGVHTWCLHQKGPIFVAMFRPLGVAIAAVMVVIFLGEALHLGSVIGSVIVAIGFYAMMW  308

Query  1032  GKAME---VKENIETNIDNSNEKVPLLPPNKGDSV  1127
             G+  E   V EN   ++ +S ++ PLL     +++
Sbjct  309   GQIKEKSIVMENEVHSLASSTQQTPLLQCRTSENI  343



>gb|KCW87484.1| hypothetical protein EUGRSUZ_B03946 [Eucalyptus grandis]
Length=357

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 143/332 (43%), Positives = 202/332 (61%), Gaps = 14/332 (4%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPST-ILYHRLMPPPVLTFGIFGRICITALLSYAG  341
             K+A + G++ +    Y N L+ L LLP   I+  R    P L F +  +I + AL+  A 
Sbjct  29    KMAMSDGINKYTMAFYCNVLSSLVLLPCPFIISRRSGSCPPLAFPVLRKIFLLALVGCAS  88

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
             QT  Y+GIEYSSP L +AM +LIPAFTFI AV++ ME ++ K  SS AK +GTI  I GA
Sbjct  89    QTSGYVGIEYSSPVLGTAMMNLIPAFTFILAVISRMEKVNWKSSSSQAKLVGTIASILGA  148

Query  522   FVITFYKGPPLLLFQ-----HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILK  686
             FV+T YKGP  L+F       +    LL QQSNWILG F+L   +  IS+ ++VQA ILK
Sbjct  149   FVVTLYKGP--LIFSPSSPPASVQPGLLSQQSNWILGGFLLAAEAFLISLAYIVQAIILK  206

Query  687   DYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVY  866
             DYP  L +        TI S + + +  R   +W L+ D+ LIAI Y+A++   FR  + 
Sbjct  207   DYPVVLNIMFYGMFFQTIFSGLLSFVTVREPQSWILKVDLGLIAILYSALVANVFRITLS  266

Query  867   AWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME  1046
              W +++ GPV+V+MF PLG V AV +G  FL + L+ GS+IGA +I +GFY V+W K+ E
Sbjct  267   TWCLKRTGPVYVSMFQPLGTVFAVGLGFIFLGEKLHIGSLIGAIVIVMGFYGVVWAKSKE  326

Query  1047  VKENI-----ETNIDNSNEKVPLLPPNKGDSV  1127
              ++ I     E ++ +S++K+PLL  NK   V
Sbjct  327   EEKTIEGSGVEESLASSSDKIPLL-RNKASRV  357



>gb|KCW87483.1| hypothetical protein EUGRSUZ_B03945 [Eucalyptus grandis]
Length=349

 Score =   235 bits (599),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 147/335 (44%), Positives = 207/335 (62%), Gaps = 13/335 (4%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPS-TILYHRLMPPPVLTFGIFGRICITALLSY  335
             + K+A + GM+ +  V YSNAL+ L LLP   I+  R    P LTF +  +I + AL+  
Sbjct  16    VTKMAMSEGMNKYTMVFYSNALSSLVLLPCPLIISRRPGSCPPLTFSVLRKIFLIALIGL  75

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             A Q  +Y+G++YSSP L  AM +LIPAFTFI A+++ ME ++ K  SS AK +GTI  I 
Sbjct  76    ACQMCEYVGMDYSSPVLGMAMMNLIPAFTFILAIISRMEKVNWKSSSSQAKLVGTITSIL  135

Query  516   GAFVITFYKGPPLLLFQHAYYNS------LLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
             GAFV+T YKGPP+LL              LL +QSNWILG F+LV  +  IS+ F+ QA+
Sbjct  136   GAFVVTLYKGPPILLSPSPPPVQPRHPPFLLSRQSNWILGGFLLVAEAFLISLWFIGQAF  195

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             ILKDYP  + L   +    T+LS + + +  R    W L+ ++ LI+I Y+A++   FR+
Sbjct  196   ILKDYPVVMNLMFYSTFFSTVLSGLLSFVTVREPQFWILKVNIGLISILYSALVSGVFRA  255

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
              +  W ++K GPV+V+MF PLG+V A  +G  FL + LY GS+IGA +I +GFY VMWGK
Sbjct  256   SLCTWCLKKTGPVYVSMFKPLGVVFAAGLGFIFLGEMLYLGSIIGAIVIVMGFYGVMWGK  315

Query  1038  AMEVKENIE-----TNIDNSNEKVPLLPPNKGDSV  1127
             + E +  IE      ++ +S  K PLL  NK  SV
Sbjct  316   SKEEETTIEGSGVGESLASSVHKTPLL-QNKASSV  349



>emb|CBI34954.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/332 (42%), Positives = 204/332 (61%), Gaps = 21/332 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYH--RLMPPPVLTFGIFGRICITAL  326
             N L K AT+RGMS ++F++YS A+A L L P   +++  RL+ PP   F +  +IC    
Sbjct  12    NVLFKSATSRGMSVYVFIVYSYAVATLILFPLLFIFNGKRLLLPP-FKFSLLCKICSLGF  70

Query  327   LSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIV  506
             + +  + + Y GI+YSSPTLAS + +L PA TF+ A+   ME L+L+  SS AK  GTI 
Sbjct  71    IGFLAEIVAYKGIDYSSPTLASVIGNLTPALTFMLAIFFRMEKLALRSLSSWAKITGTIA  130

Query  507   LITGAFVITFYKG--------PPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLF  662
              I+GA ++  YKG        P   +  H   NS   QQ  W++G  +LV   L +S+ +
Sbjct  131   SISGALIVVLYKGLQLTSTSSPLQFISLHQPLNS---QQMKWVIGGLLLVAEDLLVSIWY  187

Query  663   LVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIM  842
             +VQA +++ YP EL++  ++   +TI+SA   +IAE+N++ W++  D+ L AI ++A   
Sbjct  188   IVQAQVMEVYPEELVVVFLSNLCLTIISAPVCLIAEKNLSVWRVELDIALAAIVFSAFWG  247

Query  843   VGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYT  1022
               F  VV  W VR KGPV+VAMF PL +V A  MGV FL D LY GS+IGA +I++GFY 
Sbjct  248   SAFGMVVPTWVVRLKGPVYVAMFNPLSIVIATAMGVMFLGDTLYLGSIIGAIVISIGFYI  307

Query  1023  VMWGKAMEVKENIET----NIDN-SNEKVPLL  1103
             V WGKA E  E IE     ++++ SN K+PLL
Sbjct  308   VTWGKAKE--ETIEDFGVGSLESLSNPKIPLL  337



>ref|XP_008230953.1| PREDICTED: uncharacterized protein LOC103330182 [Prunus mume]
Length=721

 Score =   244 bits (622),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 144/334 (43%), Positives = 203/334 (61%), Gaps = 19/334 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +T++KVA +RGMS+F+F++Y NAL  L LLP  I       P  L+F +  R  +  L+ 
Sbjct  28    STISKVAMSRGMSHFVFIVYYNALGTLMLLPYFIFQRNKRAP--LSFKLICRFFLLGLIG  85

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              +G+ L + G++ SSP+LA+AMA+L P FTF+ A++  ME L L++ +S AKS+GTIV +
Sbjct  86    SSGKILFFAGVKSSSPSLAAAMANLTPIFTFLLAIIFRMEKLDLRKPTSHAKSLGTIVSV  145

Query  513   TGAFVITFYKGPPLL--------LFQHA------YYNSLLPQQSNWILGSFILVTSSLFI  650
              GA ++T YKGP LL        L  H       +Y  LL Q+SNWI G  +L    L  
Sbjct  146   LGALIVTLYKGPALLKPSSSPSGLTHHQPRLSQQHYQPLLSQRSNWIFGGLLLAIQCLVS  205

Query  651   SMLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYN  830
             S   + QA  +KDYP E+ +       +T   ++ ++I ERN NAWKL+P +E+IAI Y 
Sbjct  206   STWNIAQADAVKDYPEEMTIVFFYTLFLTCQCSVISLIVERNPNAWKLKPGIEMIAIAYA  265

Query  831   AIIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIAL  1010
             A  +  FR  V+ W + KKGPV+VAMF PLG+  AV M V FL D LY GSVIG+ +IAL
Sbjct  266   AFFVSVFRIGVHVWCLHKKGPVYVAMFKPLGIAIAVAMVVLFLGDALYLGSVIGSFVIAL  325

Query  1011  GFYTVMWGKAMEVK---ENIETNIDNSNEKVPLL  1103
             GFYTV+  +  E +   +N    ++ S +  PLL
Sbjct  326   GFYTVICAQIKEKRMALDNGAQILEPSTQTTPLL  359


 Score =   219 bits (558),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 128/329 (39%), Positives = 196/329 (60%), Gaps = 6/329 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             N L K AT++G+S ++F++YSNA+A L LLP   ++ R    P     +  ++ +  L+ 
Sbjct  395   NVLFKAATSKGLSYYVFIVYSNAIATLVLLPLFFIFRR-TGLPSFNLSLLSKVFLLGLIG  453

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             +      Y G+ YSSPTL+SAM++L PAFTFI AV   ME L+L+  S+ AK +GT+V I
Sbjct  454   FLADICGYKGLNYSSPTLSSAMSNLTPAFTFILAVFFRMEKLALRSSSTQAKIMGTLVSI  513

Query  513   TGAFVITFYKGPPLLLFQHAYYNS----LLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
             +GA V+  YKGPP+L       +     L   + NW++G  +L    L  S  +++Q  +
Sbjct  514   SGALVVVLYKGPPILSTPPTVLSPPSAVLGTSEKNWVIGGLLLAVQYLLSSTWYILQTHV  573

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             +K YP E++L  +     TI+SA   +IAE N++AW+LRP + L+AI  +  +   F S+
Sbjct  574   MKTYPAEIVLVFLFNLCGTIISAPVCLIAESNLSAWRLRPGIALVAIICSGCLGSSFGSL  633

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             V+ W +  KGPVF+++F PL +  A    V FL D L  GSV+GA I+++GFY V+WGKA
Sbjct  634   VHTWGLHLKGPVFISIFKPLSIAIAAAFSVIFLGDALSLGSVVGAIILSVGFYAVIWGKA  693

Query  1041  MEVKENIETNIDNSNEKVPLLPPNKGDSV  1127
              E  E     +  +  K PLL  +K +++
Sbjct  694   KE-DEMSSRALPIAIGKTPLLESHKVENM  721



>gb|KDO82546.1| hypothetical protein CISIN_1g018663mg [Citrus sinensis]
 gb|KDO82547.1| hypothetical protein CISIN_1g018663mg [Citrus sinensis]
Length=233

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 155/224 (69%), Gaps = 5/224 (2%)
 Frame = +3

Query  447   MEILSLKERSSLAKSIGTIVLITGAFVITFYKGPPLLLFQHA--YYNSLLPQQSNWILGS  620
             ME L L+ +SSLAKSIGT+V I GA  +T YKGP L+    +   +N L   Q NWI+G 
Sbjct  1     MEKLDLRVQSSLAKSIGTMVSIAGALTVTLYKGPALVSMSSSSNLHNELRSPQKNWIIGG  60

Query  621   FILVTSSLFISMLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRP  800
              +L   S F+S+L++VQ  I+++YP ELM T I C  VTI S + A+IAERN N+W+L+P
Sbjct  61    LVLAAGSFFLSLLYIVQTSIIREYPEELMATFICCVFVTIQSTVVALIAERNPNSWRLKP  120

Query  801   DMELIAICYNAIIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTG  980
             D ELIAI  +A   V  RS+ + WA  KKGPV+V+M+ PLG+V A+IMGVT L D LY G
Sbjct  121   DTELIAIGCSAFFAVALRSLAHTWACHKKGPVYVSMYKPLGIVFAIIMGVTLLGDTLYLG  180

Query  981   SVIGASIIALGFYTVMWGKAMEVKENIETNID---NSNEKVPLL  1103
             SV+GA+I+A GFY+V+WG++ E K   + +ID   +S+ K PLL
Sbjct  181   SVVGATIVAFGFYSVIWGQSEEEKMIDDKDIDSLKSSSPKAPLL  224



>gb|AES96253.2| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=352

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 194/317 (61%), Gaps = 6/317 (2%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAGQ  344
             K A   GM+ ++ V+YS  L+ + LLP  +  +R   PP LTF       + AL+  + Q
Sbjct  34    KFAMKDGMNKYVMVVYSMGLSSILLLPLALFINRSQRPP-LTFSALWSFFLLALIGSSAQ  92

Query  345   TLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAF  524
              + Y GIE SSPTLASAM +LIPAFTF+ A++  ME +  +  SS AK+IGTIV + GAF
Sbjct  93    IMTYGGIELSSPTLASAMLNLIPAFTFVLALIFRMERIYWRHFSSQAKAIGTIVSMAGAF  152

Query  525   VITFYKGPPLLLFQHAY-YNSL-LPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPG  698
             V+  YKGPP+L    +  YN+L      NWILG F+    SL  SM ++ Q  + K YP 
Sbjct  153   VVILYKGPPILKIHSSISYNTLQFSPNLNWILGGFLCAGDSLLSSMWYIYQVSVTKKYPA  212

Query  699   ELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAV  878
              +++       +TI + + A+I  R+ +AW+L+ DM LI I Y A+  +G R  +  W+V
Sbjct  213   VIVIVFFQVVFITIQTGVYALIVVRDPSAWELKLDMGLIVILYQAVAAIGIRYFLQTWSV  272

Query  879   RKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME--VK  1052
             ++ GP+F AMF P+G++  V +G  FL DD Y GS+IGA II +GFY V WGKA E  V+
Sbjct  273   QRAGPLFCAMFKPIGIIFTVFLGSIFLGDDFYLGSLIGAVIIVVGFYAVQWGKASEEKVE  332

Query  1053  ENIETNIDNSNEKVPLL  1103
             + IE N++  +  VPLL
Sbjct  333   KGIE-NLETQSNVVPLL  348



>ref|XP_007227338.1| hypothetical protein PRUPE_ppa015719mg [Prunus persica]
 gb|EMJ28537.1| hypothetical protein PRUPE_ppa015719mg [Prunus persica]
Length=350

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 207/330 (63%), Gaps = 19/330 (6%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             LNK A   G+S ++  +YS ALA L +LP    ++R   PP L+F I  R+ + +L+  +
Sbjct  25    LNKEAMASGLSEYVLAVYSFALAALIILPFCFFFNRSERPP-LSFSIISRLFLLSLIGSS  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
             G  +   G+ Y+S TL +AM +LIPAFTFI A++  ME L+ +  SS AK+IGT+V ITG
Sbjct  84    GLLMGLAGLNYASATLNTAMLNLIPAFTFILALLFRMEKLNWRSSSSQAKTIGTVVSITG  143

Query  519   AFVITFYKGPPLLLFQHAYYNS----------LLPQQSNWILGSFILVTSSLFISMLFLV  668
             AFV+TFYKGP ++   HA  +S          L  ++S+W+LG  +L   S   S+ F+V
Sbjct  144   AFVVTFYKGPAVI---HARLSSAGTGLFSNLFLFSEKSHWVLGGLLLAADSFSTSLWFIV  200

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             QA ILK YP  L+     C  V I  A+ ++I  ++++AW+L+P++ L+A+ Y  I+ + 
Sbjct  201   QASILKKYPAVLITVFFYCFFVCIQCALVSLILVQDLSAWRLKPNIGLLAVLYYGIVGIS  260

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
             FR+ +  W +++ GPV+V+MF PL +V A ++ V FL   LY GS+IGA++I  G Y V+
Sbjct  261   FRTNMCTWCLQRTGPVYVSMFKPLAVVFADVIDVIFLGQALYLGSLIGAAVIISGLYVVI  320

Query  1029  WGKAMEVK--ENI---ETNIDNSNEKVPLL  1103
             WGK+ E K  EN    +  +++S E+VPLL
Sbjct  321   WGKSREEKLHENSGEGQNCLESSTERVPLL  350



>ref|XP_002279776.1| PREDICTED: WAT1-related protein At5g40230 [Vitis vinifera]
Length=359

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 141/332 (42%), Positives = 204/332 (61%), Gaps = 21/332 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYH--RLMPPPVLTFGIFGRICITAL  326
             N L K AT+RGMS ++F++YS A+A L L P   +++  RL+ PP   F +  +IC    
Sbjct  27    NVLFKSATSRGMSVYVFIVYSYAVATLILFPLLFIFNGKRLLLPP-FKFSLLCKICSLGF  85

Query  327   LSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIV  506
             + +  + + Y GI+YSSPTLAS + +L PA TF+ A+   ME L+L+  SS AK  GTI 
Sbjct  86    IGFLAEIVAYKGIDYSSPTLASVIGNLTPALTFMLAIFFRMEKLALRSLSSWAKITGTIA  145

Query  507   LITGAFVITFYKG--------PPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLF  662
              I+GA ++  YKG        P   +  H   NS   QQ  W++G  +LV   L +S+ +
Sbjct  146   SISGALIVVLYKGLQLTSTSSPLQFISLHQPLNS---QQMKWVIGGLLLVAEDLLVSIWY  202

Query  663   LVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIM  842
             +VQA +++ YP EL++  ++   +TI+SA   +IAE+N++ W++  D+ L AI ++A   
Sbjct  203   IVQAQVMEVYPEELVVVFLSNLCLTIISAPVCLIAEKNLSVWRVELDIALAAIVFSAFWG  262

Query  843   VGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYT  1022
               F  VV  W VR KGPV+VAMF PL +V A  MGV FL D LY GS+IGA +I++GFY 
Sbjct  263   SAFGMVVPTWVVRLKGPVYVAMFNPLSIVIATAMGVMFLGDTLYLGSIIGAIVISIGFYI  322

Query  1023  VMWGKAMEVKENIET----NIDN-SNEKVPLL  1103
             V WGKA E  E IE     ++++ SN K+PLL
Sbjct  323   VTWGKAKE--ETIEDFGVGSLESLSNPKIPLL  352



>ref|XP_010514518.1| PREDICTED: WAT1-related protein At3g28050-like [Camelina sativa]
Length=367

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 138/339 (41%), Positives = 201/339 (59%), Gaps = 17/339 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +F++YS  LA L LLPS     R    P + F I  +I +  ++ 
Sbjct  27    NTLFKAATLKGMSYHVFIVYSYGLAALLLLPSLFWSFRSRTLPPMNFSILYKIVLLGMIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  + Y GI YSSPTLASA+++L PAFTF+ AV+  ME +S K  SS+AK +GT+V I
Sbjct  87    CCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAVLFRMESVSFKRTSSVAKMLGTVVSI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQS--NWILGSFILVTSSLFISMLFLVQAWILK  686
              GAF++T Y G P+++       SL  Q +  NWILG+  L      + + ++VQ  I++
Sbjct  147   GGAFIVTLYNG-PMVIASSPPSVSLRSQSTNPNWILGAAFLSVEYFCVPLWYIVQTQIMR  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +YP E  +       V+  +A+  +  E  ++  WK++P++ L++I  + +      + +
Sbjct  206   EYPAEFTVVCFYSIGVSFWTALVTLFTEGSDLGVWKIKPNIALVSIVCSGLFGSCINNTI  265

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+R KGP+FVAMF PL +  AV MGV FLRD LY GSVIGA++I +GFYTVMWGKA 
Sbjct  266   HTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLRDSLYIGSVIGATVITMGFYTVMWGKAK  325

Query  1044  E---VKENIETNIDNSNE----------KVPLLPPNKGD  1121
             E   V+++ + N + +NE          K PLL   K D
Sbjct  326   EVAVVEDDKKANREQANEADLDSPSGSQKAPLLESYKND  364



>ref|XP_008221764.1| PREDICTED: WAT1-related protein At5g40240-like [Prunus mume]
Length=372

 Score =   233 bits (594),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 135/330 (41%), Positives = 205/330 (62%), Gaps = 15/330 (5%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             LNK A + G+S +  V+YSNAL+ L L PS+ ++HRL  PP L+F I     +   +  +
Sbjct  47    LNKEAMSSGLSEYTLVVYSNALSTLILTPSSFIFHRLERPP-LSFYIIFSFFLLGFIGTS  105

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q +   G+ Y+S +L +AM +LIPAFTFI A++  ME L+ +  SS AKS+G +V ITG
Sbjct  106   AQLMGLAGLNYASASLNTAMLNLIPAFTFILALIFRMEKLNWRSSSSQAKSVGAVVSITG  165

Query  519   AFVITFYKGPPLLLFQHAYYNS-------LLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
             AFV+TFYKGP ++   H   +S       L   +SNW+LG  +L   +   S+  ++QA 
Sbjct  166   AFVVTFYKGPAVI---HQRLSSDPLSGPFLFSPKSNWVLGGSLLAAEAFMSSLWIILQAL  222

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             ILK YP  L+L    C  VTI SA+A++I  ++++AW L+PD+ L A+ Y+A++    R+
Sbjct  223   ILKKYPAVLILVSFYCFFVTIQSALASLILVKDLSAWSLKPDIGLFAVLYSAVVGTALRT  282

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
                AW +++ G V+V+MF PL +V A ++ V FL   L+ GS++GA++I  GFY V+WGK
Sbjct  283   CAVAWCLQRTGAVYVSMFKPLAVVVADVIDVIFLGQALHLGSLVGAAVIITGFYAVIWGK  342

Query  1038  AMEVKENIETN----IDNSNEKVPLLPPNK  1115
             A E K + ++      ++S+E  PLL   K
Sbjct  343   AREEKLHEDSGEGQWSESSSESTPLLQSAK  372



>gb|AFK39191.1| unknown [Medicago truncatula]
Length=352

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 193/317 (61%), Gaps = 6/317 (2%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAGQ  344
             K A   GM+ ++ V+YS  L+ + LLP  +  +R   PP LTF       + AL+  + Q
Sbjct  34    KFAMKDGMNKYVMVVYSMGLSSILLLPLALFINRSQRPP-LTFSALWSFFLLALIGSSAQ  92

Query  345   TLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAF  524
              + Y GIE SSPTLASAM +LIPAFTF+ A++  ME +  +  SS AK+IGTIV + GAF
Sbjct  93    IMTYGGIELSSPTLASAMLNLIPAFTFVLALIFRMERIYWRHFSSQAKAIGTIVSMAGAF  152

Query  525   VITFYKGPPLLLFQHAY-YNSL-LPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPG  698
             V+  YKGPP+L    +  YN+L      NWILG F+    SL  SM ++ Q  + K YP 
Sbjct  153   VVILYKGPPILKIHSSISYNTLQFSPNLNWILGGFLCAGDSLLSSMWYIYQVSVTKKYPA  212

Query  699   ELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAV  878
              +++       +TI + + A+I  R+ +AW+L+ DM LI I Y A+  +G R  +  W+V
Sbjct  213   VIVIVFFQVVFITIQTGVYALIVVRDPSAWELKLDMGLIVILYQAVAAIGIRYFLQTWSV  272

Query  879   RKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME--VK  1052
             ++ GP+F AMF P+G++  V +G  F  DD Y GS+IGA II +GFY V WGKA E  V+
Sbjct  273   QRAGPLFCAMFKPIGIIFTVFLGSIFFGDDFYLGSLIGAVIIVVGFYAVQWGKASEEKVE  332

Query  1053  ENIETNIDNSNEKVPLL  1103
             + IE N++  +  VPLL
Sbjct  333   KGIE-NLETQSNVVPLL  348



>ref|XP_002875421.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51680.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=367

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 139/339 (41%), Positives = 201/339 (59%), Gaps = 17/339 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +F++YS  LA L LLPS     R    P + F I  +I +  ++ 
Sbjct  27    NTLFKAATLKGMSFHVFIVYSYGLAALLLLPSLFCSFRSRTLPPMNFSILYKIVLLGIIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  + Y GI YSSPTLASA+++L PAFTF+ AVV  ME +S K  SS+AK +GT+V I
Sbjct  87    CCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAVVFRMESVSFKRTSSVAKMLGTVVSI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQS--NWILGSFILVTSSLFISMLFLVQAWILK  686
              GAF++T Y G P+++       SL  Q +  NWILG+  L      + + ++VQ  I++
Sbjct  147   GGAFIVTLYNG-PVVIATSPPSVSLRSQSTNPNWILGAAFLSVEYFCVPLWYIVQTQIMR  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +YP E  +       V+  +A+  +  E  ++ AWK++P++ L++I  + +      + +
Sbjct  206   EYPAEFTVVCFYSIGVSFWTALVTLFTEGSDLGAWKIKPNIALVSIVCSGLFGSCINNTI  265

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+R KGP+FVAMF PL +  AV MGV FLRD LY GS+IGA +I +GFYTVMWGKA 
Sbjct  266   HTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLRDSLYIGSLIGAMVITIGFYTVMWGKAK  325

Query  1044  E---VKENIETNIDNSNE----------KVPLLPPNKGD  1121
             E   V+++ + N + +NE          K PLL   K D
Sbjct  326   EVALVEDDNKANHEEANEADLDSPSSSLKAPLLESYKND  364



>gb|KFK33720.1| hypothetical protein AALP_AA5G051200 [Arabis alpina]
Length=361

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 204/329 (62%), Gaps = 15/329 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K A+++GMS+++F++YS  +  L LLPS  + HR    P L F +  ++ +  LL 
Sbjct  27    NTLFKAASSKGMSSYVFLVYSYGIGALLLLPSPFITHRSRSLPPLKFSVLCKMGLLGLLG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  L Y GI+YSSPTLASAM++L PAFTF+FAV+ GME +S+K+ SS+AK +GT+V I
Sbjct  87    CVYLMLGYTGIKYSSPTLASAMSNLTPAFTFLFAVLFGMEKVSMKKNSSIAKVVGTVVSI  146

Query  513   TGAFVITFYKG--------PPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLV  668
              GA V T Y G        P L L Q        P  SNW++G  +L      I++ +++
Sbjct  147   IGALVATLYHGPIIFAASQPTLYLPQPLSPPPPPPSNSNWVIGGGLLALEYTLIAVSYII  206

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAER-NVNAWKLRPDMELIAICYNAII-M  842
             Q  I+++YP E  L +     V+I  A  ++ AE+ N  AW +R  + LI I    ++  
Sbjct  207   QTHIMREYPSEFALALSHNVCVSISCAFVSIFAEKNNPGAWIMRSKIMLICIVATGMVNS  266

Query  843   VGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYT  1022
              G+  VV +W VR KGP+F+AMF PL ++ AV++G T L D LY GSVIG ++I++GFYT
Sbjct  267   TGY--VVESWTVRHKGPLFLAMFRPLSILTAVLLGAT-LGDSLYLGSVIGGTLISIGFYT  323

Query  1023  VMWGKAMEVKENIETNIDNSN--EKVPLL  1103
             VMWGKA E K +I+T    S+  ++VPLL
Sbjct  324   VMWGKAKEEKVDIDTYASASSHPKRVPLL  352



>ref|XP_010320601.1| PREDICTED: WAT1-related protein At3g28050-like isoform X4 [Solanum 
lycopersicum]
Length=262

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 165/258 (64%), Gaps = 9/258 (3%)
 Frame = +3

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
             GQ   Y+GI YSSPTLA+AM +LIP FTFI A+   ME+++ K  SS AK+ GT V I G
Sbjct  7     GQICDYVGISYSSPTLATAMLNLIPGFTFILAITFRMEVINWKSWSSYAKAFGTFVSIGG  66

Query  519   AFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPG  698
             AFV+TFYKGPP++   + +  S    Q NWILG  IL   S+  S+ +++QA ILK Y  
Sbjct  67    AFVLTFYKGPPII---NQHLTSTFSSQQNWILGGVILACESMSTSLWYIIQASILKIYQE  123

Query  699   ELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAV  878
             E+++  + C  VTI+S + +++ ERN NAW +  D+ LIAI Y+ II + FRS +  W +
Sbjct  124   EMVIVCLYCFFVTIISTLISLVVERNTNAWIIYLDIRLIAILYSGIIGIAFRSCMTTWCL  183

Query  879   RKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV---  1049
             +K  P+FV+MF P  +V A+++G    RD  Y GS++G+    +GFY VMWGK  E    
Sbjct  184   KKTDPLFVSMFKPFAIVFAILIGTFCFRDAFYLGSLVGSVTTVIGFYAVMWGKTQEKYYE  243

Query  1050  KENIETNIDNSNEKVPLL  1103
               N+ET  +N+   VPLL
Sbjct  244   GNNLETLAENN---VPLL  258



>gb|AAM65952.1| nodulin MtN21-like protein [Arabidopsis thaliana]
Length=367

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 138/340 (41%), Positives = 202/340 (59%), Gaps = 17/340 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +F++YS  LA L LLPS     R    P + F I  +I +  ++ 
Sbjct  27    NTLFKAATLKGMSFHVFIVYSYGLAALLLLPSLFCSFRSRTLPPMNFSILYKIVLLGIIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  + Y GI YSSPTLASA+++L PAFTF+ AVV  M+ +S K  SS+AK +GT+V I
Sbjct  87    CCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAVVFRMDSVSFKRTSSVAKMLGTVVSI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQS--NWILGSFILVTSSLFISMLFLVQAWILK  686
              GAF++T Y G P+++ +     SL  Q +  NWILG+  L      + + ++VQ  I++
Sbjct  147   GGAFIVTLYNG-PVVIAKSPPSVSLRSQSTNPNWILGAGFLAVEYFCVPLWYIVQTQIMR  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAERN-VNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +YP E  +       V   +A+  +  E N + AWK++P++ L++I  + +      + +
Sbjct  206   EYPAEFTVICFYSIGVIFWTALVTLFTEGNDLGAWKIKPNIALVSIVCSGLFGSCINNTI  265

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+R KGP+FVAMF PL +  AV MGV FLRD LY GS+IGA++I +GFYTVMWGKA 
Sbjct  266   HTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLRDSLYIGSLIGATVITIGFYTVMWGKAK  325

Query  1044  E---VKENIETNIDNSNE----------KVPLLPPNKGDS  1124
             E   V+++ + N + +NE          + PLL   K D 
Sbjct  326   EVALVEDDNKANHEEANEADLDSPSGSQEAPLLESYKNDE  365



>ref|XP_008221768.1| PREDICTED: WAT1-related protein At3g28050-like [Prunus mume]
Length=350

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 138/330 (42%), Positives = 206/330 (62%), Gaps = 19/330 (6%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             LNK A   G+S ++  +YS ALA L LLP    ++R   PP L+F I  R+ + +L+  +
Sbjct  25    LNKEAMASGLSEYVLAVYSFALAALILLPFCFFFNRSERPP-LSFSIILRLFLLSLIGSS  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
             G  +   G+ Y+S TL +AM +LIPAFTFI A++  ME L+ K  SS AK+IGT+V ITG
Sbjct  84    GLLMGLAGLNYASATLNTAMLNLIPAFTFILALLFRMEKLNWKSSSSQAKTIGTVVSITG  143

Query  519   AFVITFYKGPPLLLFQHAYYNS----------LLPQQSNWILGSFILVTSSLFISMLFLV  668
             AFV+TFYKGP ++   HA  +S          L  ++S+W+LG  +L   S   S+ F+V
Sbjct  144   AFVVTFYKGPAVV---HARLSSAGTGLFSNLFLFSEKSHWVLGGLLLAADSFSTSLWFIV  200

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             QA ILK YP  L+     C  V I  A+ ++I  ++++AW+L+ ++ L+A+ Y  I+ + 
Sbjct  201   QASILKKYPAVLITVFFYCFFVCIQCALVSLILVQDLSAWRLKSNIALLAVLYYGIVGIS  260

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
             FR+ +  W +++ GPV+V+MF PL +V A ++ V FL   LY GS+IGA++I  G Y V+
Sbjct  261   FRTNMCTWCLQRTGPVYVSMFKPLAVVFADVIDVIFLGQALYLGSLIGAAVIISGLYVVI  320

Query  1029  WGKAMEVK--ENI---ETNIDNSNEKVPLL  1103
             WGKA E K  EN    +  +++S E+VPLL
Sbjct  321   WGKAREEKLHENSGEGQNCLESSTERVPLL  350



>ref|XP_010528266.1| PREDICTED: WAT1-related protein At5g40210-like [Tarenaya hassleriana]
Length=354

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 200/326 (61%), Gaps = 15/326 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTIL--YHRLMPPPVLTFGIFGRICITAL  326
             N L K AT++GMS+ +F++YS A+  L LLP T      RL+PP  L+F I  +I +  L
Sbjct  27    NVLFKAATSKGMSSSVFLVYSFAIGALLLLPFTFFSCRSRLLPP--LSFSILSKIGVLGL  84

Query  327   LSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIV  506
             L     TL Y G+  SSPTLASAM++L PAFTFI AV+  ME +++K+ SS+AK  GT+V
Sbjct  85    LGCLYNTLGYKGVRLSSPTLASAMSNLTPAFTFILAVIFRMEKVAIKKGSSMAKVAGTLV  144

Query  507   LITGAFVITFYKGPPLLLF----QHAYYNSLLPQQSN--WILGSFILVTSSLFISMLFLV  668
              I+GA V T Y GPP+ +      H      LP+ SN  W++G  +   S   +S+ ++V
Sbjct  145   CISGALVATLYHGPPVFVASQPSDHLRRTQPLPRSSNSDWVMGGGLSALSYTLVSVAYIV  204

Query  669   QAWILKDYPGELMLTVITCALVTILSA-IAAMIAERNVNAWKLRPDMELIAICYNAIIMV  845
             QA +L++YP E ++T    A  ++ SA I+    + N +AW ++  + L  I    I+  
Sbjct  205   QAQVLREYPSESIVTQFYAAFASMFSAWISCFTEKNNPSAWIIQSKLSLACIVAAGILNP  264

Query  846   GFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTV  1025
             G   ++++W VR KGPVFVAMF PL ++ AV+MG  FL D LY GS++G ++I+ GFYTV
Sbjct  265   G-NFLIHSWVVRCKGPVFVAMFRPLSILIAVVMGAIFLGDSLYLGSLVGGALISAGFYTV  323

Query  1026  MWGKAMEVKENIETNIDNSNEKVPLL  1103
             MWGKA E K   E    NS EK  +L
Sbjct  324   MWGKAKEDKAEAE---PNSPEKASIL  346



>ref|XP_010502812.1| PREDICTED: WAT1-related protein At3g28050 [Camelina sativa]
Length=367

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 201/339 (59%), Gaps = 17/339 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +F++YS  LA L LLPS     R    P + F I  +I +  ++ 
Sbjct  27    NTLFKAATLKGMSYHVFIVYSYGLAALLLLPSLFCSFRSRTLPPMNFSILYKIVLLGIIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  + Y GI YSSPTLASA+++L PAFTF+ AV+  ME +S K  SS+AK +GT+V I
Sbjct  87    CCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAVLFRMESVSFKRTSSVAKMLGTVVSI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQS--NWILGSFILVTSSLFISMLFLVQAWILK  686
              GAF++T Y G P+++       SL  Q +  NWILG+  L      + + ++VQ  I++
Sbjct  147   GGAFIVTLYNG-PVVIATSPPSVSLRSQSTNPNWILGAAFLSVEYFCVPLWYIVQTQIMR  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +YP E  +       V+  +A+  +  E  ++  WK++P++ L++I  + +      + +
Sbjct  206   EYPAEFTVVCFYSLGVSFWTALVTLFTEGSDLGVWKIKPNIALVSIVCSGLFGSCINNTI  265

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+R KGP+FVAMF PL +  AV MGV FLRD LY GS+IGA++I +GFYTVMWGKA 
Sbjct  266   HTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLRDSLYIGSLIGATVITMGFYTVMWGKAK  325

Query  1044  E---VKENIETNIDNSNE----------KVPLLPPNKGD  1121
             E   V+++ + N + +NE          K PLL   K D
Sbjct  326   EVGLVEDDKKANHEQANEADLDSPSGSQKAPLLESYKND  364



>ref|XP_009111588.1| PREDICTED: WAT1-related protein At3g28050-like [Brassica rapa]
Length=368

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 138/340 (41%), Positives = 197/340 (58%), Gaps = 18/340 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +F++YS  LA L LLPS     R    P + F I  +I +  L+ 
Sbjct  27    NTLFKAATLQGMSFHVFIVYSYGLAALLLLPSIFFSSRSRTLPPMNFSILYKIVVLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  + Y GI YSSPTLASA+++L PAFTF+ A++  ME +S K  SS+AK +GT+V I
Sbjct  87    CCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAILFRMESVSFKRISSVAKMLGTVVSI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQS--NWILGSFILVTSSLFISMLFLVQAWILK  686
              GAF++T Y G PL++       SL  Q +  NWI+G+  L      + + ++VQ  I++
Sbjct  147   GGAFIVTLYNG-PLVISMSPPSVSLRSQSTNHNWIIGAAFLSVEYFMVPLWYIVQTQIMR  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +YP E  +       V+  + +  +  E  ++NAWK++P++ L++I  + +      + +
Sbjct  206   EYPSEFTVVCYYSLGVSFWTGLVTLFTEGSDLNAWKIKPNIALVSIVCSGVFGSCINNTI  265

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+R KGP+FVAMF PL +  AV MGV FL D LY GS+IGA++I  GFYTVMWGKA 
Sbjct  266   HTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLHDSLYIGSLIGATVITTGFYTVMWGKAK  325

Query  1044  EV----KENIETNIDNSNE----------KVPLLPPNKGD  1121
             E      +N   N D +NE          K PLL   K D
Sbjct  326   EAAMVEDDNKANNEDATNEADHDSPLASQKAPLLESYKND  365



>ref|XP_008230644.1| PREDICTED: WAT1-related protein At5g40240-like [Prunus mume]
Length=360

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 138/335 (41%), Positives = 202/335 (60%), Gaps = 13/335 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +T+ K A +RGMS ++FV+YSNALA L LLP  I   +   P  LT  +     +  L+ 
Sbjct  29    STITKAAMSRGMSTYVFVVYSNALATLLLLPCFIFQKK---PVSLTLSLLSGFFLLGLIG  85

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              +   L Y GI YSSPT+ASAM +LIP +TF+ A++  ME L L   SS AK +GTIV +
Sbjct  86    SSSLILAYNGINYSSPTVASAMGNLIPIYTFVLAIIFRMEKLDLWRSSSQAKLLGTIVSV  145

Query  513   TGAFVITFYKGPPLLLFQH-------AYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQ  671
             +GAFV+  YKG P+L F+         + N ++ Q + WI G   L  S L  ++  +VQ
Sbjct  146   SGAFVVILYKGSPILKFKALSPSNFPPHQNLIISQHTKWIFGGLFLALSCLLAAIWNIVQ  205

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
             A I+ + P ++ +       VTI   I ++I ERN N+W LRP++E+IAI  +A+    F
Sbjct  206   ASIVNNCPSKVTIVFFYTFFVTIQCTIFSLIVERNPNSWTLRPNIEMIAIVCSAVFGSVF  265

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
             R  V+ W + +KGP+FVAMF PLG+  A +M V FL + L+ GSVIG+ I+A+GFY +MW
Sbjct  266   RIGVHTWCLHQKGPIFVAMFRPLGVAIAAVMVVIFLGEALHLGSVIGSVIVAIGFYAMMW  325

Query  1032  GKAME---VKENIETNIDNSNEKVPLLPPNKGDSV  1127
             G+  E   V EN   ++ +S ++ PLL     +++
Sbjct  326   GQIKEKSIVMENEVHSLASSTQQTPLLQCRTSENI  360



>ref|XP_009599993.1| PREDICTED: WAT1-related protein At3g28050-like [Nicotiana tomentosiformis]
Length=359

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 144/330 (44%), Positives = 206/330 (62%), Gaps = 17/330 (5%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRL---MPPPVLTFGIFGRI-CITA  323
             TL K A   GMSN ++V+Y NAL  L LLP  I +HR    M P  +T  I  R   +  
Sbjct  31    TLGKAAMNDGMSNLVYVVYYNALGTLLLLPFLI-FHRCRSNMAP--ITLSILWRFFLLGL  87

Query  324   LLSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTI  503
             L     Q L Y GI+YSSPTLA+A+ +L+P FTF+ A++  ME L +++ SS AKS+GTI
Sbjct  88    LGICLLQVLAYTGIKYSSPTLAAALGNLMPGFTFLLAIIFRMEKLDIRKASSQAKSLGTI  147

Query  504   VLITGAFVITFYKGPPLL-----LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLV  668
             V I GA ++T YKGP LL         ++++SLL Q+SNW+LG  ++  + +  S   ++
Sbjct  148   VAIIGASIMTLYKGPKLLGSSTLPSHSSHHHSLLSQESNWLLGGLLITITCIMSSGWNIL  207

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             Q   +K YP ++ +   TC   +I  AI  ++ ERN  AW ++P + +IAI ++A+    
Sbjct  208   QTDTVKKYPEQMTIVFFTCCFGSIQCAILTLVLERNPEAWMVKPGIGIIAIVFSAVSGSV  267

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
             FR  V  W + KKGP++VAMF PLGMV A I+G+ FL + L+ GSVIGA II+ GFY+V+
Sbjct  268   FRYNVLTWCLDKKGPLYVAMFKPLGMVIAAILGILFLAESLHLGSVIGAVIISAGFYSVL  327

Query  1029  WGKAMEVKENIETN-----IDNSNEKVPLL  1103
             WGKA E+K  +E       ID+S+++ PLL
Sbjct  328   WGKAKEIKSMLEIEDTVCIIDSSSQRSPLL  357



>ref|XP_002303950.2| hypothetical protein POPTR_0003s19220g [Populus trichocarpa]
 gb|EEE78929.2| hypothetical protein POPTR_0003s19220g [Populus trichocarpa]
Length=355

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 191/321 (60%), Gaps = 7/321 (2%)
 Frame = +3

Query  162   NKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAG  341
              K A + GMS+F+FVLYSN +A + LLPS++++HR    P LT  I     +  L    G
Sbjct  27    GKAAMSNGMSSFVFVLYSNTIASIILLPSSLIFHRPQERPPLTLSIVFGFFLLGLFGCLG  86

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
             Q+  Y GI  SSP L +AM + +P  TF+ AV+  ME +  +  S+LAKS+GTI+ + GA
Sbjct  87    QSFGYAGINLSSPALGTAMLNTVPGLTFVLAVIFRMEKVDCRSYSTLAKSMGTIISMGGA  146

Query  522   FVITFYKGPPLLLFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             FV+T+YKGP LL    +  NS   +L Q SNW+LG  +L       S   +VQA ILK Y
Sbjct  147   FVVTYYKGPLLLKALPSASNSSHQVLSQHSNWVLGGLLLAVDCTMASSWLIVQALILKKY  206

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P +L++        T+LS+I  ++  ++ +AW L+ +  L+++ ++ I+   F+  V  W
Sbjct  207   PAKLIVVFFYFFFSTVLSSIVCLVMVKDPSAWSLKSNTRLVSVLFSGILGHAFQVGVTTW  266

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              ++K GPVFV++F PLG+V      V F  D L  G VIGA IIA GFY V+WGKA E  
Sbjct  267   CLQKTGPVFVSIFAPLGIVITATASVVFFGDALNLGIVIGAVIIASGFYAVIWGKAQEAT  326

Query  1053  ENIETNID----NSNEKVPLL  1103
             + +E        +S++KVPLL
Sbjct  327   KKVEDEESFGPASSSQKVPLL  347



>ref|XP_003608949.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES91146.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=353

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 141/325 (43%), Positives = 195/325 (60%), Gaps = 9/325 (3%)
 Frame = +3

Query  153   NTLNKVA-TTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALL  329
              TL+K A +T+GM++FIFVLYSNALA   LLPS  L +R   PP L+F +  +     L+
Sbjct  27    TTLSKEAMSTKGMNHFIFVLYSNALATFILLPSYFLINRTTRPP-LSFSLLAKFFFLGLV  85

Query  330   SYA-GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIV  506
                  Q   + GI YSSPTL SAM++L PA TF+ AV+  ME L      S  K +GT+V
Sbjct  86    GITIMQNCVFTGISYSSPTLGSAMSNLTPAITFVLAVIFRMEKLDAGSSISQIKIVGTVV  145

Query  507   LITGAFVITFYKGPPLLLFQ-----HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQ  671
              I+GA ++TFYKG P+   Q        + SLL + SNW++G   L T+SL +++  + Q
Sbjct  146   SISGALIVTFYKGAPISSIQTQPSTSQPFWSLLAETSNWVIGGLFLATASLSLAIWNIAQ  205

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
             A IL+ YP +L +    C   TI  A+ ++I  ++ NAW L  D+ELIAI Y+AI     
Sbjct  206   AEILRGYPSQLTIVAFYCLFGTIQCALLSLIVVKDPNAWNLSLDIELIAIIYSAIFGSAV  265

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
                V  W + +KGPVFV MF P+G+  A  M V FL + L+ GSVIGA +IA+GFYTVMW
Sbjct  266   TFSVLTWCIDRKGPVFVTMFKPVGIAIAAFMSVAFLGETLHVGSVIGALVIAIGFYTVMW  325

Query  1032  GKAMEVK-ENIETNIDNSNEKVPLL  1103
              ++ E   + +E +   S+   PLL
Sbjct  326   AQSKEKNVKGLEVDRLPSSSSAPLL  350



>ref|XP_011071067.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Sesamum 
indicum]
Length=349

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 196/321 (61%), Gaps = 14/321 (4%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K A   GM+N+ FV YSNALA L LLP ++L HR    P L+F +        +L   
Sbjct  28    ISKRAMATGMTNYTFVAYSNALAALILLPLSLLVHRSSNRPPLSFLLVSGFFSLGVLGCL  87

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y GI Y+S   ASAM +LIP FTFI AV+  ME ++ +  S LAK+ GT+V I G
Sbjct  88    AQLTGYTGINYTSAEFASAMLNLIPGFTFILAVIFRMEKVACRSSSFLAKATGTVVSIAG  147

Query  519   AFVITFYKGPPLLLFQHA---YYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             AFV+T YKGP ++  Q +   +Y  +   Q +WILG   L    +  S   +VQA ILK+
Sbjct  148   AFVVTLYKGPQIMTRQASSKLHYEHMEIPQLSWILGGLFLTVDCVVSSGFIIVQASILKN  207

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP EL++    C    ILS + ++I +R+++AW L+P++ LIA+ Y+          V  
Sbjct  208   YPAELIIVFFYCFFAAILSTVVSLIVDRDLSAWALQPNIRLIAVLYSV--------SVTT  259

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + ++GP+FVAMF PL +V A ++G  FL D LY GS++G+ II +GFY+VMWGKA EV
Sbjct  260   WCLHRRGPLFVAMFHPLSIVIAAVLGTIFLGDVLYLGSLVGSIIIVMGFYSVMWGKAKEV  319

Query  1050  K---ENIETNIDNSNEKVPLL  1103
             +    ++  + ++++EK PLL
Sbjct  320   EVIGNDLTRSCESTSEKAPLL  340



>ref|XP_006446450.1| hypothetical protein CICLE_v10017903mg [Citrus clementina]
 gb|ESR59690.1| hypothetical protein CICLE_v10017903mg [Citrus clementina]
Length=414

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 139/324 (43%), Positives = 196/324 (60%), Gaps = 10/324 (3%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL K A + GMSNF++V+Y NAL    LL   I        PVLTF +  +  +  +L  
Sbjct  90    TLGKAAMSSGMSNFVYVVYYNALGTFILLHYFIYNTYRSKGPVLTFSLLCKFFMLGVLGI  149

Query  336   A-GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q     GI+YSSPTLASAM +LIP  TF+ AV   ME ++++ RSS AK +GT+V I
Sbjct  150   CLVQIFAITGIKYSSPTLASAMGNLIPGITFLLAVFFRMEKVAIRSRSSQAKILGTVVSI  209

Query  513   TGAFVITFYKGPPLLLFQH-AYYNSLLP--QQSNWILGSFILVTSSLFISMLFLVQAWIL  683
              GAF+++ YKGPPLL F   +  N  LP  + SNW LG  +L  +    +   + QA +L
Sbjct  210   AGAFIVSLYKGPPLLGFSSPSNSNIQLPVSEYSNWALGGLLLTVTCFSSATWKIFQAAVL  269

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             K+YP ++ L   +C   TI  A+ ++I ERN +AWKL+P ++  A+ Y AI+    RS +
Sbjct  270   KEYPDKINLVFFSCFFGTIQCAVVSIIVERNPSAWKLQPGIQRTAVIYAAIVGTVIRSSI  329

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
              AW ++KKGPVFVA+F PLG   AV M V FL +  + GS+IGA +IA GFY V+W +  
Sbjct  330   IAWCLQKKGPVFVALFKPLGTAIAVFMAVMFLGETPHLGSLIGAVVIAFGFYAVIWAQGK  389

Query  1044  EVKENIET----NIDNSNEKVPLL  1103
             E   N+ T    ++++ N+K+P L
Sbjct  390   E--SNMTTGNVGSLESPNQKIPPL  411



>emb|CDX85184.1| BnaC07g24950D [Brassica napus]
Length=363

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 141/332 (42%), Positives = 207/332 (62%), Gaps = 19/332 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K A+++GMS+++F++YS  +  L LLPS  L HR    P L F +  ++ +  LL 
Sbjct  27    NTLFKAASSKGMSSYVFLVYSYGIGALLLLPSPFLAHRSRSLPPLKFSVLCKMGLLGLLG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  L Y GI+YSSPTLASAM++L PAFTFIFA++ GME +S+K+ SS AK +GT+V I
Sbjct  87    CVYLMLGYTGIKYSSPTLASAMSNLTPAFTFIFALLFGMEKVSIKKNSSFAKVVGTLVSI  146

Query  513   TGAFVITFYKGPPLLLF---QHAYY-------NSLLPQQSNWILGSFILVTSSLFISMLF  662
              GA V+T Y GP  ++F   Q + Y           P  SNW+ G  +L      I++ +
Sbjct  147   VGALVVTLYHGP--IIFAASQPSVYLPQPLSPPPSPPSNSNWVTGGCLLALEYTLIAISY  204

Query  663   LVQAWILKDYPGELMLTVITCALVTILSAIAAMIAER-NVNAWKLRPDMELIAICYNAII  839
             ++Q  I+++YP E  L +     V++  A  ++  E+ N +AW +R  + LI I    ++
Sbjct  205   IIQTHIMREYPSEFALALSHNICVSVSCASVSLFVEKNNPSAWIMRSSIMLICIVATGMV  264

Query  840   -MVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGF  1016
                G+  VV +W VR KGP+F+AMF PL ++ AV++G  FL D LY GSVIG ++I++GF
Sbjct  265   NSTGY--VVESWTVRHKGPLFLAMFRPLAILTAVVLGAIFLGDSLYLGSVIGGTLISIGF  322

Query  1017  YTVMWGKAMEVKENIETNIDNS---NEKVPLL  1103
             YTVMWGKA E K +I+T+   S   +++VPLL
Sbjct  323   YTVMWGKAKEEKSDIDTHHAASSSHSKRVPLL  354



>emb|CDP16602.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 139/328 (42%), Positives = 202/328 (62%), Gaps = 11/328 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +TL K A+ +GMS  +FV+YS  L  L L+P   ++HR  P P  T  +FGR+C+  +L 
Sbjct  12    STLFKAASDQGMSFMVFVVYSFGLCSLALIPIAFIFHRNTPLPRFTLPVFGRVCLLGVLG  71

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             +A Q L   G+EY SPTL+ A+++L+PAFTF  A++  ME L LK  +S AK +GT+V I
Sbjct  72    FAAQMLGCKGLEYGSPTLSYALSNLLPAFTFALAIIFRMEKLDLKSFTSQAKILGTLVSI  131

Query  513   TGAFVITFYKGPPLL--LFQHAYYNSL------LPQQSNWILGSFILVTSSLFISMLFLV  668
             +GA V+  YKG P++  +   + Y SL      +  QSNW LG  +L    L +S+ ++V
Sbjct  132   SGALVVVLYKGLPVIRVIRTSSQYQSLNQPVGLVSSQSNWALGGLLLALDYLVLSIWYIV  191

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             Q   +K YP E ++ +   A VTI+SA      E ++  W +   + LI++ Y AII  G
Sbjct  192   QTQTVKMYPAEFLVVLFYTAGVTIVSAPVCFFLEPDLKTWSISTTIMLISLLYAAIIGTG  251

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
             F +VV+ W ++ KGPV+VA+F PL +  A  MGV FL D LY GSVIGA +I++GFY V 
Sbjct  252   FGTVVHTWGLKVKGPVYVALFRPLSIAIAAFMGVVFLGDTLYLGSVIGAILISIGFYVVS  311

Query  1029  WGKAME--VKENIETNIDN-SNEKVPLL  1103
             WGKA E   ++     I++ ++E VPLL
Sbjct  312   WGKAQEEMSEDGGVLRIESAASENVPLL  339



>gb|KDO66260.1| hypothetical protein CISIN_1g019712mg [Citrus sinensis]
Length=337

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 138/324 (43%), Positives = 195/324 (60%), Gaps = 10/324 (3%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL K A + GMSNF++V+Y NAL    LL   I        PVLTF +  +  +  +L  
Sbjct  13    TLGKAAMSSGMSNFVYVVYYNALGTFILLHYFIYNTYRSKGPVLTFSLLCKFFMLGVLGI  72

Query  336   A-GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q     GI+YSSPTLASAM +LIP  TF+ AV   ME ++++ RSS AK +GT+V I
Sbjct  73    CLVQIFAITGIKYSSPTLASAMGNLIPGITFLLAVFFRMEKVAIRSRSSQAKILGTVVSI  132

Query  513   TGAFVITFYKGPPLLLFQH-AYYNSLLP--QQSNWILGSFILVTSSLFISMLFLVQAWIL  683
              GAF+++ YKGPPLL F   +  N  LP  + SNW LG  +L  +    +   + QA +L
Sbjct  133   AGAFIVSLYKGPPLLGFSSPSNSNIQLPVSEYSNWALGGLLLTVTCFSSATWKIFQAAVL  192

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             K+YP ++ L   +C   TI  A+ ++I ERN +AWKL+P ++  A+ Y AI+    RS +
Sbjct  193   KEYPDKINLVFFSCFFGTIQCAVVSIIVERNPSAWKLQPGIQRTAVIYAAIVGTVIRSSI  252

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
              AW ++KKGPVFVA+F PLG   AV M V FL +  + GS+IG  +IA GFY V+W +  
Sbjct  253   IAWCLQKKGPVFVALFKPLGTAIAVFMAVMFLGETPHLGSLIGTVVIAFGFYAVIWAQGK  312

Query  1044  EVKENIET----NIDNSNEKVPLL  1103
             E   N+ T    ++++ N+K+P L
Sbjct  313   E--SNMTTGNVGSLESLNQKIPPL  334



>ref|XP_010264833.1| PREDICTED: WAT1-related protein At4g15540-like [Nelumbo nucifera]
Length=414

 Score =   231 bits (590),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 145/335 (43%), Positives = 196/335 (59%), Gaps = 25/335 (7%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
              TL+K A ++GMS+F+FV+YSNALA L LL S I   +   P  L       +C   LL+
Sbjct  79    TTLSKAALSKGMSHFVFVVYSNALATLILLSSYIFLRKKRLPLTLPL-----LCKFFLLA  133

Query  333   YAG----QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGT  500
               G    Q+  Y GI YSSPTL SA+ +L+PA TFI AV+  ME L L+  SS  K +GT
Sbjct  134   LVGITVMQSCVYTGISYSSPTLGSAIGNLVPACTFILAVIFRMEKLDLRSWSSQVKIMGT  193

Query  501   IVLITGAFVITFYKGP-----------PLLLFQHAYYNSLLPQQSNWILGSFILVTSSLF  647
             +V I+GA V+T YKGP           P   F  +  NSL    +NWILG      +SL 
Sbjct  194   LVSISGALVVTLYKGPSIGTTLSSSQLPDKRFSSSPSNSL--TGNNWILGGVFFAVASLS  251

Query  648   ISMLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICY  827
             +S+   +QA I++ YP E  +    C   TI +A+ ++IAER+ N W L  D++LI++ Y
Sbjct  252   LSIWNTLQAAIVRGYPDETTIVSFYCLFGTIQTAVISLIAERDPNGWSLELDVKLISVVY  311

Query  828   NAIIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIA  1007
             +A+        V  W + KKGPVFVAMF PLG+  A +MGV FL D L+ GSV+GA IIA
Sbjct  312   SAVFGSVITPWVSTWCIEKKGPVFVAMFRPLGIAIAALMGVIFLGDTLHLGSVVGAIIIA  371

Query  1008  LGFYTVMWGKAMEVKENIETNIDN---SNEKVPLL  1103
              GFY V+WG++ E K   +  +D    S +K+P L
Sbjct  372   AGFYGVIWGQSKEEKNREDDKVDGFGASVDKIPFL  406



>gb|KDP45391.1| hypothetical protein JCGZ_09640 [Jatropha curcas]
Length=355

 Score =   229 bits (585),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 138/330 (42%), Positives = 209/330 (63%), Gaps = 9/330 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL   A ++ MS ++F++YS+A++ L LLP    ++R      +   +  RIC+ AL+ 
Sbjct  27    NTLLAAAWSQVMSYYVFIVYSHAISTLVLLPVPFSFYRAAAE--IKLPLLYRICVLALIG  84

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             + GQ +   G+EYSSPTL+SAM++L PAFTF FAV+  ME ++++  SS AK +GT+V I
Sbjct  85    FLGQIVGTKGLEYSSPTLSSAMSNLTPAFTFAFAVLFRMEKVAMRRSSSQAKIVGTMVSI  144

Query  513   TGAFVITFYKGPPLL-----LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
              GA V+ FYKGP +L         ++   L    S+WI+G  +L T  L  S+ +++QA 
Sbjct  145   GGALVVLFYKGPTILSTISPTNTISFRWPLGSAMSDWIIGGLLLATQCLLGSLWYIIQAE  204

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             ILK YP EL++T +  + VTI+SA    +AE N++AW L+P M L+AI Y+ I    + +
Sbjct  205   ILKIYPEELIVTFVYTSCVTIISAPVCFVAESNLDAWLLKPHMALLAILYSGIFAQSYST  264

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             V+++W +R KGP++V +F PL +  A  MGV FL D L+ G +IGA II++GFYTV+WGK
Sbjct  265   VIHSWGLRLKGPLYVTIFRPLSIAIAAFMGVLFLGDALHLGIIIGALIISMGFYTVIWGK  324

Query  1038  AMEVKENIETNIDN--SNEKVPLLPPNKGD  1121
             A E + + E +  +  S ++VP L     D
Sbjct  325   ANEERSSEEQDFSDLRSTQRVPFLQTPIND  354



>gb|KEH16737.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=364

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 139/333 (42%), Positives = 210/333 (63%), Gaps = 11/333 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTIL--YHRLMPPPVLTFGIFGRICITAL  326
             NTL K AT +GMS  +FV+Y+ A+A   LLP+  +    R++PP  L+  I  +I +  L
Sbjct  27    NTLFKAATVKGMSYHVFVVYAYAVAAFVLLPAPFISIRSRVLPP--LSKPILCKIGLLGL  84

Query  327   LSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIV  506
             +  + Q + Y GI +SSPTL+SA+++L+PAFTF+ A++  ME +++K  SS AK +GTIV
Sbjct  85    IGSSSQIMGYTGISFSSPTLSSAISNLVPAFTFLLAIIFRMEKVAIKSLSSQAKVVGTIV  144

Query  507   LITGAFVITFYKGPPLLLFQHAYYNSL---LPQQSN--WILGSFILVTSSLFISMLFLVQ  671
              I+GAF++T Y GPP+++   +  NSL   L   S+  W +G  +L    + + + ++VQ
Sbjct  145   SISGAFIVTLYIGPPIMIALRSS-NSLHQTLKSSSDQSWAIGGLLLTAEYILVPLWYIVQ  203

Query  672   AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGF  851
               I+K YP EL +       V+I++ I  +I+E N +AWK+  D  L +I  + I     
Sbjct  204   VQIMKVYPNELTVIFYYNLCVSIIAGIVGVISEPNASAWKIGFDTSLASILCSGIFGSFL  263

Query  852   RSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMW  1031
              + V+A+ +R KG V+VAMF PL +V AV MGV FL D L+ GS+IGA+II++GFYTVMW
Sbjct  264   NNTVHAYVLRIKGAVYVAMFKPLSIVIAVAMGVVFLGDTLHLGSLIGATIISIGFYTVMW  323

Query  1032  GKAM-EVKENIETNIDNSNEKVPLLPPNKGDSV  1127
             GKA  EV E++  +   + + VPLL   + D V
Sbjct  324   GKAKEEVVEDVSGHETQTTQNVPLLQSYETDRV  356



>ref|XP_002531393.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF30977.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=356

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/324 (40%), Positives = 202/324 (62%), Gaps = 13/324 (4%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             + K+A ++G++ ++ ++YS+AL+ L LLP + + HR    P L F +  +  + ++  + 
Sbjct  30    VTKLALSQGINKYVIIVYSDALSTLVLLPCSFIIHRSDRTP-LDFSLLCKFFLLSVFGWC  88

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q   Y+G++YSSPTL +AM +LIPAFTFI A++  +E L  + +SS+AKS+GTIV I G
Sbjct  89    AQICGYVGLQYSSPTLGTAMLNLIPAFTFILAIIFRLEKLDRRSKSSIAKSLGTIVSIAG  148

Query  519   AFVITFYKGPPLLLF------QHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
             AFV+TFY+GP +          H  ++S    Q  W++G+  L   +L  S  +++Q +I
Sbjct  149   AFVVTFYEGPTVFGIASHIKESHQLFHS---PQFFWMIGALFLAAEALMDSAWYILQTFI  205

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             LK +P  L++    C   T+LSAI A+I   + N+WK++P++ L  I Y A+I + FR  
Sbjct  206   LKKFPAVLIIICYLCFFNTVLSAIFALIVVEDRNSWKIKPNIGLATILYTAVIGLAFRIS  265

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             + AW + + GP++V +F PL ++ AVIM    L D L  GS+IGA II  GFY VMWGKA
Sbjct  266   LVAWCLSRTGPLYVTLFKPLAIIFAVIMDAIILGDPLCLGSLIGAIIIVTGFYWVMWGKA  325

Query  1041  MEVKENIETNI---DNSNEKVPLL  1103
              E K   ++ +   ++S++ VPLL
Sbjct  326   KEEKAGDDSAVGSCESSSDNVPLL  349



>gb|KHG27655.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=350

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 194/321 (60%), Gaps = 10/321 (3%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             + K A + G+  ++ ++YSNAL+ L LLP + ++HR +  P  +  +   I + +L+   
Sbjct  35    ITKAAMSSGVDKYVLIVYSNALSSLILLPCSFVFHRSVHLPWNSSNLCILIFLLSLIGCI  94

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
             GQ   Y GIEYSSP +A+AM +L+PAFTFI A+V  ME    +  SS AK +GT + I G
Sbjct  95    GQLCGYAGIEYSSPAMATAMLNLVPAFTFILAIVCRMEKHKWRSTSSQAKVLGTTISIAG  154

Query  519   AFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPG  698
             AFV+TFYKGP +L   H   +S    Q NWILG  +L   +   S  +++Q  +LK +P 
Sbjct  155   AFVVTFYKGPTILRLPHQLLSS---PQINWILGGLLLAVEAFINSAWYVIQTMVLKKFPA  211

Query  699   ELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAV  878
              L +    C    ILSAI ++   ++++AWKL+P++ L+AI Y+AI+   FR  + +W +
Sbjct  212   VLTVMFYLCFFNAILSAIYSLFLVKDLSAWKLKPNIGLVAILYSAIVATTFRISLCSWCL  271

Query  879   RKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKEN  1058
              K GP++V+MF PL  + A +MG+ FL DDL  G VIGA II  GFY V+WGKA E  E+
Sbjct  272   WKVGPLYVSMFKPLATIFAAVMGIVFLGDDLSLGRVIGAIIIVSGFYGVLWGKAKE--ES  329

Query  1059  IETNIDNSNEKVPLLPPNKGD  1121
              E ++     + PLL     D
Sbjct  330   GEESL-----RSPLLQNRTED  345



>gb|KDP31133.1| hypothetical protein JCGZ_11509 [Jatropha curcas]
Length=356

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/330 (41%), Positives = 190/330 (58%), Gaps = 17/330 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
              T++K A ++ MS+F+FV+YSN LA L + P    ++R   PP+     F  +C   LLS
Sbjct  29    TTISKAAMSKEMSHFVFVVYSNGLATLIMFPVAFFFNRTKRPPI----TFALLCKFFLLS  84

Query  333   YAG----QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGT  500
               G    Q   + GI YSSPTLASA+  LIPAFTF+ AV+  ME L L+   S  K + T
Sbjct  85    LVGITMMQNCVFTGISYSSPTLASALGQLIPAFTFVLAVIFRMEKLDLRSSKSQIKIMST  144

Query  501   IVLITGAFVITFYKGPPLLLFQHAYYNSLLPQQ-----SNWILGSFILVTSSLFISMLFL  665
             +V I+GA  I  YKG P+       +  L P       ++WI+G   + T+ L I++   
Sbjct  145   LVSISGALTIILYKGSPIGAKTLPPHPELHPSTFSAATNSWIIGGLFIATAGLCIAICNT  204

Query  666   VQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMV  845
              QA ILKDY   + L    C   TI  A+ +++AE+N NAWKL  D+EL++I Y+A+   
Sbjct  205   FQAAILKDYSSRMTLVFFYCLFGTIQCAMVSLVAEKNPNAWKLGHDIELLSILYSAVFGS  264

Query  846   GFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTV  1025
                S +  W ++KKGPVFVAMF PLG+  A  +GV FL D L+ GS+IGA II +GFY V
Sbjct  265   VVTSCIVTWCIQKKGPVFVAMFKPLGIAIAAFLGVIFLGDTLHVGSIIGAVIIVVGFYGV  324

Query  1026  MWGKAMEVKENIETNIDN-SNEKVPLLPPN  1112
             +W    E KE  +  +   + ++ PLL  +
Sbjct  325   IWA---ESKEEEQYKVHKVTEQRAPLLESH  351



>gb|EYU44714.1| hypothetical protein MIMGU_mgv1a008681mg [Erythranthe guttata]
Length=365

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 202/329 (61%), Gaps = 11/329 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL KVAT  GMS  +F++Y+  +A L LLPS     R    P LTF +  +I I  ++ 
Sbjct  36    NTLFKVATNSGMSRHVFLVYAYGVAALVLLPSPFFSRRSRVLPPLTFSVLWKIFILGVVG  95

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             Y  Q + Y GI Y SPTLASAM++L PAFTF+ AV+  ME ++L   SS AK IGTIV I
Sbjct  96    YTSQIMGYTGINYGSPTLASAMSNLAPAFTFVLAVIFRMEKVALSSTSSRAKIIGTIVSI  155

Query  513   TGAFVITFYKGP-----PLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
             +GAFV+TFYKGP     P+ L Q   Y+   P QSNW++GS  L      + + +++Q  
Sbjct  156   SGAFVVTFYKGPSVTAPPISLHQSLQYS---PSQSNWMIGSLFLSVEYFLVPVWYIIQTH  212

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I+K+YP EL +     + V+ L+AI +  AE +   W ++P + L ++  + +      +
Sbjct  213   IMKEYPAELTVIFFYTSCVSFLAAIVSFFAEPDSTKWIIKPSIALASVLCSGVFGCCINN  272

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
              ++AWA+  +GPV+VAMF PL +  A  MGV  L D LY GS+IGASIIA+GFYTV+WGK
Sbjct  273   AIHAWALHLRGPVYVAMFKPLSIAIAAAMGVIILGDTLYLGSIIGASIIAIGFYTVLWGK  332

Query  1038  AMEVKENIET---NIDNSNEKVPLLPPNK  1115
             A E    ++    +++++ +K PLL   K
Sbjct  333   AKEDFGEVDVDDRDMESAAQKYPLLQSYK  361



>ref|XP_009151897.1| PREDICTED: WAT1-related protein At5g40210 [Brassica rapa]
Length=363

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 138/330 (42%), Positives = 202/330 (61%), Gaps = 15/330 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K A+++GMS+++F++YS  +  L LLPS  L HR    P L F +  ++ +  LL 
Sbjct  27    NTLFKAASSKGMSSYVFLVYSYGIGALLLLPSPFLTHRSGSLPPLKFSVLCKMGLLGLLG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  L Y GI+YSSPTLASAM++L PAFTFIFA++ GME +S+K+ SS+AK +GTIV I
Sbjct  87    CVYLMLGYTGIKYSSPTLASAMSNLTPAFTFIFALLFGMEKVSIKKNSSIAKVVGTIVSI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYN--------SLLPQQSNWILGSFILVTSSLFISMLFLV  668
              GA V+T Y GP +        +           P  SNW++G  +L      I++ +++
Sbjct  147   VGALVVTLYHGPIIFAASQPSVHLPQPLSPPPSPPLNSNWVIGGCLLALEYTLIAISYII  206

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAII-M  842
             Q  I+++Y  E  L +     V++  A  ++  E  N +AW +R  + LI I    ++  
Sbjct  207   QTHIMREYASEFALALSHNICVSVSCAFVSLFVETNNPSAWIMRSSIMLICIVATGMVNS  266

Query  843   VGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYT  1022
              G+  VV +W VR KGP+F+AMF PL ++ AV++G  FL D LY GSVIG ++I++GFYT
Sbjct  267   TGY--VVESWTVRHKGPLFLAMFRPLAILTAVVLGAIFLGDSLYLGSVIGGTLISIGFYT  324

Query  1023  VMWGKAMEVKENIETNIDNS---NEKVPLL  1103
             VMWGKA E K  I+T+   S   +++VPLL
Sbjct  325   VMWGKAKEEKSEIDTHHAASSSHSKRVPLL  354



>gb|KDO82559.1| hypothetical protein CISIN_1g022220mg [Citrus sinensis]
Length=300

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 183/292 (63%), Gaps = 15/292 (5%)
 Frame = +3

Query  279   PVLTFGIFGRICITALLSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEIL  458
             P +T  +  +I + +L+S +     YIG++YSSPTL +AM +LIPAFTFI A++  ME L
Sbjct  8     PTVTTSVLWKIFLLSLISCSSDFSSYIGLQYSSPTLNTAMLNLIPAFTFILAIIFRMEKL  67

Query  459   SLKERSSLAKSIGTIVLITGAFVITFYKGPPLLL--FQHAYYNSLLPQQSNWILGSFILV  632
               + +SS AKS+GTIV I GAFV+TFYKGPP++      A  + + P QSNWILG F L 
Sbjct  68    KWRSKSSQAKSLGTIVSIAGAFVVTFYKGPPIVRPRLDIASLDQIQPLQSNWILGGFYLA  127

Query  633   TSSLFISMLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMEL  812
               ++ IS  +++QA  LK++P  +++        TIL+A+ ++     ++AWKLR D+ L
Sbjct  128   AQAILISAWYILQAITLKEFPALIVMLCYQYFFSTILAAMFSLTVVTELSAWKLRLDVGL  187

Query  813   IAICYNAIIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIG  992
              AI Y+A+I   F + +  W + + GP++V+MF PL ++ + +MGV    D L+ GS++G
Sbjct  188   FAIAYSAVIGAAFLTTLLLWCLMRAGPLYVSMFKPLAILFSTVMGVIIFGDGLFLGSLVG  247

Query  993   ASIIALGFYTVMWGKAMEVKENIETNIDN--------SNEKVPLLPPNKGDS  1124
             A II +GFY VMWGKA E     E  ID+        S+EKVPLL  +  D+
Sbjct  248   AVIIVIGFYVVMWGKAKE-----ENTIDDRGTWSSELSSEKVPLLQNSTEDT  294



>gb|KFK33719.1| hypothetical protein AALP_AA5G051100 [Arabis alpina]
Length=367

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 138/340 (41%), Positives = 201/340 (59%), Gaps = 17/340 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +F++YS  LA L LLPS     R  P P + F I  +I I  ++ 
Sbjct  27    NTLFKAATLQGMSFHVFIVYSYGLAALLLLPSLFFSFRSRPLPPMNFSILYKIVILGIIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  + Y GI YSSPTLASA+++L PAFTF+ AV+  ME  S K  SS+AK +GT+V I
Sbjct  87    CCSNVMGYTGINYSSPTLASAISNLTPAFTFLLAVIFRMESASFKRTSSVAKMLGTVVSI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQ--QSNWILGSFILVTSSLFISMLFLVQAWILK  686
              GAF++T Y GP ++        SL  Q    NWI+G+  L      + + ++VQ  I++
Sbjct  147   GGAFIVTLYNGPVVIAMSPPSI-SLRSQSPDHNWIVGAAFLSVEYFCVPLWYIVQTQIMR  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +YP E ++       V+  +AI  ++ E  +++ WK+ P++ L++I  + +      + +
Sbjct  206   EYPAEFIVVCYYSIGVSFWTAIVTLLTEGSDLSVWKIGPNIALVSIVCSGLFGSCINNTI  265

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+R KGP+FV+MF PL +  AV MGV FLRD LY GS+IGA++I +GFYTVMWGKA 
Sbjct  266   HTWALRIKGPLFVSMFKPLSIAIAVAMGVIFLRDSLYIGSIIGATVITIGFYTVMWGKAK  325

Query  1044  E---VKENIETNIDNSNE----------KVPLLPPNKGDS  1124
             E   V+++ + N + +NE          K PLL   K D 
Sbjct  326   EVAMVEDDKKANHEEANEADLDSPAGSHKTPLLESYKNDE  365



>ref|XP_010425588.1| PREDICTED: WAT1-related protein At3g28050-like [Camelina sativa]
Length=367

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 135/339 (40%), Positives = 200/339 (59%), Gaps = 17/339 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +F++YS  LA L LLPS     R    P + F I  +I +  ++ 
Sbjct  27    NTLFKAATLKGMSYHVFIVYSYGLAALLLLPSLFCSFRSRTLPPMNFSILYKIVLLGIIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  + Y GI YSSPTLASA+++L PAFTF+ AV+  ME +S K  SS+AK +GT+V I
Sbjct  87    CCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAVLFRMESVSFKRTSSVAKMLGTVVSI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQS--NWILGSFILVTSSLFISMLFLVQAWILK  686
              GAF++T Y G P+++       S+  Q +  NWILG+  L      + + ++VQ  I++
Sbjct  147   GGAFIVTLYNG-PVVIASSPPSVSIRSQSTNPNWILGAAFLSVEYFCVPLWYIVQTQIMR  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +YP E  +       V+  + +  +  E  ++  WK++P++ L++I  + +      + +
Sbjct  206   EYPAEFTVVCFYSLGVSFWTFLVTLFTEGSDLGVWKIKPNIALVSIVCSGLFGSCINNTI  265

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+R KGP+FVAMF PL +  AV MGV FLRD LY GS+IGA++I +GFYTVMWGKA 
Sbjct  266   HTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLRDSLYIGSLIGATVITMGFYTVMWGKAK  325

Query  1044  E---VKENIETNIDNSNE----------KVPLLPPNKGD  1121
             E   V+++ + N + +NE          K PLL   K D
Sbjct  326   EVALVEDDKKANHEQANEADLDSTSGSQKAPLLESYKND  364



>emb|CAN62735.1| hypothetical protein VITISV_027749 [Vitis vinifera]
Length=671

 Score =   236 bits (602),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 142/334 (43%), Positives = 200/334 (60%), Gaps = 31/334 (9%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RG++  +FV+Y+  +A L LLPS  + HR                      
Sbjct  360   NTLYKAATLRGLNYHVFVVYAYGIAALVLLPSPFITHRC---------------------  398

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              A QT+ Y GI  SSPTLASA+++L+PAFTFI AV+  ME L+L+  SS AK IGTIV I
Sbjct  399   -ASQTMGYRGINISSPTLASAISNLVPAFTFILAVIFRMEKLALRSSSSQAKIIGTIVSI  457

Query  513   TGAFVITFYKGPPLLLFQ------HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQA  674
             +GAFV+T YKGPP++L        H   + L   +S+WI+G+  L        + ++VQA
Sbjct  458   SGAFVVTLYKGPPIILTPSPSISLHQPPHPLRSSESSWIIGALFLSVEYFLTPVWYIVQA  517

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
              I+K+YP E  +       V++L+AI  ++ E N + W +RP + L +I  + I      
Sbjct  518   HIIKEYPSEPTVVFFYNLFVSLLAAIVGLVTEPNSSVWIVRPRIALASIVCSGIFGSFLG  577

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
             + ++ WA+R KGPV+VAMF PL ++ AV MGV  L D LY GSVIGA+II +GFYTVMWG
Sbjct  578   NTIHTWAIRMKGPVYVAMFKPLAIIIAVTMGVALLGDSLYLGSVIGATIITMGFYTVMWG  637

Query  1035  KAME--VKENIETNIDN-SNEKVPLLPPNKGDSV  1127
             KA E  V++    ++++ S +K PLL   K + +
Sbjct  638   KAQEDMVEDCTIGSLESPSAQKAPLLQNYKTEEI  671


 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 116/324 (36%), Positives = 172/324 (53%), Gaps = 63/324 (19%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             N L K AT+RGMS ++F++YS A+A L L P   +++                       
Sbjct  27    NVLFKSATSRGMSVYVFIVYSYAVATLILFPLLFIFN----------------------G  64

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             +  + + Y GI+YSSPTLAS + +L PA TF+ A+                         
Sbjct  65    FLAEIVAYKGIDYSSPTLASVIGNLTPALTFMLAI-------------------------  99

Query  513   TGAFVITFY--KGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILK  686
                    F+  K   + +        L  QQ  W++G  +LV   L +S+ ++VQA +++
Sbjct  100   -------FFRCKNCKIFMLLENQVEPLNSQQMKWVIGGLLLVAEDLLVSIWYIVQAQVME  152

Query  687   DYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVY  866
              YP EL++  ++   +TI+SA   +IAE+N++ W++  D+ L AI ++A     F  VV 
Sbjct  153   VYPEELVVVFLSNLCLTIISAPVCLIAEKNLSVWRVELDIALAAIVFSAFWGSAFGMVVP  212

Query  867   AWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME  1046
              W VR KGPV+VAMF PL +V A  MGV FL D LY GS+IGA +I++GFY V WGKA E
Sbjct  213   TWVVRLKGPVYVAMFNPLSIVIATAMGVMFLGDTLYLGSIIGAIVISIGFYIVTWGKAKE  272

Query  1047  VKENIET----NIDN-SNEKVPLL  1103
               E IE     ++++ SN K+PLL
Sbjct  273   --ETIEDFGVGSLESLSNPKIPLL  294



>ref|XP_004232283.1| PREDICTED: WAT1-related protein At5g40240-like [Solanum lycopersicum]
Length=355

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 136/327 (42%), Positives = 200/327 (61%), Gaps = 12/327 (4%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILY-HRLMPPPVLTFGIFGRICITALLS  332
             TL K A   G++N ++V+Y NAL  LFLLP  I + HR    P+ T  I  R  +  LL 
Sbjct  28    TLGKAAMNDGLNNLVYVVYYNALGTLFLLPCLIFHRHRSNMVPI-TLPILWRFFLLGLLG  86

Query  333   YA-GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVL  509
                 Q + + GI+YS+PTLA+A+ +L+P FTF+ A++  ME L + + SS AKS+GT+V 
Sbjct  87    ICLVQAVAFTGIKYSTPTLAAALGNLMPGFTFLLAIIFRMEKLDITKASSQAKSVGTVVA  146

Query  510   ITGAFVITFYKGPPLL----LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
             I GA ++T YKGP +L        +++  +L Q+SNWILG  ++ T+ +  S   ++Q  
Sbjct  147   IMGASIMTLYKGPRVLGSNLPSDSSHHELVLSQESNWILGGLLITTTCIMSSGWNILQTD  206

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
              +K YP  + +   TC   +I  AI  +  E N   W ++P + +IAI ++A+    FR 
Sbjct  207   TVKKYPEHMTIVFFTCFFGSIQCAILTLALESNPKTWMVKPGIGMIAIVFSAVSGSVFRY  266

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
              V  W + KKGP++VAMF PLGMV + I+G+ FL D L+ GSVIGA II  GFY+V+WGK
Sbjct  267   NVLTWCLDKKGPLYVAMFKPLGMVISAILGIIFLADPLHLGSVIGAVIITAGFYSVLWGK  326

Query  1038  AMEVK-----ENIETNIDNSNEKVPLL  1103
             A E+K     E+I   ID++++  PLL
Sbjct  327   AKEIKSMVEVEDIVCVIDSTDQTSPLL  353



>gb|KDP45389.1| hypothetical protein JCGZ_09638 [Jatropha curcas]
Length=353

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 140/326 (43%), Positives = 196/326 (60%), Gaps = 14/326 (4%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             T++K A ++GMS ++ V+YSNAL  L LLP  I Y +   P  +   +  R  +  L+  
Sbjct  28    TISKAALSQGMSKYVSVVYSNALGTLILLPYFIFYRKRRAP--INPSLLFRFFLLGLIGS  85

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
              GQ +    ++ SSPTL+SAMA+LIP FTF+ AV+  ME L L+  SS AK  G IV +T
Sbjct  86    TGQIIYLAAVKLSSPTLSSAMANLIPIFTFLLAVITRMETLDLRRSSSQAKLSGAIVSVT  145

Query  516   GAFVITFYKGPPLLLFQ----HAYYNSLLP---QQSNWILGSFILVTSSLFISMLFLVQA  674
             GA ++T YKGP + + Q    H+++  L P   Q+  WI G F+LV   L  +   + Q 
Sbjct  146   GASIVTLYKGPAIFMIQSLTSHSHHLQLQPLHSQKPEWIFGGFLLVIVCLLSATWTIAQG  205

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
               +K YP E+ +       +TI SA  ++I ERN NAW+L+  +E+IAI + A+    FR
Sbjct  206   ATVKQYPEEMTILFFFTLFITIQSAFFSLILERNPNAWRLKSAIEIIAIVFTAVFGSLFR  265

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
                + W + KKGP++VAMF PLG+  AV M VTFL + L  GSVIG+ IIALGFY+VMWG
Sbjct  266   IGFHTWCLGKKGPLYVAMFKPLGIAIAVFMTVTFLGETLCLGSVIGSIIIALGFYSVMWG  325

Query  1035  KAMEVKENIETNIDNSNEKVPLLPPN  1112
             +  E     + N   S++KVPLL  N
Sbjct  326   QMKE-----KNNEAFSSQKVPLLQRN  346



>ref|XP_006470391.1| PREDICTED: WAT1-related protein At5g40240-like [Citrus sinensis]
Length=347

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 133/323 (41%), Positives = 194/323 (60%), Gaps = 11/323 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPST--ILYHRLMPPPVLTFGIFGRICITAL  326
             N + K+AT++GMS F+FV YS A   L LL     I        P+  F +  RIC  +L
Sbjct  27    NIIFKLATSKGMSYFVFVFYSYAATTLVLLLLFPFIFRSNTASLPLFKFPVISRICFLSL  86

Query  327   LSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIV  506
             +    + L Y GI YSSPTLAS + +L P FTFI A++  ME L+L+  S+ AK IGT+V
Sbjct  87    VGSFFRILGYTGIAYSSPTLASMIGNLTPGFTFILAIIFRMENLALRSLSTWAKIIGTVV  146

Query  507   LITGAFVITFYKGPPLLLFQHAYYNSL--LPQ--QSNWILGSFILVTSSLFISMLFLVQA  674
              ++GA ++  YKGP ++        SL   PQ  QS W++G  +L+   + IS+ ++VQ 
Sbjct  147   SVSGAMLVVLYKGPTIMSTASIPAQSLQWTPQSTQSRWVIGGLLLLMEKMLISVWYIVQT  206

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
               +K YP E ++T++ C   TI+SA    + E N++AW+L+PD+EL +I Y+A   + F 
Sbjct  207   QTMKLYPAEFVVTLLYCLFATIISAPICFVGESNLSAWRLKPDIELASIVYSAFFGLSFI  266

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
             +VV+ + +R KGPV+ A+F PL +  A I    FL + L+ GSVIG  II +GFYTV+WG
Sbjct  267   TVVHTFGLRMKGPVYTAIFKPLSIAIAAITSFIFLGEGLHLGSVIGGVIICVGFYTVLWG  326

Query  1035  KAMEVKENIETNIDNSNEKVPLL  1103
             KA     N E   +  + K+PLL
Sbjct  327   KA-----NDEGGKNKDSCKIPLL  344



>ref|XP_002517371.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44913.1| conserved hypothetical protein [Ricinus communis]
Length=358

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 140/327 (43%), Positives = 197/327 (60%), Gaps = 12/327 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             +T++K A  +GMS ++ V+Y NALA L LLP  I + R   P  +T  +  R  +  L+ 
Sbjct  27    STISKAALAKGMSKYVSVVYYNALATLILLPYFIFHRRKQAP--VTHSLLFRFFLLGLIG  84

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
               GQ L    ++ SSPTL+SA+A+LIP FTF+ AV+  ME L ++  SS AKS+G IV +
Sbjct  85    STGQILFLAAVKLSSPTLSSALANLIPIFTFLLAVITRMETLDIRRSSSQAKSLGAIVSV  144

Query  513   TGAFVITFYKGPPLLLFQ-----HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
              GAFV+T YKGP +L+       H ++  L  Q+  WI G F+L+   L  +   + Q  
Sbjct  145   AGAFVVTLYKGPAVLMTTQTSNFHHHHQLLFSQKPEWIFGGFLLLIVCLLSATWNVAQGA  204

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
              +K+Y   + +       +TI SA+ ++I ERN NAW L+  +E+IAI + A+    FR 
Sbjct  205   TVKEYQEPMTIVFFFTFFITIQSAVFSLILERNPNAWILKSSIEIIAIVFTAVFGSIFRI  264

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG-  1034
              ++ W +RKKGPV+VAMF PLG+  AV M V FL D LY GSVIG+ IIALGFY+VMWG 
Sbjct  265   AIHTWCLRKKGPVYVAMFKPLGIAIAVFMTVVFLGDTLYLGSVIGSIIIALGFYSVMWGQ  324

Query  1035  ---KAMEVKENIETNIDNSNE-KVPLL  1103
                K M + +N E    NS+    PL+
Sbjct  325   MKEKKMGLNKNNEACCSNSSSLNAPLI  351



>emb|CDY04005.1| BnaC02g37200D [Brassica napus]
Length=367

 Score =   228 bits (581),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 137/340 (40%), Positives = 202/340 (59%), Gaps = 17/340 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GM   +F++YS  LA L LLPS    +R    P + F I  ++ +  L+ 
Sbjct  27    NTLFKAATLQGMGFHVFIVYSYGLAALLLLPSLFFSYRSRTLPPMNFSILYKVVLLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  + Y GI YSSPTLASA+++L PAFTF+ A++  ME +S K  SS+AK +GTIV I
Sbjct  87    CCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAILFRMESVSFKRTSSVAKMLGTIVSI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQSN--WILGSFILVTSSLFISMLFLVQAWILK  686
              GAF++T Y GP ++        SL  Q  N  WI+G+  L      + + ++VQ  I++
Sbjct  147   GGAFIVTLYNGPVVINMSPPSI-SLRSQSPNHDWIIGAAFLAVEYFMVPLWYIVQTQIMR  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +YP E  +       V+  + +A +  E  +++AWK++P++ L++I  + +      + +
Sbjct  206   EYPSEFTVVCYYSFGVSFWTGLATLFTEGSDLSAWKIKPNIALVSIVCSGLFGSCINNTI  265

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+R KGP+FVAMF PL +  AV MGV FLRD LY GS+IGA++I +GFYTVMWGKA 
Sbjct  266   HTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLRDSLYIGSLIGATVITIGFYTVMWGKAK  325

Query  1044  E---VKENIETNIDNSNE----------KVPLLPPNKGDS  1124
             E   V++N + N +++NE          K PLL   K D 
Sbjct  326   EMALVEDNNKANNEDANEADLDSPSGSQKAPLLESYKNDE  365



>ref|XP_003613295.1| Auxin-induced protein 5NG4 [Medicago truncatula]
Length=598

 Score =   234 bits (596),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 194/317 (61%), Gaps = 6/317 (2%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAGQ  344
             K A   GM+ ++ V+YS  L+ + LLP  +  +R   PP LTF       + AL+  + Q
Sbjct  280   KFAMKDGMNKYVMVVYSMGLSSILLLPLALFINRSQRPP-LTFSALWSFFLLALIGSSAQ  338

Query  345   TLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAF  524
              + Y GIE SSPTLASAM +LIPAFTF+ A++  ME +  +  SS AK+IGTIV + GAF
Sbjct  339   IMTYGGIELSSPTLASAMLNLIPAFTFVLALIFRMERIYWRHFSSQAKAIGTIVSMAGAF  398

Query  525   VITFYKGPPLLLFQHA-YYNSL-LPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPG  698
             V+  YKGPP+L    +  YN+L      NWILG F+    SL  SM ++ Q  + K YP 
Sbjct  399   VVILYKGPPILKIHSSISYNTLQFSPNLNWILGGFLCAGDSLLSSMWYIYQVSVTKKYPA  458

Query  699   ELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAV  878
              +++       +TI + + A+I  R+ +AW+L+ DM LI I Y A+  +G R  +  W+V
Sbjct  459   VIVIVFFQVVFITIQTGVYALIVVRDPSAWELKLDMGLIVILYQAVAAIGIRYFLQTWSV  518

Query  879   RKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME--VK  1052
             ++ GP+F AMF P+G++  V +G  FL DD Y GS+IGA II +GFY V WGKA E  V+
Sbjct  519   QRAGPLFCAMFKPIGIIFTVFLGSIFLGDDFYLGSLIGAVIIVVGFYAVQWGKASEEKVE  578

Query  1053  ENIETNIDNSNEKVPLL  1103
             + IE N++  +  VPLL
Sbjct  579   KGIE-NLETQSNVVPLL  594



>ref|XP_006395380.1| hypothetical protein EUTSA_v10004446mg [Eutrema salsugineum]
 gb|ESQ32666.1| hypothetical protein EUTSA_v10004446mg [Eutrema salsugineum]
Length=367

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 136/339 (40%), Positives = 196/339 (58%), Gaps = 17/339 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +F++YS  LA L LLPS     R    P + F I  +I +  L+ 
Sbjct  27    NTLFKAATLQGMSFHVFIVYSYGLAALLLLPSPFFSFRSRTLPPMNFSILYKIVLLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  + Y GI YSSPTLASA+++L PAFTF+ AV+  ME +S K  SS+AK +GT+V I
Sbjct  87    CCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAVLFRMESVSFKRTSSVAKMLGTVVSI  146

Query  513   TGAFVITFYKGPPLLLFQ--HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILK  686
              GAF++T Y GP ++          S  P   NWI+G+  L      + + ++VQ  I++
Sbjct  147   GGAFIVTLYNGPVVIAMSPPSVSMRSQSPNH-NWIIGAAFLSVEYFMVPLWYIVQTQIMR  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +YP E  +       V+  +A+  +  E  + + WK++P++ L++I  +        + +
Sbjct  206   EYPSEFTVVCYYSLGVSFWTALITLFTEGSDSSVWKIKPNIALVSIVCSGFFGSCINNTI  265

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+R KGP+FVAMF PL +  AV MGV FLRD LY GS+IGA++I +GFYTVMWGKA 
Sbjct  266   HTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLRDSLYIGSLIGATVITIGFYTVMWGKAK  325

Query  1044  EV----KENIETNID---------NSNEKVPLLPPNKGD  1121
             EV     EN  ++ D         + ++K PLL   K D
Sbjct  326   EVAMVEDENKTSHEDADEADLDSPSGSQKAPLLQSYKND  364



>gb|KHN09903.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=351

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 189/320 (59%), Gaps = 11/320 (3%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAGQ  344
             KVA T G++ ++ V+YS AL+ + LLP  +  HR   PP LTF       + A    +GQ
Sbjct  32    KVAMTDGINKYVMVVYSLALSTILLLPFALFLHRSERPP-LTFSALCSFFLLAFFGSSGQ  90

Query  345   TLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAF  524
              + Y+GI+ SSPTLASAM +LIPAFTFI A++  ME +  K  SS AK +GTIV I GAF
Sbjct  91    IMAYVGIDLSSPTLASAMLNLIPAFTFILALIFRMEEVHWKHSSSQAKFLGTIVSIAGAF  150

Query  525   VITFYKGPPLLLFQHAYYNS----LLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             V+  YKGPP+  F+    NS    L  QQ NWILG       S+  S+ ++ QA +   Y
Sbjct  151   VVILYKGPPI--FKTHLSNSSNKFLFSQQLNWILGGMFCAGDSIVCSLWYIYQASVAYKY  208

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P    +        TI   + A+I  ++   W+L+ D+ LI I Y AI     R ++  W
Sbjct  209   PAVTTIVFFQLLFSTIQCGVFALIVVQDQTEWELKLDIGLIGIVYQAIAATLIRYILCTW  268

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME--  1046
              V K GP+F +MF P+ ++ +V MG  FL DDL  GS+IGA II +GFY V+WGK++E  
Sbjct  269   CVLKAGPLFCSMFKPVAIIFSVFMGAIFLGDDLSLGSLIGAVIIVIGFYAVLWGKSIEDN  328

Query  1047  -VKENIETNIDNSNEKVPLL  1103
              +++ +E N+++S   VPLL
Sbjct  329   KIEKGVE-NLESSCHNVPLL  347



>ref|XP_007031399.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY02325.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=361

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/332 (39%), Positives = 198/332 (60%), Gaps = 12/332 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             N L K AT +GMS +IF+ YS A+  +  LP + ++      P L F +  RI +  L+ 
Sbjct  27    NILFKAATLKGMSYYIFIAYSYAVGTVLFLPLSFIFPSRAVLPRLKFHVVSRIFLLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             ++ Q   Y GIEYSSPT+ASA+++L PA TFI AV++ +E ++L+  SS AK +GTI  I
Sbjct  87    FSAQICAYKGIEYSSPTMASAVSNLTPAITFILAVLSRLERVALRSSSSQAKVLGTIASI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLL------PQQSNWILGSFILVTSSLFISMLFLVQA  674
             +GA V+  YKGP +        +S+L        +SNW +G  +L  + L  S  +++QA
Sbjct  147   SGALVVVLYKGPKVFSSPRGTSSSVLLEWPLESSESNWAIGGILLAVAYLLFSFCYIIQA  206

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
              ++  YP E+++  +     TI+SA   +IAE N+++W+LRP + +IA+ Y+ I    F 
Sbjct  207   QVMVIYPAEIIVAFLYNLCGTIISAPVCLIAEPNLSSWRLRPSVAVIAVLYSGIFQT-FY  265

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
             S+V  W +  KGPV++ +F PL +  A  M   FL D L+ GS++GA II++GFY V+WG
Sbjct  266   SLVVIWGLHLKGPVYIVIFKPLSIAIAAFMSAVFLGDSLHVGSIVGAVIISMGFYAVIWG  325

Query  1035  KAMEVKENIETNIDNSNE-----KVPLLPPNK  1115
             KA E +   + +  NS E     KVPLL  +K
Sbjct  326   KAKEEQRIHDDSGINSLEPSSSGKVPLLQSHK  357



>ref|XP_010043799.1| PREDICTED: WAT1-related protein At5g40240-like [Eucalyptus grandis]
Length=358

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 138/331 (42%), Positives = 199/331 (60%), Gaps = 11/331 (3%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPST-ILYHRLMPPPVLTFGIFGRICITALLSYAG  341
             K+A + G+S +I V Y + ++ L LLP   I+  R    P LTF +  +I + AL+    
Sbjct  29    KIAMSDGISKYIMVFYCHVVSSLVLLPCPFIISRRSGSCPPLTFTVLRKIFLLALVGLVA  88

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
             Q   Y GI+YSSP L +AM +LIPAFTFI AV++ ME ++ K  SS AK +GTI  I GA
Sbjct  89    QICAYAGIDYSSPVLGTAMMNLIPAFTFILAVISRMEKVNWKSSSSHAKLVGTIASIVGA  148

Query  522   FVITFYKGPPLL-------LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
              V+T YKGPP+L         Q      +L +QSNWILG F+L   +  +S+ +++Q  I
Sbjct  149   SVVTLYKGPPILRSPPPLPYVQPRQLLLILSRQSNWILGGFLLTADAFLLSLWYIIQTSI  208

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             LKDYP  L +        TIL+ + + I  R   +W L+ D  LIAI Y+A+++  F   
Sbjct  209   LKDYPVVLNIMFYKVLFGTILAGLLSFITVREPRSWILKLDRGLIAILYSAVVVSIFSLT  268

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             +  W +++ GPV+VAMF P G+V AV +G  FL + L+ GS+IGA +IA+GFY V+WGK+
Sbjct  269   LCTWCLKRTGPVYVAMFKPFGIVFAVGLGFIFLGETLHLGSLIGAMVIAMGFYGVVWGKS  328

Query  1041  --MEVKENIETNIDNSNEKVPLLPPNKGDSV  1127
                E +     ++ +S+ K+PLL  NK  SV
Sbjct  329   KEEEERTTEGGSLASSSHKIPLL-QNKASSV  358



>ref|XP_004508845.1| PREDICTED: WAT1-related protein At5g40240-like [Cicer arietinum]
Length=356

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 198/329 (60%), Gaps = 18/329 (5%)
 Frame = +3

Query  159   LNKVA-TTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             L+KVA +T+GM++F+FVLYSNALA   LLPS+ L +R      L+F + G+     LLS 
Sbjct  29    LSKVAMSTKGMNHFVFVLYSNALATFILLPSSFLINRSTRQS-LSFSLLGKFF---LLSL  84

Query  336   AG----QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTI  503
              G    Q   +IGI YSSPTL SAM++L PA TF+ AV+  ME L +    S  K +GT+
Sbjct  85    VGITIMQNCVFIGISYSSPTLGSAMSNLTPAITFVLAVIFRMEKLDVGSSISQIKIVGTV  144

Query  504   VLITGAFVITFYKGPPLLLFQHAYYNS-----LLPQQSNWILGSFILVTSSLFISMLFLV  668
             + I+GA ++T YKG P+  FQ     S     LL + SNW++G   L TSSL  ++  + 
Sbjct  145   LSISGALLVTLYKGAPIGSFQTEPSTSQPLLSLLAETSNWVIGGLFLATSSLSFAVWNIA  204

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             QA ILK YP +L +    C   TI  AI +++A ++ NAW L  D+ELI+I Y+A     
Sbjct  205   QAAILKSYPSQLTILAFYCLFGTIQCAILSLVAVKDPNAWNLSTDIELISIIYSATFGSV  264

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
                 V  W + +KGP+FV MF P+G+  A  M V FL + L+ GSVIGA +IA+GFYTV+
Sbjct  265   VTFSVLTWCIDRKGPLFVTMFKPVGIAIAAFMSVAFLGETLHAGSVIGALVIAIGFYTVL  324

Query  1029  WGKAMEVK----ENIETNIDNSNEKVPLL  1103
             W ++ E      E  E +  +S++  PLL
Sbjct  325   WAQSKERHGKDLEFDELSPSSSDQASPLL  353



>ref|XP_010046740.1| PREDICTED: uncharacterized protein LOC104435740 [Eucalyptus grandis]
Length=747

 Score =   235 bits (600),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 143/332 (43%), Positives = 202/332 (61%), Gaps = 14/332 (4%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPST-ILYHRLMPPPVLTFGIFGRICITALLSYAG  341
             K+A + G++ +    Y N L+ L LLP   I+  R    P L F +  +I + AL+  A 
Sbjct  29    KMAMSDGINKYTMAFYCNVLSSLVLLPCPFIISRRSGSCPPLAFPVLRKIFLLALVGCAS  88

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
             QT  Y+GIEYSSP L +AM +LIPAFTFI AV++ ME ++ K  SS AK +GTI  I GA
Sbjct  89    QTSGYVGIEYSSPVLGTAMMNLIPAFTFILAVISRMEKVNWKSSSSQAKLVGTIASILGA  148

Query  522   FVITFYKGPPLLLFQ-----HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILK  686
             FV+T YKGP  L+F       +    LL QQSNWILG F+L   +  IS+ ++VQA ILK
Sbjct  149   FVVTLYKGP--LIFSPSSPPASVQPGLLSQQSNWILGGFLLAAEAFLISLAYIVQAIILK  206

Query  687   DYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVY  866
             DYP  L +        TI S + + +  R   +W L+ D+ LIAI Y+A++   FR  + 
Sbjct  207   DYPVVLNIMFYGMFFQTIFSGLLSFVTVREPQSWILKVDLGLIAILYSALVANVFRITLS  266

Query  867   AWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME  1046
              W +++ GPV+V+MF PLG V AV +G  FL + L+ GS+IGA +I +GFY V+W K+ E
Sbjct  267   TWCLKRTGPVYVSMFQPLGTVFAVGLGFIFLGEKLHIGSLIGAIVIVMGFYGVVWAKSKE  326

Query  1047  VKENI-----ETNIDNSNEKVPLLPPNKGDSV  1127
              ++ I     E ++ +S++K+PLL  NK   V
Sbjct  327   EEKTIEGSGVEESLASSSDKIPLL-RNKASRV  357


 Score =   235 bits (599),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 147/335 (44%), Positives = 207/335 (62%), Gaps = 13/335 (4%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPS-TILYHRLMPPPVLTFGIFGRICITALLSY  335
             + K+A + GM+ +  V YSNAL+ L LLP   I+  R    P LTF +  +I + AL+  
Sbjct  414   VTKMAMSEGMNKYTMVFYSNALSSLVLLPCPLIISRRPGSCPPLTFSVLRKIFLIALIGL  473

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             A Q  +Y+G++YSSP L  AM +LIPAFTFI A+++ ME ++ K  SS AK +GTI  I 
Sbjct  474   ACQMCEYVGMDYSSPVLGMAMMNLIPAFTFILAIISRMEKVNWKSSSSQAKLVGTITSIL  533

Query  516   GAFVITFYKGPPLLLFQHAYYNS------LLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
             GAFV+T YKGPP+LL              LL +QSNWILG F+LV  +  IS+ F+ QA+
Sbjct  534   GAFVVTLYKGPPILLSPSPPPVQPRHPPFLLSRQSNWILGGFLLVAEAFLISLWFIGQAF  593

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             ILKDYP  + L   +    T+LS + + +  R    W L+ ++ LI+I Y+A++   FR+
Sbjct  594   ILKDYPVVMNLMFYSTFFSTVLSGLLSFVTVREPQFWILKVNIGLISILYSALVSGVFRA  653

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
              +  W ++K GPV+V+MF PLG+V A  +G  FL + LY GS+IGA +I +GFY VMWGK
Sbjct  654   SLCTWCLKKTGPVYVSMFKPLGVVFAAGLGFIFLGEMLYLGSIIGAIVIVMGFYGVMWGK  713

Query  1038  AMEVKENIE-----TNIDNSNEKVPLLPPNKGDSV  1127
             + E +  IE      ++ +S  K PLL  NK  SV
Sbjct  714   SKEEETTIEGSGVGESLASSVHKTPLL-QNKASSV  747



>emb|CDY20031.1| BnaA09g02200D [Brassica napus]
Length=369

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 138/341 (40%), Positives = 197/341 (58%), Gaps = 19/341 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +F++YS  LA L LLPS     R    P + F I  +I +  L+ 
Sbjct  27    NTLFKAATLQGMSFHVFIVYSYGLAALLLLPSIFFSSRSRTLPPMNFSILYKIVVLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAG-MEILSLKERSSLAKSIGTIVL  509
                  + Y GI YSSPTLASA+++L PAFTF+ A++   ME +S K  SS+AK +GT+V 
Sbjct  87    CCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAILFRLMESVSFKRISSVAKMLGTVVS  146

Query  510   ITGAFVITFYKGPPLLLFQHAYYNSLLPQQSN--WILGSFILVTSSLFISMLFLVQAWIL  683
             I GAF++T Y GP L++       SL  Q +N  WI+G+  L      + + ++VQ  I+
Sbjct  147   IGGAFIVTLYNGP-LVISMSPPSVSLRSQSTNHNWIIGAAFLSVEYFMVPLWYIVQTQIM  205

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             ++YP E  +       V+  + +  +  E  ++NAWK++P++ L++I  + +      + 
Sbjct  206   REYPSEFTVVCYYSLGVSFWTGLVTLFTEGSDLNAWKIKPNIALVSIVCSGVFGSCINNT  265

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             ++ WA+R KGP+FVAMF PL +  AV MGV FL D LY GS+IGA++I  GFYTVMWGKA
Sbjct  266   IHTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLHDSLYIGSLIGATVITTGFYTVMWGKA  325

Query  1041  MEV----KENIETNIDNSNE----------KVPLLPPNKGD  1121
              E      +N   N D +NE          K PLL   K D
Sbjct  326   KEAAMVEDDNKANNEDATNEADHDSPLASQKAPLLESYKND  366



>emb|CDY00140.1| BnaC09g01610D [Brassica napus]
Length=369

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 137/341 (40%), Positives = 196/341 (57%), Gaps = 19/341 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GMS  +F++YS  LA L LLPS     R    P + F I  +I +  L+ 
Sbjct  27    NTLFKAATLQGMSFHVFIVYSYGLAALLLLPSIFFSSRSRTLPPMNFSILYKILVLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAG-MEILSLKERSSLAKSIGTIVL  509
                  + Y GI YSSPTLASA+++L PAFTF+ A++   ME +S K  SS+AK +GT+V 
Sbjct  87    CCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAILFRLMESVSFKRTSSVAKMLGTVVS  146

Query  510   ITGAFVITFYKGPPLLLFQHAYYNSLLPQQSN--WILGSFILVTSSLFISMLFLVQAWIL  683
             I GAF++T Y GP ++        SL  Q +N  WI+G+  L      + + ++VQ  I+
Sbjct  147   IGGAFIVTLYNGPVVISMSPPSV-SLRSQSTNHNWIIGAAFLSVEYFMVPLWYIVQTQIM  205

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             ++YP E  +       V+  + +  +  E  ++NAWK++P++ L++I  + +      + 
Sbjct  206   REYPSEFTVVCYYSLGVSFWTGLVTLFTEGSDLNAWKIKPNIALVSIVCSGVFGSCINNT  265

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             ++ WA+R KGP+FVAMF PL +  AV MGV FL D LY GS+IGA++I  GFYTVMWGKA
Sbjct  266   IHTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLHDSLYIGSLIGATVITTGFYTVMWGKA  325

Query  1041  MEV----KENIETNIDNSNE----------KVPLLPPNKGD  1121
              E      +N   N D +NE          K PLL   K D
Sbjct  326   KEAAMVEDDNKANNEDATNEADLDSPLASQKAPLLESYKND  366



>ref|XP_011086525.1| PREDICTED: WAT1-related protein At3g28050-like [Sesamum indicum]
Length=354

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 200/333 (60%), Gaps = 14/333 (4%)
 Frame = +3

Query  162   NKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAG  341
              KVA + GM+   F+ YSN L  L LLP +I  +R + PP+     F  +C   LL   G
Sbjct  26    GKVAMSNGMTTLTFISYSNGLGSLVLLPFSIFIYRSIRPPLF----FTFLCGFFLLGVIG  81

Query  342   ---QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q + Y GI+++S +L++++ +LIP FTF+ AV+  +E  + + +++LAKS+GT+V I
Sbjct  82    FLVQIIGYTGIKFASASLSTSILNLIPGFTFVLAVIFRLEKFNCRSKTTLAKSVGTVVSI  141

Query  513   TGAFVITFYKGPPLL---LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWIL  683
             TGA V T Y+GP +L      +A ++++    S WILG F+LV  SL  +   + QA +L
Sbjct  142   TGAVVATLYQGPSILGPSSHSNATFHTI-TSSSAWILGGFLLVIDSLVSAFFIIAQALVL  200

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             K  P EL+L       + I SA  +++ E+++++W LRP M LI + Y+AI    F+  +
Sbjct  201   KKCPVELVLMFFYSCFIAIASASVSLVVEKDLSSWSLRPKMRLIPVIYSAIFGNAFQVSI  260

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
               W VRK+GP+F ++F PLG++ A  MG   L + LY GSV+G+ I+ +GFY+VMWGKA 
Sbjct  261   SMWCVRKRGPLFASVFHPLGVIVANAMGTVILGEPLYLGSVLGSIIVVVGFYSVMWGKAK  320

Query  1044  EVK--ENIETNIDNSNEK-VPLLPPNKGDSV*N  1133
             E K  E+    I  SN K  PLL  N  D V N
Sbjct  321   EAKTVEDGGAEILESNGKTTPLLQNNTEDGVVN  353



>ref|XP_011020453.1| PREDICTED: WAT1-related protein At3g28050-like [Populus euphratica]
Length=355

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/321 (40%), Positives = 189/321 (59%), Gaps = 7/321 (2%)
 Frame = +3

Query  162   NKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAG  341
              K A + GMS+F+FVLYSN +A + LLPS++++HR    P L   I     +  L    G
Sbjct  27    GKAAMSNGMSSFVFVLYSNTIASIILLPSSLIFHRPQERPPLNLSIVFGFFLLGLFGCLG  86

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
             Q+  Y GI  SSP L +AM + +P  TF+ AV+  ME +  +  S+LAKS+GTI+ + GA
Sbjct  87    QSFGYAGINLSSPALGTAMLNTVPGLTFVLAVIFRMEKVDCRSYSTLAKSMGTIISMGGA  146

Query  522   FVITFYKGPPLLLFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             FV+T+YKGP LL    +  NS   +L Q SNW+LG  +L       S   +VQA ILK Y
Sbjct  147   FVVTYYKGPLLLKALPSASNSSHQVLSQHSNWVLGGSLLAVDCTMASSWLIVQALILKKY  206

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P +L+         T+L++I  ++  ++ +AW L+ +  L+++ ++ I+   F+  V  W
Sbjct  207   PAKLIAVFFYFFFSTVLTSIVCLVMVKDPSAWSLKSNTRLVSVLFSGILGHAFQVGVTTW  266

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              ++K GPVFV++F PLG+V      V F  D L  G VIGA IIA GFY V+WGKA E  
Sbjct  267   CLQKTGPVFVSVFAPLGIVITATASVVFFGDALNLGIVIGAVIIASGFYAVIWGKAQEAT  326

Query  1053  ENIETNID----NSNEKVPLL  1103
             + +E        +S++KVPLL
Sbjct  327   KKVEDEESFGPASSSQKVPLL  347



>gb|KHN23566.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=361

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/326 (39%), Positives = 198/326 (61%), Gaps = 11/326 (3%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL K AT +GM+N +FV Y++A+A   L P T    R    P L+F I  +I    ++  
Sbjct  29    TLFKEATLQGMNNHVFVAYTSAVAATLLFPITFFRRRSRVVPPLSFSIASKIMFIGMIGT  88

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             + Q + Y+G+ YSSPTLAS++A+L PAFTFI A++  ME ++ K RSS AK +G+I+ IT
Sbjct  89    SSQIMYYVGVSYSSPTLASSIANLGPAFTFILAIIFRMEKIAAKSRSSQAKVVGSIISIT  148

Query  516   GAFVITFYKGPPLLL---------FQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLV  668
             GAFV+T YKG  ++           QH + + L    ++W++   +L    L  S+ ++V
Sbjct  149   GAFVLTLYKGHSIIKAHSHDLSIPLQHPF-SFLKSGDADWVIAGILLTAECLIGSLCYIV  207

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
             QA +LK +P E+ + +      T++S + A+ A  N NAWK+  ++ LI+I     I   
Sbjct  208   QADVLKVFPDEVTIVLFYNVTSTVMSTLVALFAVPNANAWKVGLNISLISIICTGTIQKV  267

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
                ++  WA+R KGPV++A F PL +V ++ MGV FL D L+ GS++GA+I++ GFY V+
Sbjct  268   MGYILSTWALRLKGPVYLASFSPLQIVFSIAMGVIFLGDSLHVGSIVGAAIVSFGFYAVL  327

Query  1029  WGKAM-EVKENIETNIDNSNEKVPLL  1103
             WGKA  E++E ++     + E VPLL
Sbjct  328   WGKATEEIEEEVDYPESPATENVPLL  353



>ref|XP_002322156.2| hypothetical protein POPTR_0015s08450g [Populus trichocarpa]
 gb|EEF06283.2| hypothetical protein POPTR_0015s08450g [Populus trichocarpa]
Length=268

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 163/261 (62%), Gaps = 7/261 (3%)
 Frame = +3

Query  342   QTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGA  521
             Q   + G+ YSSPTLASAM  LIPAFTF+ AV+  ME L  +   S  K +GT+V ++GA
Sbjct  2     QNCVFTGVSYSSPTLASAMGQLIPAFTFLLAVIFRMEKLDWRSSRSRIKIMGTLVSVSGA  61

Query  522   FVITFYKGPPLLLFQHAYYNSLLPQ----QSNWILGSFILVTSSLFISMLFLVQAWILKD  689
               IT YKGP +           +P      ++WI+G   LVT+ L +S+   +QA ILK+
Sbjct  62    LTITLYKGPAIGAITTQSNPDPIPSIMSTANSWIIGGLFLVTADLCVSIFTTLQAAILKE  121

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP E+ +    C   TI S+I ++IAERN NAWKLRPD+ELI+I Y+A++       V A
Sbjct  122   YPSEMAMVSFLCLFGTIQSSIVSLIAERNPNAWKLRPDIELISIIYSAVVGSVVTFGVTA  181

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME-  1046
             W +RKKGPVFVA+F P+G+  A  +GV FL D L+ GS++GA II  GFY V+W ++ E 
Sbjct  182   WCIRKKGPVFVAIFKPVGIATAAFLGVIFLGDTLHVGSIVGAIIIVAGFYGVIWAQSKED  241

Query  1047  --VKENIETNIDNSNEKVPLL  1103
                K N   N+ + ++K PLL
Sbjct  242   EHSKVNRPRNLQSLSQKTPLL  262



>ref|XP_006286126.1| hypothetical protein CARUB_v10007676mg [Capsella rubella]
 gb|EOA19024.1| hypothetical protein CARUB_v10007676mg [Capsella rubella]
Length=365

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 133/319 (42%), Positives = 199/319 (62%), Gaps = 6/319 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RG+S ++FV Y+   A L LLP ++++ R    P     +F  I + AL+ 
Sbjct  36    NTLFKAATLRGLSFYVFVFYTYVGATLVLLPLSLIFGRSKRLPAAKAPVFFNIFLLALVG  95

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             +    +   GIEYSSPTLASA+++L PAFTF  AV+  ME L L+  ++ AK IGTIV I
Sbjct  96    FMSLIVGCKGIEYSSPTLASAISNLTPAFTFTLAVIFRMEQLVLRSSATQAKIIGTIVSI  155

Query  513   TGAFVITFYKGPPLLLFQH--AYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILK  686
             +GA V+  YKGP +L        Y  L    S+WI+G  +L T  L IS+ +++Q  +++
Sbjct  156   SGALVVVLYKGPKVLSDASLTPTYQHLTSFDSSWIIGGLLLATQYLLISVWYILQTRVME  215

Query  687   DYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVY  866
              YP E+ +  +     T++SA   + AE+++ ++ L+P + L ++ Y+  ++  F SV++
Sbjct  216   LYPEEITVVFLYNLCATLISAPVCLFAEKDLTSFMLKPGVSLASVMYSGGLVSSFGSVIH  275

Query  867   AWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME  1046
              W +  KGPV++A+F PL +V AV MGV FL D LY GSVIG+ I++LGFYTV+WGKA  
Sbjct  276   TWGLHLKGPVYIALFKPLSIVIAVAMGVIFLGDALYLGSVIGSVILSLGFYTVIWGKA--  333

Query  1047  VKENIETNIDNSNEKVPLL  1103
              +E+    +D S E+ PLL
Sbjct  334   -REDAIKTVDGS-EQSPLL  350



>emb|CDX86451.1| BnaA06g31680D [Brassica napus]
Length=445

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 137/330 (42%), Positives = 202/330 (61%), Gaps = 15/330 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K A+++GMS+++F++YS  +  L LLPS  L HR    P L F +  ++ +  LL 
Sbjct  109   NTLFKAASSKGMSSYVFLVYSYGIGALLLLPSPFLTHRSGSLPPLKFSVLCKMGLLGLLG  168

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  L Y GI+YSSPTLASAM++L PAFTFIFA++ GME +S+K+ SS+AK +GTIV I
Sbjct  169   CVYLMLGYTGIKYSSPTLASAMSNLTPAFTFIFALLFGMEKVSIKKNSSIAKVVGTIVSI  228

Query  513   TGAFVITFYKGPPLLLFQHAYYN--------SLLPQQSNWILGSFILVTSSLFISMLFLV  668
              GA V+T Y GP +        +           P  SNW++G  +L      I++ +++
Sbjct  229   VGALVVTLYHGPIIFAASQPSVHLPQPLSPPPSPPLNSNWVIGGCLLALEYTLIAISYII  288

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAII-M  842
             Q  I+++Y  E  L +     V++  A  ++  E  N +AW +R  + LI I    ++  
Sbjct  289   QTHIMREYASEFALALSHNICVSVSCAFVSLFVETNNPSAWIMRSSIMLICIVATGMVNS  348

Query  843   VGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYT  1022
              G+  VV +W VR KGP+F+AMF PL ++ AV++G  FL D LY GSVIG ++I++GFYT
Sbjct  349   TGY--VVESWTVRHKGPLFLAMFRPLAILTAVVLGAIFLGDSLYLGSVIGGTLISIGFYT  406

Query  1023  VMWGKAMEVKENIETN---IDNSNEKVPLL  1103
             VMWGKA E K  I+T+     + +++VPLL
Sbjct  407   VMWGKAKEEKSEIDTHHAASSSHSKRVPLL  436



>emb|CDY66864.1| BnaCnng52640D [Brassica napus]
Length=351

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 192/317 (61%), Gaps = 5/317 (2%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
              TL K A  RG+S ++FV YS  ++ L LLP +++Y R    P     +F +I + ALL 
Sbjct  31    TTLYKAAALRGLSFYVFVFYSYVVSTLVLLPLSLIYRRSTRLPSAKSPVFFKIFLLALLG  90

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             +        G+EYSSPTLASA++ L PAFTF  A+V  ME + L+  +S AK IGT+V +
Sbjct  91    FMSMIAGCKGVEYSSPTLASAISTLTPAFTFTLAIVFRMERVRLRSSASQAKIIGTVVSM  150

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDY  692
             +GA V+  YKGP LL   H  Y+ L   +S+WILG   L    L IS+  ++Q  I++ Y
Sbjct  151   SGALVVVLYKGPKLLAASH--YHHLTLSESSWILGGISLAAQYLLISVWLIIQTRIMEVY  208

Query  693   PGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAW  872
             P E+ +  +     T +SA   M AE+N+ ++ L+PD+ L++I Y   ++    +V++ W
Sbjct  209   PQEITVVFLYSLCGTQISAPVCMFAEKNLTSFLLKPDVSLVSIMYTGALVSSLGTVIHTW  268

Query  873   AVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVK  1052
              +  KGPV++++F PL +V AV M   FL D ++ GSVIG+ +++LGFYTV+WGKA   +
Sbjct  269   GLHLKGPVYISLFKPLSIVIAVGMSAIFLGDAIHLGSVIGSVVLSLGFYTVIWGKA---R  325

Query  1053  ENIETNIDNSNEKVPLL  1103
             E+    + +S    PLL
Sbjct  326   EDASKPVTSSEHYSPLL  342



>dbj|BAB10904.1| nodulin-like protein [Arabidopsis thaliana]
Length=346

 Score =   224 bits (572),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 206/333 (62%), Gaps = 22/333 (7%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RG+S ++FV Y+  +A L LLP ++++ R    P     +F  I + AL+ 
Sbjct  12    NTLFKAATLRGLSFYVFVFYTYVVATLVLLPLSLIFGRSKRLPSAKTPVFFNIFLLALVG  71

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             +    +   GIEYSSPTLASA+++L PAFTF  AV+  ME + L+  ++ AK IGTIV I
Sbjct  72    FMSLIVGCKGIEYSSPTLASAISNLTPAFTFTLAVIFRMEQIVLRSSATQAKIIGTIVSI  131

Query  513   TGAFVITFYKGPPLL-------------LFQHAYYNSLLPQQSNWILGSFILVTSSLFIS  653
             +GA V+  YKGP +L             L+QH     L    S+WI+G  +L T  L +S
Sbjct  132   SGALVVILYKGPKVLTDASLTPPSPTISLYQH-----LTSFDSSWIIGGLLLATQYLLVS  186

Query  654   MLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNA  833
             + +++Q  +++ YP E+ +  +     T++SA   + AE+++N++ L+P + L ++ Y+ 
Sbjct  187   VWYILQTRVMELYPEEITVVFLYNLCATLISAPVCLFAEKDLNSFILKPGVSLASVMYSG  246

Query  834   IIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALG  1013
              ++  F SV++ W +  KGPV++++F PL +V AV MGV FL D LY GSVIG+ I++LG
Sbjct  247   GLVSSFGSVIHTWGLHLKGPVYISLFKPLSIVIAVAMGVMFLGDALYLGSVIGSLILSLG  306

Query  1014  FYTVMWGKAMEVKENIETNIDNSNEKVPLLPPN  1112
             FYTV+WGKA E  ++I+T      E+ PLLP +
Sbjct  307   FYTVIWGKARE--DSIKTV--AGTEQSPLLPSH  335



>gb|KHG04184.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=360

 Score =   225 bits (573),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 132/333 (40%), Positives = 204/333 (61%), Gaps = 18/333 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             + ++K A ++GMSN + V Y NAL  L LLP  I       P  LTF +  R  +  L+ 
Sbjct  27    SVISKAALSKGMSNVVSVTYFNALGTLILLPYFIFCRDKQAP--LTFSLLWRFFLLGLIG  84

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
              +GQ +   G+++SSPTL+SA+ +LIP FTF+ AV+  ME L +++ SS AK +G IV +
Sbjct  85    SSGQIIFLTGVKFSSPTLSSALVNLIPIFTFLLAVIFRMEKLEMRKSSSQAKLLGAIVAV  144

Query  513   TGAFVITFYKGPPLLL------FQHAYYNSL--------LPQQSNWILGSFILVTSSLFI  650
             TGAFV+T YKGPP+L+      F H  ++S         L +QS WI+G F+L+   L  
Sbjct  145   TGAFVVTLYKGPPVLMSSSPSDFLHHPFDSKQSKWIIGGLSEQSKWIIGGFLLLLVCLSS  204

Query  651   SMLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYN  830
             +   ++QA  +K+Y  ++ +       + I S + ++I ERN  AW+L+ + E+ AI  +
Sbjct  205   ATWNVLQAATVKEYTDKMTIVFFFTFFIAIQSLVFSVILERNPTAWRLKSNEEVAAILCS  264

Query  831   AIIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIAL  1010
             A+    +R  ++ W + KKGPV+V+MF PLG+  AV + V FL + L+ GSVIG++II +
Sbjct  265   ALFGSLYRISIHTWCLEKKGPVYVSMFKPLGIAVAVALTVIFLGESLFLGSVIGSTIILV  324

Query  1011  GFYTVMWGKAMEVK--ENIETNIDNSNEKVPLL  1103
             GFYTV+WG+A E    EN    +++S++K PL+
Sbjct  325   GFYTVIWGQANEKNMLENEVCGLESSHQKTPLI  357



>ref|XP_007031402.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY02328.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
isoform 1 [Theobroma cacao]
Length=361

 Score =   224 bits (572),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 129/332 (39%), Positives = 199/332 (60%), Gaps = 12/332 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             N L K AT +GMS +IF+ YS A+  +  LP + ++      P L F +  RI +  L+ 
Sbjct  27    NILFKAATLKGMSYYIFIAYSYAVGTILFLPLSFIFPSRAVLPRLKFHVVSRIFLLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             ++ Q   Y GIEYSSPT+ASA+++L PA TFI AV++ +E ++L+  SS AK +GTI  I
Sbjct  87    FSAQICAYKGIEYSSPTMASAVSNLTPAITFILAVLSRLERVALRSSSSQAKVLGTIASI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQ------QSNWILGSFILVTSSLFISMLFLVQA  674
             +GA V+  YKGP +        +S+L +      +SNW++G  +L  + L  S  +++QA
Sbjct  147   SGALVVVLYKGPKVFSSPRGTSSSVLLEWPLESPESNWVIGGILLAVAYLLFSFWYIIQA  206

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
              ++  YP E+++  +     TI+SA   +IAE N+++W+LRP + +IA+ Y+ I      
Sbjct  207   QVMVIYPAEIIVAFLYNLCGTIVSAPVCLIAEPNLSSWRLRPSVAVIAVLYSGIFQT-VS  265

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
             S+V  W +  KGPV++ +F PL +  A  M   FL D L+ GS++GA II++GFY V+WG
Sbjct  266   SLVVIWGLHLKGPVYIVIFKPLSIAIAAFMSAVFLGDSLHVGSIVGAVIISMGFYAVIWG  325

Query  1035  KAMEVKENIETNIDNSNE-----KVPLLPPNK  1115
             KA E +   + +  NS E     KVPLL  +K
Sbjct  326   KAKEEQRIHDDSGINSLEPSSSGKVPLLQSHK  357



>emb|CBI15069.3| unnamed protein product [Vitis vinifera]
Length=325

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 187/325 (58%), Gaps = 16/325 (5%)
 Frame = +3

Query  186   MSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAG----QTLQ  353
             M  F+FV+YSNA A L L   + ++ R   PP+     F  +C   LLS AG    Q   
Sbjct  1     MDRFVFVVYSNAFASLILFSISFIFLRTKRPPLS----FSLLCKFFLLSLAGITVMQNCV  56

Query  354   YIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAFVIT  533
             + G+ Y SPTL SAM++LIPAFTF+ AV   +E L L+   SL K +GT+V I+GA ++T
Sbjct  57    FTGVSYGSPTLGSAMSNLIPAFTFLLAVAFRLENLDLRSSRSLIKILGTLVSISGALIVT  116

Query  534   FYKGPPLL--LFQHAYYNS---LLPQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPG  698
              YKGPP+   L +    +S   L    +NW++G      + L IS+  + QA IL+ YP 
Sbjct  117   LYKGPPIGAGLIKSPSISSNDHLQKTANNWVIGGLFFAMAGLSISVWNIFQAPILRRYPS  176

Query  699   ELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAV  878
             E+ +         I  A  A+IA ++ NAWKLRPD ELI I Y+A+        V  W +
Sbjct  177   EITIVSFFTLFGAIQCAAVALIAVKDSNAWKLRPDFELITIIYSAVFGGVVSFCVQTWCI  236

Query  879   RKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEVKEN  1058
             ++KGPVFVA+F PLG+  A IMGV FL D LY GSVIGA II  GFY VMW +  E ++ 
Sbjct  237   KRKGPVFVAIFKPLGIGIAAIMGVIFLGDTLYIGSVIGAIIIVTGFYGVMWAQTKEGEKG  296

Query  1059  IETNID---NSNEKVPLLPPNKGDS  1124
                 +D   +++EK PLL   + + 
Sbjct  297   EAQEVDGLPSTSEKAPLLQSRRDEQ  321



>emb|CDY11676.1| BnaC06g12840D [Brassica napus]
Length=366

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/322 (39%), Positives = 198/322 (61%), Gaps = 9/322 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RG+S ++++ YS  +A + LLP ++++ R    P   F +F +I   A+L 
Sbjct  36    NTLFKAATLRGLSFYVYIFYSYVVATIVLLPLSLIFGRSRRLPSAKFPVFVKIFFLAILG  95

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  +   G+EYSSPTL+SA+++L PAFTF  A++  +E + L+  ++ AK IGTIV I
Sbjct  96    LMSGLVGLKGVEYSSPTLSSAISNLTPAFTFTLAIIFRIEQVRLRSSATQAKIIGTIVSI  155

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQ-----SNWILGSFILVTSSLFISMLFLVQAW  677
             +GA V+  YKG  +L    +  N  L Q      S+W++G  +L +   FIS+ ++VQ  
Sbjct  156   SGALVVVLYKGHKVLTAAPSPSNISLDQHLTSSNSSWMIGGLLLASQYFFISVWYIVQTK  215

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             +++ YP E+ +        T++SA     AERN+ +W L+PD+ L AI Y+ +++  F  
Sbjct  216   VMEAYPEEITVIFFYNLFATLISAPVCFFAERNLTSWVLKPDISLAAIIYSGVLLSSFGL  275

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
              ++ W +  KGPV++++F PL +V AVI+G  FL D LY GSVIG+ I++LGFYTV+WGK
Sbjct  276   AMHTWGLHLKGPVYISLFKPLSIVIAVILGAIFLGDALYLGSVIGSVILSLGFYTVIWGK  335

Query  1038  AMEVKENIETNIDNSNEKVPLL  1103
             A   +E+    +  S E+ PLL
Sbjct  336   A---REDATKTVTGS-EQSPLL  353



>ref|NP_198839.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
 sp|F4KHA8.1|WTR41_ARATH RecName: Full=WAT1-related protein At5g40230 [Arabidopsis thaliana]
 gb|AED94522.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=370

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 206/333 (62%), Gaps = 22/333 (7%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RG+S ++FV Y+  +A L LLP ++++ R    P     +F  I + AL+ 
Sbjct  36    NTLFKAATLRGLSFYVFVFYTYVVATLVLLPLSLIFGRSKRLPSAKTPVFFNIFLLALVG  95

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             +    +   GIEYSSPTLASA+++L PAFTF  AV+  ME + L+  ++ AK IGTIV I
Sbjct  96    FMSLIVGCKGIEYSSPTLASAISNLTPAFTFTLAVIFRMEQIVLRSSATQAKIIGTIVSI  155

Query  513   TGAFVITFYKGPPLL-------------LFQHAYYNSLLPQQSNWILGSFILVTSSLFIS  653
             +GA V+  YKGP +L             L+QH     L    S+WI+G  +L T  L +S
Sbjct  156   SGALVVILYKGPKVLTDASLTPPSPTISLYQH-----LTSFDSSWIIGGLLLATQYLLVS  210

Query  654   MLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNA  833
             + +++Q  +++ YP E+ +  +     T++SA   + AE+++N++ L+P + L ++ Y+ 
Sbjct  211   VWYILQTRVMELYPEEITVVFLYNLCATLISAPVCLFAEKDLNSFILKPGVSLASVMYSG  270

Query  834   IIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALG  1013
              ++  F SV++ W +  KGPV++++F PL +V AV MGV FL D LY GSVIG+ I++LG
Sbjct  271   GLVSSFGSVIHTWGLHLKGPVYISLFKPLSIVIAVAMGVMFLGDALYLGSVIGSLILSLG  330

Query  1014  FYTVMWGKAMEVKENIETNIDNSNEKVPLLPPN  1112
             FYTV+WGKA E  ++I+T      E+ PLLP +
Sbjct  331   FYTVIWGKARE--DSIKTV--AGTEQSPLLPSH  359



>ref|XP_006470385.1| PREDICTED: WAT1-related protein At4g15540-like [Citrus sinensis]
Length=556

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 138/324 (43%), Positives = 194/324 (60%), Gaps = 10/324 (3%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL K A + GMSNF++V+Y NAL    LL   I        PVLTF +  R  +  +L  
Sbjct  232   TLGKAAMSSGMSNFVYVVYYNALGTFILLHYFIYNTYRSKGPVLTFSLLCRFFMLGVLGI  291

Query  336   A-GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                Q     GI+YSSPTLASAM +LIP  TF+ AV   ME ++++ RSS  K +GT+V I
Sbjct  292   CLVQIFAITGIKYSSPTLASAMGNLIPGITFLLAVFFRMEKVAIRSRSSQVKILGTVVSI  351

Query  513   TGAFVITFYKGPPLLLFQH-AYYNSLLP--QQSNWILGSFILVTSSLFISMLFLVQAWIL  683
              GAF+++ YKGPPLL F   +  N  LP  + SNW LG  +L  +    +   + QA +L
Sbjct  352   AGAFIVSLYKGPPLLGFSSPSNSNIQLPVSEYSNWALGGLLLTVTCFSSATWKIFQAAVL  411

Query  684   KDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             K+YP ++ L   +C   TI  A+ ++I ERN +AWKL+P ++  A+ Y AI+    RS +
Sbjct  412   KEYPDKINLVFFSCFFGTIQCAVVSIIVERNPSAWKLQPGIQRTAVIYAAIVGTVIRSSI  471

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
              AW ++KKGPVFVA+F PLG   AV M V FL +  + GS+IG  +IA GFY V+W +  
Sbjct  472   IAWCLQKKGPVFVALFKPLGTAIAVFMAVMFLGETPHLGSLIGTVVIAFGFYAVIWAQGK  531

Query  1044  EVKENIET----NIDNSNEKVPLL  1103
             E   N+ T    ++++ N+K+P L
Sbjct  532   E--SNMTTGNVGSLESLNQKIPPL  553



>gb|AES96252.2| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=304

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 160/233 (69%), Gaps = 9/233 (4%)
 Frame = +3

Query  153  NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             TL K AT  GMS FIF+ YSN LAL FLLPST+ +HR   PP ++  IF R+ +   L 
Sbjct  23   ETLMKSATKDGMSIFIFIFYSNLLALCFLLPSTLFHHRKRAPPPISTSIFCRLLLLGCLK  82

Query  333  YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             A QTL   GI++SSP LASA+ +L+PAFTFI A+++ ME+L++K+ SS AK IGT+V I
Sbjct  83   TATQTLMTSGIKFSSPALASAIVNLVPAFTFILAIISRMEVLNMKKHSSQAKVIGTVVSI  142

Query  513  TGAFVITFYKGPPLLLFQHAYYN-------SLLPQQSNWILGSFILVTSSLFISMLFLVQ  671
             GA V+TFYKG PL+    A  N         L  +S+WI+G+F++   S  +S+LF+VQ
Sbjct  143  AGALVVTFYKGIPLI--NDAIKNIEMGASGIFLLGKSDWIIGAFLVAVGSFCLSLLFIVQ  200

Query  672  AWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYN  830
             WI++DYP EL++  I C  V I+S I A+IAE N NAW+LRPD EL+++CY+
Sbjct  201  TWIVRDYPEELVINTICCCFVVIISTIVALIAEGNSNAWRLRPDKELLSVCYS  253



>ref|XP_009129384.1| PREDICTED: WAT1-related protein At3g28050 isoform X1 [Brassica 
rapa]
Length=367

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 135/340 (40%), Positives = 201/340 (59%), Gaps = 17/340 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT +GM   +F++YS  LA L LLPS    +R    P + F I  ++ +  L+ 
Sbjct  27    NTLFKAATLQGMGFHVFIVYSYGLAALLLLPSLFFSYRSRTLPPMNFSILYKVVLLGLIG  86

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                  + Y GI YSSPTLASA+++L PAFTF+ A++  ME +S K  SS+AK +GTIV I
Sbjct  87    CCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAILFRMESVSFKRTSSVAKMLGTIVSI  146

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLPQQSN--WILGSFILVTSSLFISMLFLVQAWILK  686
              GAF++T Y GP ++        SL  Q  N  WI+G+  L      + + ++VQ  I++
Sbjct  147   GGAFIVTLYNGPVVINMSPPSI-SLRSQSPNHDWIIGAGFLAVEYFMVPLWYIVQTQIMR  205

Query  687   DYPGELMLTVITCALVTILSAIAAMIAE-RNVNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +YP E  +       V+  + +  +  E  +++AWK++P++ L++I  + +      + +
Sbjct  206   EYPSEFTVVCYYSFGVSFWTGLVTLFTEGSDLSAWKIKPNIALVSIVCSGLFGSCINNTI  265

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WA+R KGP+FVAMF PL +  AV MGV FLRD LY GS+IGA++I +GFYTVMWGKA 
Sbjct  266   HTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLRDSLYIGSLIGATVITIGFYTVMWGKAK  325

Query  1044  E---VKENIETNIDNSNE----------KVPLLPPNKGDS  1124
             E   V+++ + N +++NE          K PLL   K D 
Sbjct  326   EMALVEDDNKANNEDANEADLDSPSGSQKAPLLESYKNDE  365



>ref|XP_010555908.1| PREDICTED: WAT1-related protein At3g28130-like [Tarenaya hassleriana]
Length=356

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 140/325 (43%), Positives = 198/325 (61%), Gaps = 13/325 (4%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K A+++GMS++ F+ YS A   L LLPS    HR    P L   I G+  +  ++ 
Sbjct  27    NTLFKAASSKGMSSYTFLFYSYAFGSLLLLPSLFSSHRSRSLPPLR--ILGKTGLLGVIG  84

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
                    Y GI++SSPTLASAM+++ PAFTFI AV+ GME +S+   SS+AK +GT V I
Sbjct  85    SIYLVTGYTGIKFSSPTLASAMSNVTPAFTFILAVIFGMEKISMGRESSVAKVVGTAVSI  144

Query  513   TGAFVITFYKGPPLLLFQHAYYNSLLP--QQSNWILGSFILVTSSLFISMLFLVQAWILK  686
              GA V   Y GPP+   +     SL P  + SNW+ G  +L      IS+ +++QA I+ 
Sbjct  145   GGALVAALYNGPPIFSVESQPSISLSPSPENSNWVAGGGLLAIKDTVISLSYILQAQIMS  204

Query  687   DYPGELMLTVITCALVTILSAIAAMIAERN-VNAWKLRPDMELIAICYNAIIMVGFRSVV  863
             +      +T I  A+V I S + ++IAERN  +AW +R D+  I I    I+  G+  V+
Sbjct  205   EQQSPFTVTFIYSAIVCISSVLVSVIAERNNPSAWSIRFDITSICIITAGILNPGYY-VI  263

Query  864   YAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAM  1043
             + WAVR KGPV++A+F PL +V AV+MG  FL D LY GS+IG ++I++GFY+VMWGKA 
Sbjct  264   HLWAVRYKGPVYIAIFRPLSIVIAVVMGAIFLGDSLYLGSLIGGTLISMGFYSVMWGKAK  323

Query  1044  EVKENIETNIDNS-----NEKVPLL  1103
             E  E  ET+  +S     ++K PLL
Sbjct  324   E--ETSETDETSSPPCLDSKKAPLL  346



>gb|EYU29711.1| hypothetical protein MIMGU_mgv1a009127mg [Erythranthe guttata]
Length=352

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 135/318 (42%), Positives = 198/318 (62%), Gaps = 8/318 (3%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             ++K+A T G S FI  +YSNALA L L P   L HR   PP LTF I  RI +       
Sbjct  33    VSKIAMTNGTSFFILSVYSNALATLILFPCGFLLHRSKLPP-LTFKILCRIFLLGCFGCL  91

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
                  Y GI  SS TL + + +L+P FT+I AV+  ME L+L++ S ++KS+GTI+ I G
Sbjct  92    ADIGSYAGINNSSATLGTELLNLVPGFTYILAVIFRMERLNLRKSSGISKSLGTIISILG  151

Query  519   AFVITFYKGPPLLLFQHAYYNSL---LPQQSNWILGSFILVTSSLFISMLFLVQAWILKD  689
             A ++T YKGP ++       +S    LP+Q NW+LG  +L  ++   +   +VQ+ ILK 
Sbjct  152   ASIVTLYKGPAIMNKALTLNSSAIISLPEQ-NWVLGGILLAIAAFSTAAWSIVQSSILKI  210

Query  690   YPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYA  869
             YP E+++  + C  VT+ S + A+IAE+++ AWKL+ DM L+A+ Y  II V +R  + +
Sbjct  211   YPAEMIIVAVYCLFVTMQSTVVALIAEKDMTAWKLQADMGLVAVLYAGIINVTYRLYIMS  270

Query  870   WAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAMEV  1049
             W + + GP+FV++F PL +V +V++GV FL + LY GSV GA ++  GFY V+WGKA E 
Sbjct  271   WCLTRTGPLFVSLFNPLTIVISVVIGVIFLHEVLYFGSVAGAVVLVTGFYAVIWGKAKER  330

Query  1050  KENIETNIDNSNEKVPLL  1103
             K N+E+    S E+V LL
Sbjct  331   KINVES---TSEEEVSLL  345



>ref|XP_010031116.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010031117.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW50384.1| hypothetical protein EUGRSUZ_J00139 [Eucalyptus grandis]
Length=352

 Score =   223 bits (567),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 135/328 (41%), Positives = 202/328 (62%), Gaps = 17/328 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTI--LYHRLMPPPVLTFGIFGRICITAL  326
              TL K A +RGMS ++F++Y+ ++  L LLP+    L  R++PP  L+F I  +I +  L
Sbjct  28    TTLFKAANSRGMSYYVFLVYAYSIGSLLLLPAPFFSLKSRVLPP--LSFVILAKIGLLGL  85

Query  327   LSYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIV  506
             +    Q   Y GI  SSPTL SA+++L PA TFI A++  ME +SL  RSS AK IGT++
Sbjct  86    IGGFSQIFGYAGISMSSPTLGSAISNLTPALTFILAILFRMEKVSLSRRSSQAKIIGTVM  145

Query  507   LITGAFVITFYKGPPLLLFQHAYYNSL------LPQQSNWILGSFILVTSSLFISMLFLV  668
              I+GA VIT YKG P+    H+   SL          SNW++G  +L    + +++ +++
Sbjct  146   SISGALVITLYKGLPI---THSPKPSLSLYPLVHSSNSNWVVGGILLTADYILVTLWYIL  202

Query  669   QAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVG  848
                I+KDYP EL +      +VT ++ I  ++ E +++AW++   + L ++  + I    
Sbjct  203   LKQIMKDYPAELTVMFFYNVIVTFMNTIVCLVMEHDMSAWRVL-GIGLASVICSGIFDRC  261

Query  849   FRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVM  1028
               + V+ WA+R KGP +VAMF PL +  AV MGV FLRD L+ GS+IGA+I+A+GFY VM
Sbjct  262   LNNTVHTWAIRLKGPFYVAMFKPLSIPVAVAMGVFFLRDTLHLGSLIGATILAIGFYIVM  321

Query  1029  WGKAME--VKENIETNIDNSN-EKVPLL  1103
             WGK  E  V+E+ E   D+S+ +KVPLL
Sbjct  322   WGKGKEEMVEESAEIRSDSSSFQKVPLL  349



>ref|XP_006476741.1| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Citrus 
sinensis]
Length=364

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 141/324 (44%), Positives = 193/324 (60%), Gaps = 17/324 (5%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
              TL+K A ++G +  I  +Y++A+A L LLP +   +R   PP LTF +   +C   +LS
Sbjct  29    TTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNRKNRPP-LTFAL---LCKVFILS  84

Query  333   YAGQTLQ----YIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGT  500
               G TL     Y G+ +SSPTL SA  +LIPAFTF+ AV+  ME + L+   S  K IGT
Sbjct  85    LIGITLMQICVYTGVSFSSPTLVSATNNLIPAFTFLLAVIFRMEKVDLRSLISQIKIIGT  144

Query  501   IVLITGAFVITFYKGPPL--LLFQHAYYN------SLLPQQSNWILGSFILVTSSLFISM  656
             +V I GAF+IT YKGP +  LLF+H          +LL    NW++G  +L  +S  I+ 
Sbjct  145   LVSIAGAFIITLYKGPSIVALLFEHQPKPQPPTSFTLLATTDNWVIGGILLSIASFSIAA  204

Query  657   LFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAI  836
               + QA ILK YP E+ +        TI  AI A+IAERN +AW++RP +ELI + Y AI
Sbjct  205   GNIFQAAILKSYPSEVTIVFFYILFGTIQCAIVALIAERNPDAWRIRPGIELITVMYTAI  264

Query  837   IMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGF  1016
                     + AW +R+KGPVFVAMF P+G+  A +M   FL D L+ GSVIGA II  GF
Sbjct  265   FGGLMLFGLVAWCLRRKGPVFVAMFNPVGIFIAALMSDIFLGDTLHLGSVIGAIIIVTGF  324

Query  1017  YTVMWGKAMEVKENIETNIDNSNE  1088
             Y VMW ++ E +E I+ N D  ++
Sbjct  325   YGVMWAQSKE-EEKIQANTDGRSQ  347



>ref|XP_008348035.1| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Malus 
domestica]
Length=359

 Score =   222 bits (566),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 135/325 (42%), Positives = 205/325 (63%), Gaps = 10/325 (3%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             T++K A +RGMS+++FV+YSNALA +FLLP  IL  +  P   L   +   + +  L+  
Sbjct  30    TVSKAAMSRGMSSYVFVVYSNALAAIFLLPCFILQKK--PATSLPLSLLCGLFLLGLIGS  87

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             +   L Y GI YSSPT++SAM +LIP FTF  AV+  +E  +L++ S+ AK +GTIV ++
Sbjct  88    SSLILAYNGINYSSPTVSSAMGNLIPIFTFALAVIFRIEKPNLRKSSTRAKLLGTIVSVS  147

Query  516   GAFVITFYKGPPLLLFQ-----HAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
             GAF++  YKG  +L FQ     +  Y   + Q++NW+ G F+L  S L  ++  +VQA I
Sbjct  148   GAFIVILYKGSAILKFQGLSPPNFSYQHFVSQRTNWVFGGFLLALSCLLAAIWNIVQAPI  207

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             + ++P +  +       VTI + I ++I ERN N+W LRPD+E+IAI  +A+    FR+ 
Sbjct  208   VNNFPSKETIVFFYIFFVTIQTTIYSLIVERNPNSWVLRPDIEMIAIVCSAMFGSVFRTA  267

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             V+ W +++ GP+FV MF PLG+  A  M V FL + L+ GSVIG+ IIA+GFY ++WG+ 
Sbjct  268   VHVWCLQQNGPIFVTMFRPLGVAIAAAMVVIFLGESLHLGSVIGSIIIAIGFYAMIWGQI  327

Query  1041  MEVKENIETNIDNS---NEKVPLLP  1106
              E K  +E  + +S    ++ PLLP
Sbjct  328   KEHKIAMENEVHSSASATQQAPLLP  352



>ref|XP_007226752.1| hypothetical protein PRUPE_ppa018854mg [Prunus persica]
 gb|EMJ27951.1| hypothetical protein PRUPE_ppa018854mg [Prunus persica]
Length=350

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/330 (40%), Positives = 202/330 (61%), Gaps = 15/330 (5%)
 Frame = +3

Query  159   LNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYA  338
             L K A + G+S +  V+YSNAL+ L L PS+ ++HRL  PP L+F I     +   +  +
Sbjct  25    LTKEAMSIGLSEYTLVVYSNALSTLILTPSSFIFHRLERPP-LSFYIVFSFFLLGFIGTS  83

Query  339   GQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITG  518
              Q +   G+ Y+S TL + M +LIPAFTFI A++  ME L+ +  SS AKS G +V ITG
Sbjct  84    AQLMGLAGLNYASATLNTTMLNLIPAFTFILALLFRMEKLNWRSSSSQAKSFGAVVSITG  143

Query  519   AFVITFYKGPPLLLFQHAYYNS-------LLPQQSNWILGSFILVTSSLFISMLFLVQAW  677
             AFV+TFYKGP ++   H   +S       L   +S+W+LG  +L   +   S+  ++QA 
Sbjct  144   AFVVTFYKGPAVI---HQRLSSDPLSGPCLFSPKSHWVLGGSLLAAEAFMSSLWIILQAL  200

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             ILK YP  L+L    C  VTI +A+A++I  ++ +AW L+P++ L A+ Y+A++    R+
Sbjct  201   ILKKYPAVLILASFYCFFVTIQAALASLILVKDPSAWSLKPNIGLFAVLYSAVVGTALRT  260

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
                AW +++ GP++V+MF PL +V A ++ V FL   L+ GS++GA++I  GFY V+WGK
Sbjct  261   SAVAWCLQRTGPLYVSMFKPLAVVVADVIDVIFLGQALHLGSLVGAAVIITGFYAVIWGK  320

Query  1038  AMEVKENIETN----IDNSNEKVPLLPPNK  1115
             A E K + ++      ++S+E  PLL   K
Sbjct  321   AREEKLHEDSGEGQWSESSSESTPLLQSAK  350



>ref|XP_010031126.1| PREDICTED: WAT1-related protein At3g28050-like [Eucalyptus grandis]
 gb|KCW50390.1| hypothetical protein EUGRSUZ_J00146 [Eucalyptus grandis]
Length=365

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 205/317 (65%), Gaps = 5/317 (2%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAGQ  344
             K A +RGMS+ +F++Y+  LA L LLP+    H+    P L+  I  ++ +  L+    Q
Sbjct  49    KAANSRGMSSHVFIVYAYGLASLLLLPAPFFSHKSRALPPLSLAIAAKLGLLGLIGGFAQ  108

Query  345   TLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAF  524
              L Y GI  SSPTLASA+++LIPA TFI A +  ME +SL  RSS AK IGTI+ I+GA 
Sbjct  109   VLGYAGISMSSPTLASAISNLIPALTFIIACLFRMEEVSLNRRSSQAKIIGTILSISGAS  168

Query  525   VITFYKGPPLLLFQHAYYNSLL-PQQSNWILGSFILVTSSLFISMLFLVQAWILKDYPGE  701
             VIT YKGPP++    +   +L+    SNW++G  +L   ++ I++ +++   I+K+YP E
Sbjct  169   VITLYKGPPVIFTAKSSSFALVQASSSNWVVGGILLTAKNILITLWYILMKQIMKEYPAE  228

Query  702   LMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSVVYAWAVR  881
             L +     A+VT ++AI  ++ E +++AW++   + L ++ +++       +++ AWA+R
Sbjct  229   LTVIFFYNAVVTFVTAIVCLVTEPDISAWRVW-GIGLASVIFSSFFGQCLNNIIRAWAIR  287

Query  882   KKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKAME--VKE  1055
              KGP +VAMF PL +  AV MGV FL D L+ GS++GA+I+ +GFY V+WGKA E  V+E
Sbjct  288   LKGPFYVAMFKPLSIPMAVAMGVFFLGDRLHLGSIVGATILCIGFYIVLWGKAKEERVEE  347

Query  1056  NIETNIDN-SNEKVPLL  1103
             ++E  +++ S +KVPLL
Sbjct  348   SVEHRMESPSFQKVPLL  364



>ref|XP_007151109.1| hypothetical protein PHAVU_004G018600g [Phaseolus vulgaris]
 gb|ESW23103.1| hypothetical protein PHAVU_004G018600g [Phaseolus vulgaris]
Length=364

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/331 (40%), Positives = 196/331 (59%), Gaps = 8/331 (2%)
 Frame = +3

Query  156   TLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSY  335
             TL KVA+ +GM++ +FV Y+ A+A   LLP T  + R    P ++F I  +I +  ++  
Sbjct  29    TLFKVASLQGMNSHVFVAYAYAVATTVLLPVTFFHRRSRGVPPISFSILSKIVLLGVIGS  88

Query  336   AGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLIT  515
             + Q L Y GI YSSP LAS++  L+PAFTFI AV+  ME L+ K RSS AK +G+I+ I+
Sbjct  89    SSQILGYAGISYSSPALASSIGILVPAFTFILAVLCRMEKLAAKSRSSQAKVMGSIISIS  148

Query  516   GAFVITFYKGPPLL-------LFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQA  674
             GAFV+TFYKGP +L       L      N L  + ++W  G  +L+   +  S+ ++++ 
Sbjct  149   GAFVLTFYKGPSILNAHKHLSLSLQQPMNFLKSEDASWATGGILLIGDYILTSVWYILEE  208

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
              IL+ +P EL L        TI +    +    + +AWK+  ++ LI+I  + I      
Sbjct  209   DILRVFPDELTLVFFYSVTATIFTTTVGLFGVPDASAWKIGLNVSLISIVCSGIFGKLMS  268

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
             +VVYAWA+  KG VFV  F P  +V AV MGV FL D LY GSV+GA I+++G Y V+WG
Sbjct  269   NVVYAWALNLKGSVFVTSFRPFQIVIAVGMGVMFLDDTLYIGSVVGAIIVSIGLYVVLWG  328

Query  1035  KAMEVKENIETNIDN-SNEKVPLLPPNKGDS  1124
             KA E  E +  ++++ + E VPLL   + ++
Sbjct  329   KATEEIEEVVGSLESPTTENVPLLQSQRTET  359



>ref|XP_011098767.1| PREDICTED: WAT1-related protein At5g40240-like [Sesamum indicum]
Length=364

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/327 (40%), Positives = 192/327 (59%), Gaps = 14/327 (4%)
 Frame = +3

Query  165   KVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLSYAGQ  344
             K A  +G+S  +F+ YS A++ L  LP     HR    P LT G+FGRI +  ++ +  Q
Sbjct  33    KAAVVKGLSYHVFMAYSYAISALVTLPLAYFSHRKTALPPLTLGVFGRIFLLGVIGFVSQ  92

Query  345   TLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLITGAF  524
             +  Y GIE S+PT++SAM++L PA TF  A++  ME L L   SS AK +GT+V ITGA 
Sbjct  93    SCGYKGIELSNPTMSSAMSNLNPATTFFLAILFRMEKLKLTSVSSQAKIVGTLVSITGAL  152

Query  525   VITFYKGP----------PLLLFQHAYYNSLLPQQSNWILGSFILVTSSLFISMLFLVQA  674
             V+  Y+GP          PL  F  +     + +Q+NWI+G  +L  +++ +S+  ++QA
Sbjct  153   VVVLYQGPMVITTHRHRSPLSEFLSSIVLRAMSEQANWIVGGGLLAAANILLSIWDILQA  212

Query  675   WILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFR  854
               +KDYP E +          I+S    +++E  ++AW +  D++L AI Y+ I+   F 
Sbjct  213   KFVKDYPAEFIWVFWYNLSSFIVSLPVGIMSEPKLSAWIVPVDVKLSAIVYSGIMGTAFS  272

Query  855   SVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWG  1034
             ++V+ W +  KGPV+VAMF PL +  A I+GV  L D+LY GSV+G+SII++GFYTVMWG
Sbjct  273   TIVHIWGLHVKGPVYVAMFKPLSIAIAAILGVVSLGDNLYLGSVVGSSIISVGFYTVMWG  332

Query  1035  KAME----VKENIETNIDNSNEKVPLL  1103
             K  E      E       NSN + PLL
Sbjct  333   KIKEEISDTPEYYSGEASNSNGEAPLL  359



>ref|XP_002868665.1| hypothetical protein ARALYDRAFT_330483 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44924.1| hypothetical protein ARALYDRAFT_330483 [Arabidopsis lyrata subsp. 
lyrata]
Length=367

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/333 (39%), Positives = 203/333 (61%), Gaps = 21/333 (6%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             NTL K AT RG+S ++FV Y+   A L LLP ++++ R    P     +F  I + AL+ 
Sbjct  36    NTLFKAATLRGLSFYVFVFYTYVGATLVLLPLSLIFGRSKRLPSAKTPVFFYIFLLALVG  95

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             +    +   GIEYSSPTLASA+++L PAFTF  AV+  ME + L+  ++ AK IGTIV I
Sbjct  96    FMSLIVGCKGIEYSSPTLASAISNLTPAFTFTLAVIFRMEQVVLRSSATQAKIIGTIVSI  155

Query  513   TGAFVITFYKGPPLL-------------LFQHAYYNSLLPQQSNWILGSFILVTSSLFIS  653
             +GA V+  YKGP +L             L+QH     L    S+WI+G  +L T  L +S
Sbjct  156   SGALVVVLYKGPKVLTDATLTPPSPTISLYQH-----LTSFDSSWIIGGLLLATQYLLVS  210

Query  654   MLFLVQAWILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNA  833
             + +++Q  +++ YP E+ +  +     T++SA   + AE+++ ++ L+P + L ++ Y+ 
Sbjct  211   VWYILQTRVMELYPEEITVVFLYNLCATLISAPVCLFAEKDLTSFVLKPGVSLASVMYSG  270

Query  834   IIMVGFRSVVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALG  1013
              ++  F SV++ W +  KGPV++++F PL +V AV MGV FL D LY  SVIG+ I++LG
Sbjct  271   GLVSSFGSVIHTWGLHLKGPVYISLFKPLSIVIAVAMGVIFLGDALYLRSVIGSVILSLG  330

Query  1014  FYTVMWGKAMEVKENIETNIDNSNEKVPLLPPN  1112
             FYTV+WGKA   +E+    + ++ ++ PLLP +
Sbjct  331   FYTVIWGKA---REDSTKTVADTEQQSPLLPSH  360



>ref|XP_006470392.1| PREDICTED: WAT1-related protein At5g40240-like [Citrus sinensis]
Length=346

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/322 (40%), Positives = 195/322 (61%), Gaps = 10/322 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPP-PVLTFGIFGRICITALL  329
             N L K+AT +GMS F+F+ YS+A A L LL    ++       P+L F +  RIC+ +L+
Sbjct  27    NILFKLATNKGMSYFVFIFYSSATATLVLLLFPFIFRSNTASLPLLKFPVISRICLLSLI  86

Query  330   SYAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVL  509
                 + L Y GI YSSPTLAS +++L P FTF  A++  ME L+L+   + AK IGT+V 
Sbjct  87    GSLLRILGYTGIAYSSPTLASMISNLTPGFTFTLAIIFRMEKLALRSLGTWAKIIGTVVS  146

Query  510   ITGAFVITFYKGPPLLLFQHAYYNSLL----PQQSNWILGSFILVTSSLFISMLFLVQAW  677
             ++GA ++  YKGP ++        SL       QS W++G  +L+  +L IS+ +++Q  
Sbjct  147   VSGAMLVVLYKGPTIISPSSTALQSLQWPLQSTQSKWVMGGLLLLMENLLISVWYIIQTQ  206

Query  678   ILKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRS  857
             I+K YP E ++T++ C   TI+SA    + E N++AW+L+PD+EL +I Y+A   + F +
Sbjct  207   IIKLYPAEFVVTLLYCVFATIISAPICFLGESNLSAWRLKPDIELASIVYSAFFGLTFST  266

Query  858   VVYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGK  1037
             VV+ + +  KGPV+ A+F PL +  A IM   FL + L+ GSVIG  II +GFY V+WGK
Sbjct  267   VVHTFGLHMKGPVYTAIFKPLSVAIAAIMSFIFLGESLHLGSVIGGVIICVGFYVVIWGK  326

Query  1038  AMEVKENIETNIDNSNEKVPLL  1103
             A     N E   +  + KV LL
Sbjct  327   A-----NDEEGGNEDSSKVSLL  343



>ref|XP_007217782.1| hypothetical protein PRUPE_ppa020036mg [Prunus persica]
 gb|EMJ18981.1| hypothetical protein PRUPE_ppa020036mg [Prunus persica]
Length=360

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/331 (38%), Positives = 194/331 (59%), Gaps = 11/331 (3%)
 Frame = +3

Query  153   NTLNKVATTRGMSNFIFVLYSNalallfllPSTILYHRLMPPPVLTFGIFGRICITALLS  332
             N L K AT++G+S ++F++YSN +A L LLP   ++ R    P     +  +I +  L+ 
Sbjct  27    NVLFKAATSKGLSYYVFIVYSNIIATLVLLPLFFIFRR-TGLPSFNLSLLSKIFLLGLIG  85

Query  333   YAGQTLQYIGIEYSSPTLASAMADLIPAFTFIFAVVAGMEILSLKERSSLAKSIGTIVLI  512
             +      Y G+ YSSPTL+SAM++L PAFTFI AV   ME L+L+  S+ AK +GT+V I
Sbjct  86    FLADICGYKGLNYSSPTLSSAMSNLTPAFTFILAVFFRMEKLALRSSSTQAKIMGTLVSI  145

Query  513   TGAFVITFYKGPPLLLFQHAYYNS----LLPQQSNWILGSFILVTSSLFISMLFLVQAWI  680
             +GA V+  YKGP +L       +     L   + NW++G  +L    L  S  +++Q  +
Sbjct  146   SGALVVVLYKGPTILSTASTVLSPPSAVLGTSEKNWVVGGLLLAVQYLLSSTWYILQTHV  205

Query  681   LKDYPGELMLTVITCALVTILSAIAAMIAERNVNAWKLRPDMELIAICYNAIIMVGFRSV  860
             +K YP E++L  +     TI+SA   +IAE N++AW+LRP + L+AI  +  +   F S+
Sbjct  206   MKTYPAEIVLVFLFNLCGTIISAPVCLIAETNLSAWRLRPGIALVAIICSGCLGSSFSSL  265

Query  861   VYAWAVRKKGPVFVAMFIPLGMVAAVIMGVTFLRDDLYTGSVIGASIIALGFYTVMWGKA  1040
             V+ W +  KGPVF+++F PL +  A    V FL D L  GSV+GA I+++GFY V+WGKA
Sbjct  266   VHTWGLHLKGPVFISIFKPLSIAIAAAFSVIFLGDALSLGSVVGAIILSMGFYAVIWGKA  325

Query  1041  MEVKENIETNIDNSNE------KVPLLPPNK  1115
              E + + +   ++S        K PLL  +K
Sbjct  326   KEDETSEDCRFESSRALPIALGKTPLLESHK  356



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2917093240962