BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16983_g1_i1 len=1630 path=[1706:0-1246 3352:1247-1326
3031:1327-1335 3040:1336-1629]

Length=1630
                                                                      Score     E

ref|XP_004230332.1|  PREDICTED: WAT1-related protein At1g09380-like     445   2e-149   
ref|XP_009794409.1|  PREDICTED: WAT1-related protein At1g09380-like     445   5e-149   
ref|XP_006344799.1|  PREDICTED: WAT1-related protein At1g09380-li...    443   2e-148   
ref|XP_009629514.1|  PREDICTED: WAT1-related protein At1g09380-like     442   5e-148   
gb|EYU19418.1|  hypothetical protein MIMGU_mgv1a009113mg                431   4e-144   
ref|XP_011087522.1|  PREDICTED: WAT1-related protein At1g09380          427   5e-142   
ref|XP_009616803.1|  PREDICTED: WAT1-related protein At1g09380-li...    420   1e-139   
ref|XP_009777189.1|  PREDICTED: WAT1-related protein At1g09380-li...    415   2e-137   
emb|CDP15218.1|  unnamed protein product                                414   3e-137   
ref|XP_009625723.1|  PREDICTED: WAT1-related protein At1g09380-li...    414   6e-137   
ref|XP_006341313.1|  PREDICTED: WAT1-related protein At1g09380-like     412   2e-136   
ref|XP_004252215.1|  PREDICTED: WAT1-related protein At1g09380          410   6e-136   
ref|XP_006344854.1|  PREDICTED: WAT1-related protein At1g09380-like     408   2e-134   
ref|XP_004231303.1|  PREDICTED: WAT1-related protein At1g09380-like     405   2e-133   
ref|XP_009616805.1|  PREDICTED: WAT1-related protein At1g09380-li...    400   5e-132   
ref|XP_009616806.1|  PREDICTED: WAT1-related protein At1g09380-li...    397   4e-131   
ref|XP_009768038.1|  PREDICTED: WAT1-related protein At1g09380-like     387   2e-126   
ref|NP_172409.1|  nodulin MtN21-like transporter family protein         384   3e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004230335.1|  PREDICTED: WAT1-related protein At1g09380          383   8e-125   
ref|XP_004230333.1|  PREDICTED: WAT1-related protein At1g09380-like     380   9e-124   
ref|XP_002892502.1|  hypothetical protein ARALYDRAFT_888180             380   2e-123   
ref|XP_006344855.1|  PREDICTED: WAT1-related protein At1g09380-like     379   3e-123   
ref|XP_009777190.1|  PREDICTED: WAT1-related protein At1g09380-li...    377   7e-123   
emb|CDX94976.1|  BnaC05g06950D                                          377   1e-122   
ref|XP_009625724.1|  PREDICTED: WAT1-related protein At1g09380-li...    376   2e-122   
ref|XP_010314776.1|  PREDICTED: WAT1-related protein At1g09380-li...    375   3e-122   
ref|XP_002277072.1|  PREDICTED: WAT1-related protein At1g09380          374   2e-121   Vitis vinifera
ref|XP_004230334.1|  PREDICTED: WAT1-related protein At1g09380-like     374   2e-121   
emb|CDX94974.1|  BnaC05g06970D                                          373   5e-121   
ref|XP_009148234.1|  PREDICTED: WAT1-related protein At1g09380          372   1e-120   
ref|XP_007031215.1|  Nodulin MtN21 /EamA-like transporter family ...    372   2e-120   
gb|AAM65466.1|  putative nodulin protein, N21                           371   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417578.1|  hypothetical protein EUTSA_v10007900mg             371   4e-120   
ref|XP_010475772.1|  PREDICTED: WAT1-related protein At1g09380          370   6e-120   
emb|CDY69907.1|  BnaA06g37940D                                          370   8e-120   
ref|XP_006305109.1|  hypothetical protein CARUB_v10009476mg             370   1e-119   
ref|XP_006344801.1|  PREDICTED: WAT1-related protein At1g09380-li...    369   1e-119   
ref|XP_002512549.1|  Auxin-induced protein 5NG4, putative               369   3e-119   Ricinus communis
ref|XP_010026174.1|  PREDICTED: WAT1-related protein At1g09380-like     368   5e-119   
ref|XP_010458220.1|  PREDICTED: WAT1-related protein At1g09380-like     367   7e-119   
gb|KDP23359.1|  hypothetical protein JCGZ_23192                         367   1e-118   
gb|KEH24463.1|  nodulin MtN21/EamA-like transporter family protein      366   3e-118   
emb|CBI39638.3|  unnamed protein product                                373   3e-118   
ref|XP_010489953.1|  PREDICTED: WAT1-related protein At1g09380-like     364   2e-117   
ref|XP_011038989.1|  PREDICTED: WAT1-related protein At1g09380          363   3e-117   
ref|XP_010270886.1|  PREDICTED: WAT1-related protein At1g09380 is...    362   5e-117   
ref|XP_003536035.1|  PREDICTED: WAT1-related protein At1g09380-like     363   6e-117   
ref|XP_009118319.1|  PREDICTED: WAT1-related protein At1g09380-like     362   8e-117   
ref|XP_010674547.1|  PREDICTED: WAT1-related protein At1g09380          361   3e-116   
ref|XP_006382304.1|  hypothetical protein POPTR_0005s00820g             359   1e-115   
ref|XP_010544146.1|  PREDICTED: WAT1-related protein At1g09380          359   2e-115   
ref|XP_003520787.1|  PREDICTED: WAT1-related protein At1g09380-li...    357   8e-115   
ref|XP_007208228.1|  hypothetical protein PRUPE_ppa018179mg             356   1e-114   
ref|XP_008246269.1|  PREDICTED: WAT1-related protein At1g09380          355   3e-114   
gb|KFK43234.1|  hypothetical protein AALP_AA1G097400                    355   5e-114   
ref|XP_004494524.1|  PREDICTED: WAT1-related protein At1g09380-like     354   1e-113   
ref|XP_003554607.1|  PREDICTED: WAT1-related protein At1g09380-li...    353   2e-113   
gb|AFK39803.1|  unknown                                                 351   2e-112   
gb|EPS65422.1|  hypothetical protein M569_09355                         350   2e-112   
ref|XP_010026177.1|  PREDICTED: WAT1-related protein At1g09380-like     350   2e-112   
ref|XP_003555788.1|  PREDICTED: WAT1-related protein At1g09380-like     350   3e-112   
ref|XP_007163305.1|  hypothetical protein PHAVU_001G223600g             350   4e-112   
ref|XP_006344802.1|  PREDICTED: WAT1-related protein At1g09380-li...    350   4e-112   
ref|XP_010921389.1|  PREDICTED: WAT1-related protein At1g09380          350   9e-112   
ref|XP_006428234.1|  hypothetical protein CICLE_v10012006mg             348   2e-111   
ref|XP_004166072.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    348   2e-111   
ref|XP_008781052.1|  PREDICTED: WAT1-related protein At1g09380          347   6e-111   
ref|XP_004139525.1|  PREDICTED: auxin-induced protein 5NG4-like         347   6e-111   
gb|KHG28119.1|  Auxin-induced protein 5NG4                              347   9e-111   
gb|AAO60108.1|  nodulin-like protein                                    346   1e-110   Gossypium hirsutum [American cotton]
gb|AAO60157.1|  putative nodulin protein                                345   3e-110   Gossypium hirsutum [American cotton]
ref|XP_009794905.1|  PREDICTED: WAT1-related protein At1g09380-like     343   4e-110   
ref|XP_010026180.1|  PREDICTED: WAT1-related protein At1g09380-like     344   9e-110   
ref|XP_004302299.1|  PREDICTED: auxin-induced protein 5NG4-like         341   1e-108   
gb|KHG28117.1|  ADP-ribosylation factor 2                               347   1e-108   
ref|XP_008453225.1|  PREDICTED: WAT1-related protein At1g09380          339   5e-108   
ref|XP_009794851.1|  PREDICTED: WAT1-related protein At1g09380-li...    337   7e-108   
ref|XP_008463595.1|  PREDICTED: WAT1-related protein At1g09380-like     336   9e-107   
ref|XP_010092938.1|  Auxin-induced protein 5NG4                         335   7e-106   
ref|XP_008364022.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    333   1e-105   
ref|XP_008370594.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    333   2e-105   
ref|XP_009366070.1|  PREDICTED: WAT1-related protein At1g09380          332   3e-105   
ref|XP_009387482.1|  PREDICTED: WAT1-related protein At1g09380-like     331   9e-105   
gb|AAC33198.1|  Similar to MtN21, gi|2598575, Megicago truncatula...    331   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004144805.1|  PREDICTED: auxin-induced protein 5NG4-like         330   2e-104   
ref|XP_008350587.1|  PREDICTED: WAT1-related protein At1g09380-like     328   1e-103   
ref|XP_006344800.1|  PREDICTED: WAT1-related protein At1g09380-li...    323   4e-103   
ref|XP_009417762.1|  PREDICTED: WAT1-related protein At1g09380-like     325   2e-102   
ref|XP_009335510.1|  PREDICTED: WAT1-related protein At1g09380-like     325   3e-102   
ref|XP_009794852.1|  PREDICTED: WAT1-related protein At1g09380-li...    320   9e-102   
ref|XP_010270887.1|  PREDICTED: WAT1-related protein At1g09380 is...    319   1e-100   
ref|XP_009623882.1|  PREDICTED: WAT1-related protein At1g09380-like     317   3e-98    
ref|XP_003589590.1|  Auxin-induced protein 5NG4                         312   2e-97    
ref|XP_009616810.1|  PREDICTED: WAT1-related protein At1g09380-li...    300   4e-94    
ref|XP_004253026.2|  PREDICTED: WAT1-related protein At1g09380-li...    298   5e-93    
gb|EMS59309.1|  Auxin-induced protein 5NG4                              301   7e-93    
ref|XP_006577206.1|  PREDICTED: WAT1-related protein At1g09380-li...    297   9e-93    
emb|CDY64772.1|  BnaC08g49990D                                          297   1e-92    
ref|XP_010230816.1|  PREDICTED: WAT1-related protein At1g09380-like     299   4e-92    
gb|EMT10029.1|  Auxin-induced protein 5NG4                              299   4e-92    
ref|XP_006604784.1|  PREDICTED: WAT1-related protein At1g09380-li...    295   9e-92    
ref|NP_001042809.1|  Os01g0297700                                       296   3e-91    Oryza sativa Japonica Group [Japonica rice]
emb|CDM82961.1|  unnamed protein product                                295   9e-91    
gb|EAY73629.1|  hypothetical protein OsI_01515                          292   1e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_002455503.1|  hypothetical protein SORBIDRAFT_03g012300          291   5e-89    Sorghum bicolor [broomcorn]
ref|XP_004967586.1|  PREDICTED: WAT1-related protein At1g09380-like     290   8e-89    
emb|CDY06357.1|  BnaA09g48460D                                          285   5e-88    
gb|KHN43359.1|  Auxin-induced protein 5NG4                              281   5e-86    
ref|NP_001145854.1|  hypothetical protein                               283   6e-86    Zea mays [maize]
gb|KHN02821.1|  Auxin-induced protein 5NG4                              279   2e-85    
ref|XP_008654544.1|  PREDICTED: hypothetical protein isoform X6         279   3e-84    
ref|XP_008785911.1|  PREDICTED: WAT1-related protein At1g25270-like     277   4e-84    
ref|XP_006644097.1|  PREDICTED: WAT1-related protein At1g09380-like     278   5e-84    
ref|XP_008654543.1|  PREDICTED: hypothetical protein isoform X5         271   5e-81    
ref|XP_009616814.1|  PREDICTED: WAT1-related protein At1g09380-like     267   1e-80    
ref|XP_009399308.1|  PREDICTED: WAT1-related protein At1g68170-like     268   3e-80    
ref|XP_010911986.1|  PREDICTED: WAT1-related protein At1g25270-like     265   2e-79    
ref|XP_004166799.1|  PREDICTED: auxin-induced protein 5NG4-like         266   2e-79    
ref|XP_010684310.1|  PREDICTED: WAT1-related protein At1g68170-like     265   4e-79    
ref|XP_006838307.1|  hypothetical protein AMTR_s00103p00127060          263   9e-79    
ref|XP_008781415.1|  PREDICTED: WAT1-related protein At1g68170-like     264   1e-78    
ref|XP_002277022.1|  PREDICTED: WAT1-related protein At1g68170-li...    263   3e-78    Vitis vinifera
ref|XP_010531902.1|  PREDICTED: WAT1-related protein At1g68170-li...    261   1e-77    
ref|XP_006838306.1|  hypothetical protein AMTR_s00103p00126500          259   1e-77    
gb|ABR16695.1|  unknown                                                 261   2e-77    Picea sitchensis
gb|AFK33606.1|  unknown                                                 257   2e-77    
ref|XP_006432264.1|  hypothetical protein CICLE_v10003704mg             259   1e-76    
ref|XP_010068198.1|  PREDICTED: WAT1-related protein At1g68170-like     258   2e-76    
ref|XP_010261295.1|  PREDICTED: WAT1-related protein At1g68170          258   5e-76    
ref|XP_011029206.1|  PREDICTED: WAT1-related protein At1g25270-like     256   6e-76    
gb|KHG16428.1|  Auxin-induced 5NG4                                      256   7e-76    
ref|XP_007148451.1|  hypothetical protein PHAVU_006G210000g             257   8e-76    
gb|EEE60997.1|  hypothetical protein OsJ_14806                          254   1e-75    Oryza sativa Japonica Group [Japonica rice]
emb|CAE05944.3|  OSJNBb0088C09.3                                        254   2e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006399183.1|  hypothetical protein EUTSA_v10015938mg             256   2e-75    
gb|ABK25095.1|  unknown                                                 255   2e-75    Picea sitchensis
dbj|BAF46315.1|  nodulin-like protein                                   250   3e-75    Ipomoea nil [qian niu]
emb|CBI37609.3|  unnamed protein product                                253   7e-75    
gb|EEC77269.1|  hypothetical protein OsI_15893                          253   7e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_008457201.1|  PREDICTED: WAT1-related protein At1g25270-like     253   8e-75    
ref|XP_008457270.1|  PREDICTED: WAT1-related protein At1g25270-like     254   9e-75    
ref|XP_006846485.1|  hypothetical protein AMTR_s00018p00139030          252   1e-74    
ref|XP_004249118.1|  PREDICTED: WAT1-related protein At5g07050          253   1e-74    
dbj|BAK02715.1|  predicted protein                                      253   3e-74    
ref|XP_003572196.1|  PREDICTED: WAT1-related protein At1g09380-like     249   9e-74    
ref|XP_006644860.1|  PREDICTED: WAT1-related protein At5g07050-like     251   1e-73    
gb|KFK25097.1|  hypothetical protein AALP_AA8G066000                    251   1e-73    
ref|XP_006364778.1|  PREDICTED: WAT1-related protein At5g07050-like     250   2e-73    
ref|XP_010941182.1|  PREDICTED: WAT1-related protein At3g30340-like     249   2e-73    
emb|CDM84603.1|  unnamed protein product                                250   2e-73    
gb|EMT31802.1|  Auxin-induced protein 5NG4                              250   3e-73    
ref|XP_007041588.1|  Mtn21-like protein, putative isoform 2             249   3e-73    
ref|XP_004139017.1|  PREDICTED: auxin-induced protein 5NG4-like         249   4e-73    
ref|XP_008342773.1|  PREDICTED: WAT1-related protein At1g25270-like     249   4e-73    
gb|AES63368.2|  auxin-induced 5NG4-like protein                         249   7e-73    
ref|XP_003593117.1|  Auxin-induced protein 5NG4                         249   7e-73    
ref|XP_004959978.1|  PREDICTED: WAT1-related protein At1g25270-like     249   7e-73    
gb|KHN43349.1|  Auxin-induced protein 5NG4                              244   1e-72    
ref|XP_010103862.1|  Auxin-induced protein 5NG4                         250   1e-72    
ref|XP_010068190.1|  PREDICTED: WAT1-related protein At1g68170-like     247   2e-72    
ref|XP_006844156.1|  hypothetical protein AMTR_s00006p00261210          246   2e-72    
ref|XP_002277059.2|  PREDICTED: uncharacterized protein LOC100243646    256   3e-72    Vitis vinifera
ref|XP_003564421.1|  PREDICTED: WAT1-related protein At5g07050          247   3e-72    
ref|XP_004163894.1|  PREDICTED: auxin-induced protein 5NG4-like         247   3e-72    
ref|XP_009354252.1|  PREDICTED: WAT1-related protein At1g25270-like     247   3e-72    
ref|XP_003572197.1|  PREDICTED: WAT1-related protein At1g09380-like     246   4e-72    
ref|NP_001172290.1|  Os01g0296900                                       246   4e-72    
ref|XP_008378803.1|  PREDICTED: WAT1-related protein At1g25270-like     247   4e-72    
emb|CDX70003.1|  BnaA10g23520D                                          247   4e-72    
ref|XP_009341318.1|  PREDICTED: WAT1-related protein At1g25270-like     246   5e-72    
ref|XP_010649426.1|  PREDICTED: WAT1-related protein At1g68170-li...    246   5e-72    
ref|XP_010068193.1|  PREDICTED: WAT1-related protein At1g68170-like     246   1e-71    
ref|XP_009391606.1|  PREDICTED: WAT1-related protein At5g07050-like     245   2e-71    
ref|XP_009621489.1|  PREDICTED: WAT1-related protein At5g07050-li...    245   2e-71    
ref|XP_008788560.1|  PREDICTED: WAT1-related protein At5g07050-like     245   2e-71    
ref|XP_002447365.1|  hypothetical protein SORBIDRAFT_06g033770          244   2e-71    Sorghum bicolor [broomcorn]
ref|XP_009790909.1|  PREDICTED: WAT1-related protein At5g07050-li...    245   2e-71    
ref|XP_010934894.1|  PREDICTED: WAT1-related protein At3g30340-like     244   2e-71    
ref|XP_010105267.1|  Auxin-induced protein 5NG4                         244   2e-71    
ref|XP_009122385.1|  PREDICTED: WAT1-related protein At5g07050          245   2e-71    
ref|XP_007148017.1|  hypothetical protein PHAVU_006G173600g             244   2e-71    
ref|XP_006604312.1|  PREDICTED: WAT1-related protein At5g07050-like     244   3e-71    
ref|XP_010103868.1|  Auxin-induced protein 5NG4                         245   3e-71    
ref|XP_007041587.1|  Nodulin MtN21 /EamA-like transporter family ...    247   3e-71    
ref|XP_009610629.1|  PREDICTED: WAT1-related protein At5g07050-li...    244   3e-71    
dbj|BAB92246.1|  putative nodulin MtN21                                 244   3e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004230592.1|  PREDICTED: WAT1-related protein At1g68170-li...    244   4e-71    
ref|XP_010241528.1|  PREDICTED: WAT1-related protein At3g30340-li...    243   5e-71    
ref|XP_002873292.1|  hypothetical protein ARALYDRAFT_487525             244   6e-71    
gb|KDP46086.1|  hypothetical protein JCGZ_06597                         244   7e-71    
gb|EMS48876.1|  Auxin-induced protein 5NG4                              243   9e-71    
ref|XP_009620098.1|  PREDICTED: WAT1-related protein At5g07050-like     242   1e-70    
ref|XP_003541692.1|  PREDICTED: WAT1-related protein At3g30340-like     243   1e-70    
ref|XP_006349811.1|  PREDICTED: WAT1-related protein At3g30340-like     242   1e-70    
ref|NP_001054334.1|  Os04g0687800                                       243   1e-70    Oryza sativa Japonica Group [Japonica rice]
gb|EEC71658.1|  hypothetical protein OsI_04113                          243   2e-70    Oryza sativa Indica Group [Indian rice]
ref|XP_004499808.1|  PREDICTED: WAT1-related protein At5g07050-like     243   2e-70    
ref|XP_006645793.1|  PREDICTED: WAT1-related protein At1g09380-like     245   2e-70    
ref|XP_003546041.1|  PREDICTED: WAT1-related protein At3g30340          242   2e-70    
gb|KDP46080.1|  hypothetical protein JCGZ_06591                         242   2e-70    
ref|XP_010938846.1|  PREDICTED: WAT1-related protein At5g07050-like     243   2e-70    
dbj|BAJ87280.1|  predicted protein                                      242   2e-70    
ref|XP_006491838.1|  PREDICTED: WAT1-related protein At1g68170-li...    243   2e-70    
ref|XP_004294697.1|  PREDICTED: auxin-induced protein 5NG4-like         242   2e-70    
ref|NP_001150619.1|  nodulin-like protein                               243   3e-70    Zea mays [maize]
ref|XP_007051368.1|  Nodulin MtN21 /EamA-like transporter family ...    241   3e-70    
ref|XP_010260942.1|  PREDICTED: WAT1-related protein At1g43650          241   3e-70    
gb|KHN47404.1|  Auxin-induced protein 5NG4                              241   3e-70    
ref|XP_003524084.1|  PREDICTED: WAT1-related protein At1g68170-like     242   3e-70    
gb|ADE76940.1|  unknown                                                 241   3e-70    
gb|ACL54205.1|  unknown                                                 242   3e-70    Zea mays [maize]
emb|CDP06236.1|  unnamed protein product                                242   4e-70    
ref|XP_010906409.1|  PREDICTED: WAT1-related protein At5g07050-like     241   6e-70    
ref|XP_009615510.1|  PREDICTED: WAT1-related protein At1g68170-li...    241   6e-70    
ref|XP_004485925.1|  PREDICTED: WAT1-related protein At3g30340-like     240   6e-70    
ref|XP_007218191.1|  hypothetical protein PRUPE_ppa007702mg             240   6e-70    
ref|XP_006491488.1|  PREDICTED: WAT1-related protein At3g30340-like     240   7e-70    
emb|CDO97499.1|  unnamed protein product                                241   7e-70    
ref|XP_006444680.1|  hypothetical protein CICLE_v10023809mg             240   7e-70    
ref|NP_001242267.1|  uncharacterized protein LOC100811617               241   8e-70    
gb|ABR18253.1|  unknown                                                 242   8e-70    Picea sitchensis
ref|XP_009601128.1|  PREDICTED: WAT1-related protein At1g68170-like     241   9e-70    
ref|XP_002298718.1|  hypothetical protein POPTR_0001s31530g             239   1e-69    Populus trichocarpa [western balsam poplar]
ref|XP_006654584.1|  PREDICTED: WAT1-related protein At5g07050-like     241   1e-69    
ref|XP_006851387.1|  hypothetical protein AMTR_s00040p00029850          241   1e-69    
ref|XP_004151540.1|  PREDICTED: auxin-induced protein 5NG4-like         240   1e-69    
gb|AFK34273.1|  unknown                                                 240   1e-69    
ref|XP_011045738.1|  PREDICTED: WAT1-related protein At1g25270-like     239   1e-69    
gb|EMS59079.1|  Auxin-induced protein 5NG4                              239   1e-69    
ref|XP_006359736.1|  PREDICTED: WAT1-related protein At1g25270-like     240   2e-69    
emb|CBI19781.3|  unnamed protein product                                239   2e-69    
ref|XP_009387815.1|  PREDICTED: protein WALLS ARE THIN 1-like           239   2e-69    
ref|XP_009759485.1|  PREDICTED: WAT1-related protein At1g68170-like     239   3e-69    
ref|XP_003581230.2|  PREDICTED: WAT1-related protein At1g68170          239   4e-69    
ref|XP_010030083.1|  PREDICTED: WAT1-related protein At1g68170-like     239   4e-69    
ref|XP_002280062.1|  PREDICTED: protein WALLS ARE THIN 1                239   4e-69    Vitis vinifera
ref|XP_010423261.1|  PREDICTED: WAT1-related protein At5g07050          239   5e-69    
gb|EEC70465.1|  hypothetical protein OsI_01511                          237   5e-69    Oryza sativa Indica Group [Indian rice]
ref|XP_006473582.1|  PREDICTED: protein WALLS ARE THIN 1-like           239   5e-69    
ref|XP_002517269.1|  Auxin-induced protein 5NG4, putative               238   5e-69    Ricinus communis
ref|XP_009354063.1|  PREDICTED: WAT1-related protein At1g25270-like     239   5e-69    
ref|XP_009405190.1|  PREDICTED: WAT1-related protein At1g68170-like     238   6e-69    
ref|XP_002530977.1|  Auxin-induced protein 5NG4, putative               238   7e-69    Ricinus communis
emb|CAH58631.1|  nodulin-like protein                                   237   7e-69    Plantago major [cart-track plant]
ref|XP_007148456.1|  hypothetical protein PHAVU_006G210300g             238   7e-69    
ref|XP_008239274.1|  PREDICTED: WAT1-related protein At3g30340-like     237   8e-69    
ref|XP_002458648.1|  hypothetical protein SORBIDRAFT_03g037390          238   1e-68    Sorghum bicolor [broomcorn]
ref|XP_003594304.1|  Auxin-induced protein 5NG4                         237   1e-68    
ref|XP_009780606.1|  PREDICTED: WAT1-related protein At3g30340-like     237   1e-68    
ref|XP_004288674.1|  PREDICTED: auxin-induced protein 5NG4-like         238   1e-68    
ref|XP_009419851.1|  PREDICTED: WAT1-related protein At5g07050-like     237   1e-68    
ref|XP_010268621.1|  PREDICTED: protein WALLS ARE THIN 1-like           237   1e-68    
ref|XP_010244423.1|  PREDICTED: WAT1-related protein At5g07050          238   2e-68    
ref|XP_002267371.1|  PREDICTED: WAT1-related protein At5g07050          238   2e-68    Vitis vinifera
ref|XP_004485529.1|  PREDICTED: WAT1-related protein At1g68170-li...    238   2e-68    
ref|XP_010251137.1|  PREDICTED: WAT1-related protein At3g30340-like     236   2e-68    
ref|XP_006471332.1|  PREDICTED: WAT1-related protein At5g07050-like     238   2e-68    
ref|XP_009631686.1|  PREDICTED: WAT1-related protein At3g30340-li...    236   2e-68    
gb|KDO84715.1|  hypothetical protein CISIN_1g016399mg                   237   2e-68    
gb|KHF97890.1|  Auxin-induced 5NG4                                      237   2e-68    
ref|XP_006585457.1|  PREDICTED: WAT1-related protein At1g68170-like     237   2e-68    
ref|XP_010240649.1|  PREDICTED: WAT1-related protein At1g25270-like     237   2e-68    
ref|XP_006435087.1|  hypothetical protein CICLE_v10001438mg             237   2e-68    
ref|XP_008445949.1|  PREDICTED: WAT1-related protein At5g07050          236   3e-68    
ref|XP_006432378.1|  hypothetical protein CICLE_v10001335mg             237   3e-68    
ref|XP_009403831.1|  PREDICTED: WAT1-related protein At5g07050-like     238   4e-68    
ref|XP_009624509.1|  PREDICTED: WAT1-related protein At3g30340-li...    235   4e-68    
ref|XP_007041589.1|  Mtn21-like protein, putative isoform 1             236   4e-68    
ref|XP_002302687.2|  hypothetical protein POPTR_0002s18350g             235   4e-68    Populus trichocarpa [western balsam poplar]
ref|XP_010456426.1|  PREDICTED: WAT1-related protein At5g07050-like     236   4e-68    
ref|XP_006482028.1|  PREDICTED: WAT1-related protein At5g07050-like     237   4e-68    
gb|EYU35417.1|  hypothetical protein MIMGU_mgv1a006677mg                238   4e-68    
ref|XP_011020462.1|  PREDICTED: WAT1-related protein At5g07050          237   4e-68    
ref|XP_010061007.1|  PREDICTED: protein WALLS ARE THIN 1-like iso...    236   4e-68    
ref|XP_003547068.1|  PREDICTED: WAT1-related protein At1g68170-like     237   4e-68    
ref|XP_010919069.1|  PREDICTED: WAT1-related protein At5g64700-like     235   4e-68    
ref|XP_011015432.1|  PREDICTED: WAT1-related protein At5g07050-like     236   4e-68    
ref|XP_004167156.1|  PREDICTED: auxin-induced protein 5NG4-like         236   5e-68    
ref|XP_004136769.1|  PREDICTED: auxin-induced protein 5NG4-like         236   5e-68    
gb|KGN59418.1|  hypothetical protein Csa_3G818270                       236   6e-68    
dbj|BAK04850.1|  predicted protein                                      236   7e-68    
ref|XP_006430497.1|  hypothetical protein CICLE_v10012013mg             235   7e-68    
ref|XP_003526345.1|  PREDICTED: WAT1-related protein At5g07050-like     236   7e-68    
ref|XP_011040724.1|  PREDICTED: WAT1-related protein At5g07050          236   8e-68    
gb|KDO50616.1|  hypothetical protein CISIN_1g016076mg                   236   8e-68    
ref|XP_006491888.1|  PREDICTED: WAT1-related protein At1g25270-like     236   8e-68    
ref|XP_002441090.1|  hypothetical protein SORBIDRAFT_09g020200          236   8e-68    
ref|XP_009395155.1|  PREDICTED: WAT1-related protein At5g07050-like     235   9e-68    
ref|XP_007031216.1|  Nodulin MtN21 /EamA-like transporter family ...    233   9e-68    
ref|XP_004962102.1|  PREDICTED: WAT1-related protein At5g07050-like     236   1e-67    
ref|XP_008367450.1|  PREDICTED: WAT1-related protein At3g30340-like     234   1e-67    
gb|AFW82369.1|  hypothetical protein ZEAMMB73_445023                    235   1e-67    
ref|XP_007160706.1|  hypothetical protein PHAVU_001G010100g             235   1e-67    
ref|XP_004243056.1|  PREDICTED: WAT1-related protein At1g25270-like     235   1e-67    
ref|XP_003568462.2|  PREDICTED: WAT1-related protein At5g07050-like     235   1e-67    
ref|XP_010649427.1|  PREDICTED: WAT1-related protein At1g68170-li...    234   1e-67    
dbj|BAJ53175.1|  JHL18I08.9                                             234   1e-67    
ref|XP_003593115.1|  Auxin-induced protein 5NG4                         235   1e-67    
ref|XP_006289728.1|  hypothetical protein CARUB_v10003296mg             235   1e-67    
ref|XP_006851384.1|  hypothetical protein AMTR_s00040p00026230          234   1e-67    
ref|XP_006379888.1|  hypothetical protein POPTR_0008s16550g             234   1e-67    
ref|XP_002447367.1|  hypothetical protein SORBIDRAFT_06g033810          234   2e-67    
ref|XP_004986753.1|  PREDICTED: WAT1-related protein At1g09380-like     234   2e-67    
ref|XP_003531263.1|  PREDICTED: WAT1-related protein At3g30340-like     233   2e-67    
ref|XP_004288677.1|  PREDICTED: auxin-induced protein 5NG4-like         235   2e-67    
ref|NP_196322.3|  nodulin MtN21 /EamA-like transporter family pro...    234   2e-67    
ref|XP_010271523.1|  PREDICTED: protein WALLS ARE THIN 1-like           234   2e-67    
ref|XP_006444681.1|  hypothetical protein CICLE_v10020746mg             233   2e-67    
ref|NP_001240227.1|  uncharacterized protein LOC100791663               233   2e-67    
ref|XP_011029842.1|  PREDICTED: WAT1-related protein At5g07050-like     234   2e-67    
ref|XP_007035082.1|  Nodulin MtN21 /EamA-like transporter family ...    233   2e-67    
ref|XP_010068192.1|  PREDICTED: WAT1-related protein At1g68170-like     234   2e-67    
gb|EYU20823.1|  hypothetical protein MIMGU_mgv1a008005mg                234   2e-67    
ref|XP_011070079.1|  PREDICTED: WAT1-related protein At5g07050-like     234   3e-67    
ref|XP_006477502.1|  PREDICTED: WAT1-related protein At3g30340-like     233   3e-67    
ref|XP_006491487.1|  PREDICTED: WAT1-related protein At3g30340-like     233   3e-67    
ref|XP_006495057.1|  PREDICTED: WAT1-related protein At1g25270-like     234   3e-67    
ref|XP_004297816.1|  PREDICTED: auxin-induced protein 5NG4-like         233   3e-67    
ref|XP_010249759.1|  PREDICTED: WAT1-related protein At3g18200-like     233   3e-67    
ref|XP_006851393.1|  hypothetical protein AMTR_s00040p00037300          233   3e-67    
ref|XP_011085946.1|  PREDICTED: WAT1-related protein At5g07050          234   3e-67    
ref|XP_010531911.1|  PREDICTED: WAT1-related protein At1g68170-li...    233   3e-67    
emb|CDX79964.1|  BnaA05g01920D                                          234   3e-67    
ref|XP_010673090.1|  PREDICTED: WAT1-related protein At5g07050          234   3e-67    
ref|XP_002530887.1|  Auxin-induced protein 5NG4, putative               234   3e-67    
gb|KHN26712.1|  Auxin-induced protein 5NG4-like protein                 233   4e-67    
ref|XP_007209305.1|  hypothetical protein PRUPE_ppa007863mg             233   4e-67    
ref|XP_008654545.1|  PREDICTED: hypothetical protein isoform X7         233   4e-67    
ref|XP_008443233.1|  PREDICTED: WAT1-related protein At5g07050-like     234   4e-67    
ref|XP_009620096.1|  PREDICTED: WAT1-related protein At5g07050-like     234   4e-67    
ref|XP_011041376.1|  PREDICTED: WAT1-related protein At5g07050          234   4e-67    
ref|XP_009369498.1|  PREDICTED: WAT1-related protein At4g08300-like     233   4e-67    
ref|XP_003593114.1|  Auxin-induced protein 5NG4                         234   4e-67    
gb|AES63302.2|  nodulin MtN21/EamA-like transporter family protein      234   5e-67    
ref|XP_003532973.1|  PREDICTED: WAT1-related protein At1g68170-li...    234   5e-67    
ref|XP_006856804.1|  hypothetical protein AMTR_s00055p00139380          232   6e-67    
ref|XP_010649428.1|  PREDICTED: WAT1-related protein At1g68170-like     231   6e-67    
ref|NP_001149226.1|  mtN21 nodulin protein-like                         232   8e-67    
ref|XP_004249327.1|  PREDICTED: WAT1-related protein At5g07050-li...    233   8e-67    
ref|XP_002321499.1|  hypothetical protein POPTR_0015s04130g             232   9e-67    
ref|XP_006439173.1|  hypothetical protein CICLE_v10020755mg             232   9e-67    
ref|XP_003581229.2|  PREDICTED: WAT1-related protein At1g68170-like     232   9e-67    
ref|XP_007041591.1|  Mtn21-like protein                                 232   9e-67    
ref|XP_004499208.1|  PREDICTED: protein WALLS ARE THIN 1-like iso...    232   1e-66    
ref|XP_003628011.1|  Auxin-induced protein 5NG4                         233   1e-66    
gb|KEH36637.1|  auxin-induced 5NG4-like protein                         231   1e-66    
ref|XP_007039295.1|  Nodulin MtN21 /EamA-like transporter family ...    232   1e-66    
ref|XP_008788718.1|  PREDICTED: WAT1-related protein At3g30340          231   1e-66    
ref|XP_007159054.1|  hypothetical protein PHAVU_002G204500g             232   1e-66    
ref|XP_003550406.1|  PREDICTED: protein WALLS ARE THIN 1-like           233   1e-66    
ref|XP_006655691.1|  PREDICTED: WAT1-related protein At4g01440-li...    231   1e-66    
ref|XP_006661686.1|  PREDICTED: WAT1-related protein At4g08290-like     231   1e-66    
ref|XP_009788498.1|  PREDICTED: WAT1-related protein At5g07050-like     232   1e-66    
gb|EYU26922.1|  hypothetical protein MIMGU_mgv1a007458mg                233   1e-66    
gb|KCW63054.1|  hypothetical protein EUGRSUZ_G00640                     232   1e-66    
gb|EEC79453.1|  hypothetical protein OsI_20446                          233   1e-66    
ref|NP_001055921.1|  Os05g0493800                                       233   1e-66    
gb|AFK41401.1|  unknown                                                 232   2e-66    
gb|EAY98030.1|  hypothetical protein OsI_19945                          233   2e-66    
ref|XP_009373697.1|  PREDICTED: WAT1-related protein At3g30340-like     231   2e-66    
gb|KHN39450.1|  Auxin-induced protein 5NG4                              232   2e-66    
gb|KHG09563.1|  Auxin-induced 5NG4                                      233   2e-66    
ref|XP_011048851.1|  PREDICTED: protein WALLS ARE THIN 1-like           231   2e-66    
ref|NP_001055529.2|  Os05g0409500                                       233   2e-66    
ref|XP_009147948.1|  PREDICTED: WAT1-related protein At3g18200-like     231   2e-66    
ref|XP_006351822.1|  PREDICTED: WAT1-related protein At1g68170-like     232   2e-66    
ref|XP_004486241.1|  PREDICTED: WAT1-related protein At1g68170-like     231   2e-66    
tpg|DAA36748.1|  TPA: mtN21 nodulin protein-like protein                231   2e-66    
ref|XP_004977988.1|  PREDICTED: WAT1-related protein At1g09380-like     231   2e-66    
gb|AFK33485.1|  unknown                                                 231   2e-66    
emb|CDY18510.1|  BnaA01g26850D                                          231   2e-66    
ref|XP_003523924.1|  PREDICTED: WAT1-related protein At5g07050-like     232   2e-66    
emb|CDX93689.1|  BnaA06g03590D                                          231   2e-66    
ref|XP_002885242.1|  nodulin MtN21 family protein                       231   2e-66    
ref|XP_011091208.1|  PREDICTED: WAT1-related protein At4g08300-like     230   3e-66    
ref|XP_007133643.1|  hypothetical protein PHAVU_011G196800g             231   3e-66    
gb|KHN48009.1|  Auxin-induced protein 5NG4                              230   3e-66    
ref|XP_002307691.1|  nodulin MtN21 family protein                       231   3e-66    
ref|XP_002510467.1|  Auxin-induced protein 5NG4, putative               231   3e-66    
ref|XP_002308862.2|  hypothetical protein POPTR_0006s03200g             231   3e-66    
ref|NP_001130743.1|  hypothetical protein                               231   3e-66    
ref|XP_007039289.1|  Nodulin MtN21 /EamA-like transporter family ...    230   4e-66    
ref|NP_181622.2|  nodulin MtN21-like transporter family protein         231   4e-66    
ref|XP_007148806.1|  hypothetical protein PHAVU_005G015900g             231   4e-66    
ref|XP_002445672.1|  hypothetical protein SORBIDRAFT_07g023970          231   4e-66    
dbj|BAD13218.1|  putative MtN21                                         231   4e-66    
ref|XP_004309506.1|  PREDICTED: auxin-induced protein 5NG4-like         230   4e-66    
ref|XP_009113449.1|  PREDICTED: WAT1-related protein At3g18200-like     230   4e-66    
ref|XP_002303952.2|  hypothetical protein POPTR_0003s19170g             231   4e-66    
gb|EAZ13316.1|  hypothetical protein OsJ_03238                          231   5e-66    
ref|XP_004493327.1|  PREDICTED: WAT1-related protein At5g07050-li...    231   5e-66    
ref|XP_010241742.1|  PREDICTED: WAT1-related protein At1g43650-like     229   5e-66    
ref|XP_010053986.1|  PREDICTED: WAT1-related protein At1g43650-like     229   5e-66    
emb|CAA75575.1|  MtN21                                                  231   6e-66    
ref|XP_009800321.1|  PREDICTED: WAT1-related protein At5g07050-like     231   6e-66    
ref|XP_002272105.2|  PREDICTED: WAT1-related protein At3g30340-like     229   7e-66    
gb|EEC66707.1|  hypothetical protein OsI_33030                          229   8e-66    
ref|XP_009591224.1|  PREDICTED: WAT1-related protein At3g30340-like     229   9e-66    
ref|XP_007144098.1|  hypothetical protein PHAVU_007G128600g             229   1e-65    
ref|XP_010061252.1|  PREDICTED: protein WALLS ARE THIN 1-like           229   1e-65    
ref|XP_008444764.1|  PREDICTED: protein WALLS ARE THIN 1                230   1e-65    
ref|XP_008655310.1|  PREDICTED: uncharacterized protein LOC100384...    230   1e-65    
ref|NP_001064323.1|  Os10g0210500                                       229   1e-65    
gb|KDP40571.1|  hypothetical protein JCGZ_24570                         230   1e-65    
ref|XP_008365295.1|  PREDICTED: WAT1-related protein At1g25270-like     230   1e-65    
ref|XP_007159057.1|  hypothetical protein PHAVU_002G204700g             229   1e-65    
gb|ABK93004.1|  unknown                                                 229   1e-65    
gb|KHN44603.1|  Auxin-induced protein 5NG4                              228   1e-65    
gb|AFW78503.1|  nodulin-like protein                                    229   2e-65    
ref|XP_003547067.2|  PREDICTED: WAT1-related protein At1g68170-like     229   2e-65    
ref|XP_003523716.1|  PREDICTED: protein WALLS ARE THIN 1-like           229   2e-65    
ref|XP_009587259.1|  PREDICTED: WAT1-related protein At3g18200 is...    228   2e-65    
ref|XP_003597788.1|  Auxin-induced protein 5NG4                         229   2e-65    
ref|XP_009787022.1|  PREDICTED: WAT1-related protein At1g68170-li...    229   2e-65    
ref|XP_010111209.1|  Auxin-induced protein 5NG4                         230   2e-65    
ref|XP_009135570.1|  PREDICTED: WAT1-related protein At3g18200          228   2e-65    
ref|XP_007162036.1|  hypothetical protein PHAVU_001G118300g             230   2e-65    
gb|EAZ08018.1|  hypothetical protein OsI_30283                          229   2e-65    
ref|XP_004500966.1|  PREDICTED: protein WALLS ARE THIN 1-like           229   2e-65    
ref|XP_008810183.1|  PREDICTED: WAT1-related protein At5g07050-like     229   2e-65    
gb|ACR36165.1|  unknown                                                 228   2e-65    
ref|XP_009797192.1|  PREDICTED: WAT1-related protein At3g18200          228   3e-65    
ref|XP_003545052.1|  PREDICTED: protein WALLS ARE THIN 1-like           229   3e-65    
ref|XP_008795134.1|  PREDICTED: WAT1-related protein At5g07050-like     229   3e-65    
ref|XP_010110839.1|  Auxin-induced protein 5NG4                         228   3e-65    
dbj|BAK04730.1|  predicted protein                                      228   3e-65    
ref|XP_002272440.2|  PREDICTED: WAT1-related protein At3g30340-like     228   3e-65    
ref|XP_004152669.1|  PREDICTED: auxin-induced protein 5NG4-like         229   3e-65    
ref|XP_006406637.1|  hypothetical protein EUTSA_v10021001mg             228   3e-65    
ref|NP_001151393.1|  nodulin-like protein                               229   3e-65    
ref|XP_002284091.1|  PREDICTED: WAT1-related protein At2g39510          228   3e-65    
gb|KFK39156.1|  hypothetical protein AALP_AA3G207600                    228   3e-65    
ref|XP_003577657.1|  PREDICTED: protein WALLS ARE THIN 1                228   4e-65    
ref|XP_009380328.1|  PREDICTED: auxin-induced protein 5NG4-like         228   4e-65    
gb|EMT14666.1|  Auxin-induced protein 5NG4                              229   4e-65    
ref|XP_011000504.1|  PREDICTED: WAT1-related protein At3g18200          227   4e-65    
ref|XP_003531568.1|  PREDICTED: WAT1-related protein At1g68170-like     229   4e-65    
ref|XP_011092392.1|  PREDICTED: WAT1-related protein At1g25270-like     229   4e-65    
emb|CDX91104.1|  BnaC02g04930D                                          228   4e-65    
ref|XP_006830632.1|  hypothetical protein AMTR_s00120p00105340          228   5e-65    
ref|XP_008382878.1|  PREDICTED: WAT1-related protein At4g08300-like     227   5e-65    
ref|XP_004309502.1|  PREDICTED: auxin-induced protein 5NG4-like         227   5e-65    
ref|XP_002323220.2|  hypothetical protein POPTR_0016s03120g             228   5e-65    
ref|XP_007208872.1|  hypothetical protein PRUPE_ppa026053mg             227   5e-65    
gb|KHN12669.1|  Auxin-induced protein 5NG4                              228   5e-65    
ref|XP_009341321.1|  PREDICTED: WAT1-related protein At1g68170-like     228   5e-65    
ref|XP_009587258.1|  PREDICTED: WAT1-related protein At3g18200 is...    227   5e-65    
ref|XP_004308749.1|  PREDICTED: auxin-induced protein 5NG4-like         227   6e-65    
ref|XP_003589726.1|  Auxin-induced protein 5NG4                         226   7e-65    
ref|XP_004954554.1|  PREDICTED: WAT1-related protein At3g30340-like     233   7e-65    
ref|XP_010495095.1|  PREDICTED: WAT1-related protein At5g07050-like     228   7e-65    
ref|XP_007148455.1|  hypothetical protein PHAVU_006G210200g             228   8e-65    
ref|XP_003545806.1|  PREDICTED: WAT1-related protein At5g07050-like     228   8e-65    
ref|XP_011074856.1|  PREDICTED: WAT1-related protein At1g44800-like     227   8e-65    
ref|XP_006580831.1|  PREDICTED: WAT1-related protein At1g25270-like     227   8e-65    
ref|XP_004974226.1|  PREDICTED: protein WALLS ARE THIN 1-like           228   8e-65    
ref|XP_010096006.1|  Auxin-induced protein 5NG4                         228   8e-65    
ref|XP_006299289.1|  hypothetical protein CARUB_v10015443mg             226   9e-65    
ref|XP_004288673.1|  PREDICTED: auxin-induced protein 5NG4-like         227   9e-65    
ref|XP_011087819.1|  PREDICTED: WAT1-related protein At1g25270-li...    228   1e-64    
gb|EYU32879.1|  hypothetical protein MIMGU_mgv1a008013mg                227   1e-64    
ref|XP_006399861.1|  hypothetical protein EUTSA_v10013837mg             227   1e-64    
gb|ACR34989.1|  unknown                                                 228   1e-64    
ref|XP_009772058.1|  PREDICTED: WAT1-related protein At3g30340-like     226   1e-64    
gb|KDP40312.1|  hypothetical protein JCGZ_02310                         226   1e-64    
ref|XP_009386212.1|  PREDICTED: protein WALLS ARE THIN 1-like           227   1e-64    
ref|XP_002315243.2|  hypothetical protein POPTR_0010s21630g             227   1e-64    
ref|XP_010536384.1|  PREDICTED: protein WALLS ARE THIN 1                227   1e-64    
gb|KEH36219.1|  auxin-induced 5NG4-like protein                         227   1e-64    
ref|XP_004309563.1|  PREDICTED: auxin-induced protein 5NG4-like         226   1e-64    
ref|XP_007048228.1|  Auxin-induced protein 5NG4, putative               226   1e-64    
ref|XP_009781457.1|  PREDICTED: WAT1-related protein At5g07050-like     226   1e-64    
emb|CAB53493.1|  CAA303720.1 protein                                    226   1e-64    
ref|XP_002453161.1|  hypothetical protein SORBIDRAFT_04g001020          226   2e-64    
ref|XP_007224058.1|  hypothetical protein PRUPE_ppa015276mg             226   2e-64    
ref|XP_007153065.1|  hypothetical protein PHAVU_003G003600g             226   2e-64    
ref|XP_004247715.1|  PREDICTED: WAT1-related protein At4g08300-like     226   2e-64    
gb|EYU25979.1|  hypothetical protein MIMGU_mgv1a009103mg                225   2e-64    
ref|XP_004307206.1|  PREDICTED: auxin-induced protein 5NG4-like         227   2e-64    
ref|NP_188448.1|  nodulin MtN21-like transporter UMAMIT4                226   2e-64    
ref|XP_011069552.1|  PREDICTED: WAT1-related protein At1g21890-like     226   2e-64    
ref|NP_001239827.1|  uncharacterized protein LOC100804390               227   2e-64    
ref|XP_008244228.1|  PREDICTED: WAT1-related protein At3g30340-like     225   2e-64    
ref|XP_006339335.1|  PREDICTED: WAT1-related protein At5g07050-like     225   2e-64    
ref|NP_001172775.1|  Os02g0114050                                       226   2e-64    
ref|XP_002273800.3|  PREDICTED: WAT1-related protein At1g43650-li...    226   2e-64    
gb|ADN33888.1|  nodulin-like protein                                    226   2e-64    
ref|XP_008375451.1|  PREDICTED: WAT1-related protein At3g30340          225   2e-64    
gb|KCW63055.1|  hypothetical protein EUGRSUZ_G00647                     223   3e-64    
ref|XP_006660389.1|  PREDICTED: protein WALLS ARE THIN 1-like           226   3e-64    
ref|XP_002529296.1|  Auxin-induced protein 5NG4, putative               225   3e-64    
ref|XP_008443232.1|  PREDICTED: WAT1-related protein At5g07050-like     226   3e-64    
gb|KHG30626.1|  Auxin-induced 5NG4                                      225   3e-64    
dbj|BAA85424.2|  putative MtN21                                         225   3e-64    
ref|XP_006289509.1|  hypothetical protein CARUB_v10003044mg             225   3e-64    
ref|XP_008677722.1|  PREDICTED: nodulin-like protein 5NG4 isoform X1    226   3e-64    
ref|XP_010549098.1|  PREDICTED: WAT1-related protein At3g18200          225   4e-64    
sp|Q9LV20.1|WTR17_ARATH  RecName: Full=WAT1-related protein At3g1...    225   4e-64    
ref|XP_008224471.1|  PREDICTED: WAT1-related protein At4g08300-like     225   4e-64    
ref|XP_004249326.1|  PREDICTED: WAT1-related protein At5g07050          225   4e-64    



>ref|XP_004230332.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum lycopersicum]
Length=358

 Score =   445 bits (1145),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 207/347 (60%), Positives = 278/347 (80%), Gaps = 2/347 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             +DLLPL  MVIVQLGYAG+NI++   M +GMNPF+H+AY+Q+FATIA+AP AYFLERK+R
Sbjct  3     NDLLPLLTMVIVQLGYAGMNIISKLAMDSGMNPFVHVAYRQIFATIAIAPFAYFLERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+TP+I FQIFL + FG++ +QI YFVGL N+TPT++ AL+NL PA+TF+ A+ F LE 
Sbjct  63    PKLTPSILFQIFLCSIFGVSMNQITYFVGLKNTTPTISCALSNLTPAVTFLLAIPFGLER  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             VGL +K GQAK+LGT++C+GGAMLL+ Y G +V I Q  IHWKYA++     S+++H N 
Sbjct  123   VGLGSKAGQAKMLGTILCVGGAMLLSFYHGSIVPIDQPNIHWKYAQDMTQNKSTTTHENF  182

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             ILGP ++I+S  S+  + I QA+LS  Y APYSS+AL C +A F+C+I+ +C DHN+SDW
Sbjct  183   ILGPFLLIISAVSWGIWSILQAKLSMVYAAPYSSSALMCLMASFQCVIVGICFDHNISDW  242

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L+  +RAVS+ Y+G+V +ALA CL SWCIERKGPLYV+VFNPLLLV+ AILSW  L+EK
Sbjct  243   SLSHSIRAVSSIYSGVVCTALAYCLMSWCIERKGPLYVSVFNPLLLVIVAILSWGVLQEK  302

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTE  356
             IY GTV+GSILIV+GLY VLWGK NEL+++ +E + ++ + + EK +
Sbjct  303   IYIGTVIGSILIVLGLYGVLWGKNNELKLLPIEFDEEIGDIEKEKQK  349



>ref|XP_009794409.1| PREDICTED: WAT1-related protein At1g09380-like [Nicotiana sylvestris]
Length=370

 Score =   445 bits (1144),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 211/353 (60%), Positives = 273/353 (77%), Gaps = 7/353 (2%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             M   DLLP   MVIVQLGYAG+NI++   M +GMNPF+H+AY+Q+FATI++AP AYFLER
Sbjct  1     MASHDLLPFLTMVIVQLGYAGMNIISKLAMDSGMNPFVHVAYRQIFATISIAPFAYFLER  60

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
             K+RPK+TP+I FQIFL + FG++ +QI YFVGL N+TPT+A AL+NL PA+TF+ A+ F 
Sbjct  61    KTRPKLTPSILFQIFLCSIFGVSMNQITYFVGLKNTTPTIACALSNLTPAVTFLLAIPFG  120

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSH  863
             LE VGL TK GQAK+LGT++C+GGAMLL+ Y G +V I Q  IHWKYA++  +  SS++H
Sbjct  121   LERVGLGTKAGQAKMLGTILCVGGAMLLSFYHGSIVPIDQPNIHWKYAQDMTENKSSTNH  180

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
             GN +LGP ++I+S  S+  + I QAR+S  Y APYSS+AL C +A F+CLI+  C DHN+
Sbjct  181   GNFMLGPFLLIVSAVSWGVWSILQARVSMDYAAPYSSSALMCLMASFQCLIVGFCFDHNL  240

Query  682   SDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             SDW+L   +RAVS  Y G+V +ALA CL SWCIERKGPLYV+VFNPLLLV+ AILSWA L
Sbjct  241   SDWSLRHSIRAVSAIYAGVVCTALAYCLMSWCIERKGPLYVSVFNPLLLVIVAILSWALL  300

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDN-----NKLKEKDAEK  362
             +EKIY GTV+GS+LIV+GLY VLWGK NE++ I  ++      N  KEK+ + 
Sbjct  301   QEKIYIGTVVGSVLIVLGLYGVLWGKNNEMKPIKFDEEIGAEINGDKEKEKKD  353



>ref|XP_006344799.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Solanum 
tuberosum]
Length=357

 Score =   443 bits (1139),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 208/347 (60%), Positives = 277/347 (80%), Gaps = 3/347 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             +DLLP   MVIVQLGYAG+NI++   M +GMNPF+H+AY+Q+FATIA+AP AYFLERK+R
Sbjct  3     NDLLPFLTMVIVQLGYAGMNIISKLAMDSGMNPFVHVAYRQIFATIAIAPFAYFLERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+TP+I FQIFL + FG++ +QI YFVGL N+TPT++ AL+NL PA+TF+ A+ F LE 
Sbjct  63    PKLTPSILFQIFLCSIFGVSMNQITYFVGLKNTTPTISCALSNLTPAVTFLLAIPFGLER  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             VGL +K GQAK+LGT++C+GGAMLL+ Y G +V I Q  IHWKYA++     S++SHGN 
Sbjct  123   VGLGSKAGQAKMLGTILCVGGAMLLSFYHGSIVPIDQPNIHWKYAQDMTQNKSTTSHGNF  182

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             ILGP ++I+S  S+  + I QA+LS  Y APYSS+AL C +A F+C+I+ +C DHN+SDW
Sbjct  183   ILGPFLLIISAVSWGIWSILQAKLSMVYAAPYSSSALMCLMASFQCVIVGICFDHNISDW  242

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L+  +RAVS+ Y+G+V +ALA CL SWCIERKGPLYV+VFNPLLLV+ AILSW  L+EK
Sbjct  243   SLSHSIRAVSSIYSGVVCTALAYCLMSWCIERKGPLYVSVFNPLLLVIVAILSWGLLQEK  302

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTE  356
             IY GTV+GSILIV+GLY VLWGK NEL+ + +E + ++ + + EK +
Sbjct  303   IYIGTVVGSILIVLGLYGVLWGKNNELK-LPIEFDEEIGDIEKEKQK  348



>ref|XP_009629514.1| PREDICTED: WAT1-related protein At1g09380-like [Nicotiana tomentosiformis]
Length=370

 Score =   442 bits (1137),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 208/338 (62%), Positives = 267/338 (79%), Gaps = 2/338 (1%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             M   DLLP   MVIVQLGYAG+NI++   M +GMNPF+H+AY+Q+FATI++AP AYFLER
Sbjct  1     MASHDLLPFLTMVIVQLGYAGMNIISKLAMDSGMNPFVHVAYRQIFATISIAPFAYFLER  60

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
             K+RPK+TP+I FQIFL + FG++ +QI YFVGL N+TPT+A AL+NL PA+TF+ A+ F 
Sbjct  61    KTRPKLTPSILFQIFLCSIFGVSMNQITYFVGLKNTTPTIACALSNLTPAVTFLLAIPFG  120

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSH  863
             LE VGL TK GQAK+LGT++C+GGAMLL+ Y G +V I Q  IHWKYA++  +  SS++H
Sbjct  121   LERVGLGTKAGQAKMLGTILCVGGAMLLSFYHGSIVPIDQPNIHWKYAQDMTENKSSTNH  180

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
             GN +LGP ++I+S  S+  + I QAR+S  Y APYSS+AL C +A F+CLII  C DHN+
Sbjct  181   GNFMLGPFLLIVSAVSWGVWSILQARVSMDYAAPYSSSALMCLMASFQCLIIGFCFDHNL  240

Query  682   SDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             SDW+L   +RAVS  Y G+V +ALA CL SWCIERKGPLYV+VFNPLLLV+ AILSWA L
Sbjct  241   SDWSLRHSIRAVSAIYAGVVCTALAYCLMSWCIERKGPLYVSVFNPLLLVIVAILSWALL  300

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDN  392
             +EKIY GTV+GS+LIV+GLY VLWGK NE++ I  ++ 
Sbjct  301   QEKIYIGTVVGSVLIVLGLYGVLWGKNNEMKPIKFDEE  338



>gb|EYU19418.1| hypothetical protein MIMGU_mgv1a009113mg [Erythranthe guttata]
Length=353

 Score =   431 bits (1109),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 273/344 (79%), Gaps = 8/344 (2%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             DL P   MVIVQLGYAG+NI++   M +GMNP++H+AY+Q+FATIA+AP AYF+ERK+RP
Sbjct  4     DLFPFLTMVIVQLGYAGMNIISKVAMDSGMNPYVHVAYRQVFATIAIAPFAYFMERKTRP  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             KMT +IFFQIFL + FG+T +QI YFVGL NSTPT+A AL N+ PA+TF+ AV F LE V
Sbjct  64    KMTASIFFQIFLCSIFGVTVNQITYFVGLKNSTPTIACALTNINPAVTFIMAVPFGLEKV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G+++K GQAK++GT+IC+GGA+LL+ Y G +V IG+S+IHWKYA+ T  K SS +H N I
Sbjct  124   GVKSKAGQAKVMGTIICVGGALLLSFYHGSIVDIGKSSIHWKYAEQTGTK-SSINHVNFI  182

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGPI++I+S  S++ +LI Q R+S++YGAPYSS+AL C +A F+C+++A   DHN+S W+
Sbjct  183   LGPILLIVSAISWAIWLIIQTRVSQKYGAPYSSSALMCLMATFQCVVVAFFFDHNLSAWS  242

Query  670   LTP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             LT  +R +S+ Y+G+V SALA CL SWCIERKGPLYV+VF+PLLLV+ AILSWA L EK+
Sbjct  243   LTSNIRIISSVYSGIVCSALAFCLMSWCIERKGPLYVSVFSPLLLVIVAILSWALLEEKL  302

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEK  362
             + GTV GS+LIV+GLY VLWGK  E+  I       ++E+ AEK
Sbjct  303   FVGTVAGSVLIVLGLYGVLWGKNREMSSI-----YHIEEEAAEK  341



>ref|XP_011087522.1| PREDICTED: WAT1-related protein At1g09380 [Sesamum indicum]
Length=368

 Score =   427 bits (1097),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 202/348 (58%), Positives = 271/348 (78%), Gaps = 4/348 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             DLLP   MVIVQLGYAG+NI++   M +GMNPF+H+AY+Q+FAT+A+AP AYF+ERK+RP
Sbjct  4     DLLPFLAMVIVQLGYAGMNIISKLAMDSGMNPFVHVAYRQVFATVAIAPFAYFMERKTRP  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             KMT +IFF IFL + FG+T +QI YFVGL NSTPT+A AL N+ PA+TF+ A+ FRLE +
Sbjct  64    KMTLSIFFHIFLCSIFGVTVNQITYFVGLKNSTPTIACALTNINPAVTFIMALPFRLEKL  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G+++K GQAKILGT++C+GGA+LL+ Y G  V IG+S+IHW YA  T   N+S +H N+I
Sbjct  124   GVKSKAGQAKILGTIVCVGGALLLSFYHGSAVDIGESSIHWNYAHKT-GTNNSINHVNLI  182

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP ++I+S  S++ +LI Q R+S++Y APYSS+AL C +A  +C+I+    DHN+S W+
Sbjct  183   LGPFLLIVSAVSWAVWLIIQTRVSQKYAAPYSSSALMCLMASVQCVIVGFSFDHNLSAWS  242

Query  670   LTP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L+P +R VS+ Y G+V SALA CL SWCIERKGPLYV+VF+PLLLV+ A+LSWA L EK+
Sbjct  243   LSPSIRIVSSVYAGIVCSALAFCLMSWCIERKGPLYVSVFSPLLLVIVAVLSWALLEEKL  302

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVI-NVEDNNKLKEKDAEKTEA  353
             Y GTV GS+LIV+GLY VLWGK  E+  I ++E+ +K  +  A   E+
Sbjct  303   YVGTVGGSVLIVLGLYGVLWGKNREMSSIYHIEEVDKATQTTAYDLES  350



>ref|XP_009616803.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Nicotiana 
tomentosiformis]
Length=347

 Score =   420 bits (1079),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/346 (58%), Positives = 265/346 (77%), Gaps = 5/346 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             +++LP  +MV VQ+GYAG+NIV T VM AGM+PF+HIAY+Q+ ATI+L P AYF E K++
Sbjct  3     NEVLPFLLMVTVQVGYAGMNIVGTLVMDAGMDPFVHIAYRQIIATISLVPFAYFFEWKTK  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             P++T +I F IFL +  GLT  QIAYFVGL NSTPT+A AL+NLIPA TF+ A+ F LE 
Sbjct  63    PQLTSSILFWIFLCSLSGLTASQIAYFVGLKNSTPTIACALSNLIPAATFLLAIPFGLEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             VG R+K GQAK+ GT+IC+GGAMLL+LY GP+VIGQS IHWK+A+NT  KN S+ H N+I
Sbjct  123   VGFRSKSGQAKVWGTIICVGGAMLLSLYHGPIVIGQSGIHWKFAENTEKKN-STDHVNLI  181

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP+++I+S  SYS ++I QAR+S++Y APY+ST L C +A F+C+II + V H+ + W 
Sbjct  182   LGPLLLIVSTVSYSLWIIFQARVSEKYAAPYTSTMLMCLMASFQCVIIGVFVIHDKAAWF  241

Query  670   LTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
             L  MR ++  YNG+V +AL  CLTSWCI+RKGPLYV+VF PL+L++TA+LSW  LREK+Y
Sbjct  242   LDRMRTIAVLYNGIVCTALGYCLTSWCIQRKGPLYVSVFYPLMLIITAVLSWTLLREKLY  301

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVED----NNKLKEKDAE  365
              GTV+GS L VVG Y VLWGK  E      E+     +KLK++ A+
Sbjct  302   LGTVVGSFLTVVGFYGVLWGKDEEKSKSETENLEIKTDKLKQQGAK  347



>ref|XP_009777189.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Nicotiana 
sylvestris]
Length=374

 Score =   415 bits (1067),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 194/342 (57%), Positives = 262/342 (77%), Gaps = 2/342 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              D LP F+MV+VQLG AG  I++  VM  GM+PF+H++Y+Q+FATI++AP AYF ERK+R
Sbjct  3     KDSLPFFLMVMVQLGGAGTAIISKLVMDEGMDPFVHLSYRQIFATISIAPFAYFFERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+TP+  F IFL + FG+T  Q+ Y +GL NST T+ +ALANL+PAITF+ AVL  LE 
Sbjct  63    PKLTPSTVFLIFLCSIFGVTAMQMTYLIGLKNSTATITTALANLVPAITFLLAVLSGLEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             VGLRTK GQAK+LGT++CI GA+LL+LY G VVIGQ  IHWKY++ T     +++HGN  
Sbjct  123   VGLRTKAGQAKVLGTILCICGAILLSLYHGKVVIGQLRIHWKYSEQTSKNIEANTHGNFF  182

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP +VI+S   YS +LI Q R++++Y APYSST L CF+A  EC+I+A+CV+ + + W+
Sbjct  183   LGPFLVIISTIVYSLWLIIQPRVNERYAAPYSSTTLMCFMASLECVIVAVCVNRDKTAWS  242

Query  670   LTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
             L P+RA+S  YNG++ SALA  L +WCI+RKGPLYV+VF PLLLV++A LSW  L EK+Y
Sbjct  243   LNPIRAISVLYNGIISSALAFYLMTWCIKRKGPLYVSVFLPLLLVISAFLSWTLLGEKLY  302

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQ--VINVEDNNKLKEKD  371
              GTV+GSIL V+GLY  LWGKK E++   +++++   LKEK+
Sbjct  303   VGTVVGSILTVIGLYGFLWGKKKEMERNTVHIKEEKVLKEKN  344



>emb|CDP15218.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   414 bits (1065),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/343 (58%), Positives = 262/343 (76%), Gaps = 7/343 (2%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
              LP   MVI+QLGYAG+NIV+   M +GMNPF+H+AY+Q+FAT+++AP AYFLER++RP+
Sbjct  5     FLPFLTMVILQLGYAGMNIVSKLAMDSGMNPFVHVAYRQLFATLSIAPFAYFLERETRPR  64

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T +I F IF+ + FG T +QI YFVGL NS+PT+A AL+NL PA+TF+ AV   LES G
Sbjct  65    LTFSILFHIFMCSVFGATVNQITYFVGLKNSSPTIACALSNLSPAVTFILAVPLGLESAG  124

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVIL  848
             LR K GQAK+LGT++C+GGA+LL+ Y GPVV +GQS IHWK+A N  +K + S+H N +L
Sbjct  125   LRAKAGQAKVLGTVVCVGGAILLSFYHGPVVGVGQSRIHWKFADNLRNK-TVSNHVNFVL  183

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             GP M+I S  S++ +LI QAR+ K Y APYSS+AL CF+A  +C II  C DH++S W+L
Sbjct  184   GPFMLIASSVSWAVWLIIQARVGKMYAAPYSSSALTCFMASIQCAIIGFCFDHHLSAWSL  243

Query  667   TP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
              P +RAVS+ Y G+V +ALA CL SWCIERKGPLYV+VF+PLLLV+ AILSWA L+EK+Y
Sbjct  244   YPAIRAVSSIYAGIVCTALAFCLMSWCIERKGPLYVSVFSPLLLVIVAILSWAILQEKLY  303

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEK  362
              G V+GS LIV+GLY VLWGK  E++     D    +E D+ K
Sbjct  304   IGMVIGSTLIVMGLYCVLWGKNEEMKPTKTPD----QEVDSGK  342



>ref|XP_009625723.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Nicotiana 
tomentosiformis]
Length=375

 Score =   414 bits (1064),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 261/343 (76%), Gaps = 3/343 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              D LP F+MV+VQLG AG  +++  VM  GM+PF+H++Y+Q+FATI++AP AYF ERK+R
Sbjct  3     KDSLPFFLMVLVQLGGAGTAVISKLVMDEGMDPFVHLSYRQIFATISIAPFAYFFERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+TP+  F IFL + FG+T  Q+ Y +GL NST T+ +ALANL+PAITF+ A+L  LE 
Sbjct  63    PKLTPSTVFLIFLCSIFGVTAMQMTYLIGLKNSTATITTALANLVPAITFLLAILSGLEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             VGLRTK G AK+LGT++CI GAMLL+LY G VVIGQ  IHWKY++ T     ++SHGN  
Sbjct  123   VGLRTKAGLAKVLGTILCICGAMLLSLYHGKVVIGQLRIHWKYSEQTSKNIEANSHGNFF  182

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP +VI+S   YS +LI Q R++++Y APYSST L CF+A  EC+I+A+CV+H+ + W+
Sbjct  183   LGPFLVIISTIVYSLWLIIQPRVNERYAAPYSSTTLMCFMASLECVIVAVCVNHDKTAWS  242

Query  670   LTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
             L P+RA+S  YNG++ SALA  L +WCI+RKGPLYV+VF PLLLV++A LSW  L EK+Y
Sbjct  243   LNPIRAISVLYNGIISSALAFYLMTWCIKRKGPLYVSVFLPLLLVISAFLSWTLLGEKLY  302

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQ---VINVEDNNKLKEKD  371
              GTV+GSIL V+GLY  LWGKK  ++   V++V++    KEK+
Sbjct  303   VGTVVGSILTVIGLYGFLWGKKKGMERTTVVHVKEEKVFKEKN  345



>ref|XP_006341313.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum tuberosum]
Length=353

 Score =   412 bits (1059),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 260/341 (76%), Gaps = 5/341 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             SDLLP   MVIVQ+GYAG N+V   VM  GM+PF+  AY+ +FATI++AP AYFLERK+R
Sbjct  6     SDLLPFIAMVIVQVGYAGSNVVTKLVMDTGMDPFVQTAYRPIFATISIAPFAYFLERKTR  65

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK++ ++FFQIFL +  G+T +Q  + +GL  +TPT+ SAL NLIPA TFV AV F LE 
Sbjct  66    PKLSLSVFFQIFLCSIIGITANQYTFCIGLKYTTPTIVSALDNLIPAFTFVLAVPFGLEK  125

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTV-DKNSSSSHGNV  854
             +GLR+  GQAK++GT++C+GGAMLL+LY GPVVIGQ   HWKY +NT  DK+ +S+H N 
Sbjct  126   LGLRSIAGQAKLIGTIVCVGGAMLLSLYRGPVVIGQLGFHWKYVENTTDDKDVNSTHTNF  185

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             +LGP ++I+S  +Y+ +LI QAR++++Y APYSST L  F+A F+C+II+ CV    S+W
Sbjct  186   LLGPFILIISSITYALWLIIQARVNEKYAAPYSSTLLMFFMASFQCMIISFCVVPKASEW  245

Query  673   TLTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
              L P+RA+S  YNG V S+LA+ L SWCIERKGPLYV++FNPLLLV+ A LSW  LREK+
Sbjct  246   ALNPIRAISVVYNGTVCSSLALYLCSWCIERKGPLYVSMFNPLLLVIAAFLSWILLREKL  305

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKD  371
             Y G V+GSIL VVGLY  LWG+K E++    +  N+++E+D
Sbjct  306   YLGIVVGSILTVVGLYGFLWGQKKEME----QSKNEIEEED  342



>ref|XP_004252215.1| PREDICTED: WAT1-related protein At1g09380 [Solanum lycopersicum]
Length=351

 Score =   410 bits (1055),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 193/341 (57%), Positives = 261/341 (77%), Gaps = 5/341 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             SDLLP   MVIVQ+GYAG N+V   VM  GM+PF+  AY+ +FATI++AP AYFLERK+R
Sbjct  6     SDLLPFIAMVIVQVGYAGSNVVTKLVMDTGMHPFVQTAYRPIFATISIAPFAYFLERKTR  65

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T ++FFQIFL +  G+T +Q  + +GL  +TPT+ SAL NLIPA TF+ A+LF LE 
Sbjct  66    PKLTLSVFFQIFLCSIIGVTANQYTFCIGLKYTTPTIVSALDNLIPAFTFLLAILFGLEK  125

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTV-DKNSSSSHGNV  854
             +GL++  GQAK++GT++C+GGAMLL+LY GPV+IGQ   HWKYA+NT  DK+ +S+H N 
Sbjct  126   LGLKSLAGQAKLIGTIVCVGGAMLLSLYRGPVLIGQLGFHWKYAENTTNDKDINSTHTNF  185

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             ILGP ++I+S  +Y+ +L  QAR++++Y APYSST L  F+A F+C+II+ CV     +W
Sbjct  186   ILGPFILIISSITYALWLTIQARVNEKYAAPYSSTLLMFFMASFQCMIISFCVVPKAYEW  245

Query  673   TLTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
              L P+RA+S  YNG V S+LA+ L+SWCIERKGPLYV++FNPLLLV+ A LSW  LREK+
Sbjct  246   ALNPIRAISVVYNGTVCSSLALYLSSWCIERKGPLYVSMFNPLLLVIAAFLSWILLREKL  305

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKD  371
             Y G V+GSIL VVGLY  LWG+K E++    +  N+++E+D
Sbjct  306   YLGIVVGSILTVVGLYGFLWGQKKEME----QSKNEIEEED  342



>ref|XP_006344854.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum tuberosum]
Length=376

 Score =   408 bits (1048),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 194/342 (57%), Positives = 260/342 (76%), Gaps = 6/342 (2%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              DL P F+MV+VQLG AG  I++  VM  GMNP++H++Y+Q+ ATI++AP AYF ER++R
Sbjct  3     KDLFPFFLMVLVQLGSAGTVIISKIVMDDGMNPYVHLSYRQIIATISIAPFAYFFERETR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T +  F IFL + FG+TG Q+ Y +GL NST T+ +ALANL+PAITF+ AVL  LE 
Sbjct  63    PKLTLSTLFLIFLCSIFGVTGMQMTYLIGLKNSTATITTALANLVPAITFLLAVLSGLEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKN-----SSSS  866
             VGLR+KGGQAK++GT++CI GAMLL+LY G ++IGQ  IHWKY+++   KN     ++++
Sbjct  123   VGLRSKGGQAKVMGTILCICGAMLLSLYHGKMLIGQLKIHWKYSQHHTSKNIIHDPNNNT  182

Query  865   HGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCV-DH  689
             HGN  LGP +VI+S   YS +LI Q R+S++Y APYSST L CF+A  EC IIALCV +H
Sbjct  183   HGNFFLGPFLVIISGIVYSLWLIIQPRVSERYAAPYSSTTLMCFMASLECTIIALCVNNH  242

Query  688   NVSDWTLTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAF  509
             N + W+L P+RA+S  YNG++ SALA  L +WCI+RKGPLYV+VF PLLLV++A LSWA 
Sbjct  243   NKNAWSLNPIRAISVLYNGIISSALAFYLITWCIKRKGPLYVSVFLPLLLVISAFLSWAL  302

Query  508   LREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKL  383
             L EK+Y GT++GS+L V+GLY  LWGKK E++ I  E   K+
Sbjct  303   LGEKLYVGTIVGSMLTVIGLYGFLWGKKKEMERIKKETEEKV  344



>ref|XP_004231303.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum lycopersicum]
Length=376

 Score =   405 bits (1040),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/342 (56%), Positives = 260/342 (76%), Gaps = 6/342 (2%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              +L P F+MV+VQLG AG  I++  VM  GMNP++H++Y+Q+ ATI++AP AYF ER++R
Sbjct  3     KNLFPFFLMVLVQLGSAGTAIISKIVMDDGMNPYVHLSYRQIIATISIAPFAYFFERETR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+TP+  F IFL + FG+TG Q  Y +GL NST T+ +ALANL+PAITF+ AVL  LE 
Sbjct  63    PKLTPSTLFLIFLCSIFGVTGMQTTYLIGLKNSTATITTALANLVPAITFLLAVLSGLEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKN-----SSSS  866
             V LR+KGGQAK++GT++CI GAMLL+LY G ++IGQ  IHWKY+++   KN     ++++
Sbjct  123   VVLRSKGGQAKVMGTMLCICGAMLLSLYHGKMLIGQLKIHWKYSQHHTSKNIIHDPNNNT  182

Query  865   HGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCV-DH  689
             HGN  LGP +VI+SC  YS +LI Q R++++Y APY+ST L CF+A  EC IIALCV +H
Sbjct  183   HGNFFLGPFLVIISCIVYSLWLIIQPRVNERYAAPYTSTTLMCFMASLECTIIALCVNNH  242

Query  688   NVSDWTLTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAF  509
             + + W+L P+RA+S  YNG++ SALA  L +WCI+RKGPLYV+VF PLLLV+++ LSWA 
Sbjct  243   DKNAWSLNPIRAISVLYNGIISSALAFYLITWCIKRKGPLYVSVFLPLLLVISSFLSWAL  302

Query  508   LREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKL  383
             L EK+Y GT++GS+L V+GLY  LWGKK E++ I  E   K+
Sbjct  303   LGEKLYIGTIVGSMLTVIGLYGFLWGKKKEMERIKKETEEKV  344



>ref|XP_009616805.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Nicotiana 
tomentosiformis]
Length=339

 Score =   400 bits (1028),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 192/329 (58%), Positives = 251/329 (76%), Gaps = 5/329 (2%)
 Frame = -1

Query  1339  GVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIFFQIFLTATF  1160
             G+NIV T VM AGM+PF+HIAY+Q+ ATI+L P AYF E K++P++T +I F IFL +  
Sbjct  12    GMNIVGTLVMDAGMDPFVHIAYRQIIATISLVPFAYFFEWKTKPQLTSSILFWIFLCSLS  71

Query  1159  GLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGGQAKILGTLI  980
             GLT  QIAYFVGL NSTPT+A AL+NLIPA TF+ A+ F LE VG R+K GQAK+ GT+I
Sbjct  72    GLTASQIAYFVGLKNSTPTIACALSNLIPAATFLLAIPFGLEKVGFRSKSGQAKVWGTII  131

Query  979   CIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPIMVILSCCSYSAFL  800
             C+GGAMLL+LY GP+VIGQS IHWK+A+NT  KN S+ H N+ILGP+++I+S  SYS ++
Sbjct  132   CVGGAMLLSLYHGPIVIGQSGIHWKFAENTEKKN-STDHVNLILGPLLLIVSTVSYSLWI  190

Query  799   ITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLTPMRAVSTTYNGLVYS  620
             I QAR+S++Y APY+ST L C +A F+C+II + V H+ + W L  MR ++  YNG+V +
Sbjct  191   IFQARVSEKYAAPYTSTMLMCLMASFQCVIIGVFVIHDKAAWFLDRMRTIAVLYNGIVCT  250

Query  619   ALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMGSILIVVGLYIV  440
             AL  CLTSWCI+RKGPLYV+VF PL+L++TA+LSW  LREK+Y GTV+GS L VVG Y V
Sbjct  251   ALGYCLTSWCIQRKGPLYVSVFYPLMLIITAVLSWTLLREKLYLGTVVGSFLTVVGFYGV  310

Query  439   LWGKKNELQVINVED----NNKLKEKDAE  365
             LWGK  E      E+     +KLK++ A+
Sbjct  311   LWGKDEEKSKSETENLEIKTDKLKQQGAK  339



>ref|XP_009616806.1| PREDICTED: WAT1-related protein At1g09380-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009616807.1| PREDICTED: WAT1-related protein At1g09380-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009616808.1| PREDICTED: WAT1-related protein At1g09380-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009616809.1| PREDICTED: WAT1-related protein At1g09380-like isoform X3 [Nicotiana 
tomentosiformis]
Length=327

 Score =   397 bits (1020),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 191/328 (58%), Positives = 250/328 (76%), Gaps = 5/328 (2%)
 Frame = -1

Query  1336  VNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIFFQIFLTATFG  1157
             +NIV T VM AGM+PF+HIAY+Q+ ATI+L P AYF E K++P++T +I F IFL +  G
Sbjct  1     MNIVGTLVMDAGMDPFVHIAYRQIIATISLVPFAYFFEWKTKPQLTSSILFWIFLCSLSG  60

Query  1156  LTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGGQAKILGTLIC  977
             LT  QIAYFVGL NSTPT+A AL+NLIPA TF+ A+ F LE VG R+K GQAK+ GT+IC
Sbjct  61    LTASQIAYFVGLKNSTPTIACALSNLIPAATFLLAIPFGLEKVGFRSKSGQAKVWGTIIC  120

Query  976   IGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPIMVILSCCSYSAFLI  797
             +GGAMLL+LY GP+VIGQS IHWK+A+NT  KN S+ H N+ILGP+++I+S  SYS ++I
Sbjct  121   VGGAMLLSLYHGPIVIGQSGIHWKFAENTEKKN-STDHVNLILGPLLLIVSTVSYSLWII  179

Query  796   TQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLTPMRAVSTTYNGLVYSA  617
              QAR+S++Y APY+ST L C +A F+C+II + V H+ + W L  MR ++  YNG+V +A
Sbjct  180   FQARVSEKYAAPYTSTMLMCLMASFQCVIIGVFVIHDKAAWFLDRMRTIAVLYNGIVCTA  239

Query  616   LAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMGSILIVVGLYIVL  437
             L  CLTSWCI+RKGPLYV+VF PL+L++TA+LSW  LREK+Y GTV+GS L VVG Y VL
Sbjct  240   LGYCLTSWCIQRKGPLYVSVFYPLMLIITAVLSWTLLREKLYLGTVVGSFLTVVGFYGVL  299

Query  436   WGKKNELQVINVED----NNKLKEKDAE  365
             WGK  E      E+     +KLK++ A+
Sbjct  300   WGKDEEKSKSETENLEIKTDKLKQQGAK  327



>ref|XP_009768038.1| PREDICTED: WAT1-related protein At1g09380-like [Nicotiana sylvestris]
Length=372

 Score =   387 bits (994),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/344 (55%), Positives = 249/344 (72%), Gaps = 7/344 (2%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             +DLL   VMVIVQL +AG+ I+   VM  GMNPF+  AY+ +FATI++AP A+FLERKSR
Sbjct  5     NDLLAFVVMVIVQLAFAGMIIITKLVMNGGMNPFVQSAYRPIFATISIAPFAFFLERKSR  64

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T +I FQIFL + FG+T +Q  YF+GL NSTPTV SA+ NLIPA TF+ AV    E 
Sbjct  65    PKLTRSILFQIFLCSIFGITVNQYVYFIGLKNSTPTVVSAIDNLIPAFTFLIAVPMGAEK  124

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             +GLR   GQAK+LGT+IC+GGAMLL+LY G VVIGQ   HWKYA++T    +SS HGN  
Sbjct  125   LGLRNIAGQAKLLGTIICVGGAMLLSLYHGKVVIGQLGFHWKYAESTGKDVNSSGHGNFF  184

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
              GP +VI+S  +Y+ +LI Q +++++Y APY+   L C +A  E +II  CV   +S+W 
Sbjct  185   SGPFLVIMSSLTYAIWLIIQGKVNEKYAAPYTCITLMCLMASVESVIIGFCVVPKLSEWA  244

Query  670   LTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
             L P+RA+S  YNG+V ++ A  L+SWCIERKGPLYV++FNPLLLV++A LSW  LREK+Y
Sbjct  245   LNPIRAISVVYNGVVCTSFAYFLSSWCIERKGPLYVSMFNPLLLVISAFLSWTLLREKLY  304

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQ-------VINVEDNNKLK  380
              G V+GSI+IV+GLY  LWG+K E +       ++N E N+  K
Sbjct  305   LGVVVGSIIIVLGLYGFLWGQKMETRTDDDIEVMVNKEKNHSTK  348



>ref|NP_172409.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|Q8GXB4.1|WTR2_ARATH RecName: Full=WAT1-related protein At1g09380 [Arabidopsis thaliana]
 dbj|BAC42941.1| putative nodulin protein N21 [Arabidopsis thaliana]
 gb|AAO64061.1| putative nodulin protein, N21 [Arabidopsis thaliana]
 gb|AEE28435.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=374

 Score =   384 bits (986),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 251/357 (70%), Gaps = 8/357 (2%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             M  SD+LP   MV+VQ+GYAG+NI +   M AGM P I +AY+Q+FATIA  P+A+FLER
Sbjct  1     MAKSDMLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATFPVAFFLER  60

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
             K+RPK+T  I  Q+F  +  G TG+Q+ YFVGL NS+PT+A AL NL+PA+TF+ A +FR
Sbjct  61    KTRPKITLRILVQVFFCSITGATGNQVLYFVGLQNSSPTIACALTNLLPAVTFLLAAIFR  120

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSH  863
              E+VG++   GQAK++GTL+C+ GAM+L+ Y G  + IG+S IHW YA+N     SSS H
Sbjct  121   QETVGIKKASGQAKVIGTLVCVIGAMVLSFYHGHTIGIGESKIHWAYAENITKHGSSSGH  180

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
              N  LGP +++ +  S++A+ I Q ++S+ + APY+ST L C +   +C  IAL  DH +
Sbjct  181   SNFFLGPFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALISDHTI  240

Query  682   SDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             SDW+L +P+R +S  Y G+V SALA CL SW ++RKGPLYV+VF+PLLLV+ AI SWA L
Sbjct  241   SDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWALL  300

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKK------NELQVINVEDNNKLKEKDAEKTEA  353
              EK+YTGT MGS L+V+GLY VLWGK        E +    + N+K+K +  E  E+
Sbjct  301   EEKLYTGTFMGSALVVIGLYGVLWGKDREVSEKEEEREKVKQQNHKVKSESNEDIES  357



>ref|XP_004230335.1| PREDICTED: WAT1-related protein At1g09380 [Solanum lycopersicum]
Length=377

 Score =   383 bits (983),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 181/345 (52%), Positives = 250/345 (72%), Gaps = 1/345 (0%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             ++L+   +MVIVQ+ YAG+ I++  VM  GMN F+  AY+ +FATI++AP A+FLERK+R
Sbjct  3     NELMVFMIMVIVQVAYAGMIIISKLVMDGGMNAFVQSAYRPIFATISIAPFAFFLERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PKMT ++ FQIFL + FG+T +Q  YF+GL NSTPT+ SA+ NLIPA TF+ AV   +E 
Sbjct  63    PKMTCSVLFQIFLCSIFGITANQNIYFIGLKNSTPTIVSAIDNLIPAFTFIIAVPLGIEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             +GLR+  GQ K  GT+IC+GGAMLL+LY G VVIGQ   HWKYA+NT  K+ +S++ N  
Sbjct  123   LGLRSIAGQTKFWGTIICVGGAMLLSLYHGKVVIGQLGFHWKYAENT-SKDVNSANSNFF  181

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP ++I+S  +Y+ +LI QAR++++Y APY+ST L C +A  EC+II  CV   +S+W 
Sbjct  182   LGPFLLIVSSLTYAIWLIIQARVNEKYAAPYTSTTLMCLMASVECVIIGFCVVPKLSEWK  241

Query  670   LTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
             L P+RAVS  YNG + ++    L+SWCIE+KGPLYV++FNPL LV++A LSW  LREK+Y
Sbjct  242   LNPIRAVSVVYNGAMATSFTYFLSSWCIEKKGPLYVSMFNPLFLVISAFLSWILLREKLY  301

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTE  356
              G V+GSI++V G+Y  LWGKK E    +++     KEK    T+
Sbjct  302   LGVVLGSIIVVAGMYGFLWGKKMETSAEDIDVLELTKEKKQLSTK  346



>ref|XP_004230333.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum lycopersicum]
Length=368

 Score =   380 bits (975),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 187/344 (54%), Positives = 253/344 (74%), Gaps = 1/344 (0%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             ++L+   VMVIVQ+ +AG+ I+   VM +GM+PF+  AY+ +FATI++AP AY LERK+R
Sbjct  3     NELMIFMVMVIVQVAFAGMIIITKLVMDSGMDPFVQSAYKPIFATISIAPFAYVLERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PKMT + FFQIFL + FG+T +Q AYF+GLNNSTPT+ASA+ NLIPA TF+ AV   +E 
Sbjct  63    PKMTRSTFFQIFLCSIFGITANQYAYFIGLNNSTPTIASAIDNLIPAFTFIIAVPLGVEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             +GLR+  GQ K  GT++C+GGAMLL+LY G VVIGQ   HWKY +NT  K+ +SSH N  
Sbjct  123   LGLRSIAGQTKFWGTIVCVGGAMLLSLYHGKVVIGQLGFHWKYEENT-GKDVNSSHSNFF  181

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP ++I++  +Y+ +LI Q R+S++Y APY+   L CF+A  E +II  CV   +S+W 
Sbjct  182   LGPFLLIMASLTYAIWLIIQGRVSEKYAAPYTCITLMCFMASVESVIIGFCVVPKLSEWA  241

Query  670   LTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
             L P+RA+S  YNG+V ++ A  L+SWCIE+KGPLYV++FNPLLLV++A LSW  LREK+Y
Sbjct  242   LNPIRAISVVYNGVVSTSFAYFLSSWCIEKKGPLYVSMFNPLLLVISAFLSWTLLREKLY  301

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKT  359
              G V+GSI++V GLY  LWGKK E  V N+E N +   K   K+
Sbjct  302   LGVVVGSIIVVAGLYGFLWGKKMETSVENIEVNKEKMMKQFNKS  345



>ref|XP_002892502.1| hypothetical protein ARALYDRAFT_888180 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68761.1| hypothetical protein ARALYDRAFT_888180 [Arabidopsis lyrata subsp. 
lyrata]
Length=375

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/354 (51%), Positives = 254/354 (72%), Gaps = 3/354 (1%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             M  SD+LP   MV+VQ+GYAG+NI +   M AGM P I +AY+Q+FATIA  P+A+FLER
Sbjct  1     MAKSDMLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATFPVAFFLER  60

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
             K+RPK+T  +  Q+F  +  G TG+Q+ YF+GL NS+PT+A AL NL+PA+TF+ A +FR
Sbjct  61    KTRPKITLRVLVQVFFCSITGATGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFR  120

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSH  863
              E+VG++   GQAK++GTL+C+ GAM+L+ Y G  + IG+S IHW YA+N   + SSS+H
Sbjct  121   QETVGIKKASGQAKVIGTLVCVIGAMVLSFYHGHTIGIGESKIHWAYAENITRQGSSSAH  180

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
              N  LGP +++ +  S++A+ I Q ++S+ + APY+ST L C +   +C  IAL  DH +
Sbjct  181   SNFFLGPFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALISDHKL  240

Query  682   SDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             SDW+L +P+R +S  Y G+V SALA CL SW ++RKGPLYV+VF+PLLLV+ AI SWA L
Sbjct  241   SDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWALL  300

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAE-KTEAGE  347
              EK+YTGT MGS L+V+GLY VLWGK  E+     E     +++ ++ K+E+ E
Sbjct  301   EEKLYTGTFMGSALVVIGLYGVLWGKDREVSEKEEEREKVKQQQRSKGKSESNE  354



>ref|XP_006344855.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum tuberosum]
Length=373

 Score =   379 bits (972),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 188/344 (55%), Positives = 255/344 (74%), Gaps = 2/344 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             ++++   VMVIVQ+ +AG+ I+   VM +GM+PF+  AY+ +FATI++AP AYFLERK+R
Sbjct  3     NEIMIFMVMVIVQVAFAGMIIITKLVMDSGMDPFVQSAYKPIFATISIAPFAYFLERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PKMT +I FQIFL + FG+T +Q AYF+GLNNSTPT+ASA+ NLIPA TF+ AV   +E 
Sbjct  63    PKMTRSILFQIFLCSIFGITANQYAYFIGLNNSTPTIASAIDNLIPAFTFIIAVPLGVEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             +GLR+  GQAK  GT++C+GGAMLL+LY G VVIGQ   HWKY +NT  K+ +SSH N +
Sbjct  123   MGLRSIAGQAKFWGTIVCVGGAMLLSLYHGKVVIGQLGFHWKYEENT-GKDVNSSHSNFL  181

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP ++I++  +Y+ +LI Q R+S++Y APY+   L C +A  E +II  CV   +S+W 
Sbjct  182   LGPFLLIMASLTYAIWLIIQGRVSEKYAAPYTCITLMCLMASVESVIIGFCVVPKLSEWA  241

Query  670   LTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
             L P+RA+S  YNG+V ++ A  L+SWCIE+KGPLYV++FNPLLLV++A LSW  LREK+Y
Sbjct  242   LNPIRAISVVYNGVVSTSFAYFLSSWCIEKKGPLYVSMFNPLLLVISAFLSWTLLREKLY  301

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKT  359
              G V+GSI++V GLY  LWGKK E    N+E  NK K K   K+
Sbjct  302   LGVVVGSIIVVAGLYGFLWGKKMETSAENIEV-NKEKMKQFNKS  344



>ref|XP_009777190.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Nicotiana 
sylvestris]
Length=353

 Score =   377 bits (968),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 182/342 (53%), Positives = 246/342 (72%), Gaps = 23/342 (7%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              D LP F+MV+VQLG AG  I++  VM  GM+PF+H++Y+Q+FATI++AP AYF ER   
Sbjct  3     KDSLPFFLMVMVQLGGAGTAIISKLVMDEGMDPFVHLSYRQIFATISIAPFAYFFER---  59

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
                               +T  Q+ Y +GL NST T+ +ALANL+PAITF+ AVL  LE 
Sbjct  60    ------------------VTAMQMTYLIGLKNSTATITTALANLVPAITFLLAVLSGLEK  101

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             VGLRTK GQAK+LGT++CI GA+LL+LY G VVIGQ  IHWKY++ T     +++HGN  
Sbjct  102   VGLRTKAGQAKVLGTILCICGAILLSLYHGKVVIGQLRIHWKYSEQTSKNIEANTHGNFF  161

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP +VI+S   YS +LI Q R++++Y APYSST L CF+A  EC+I+A+CV+ + + W+
Sbjct  162   LGPFLVIISTIVYSLWLIIQPRVNERYAAPYSSTTLMCFMASLECVIVAVCVNRDKTAWS  221

Query  670   LTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
             L P+RA+S  YNG++ SALA  L +WCI+RKGPLYV+VF PLLLV++A LSW  L EK+Y
Sbjct  222   LNPIRAISVLYNGIISSALAFYLMTWCIKRKGPLYVSVFLPLLLVISAFLSWTLLGEKLY  281

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQ--VINVEDNNKLKEKD  371
              GTV+GSIL V+GLY  LWGKK E++   +++++   LKEK+
Sbjct  282   VGTVVGSILTVIGLYGFLWGKKKEMERNTVHIKEEKVLKEKN  323



>emb|CDX94976.1| BnaC05g06950D [Brassica napus]
Length=385

 Score =   377 bits (969),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/347 (51%), Positives = 246/347 (71%), Gaps = 2/347 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             DLLP   MV+VQ+GYAG+NI +   M +GM P I +AY+Q+FATIA  P+A+FLERK+RP
Sbjct  6     DLLPSLAMVLVQIGYAGMNITSKMAMESGMKPLILVAYRQIFATIATFPVAFFLERKTRP  65

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  +  QIF  +  G+TG+Q+ YF+GL NS+PT+A AL NL+PA+TF+ A +FR E+V
Sbjct  66    KITLTVLVQIFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQEAV  125

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G+R   GQAK++GT++C+ GAM+L+ Y G  + IG+S IHW YA+N  +  S S+  N  
Sbjct  126   GIRKASGQAKVIGTVVCVAGAMVLSFYHGHTIGIGESKIHWAYAQNITNHGSDSNGSNFF  185

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP M++ +  S++ + I Q ++S+ + APY+ST L C +   EC  IAL  DH ++DW+
Sbjct  186   LGPFMIMAAAVSWAVWFIIQTKMSETFAAPYTSTLLMCLMGSIECGGIALISDHKLADWS  245

Query  670   L-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L +P+R +S  Y G+V SALA CL SW I+ KGPLYV+VF+PLLLV+ A+ SW  L EK+
Sbjct  246   LSSPLRLISALYAGVVASALAFCLMSWAIQIKGPLYVSVFSPLLLVVVAVFSWTLLEEKL  305

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEA  353
             YTGT MGS L+V+GLY VLWGK  E+     E+ N+ K K   K ++
Sbjct  306   YTGTFMGSALVVIGLYGVLWGKDREMNENQDEEENQKKVKQEYKVKS  352



>ref|XP_009625724.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Nicotiana 
tomentosiformis]
Length=354

 Score =   376 bits (966),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 245/343 (71%), Gaps = 24/343 (7%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              D LP F+MV+VQLG AG  +++  VM  GM+PF+H++Y+Q+FATI++AP AYF ER   
Sbjct  3     KDSLPFFLMVLVQLGGAGTAVISKLVMDEGMDPFVHLSYRQIFATISIAPFAYFFER---  59

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
                               +T  Q+ Y +GL NST T+ +ALANL+PAITF+ A+L  LE 
Sbjct  60    ------------------VTAMQMTYLIGLKNSTATITTALANLVPAITFLLAILSGLEK  101

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             VGLRTK G AK+LGT++CI GAMLL+LY G VVIGQ  IHWKY++ T     ++SHGN  
Sbjct  102   VGLRTKAGLAKVLGTILCICGAMLLSLYHGKVVIGQLRIHWKYSEQTSKNIEANSHGNFF  161

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP +VI+S   YS +LI Q R++++Y APYSST L CF+A  EC+I+A+CV+H+ + W+
Sbjct  162   LGPFLVIISTIVYSLWLIIQPRVNERYAAPYSSTTLMCFMASLECVIVAVCVNHDKTAWS  221

Query  670   LTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
             L P+RA+S  YNG++ SALA  L +WCI+RKGPLYV+VF PLLLV++A LSW  L EK+Y
Sbjct  222   LNPIRAISVLYNGIISSALAFYLMTWCIKRKGPLYVSVFLPLLLVISAFLSWTLLGEKLY  281

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQ---VINVEDNNKLKEKD  371
              GTV+GSIL V+GLY  LWGKK  ++   V++V++    KEK+
Sbjct  282   VGTVVGSILTVIGLYGFLWGKKKGMERTTVVHVKEEKVFKEKN  324



>ref|XP_010314776.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Solanum 
lycopersicum]
Length=352

 Score =   375 bits (963),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/344 (53%), Positives = 252/344 (73%), Gaps = 6/344 (2%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              D+LPL +MVIVQLGYAG  IV+  VM  GM+P++H++Y+Q+ ATI++AP AYF ERK+R
Sbjct  3     KDVLPLLLMVIVQLGYAGTAIVSKLVMDEGMDPYVHLSYRQILATISIAPFAYFFERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+TP   F IFL +  G+T  Q+   +GL NST T+ SA+ANLIPA TF+ A++ RLE 
Sbjct  63    PKLTPFSLFLIFLCSVLGVTAMQMTCIIGLRNSTATITSAMANLIPANTFLLALICRLEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAK-NTVDKNSSSSHGNV  854
             +GL+TK GQAK++GT++CIGGAMLL+LY G VVIG+    WKY++ N   KN  +SHGN 
Sbjct  123   LGLKTKAGQAKMMGTIMCIGGAMLLSLYHGKVVIGKLGFQWKYSQHNNTSKN--NSHGNF  180

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH-NVSD  677
               GP +VI+S   YS +LI Q  ++ +Y APY+ST L  F+A  EC+I+A+CV+H + + 
Sbjct  181   FNGPFLVIISTMVYSLWLIIQPSVNMRYAAPYTSTTLMFFMASLECVIVAICVNHDDKTA  240

Query  676   WTLTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             W+L P+RA+S  YNG+V SALA+ L +WCI+RKGPLYV++F PL L+ +A LSW  L EK
Sbjct  241   WSLNPIRAISVLYNGIVSSALALYLVTWCIKRKGPLYVSMFLPLQLIFSAFLSWTLLGEK  300

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNEL--QVINVEDNNKLKEKD  371
             +YTGT +GSI  ++GLY  LWGKK ++    INV++    ++K 
Sbjct  301   LYTGTFIGSITTIIGLYCFLWGKKKDMNDNTINVKEEISKEKKQ  344



>ref|XP_002277072.1| PREDICTED: WAT1-related protein At1g09380 [Vitis vinifera]
Length=356

 Score =   374 bits (959),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 248/349 (71%), Gaps = 9/349 (3%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D LP   M +VQ+GYAG+NI     M +GMNPFI +AY+Q+FAT+A+ P AYFLERK+RP
Sbjct  4     DYLPFLAMFLVQMGYAGMNIFVKLAMDSGMNPFILVAYRQIFATVAMIPFAYFLERKTRP  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  + FQ FL++ FG T +QI YF+GL +S PT+  A  NL PA+TF+ AV FRLE+V
Sbjct  64    KITRIVLFQAFLSSIFGATLNQILYFIGLKHSNPTLGCAFNNLFPAMTFLLAVPFRLETV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G++T+ GQAK+LGT++CIGGAM+LT Y G  + IG+S IHWKYA+    ++S S   N I
Sbjct  124   GIKTRPGQAKVLGTVVCIGGAMILTFYRGHAINIGESGIHWKYAEQLKTRDSQSG-ANFI  182

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP ++I SC S++ + I Q R+  ++ APY+S+ L CF+A  EC +I L VDH  S W+
Sbjct  183   LGPFLLITSCISWAIWFIIQGRMCVKFAAPYTSSTLMCFMASIECGVIGLFVDHQPSAWS  242

Query  670   LTP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L   +R ++  Y+ +V +ALA CL SW I+RKGPLYV+VF+PLLLV+ AILSWA LR+K+
Sbjct  243   LNDSIRLIAALYSAIVCTALAFCLMSWTIQRKGPLYVSVFSPLLLVIVAILSWALLRDKL  302

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             + GTV+GS+ +V+GLY VLWGK  E      E+    +E+  E  E  E
Sbjct  303   HFGTVVGSLFVVLGLYAVLWGKGKE------ENQRGSREEAEEGKEDLE  345



>ref|XP_004230334.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum lycopersicum]
Length=366

 Score =   374 bits (959),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/343 (53%), Positives = 248/343 (72%), Gaps = 2/343 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              +LL   VMVIVQLG+AG+ I++  VM  GMNPF+  AY+ +FATI++AP A++ ERK++
Sbjct  3     KELLAFVVMVIVQLGFAGMIIISKLVMDGGMNPFVQSAYRPIFATISIAPFAFYFERKNK  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
              K+T  + FQIFL + FG+T +Q A+F+GL NSTPT+ASA+ NLIPA TF+ AV   +E 
Sbjct  63    SKLTIFVLFQIFLCSIFGITANQYAWFIGLTNSTPTIASAIDNLIPAFTFIIAVPLGIEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             +GLR+  GQAK  GT++C+GGAMLL+LY G VVIGQ   HWK A+NT  K+ +S+H N  
Sbjct  123   LGLRSIAGQAKFWGTIVCVGGAMLLSLYHGKVVIGQLGFHWKLAENT-GKDVNSAHSNFF  181

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP ++I+   +Y+ +LI Q +L+++Y APY+   L C +A  E +II  CV   +S+W 
Sbjct  182   LGPFLLIVCSLTYAIWLIIQTKLNEKYAAPYTCITLMCCMASVESVIIGFCVVPKLSEWK  241

Query  670   LTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
             L P+RA+S  YNG V ++L   L+SWCIE+KGPLYV++FNPLLLV++A LSW  LREK+Y
Sbjct  242   LNPIRAISVVYNGAVSTSLVFFLSSWCIEKKGPLYVSMFNPLLLVISAFLSWTLLREKLY  301

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKL-KEKDAE  365
              G V+GS+++V GLY  LWGKK E   +N E  N+L K  D E
Sbjct  302   LGVVVGSMIVVAGLYGFLWGKKMEDIKVNKEKMNQLSKSIDLE  344



>emb|CDX94974.1| BnaC05g06970D [Brassica napus]
Length=385

 Score =   373 bits (958),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 176/348 (51%), Positives = 250/348 (72%), Gaps = 4/348 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             DLLP   MV+VQ+GYAG+NI +   M +GM P I +AY+Q+FATIA  P+A+FLERK+RP
Sbjct  6     DLLPSLAMVLVQIGYAGMNITSKMAMESGMKPLILVAYRQIFATIATFPVAFFLERKTRP  65

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  +  QIF  +  G+TG+Q+ YF+GL NS+PT+A AL NL+PA+TF+ A +FR E+V
Sbjct  66    KITLTVLVQIFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQEAV  125

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G+R   GQAK++GT++C+ GAM+L+ Y G  + IG+S IHW YA+N  +  S S+  N  
Sbjct  126   GIRKASGQAKVIGTVVCVAGAMVLSFYHGHTIGIGESKIHWAYAQNITNHGSDSNGSNFF  185

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP M++ +  S++ + I Q ++S+ + APY+ST L C +   EC  IAL  DH ++DW+
Sbjct  186   LGPFMIMAAAVSWAVWFIIQTKMSETFAAPYTSTLLMCLMGSIECGGIALISDHKLADWS  245

Query  670   L-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L +P+R +S  Y G+V SALA CL SW I+ KGPLYV+VF+PLLLV+ A+ SW  L EK+
Sbjct  246   LSSPLRLISALYAGVVASALAFCLMSWAIQIKGPLYVSVFSPLLLVVVAVFSWTLLEEKL  305

Query  493   YTGTVMGSILIVVGLYIVLWGKKNEL-QVINVEDNN-KLKEKDAEKTE  356
             YTGT MGS L+V+GL+ VLWGK  E+ +  + EDN  K+K++   K++
Sbjct  306   YTGTFMGSALVVIGLFGVLWGKDREMNENQDQEDNQKKVKQQHTVKSD  353



>ref|XP_009148234.1| PREDICTED: WAT1-related protein At1g09380 [Brassica rapa]
Length=385

 Score =   372 bits (956),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/335 (52%), Positives = 240/335 (72%), Gaps = 2/335 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             DLLP   MV+VQ+GYAG+NI +   M +GM P I +AY+Q+FATIA  P+A+FLERK+RP
Sbjct  6     DLLPSLAMVLVQIGYAGMNITSKMAMESGMKPLILVAYRQIFATIATFPVAFFLERKTRP  65

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  +  QIF  +  G+TG+Q+ YF+GL NS+PT+A AL NL+PA+TF+ A +FR E+V
Sbjct  66    KITLRVLVQIFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQEAV  125

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G+R   GQAK++GT++C+ GAM+L+ Y G  + IG+S IHW YA+N  +  S S+  N  
Sbjct  126   GIRKASGQAKVIGTVVCVAGAMVLSFYHGHTIGIGESKIHWAYAQNITNHGSDSNGSNFF  185

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP M++ +  S++ + I Q ++S+ + APY+ST L C +   EC  IAL  DH ++DW+
Sbjct  186   LGPFMIMAAAVSWAVWFIIQTKMSETFAAPYTSTLLMCLMGSIECGGIALISDHKLADWS  245

Query  670   L-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L +P+R +S  Y G+V SALA CL SW I+ KGPLYV+VF+PLLLV+ A+ SW  L EK+
Sbjct  246   LSSPLRLISALYAGVVASALAFCLMSWAIQIKGPLYVSVFSPLLLVVVAVFSWTLLEEKL  305

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNN  389
             YTGT MGS L+V+GLY VLWGK  E+     E+ N
Sbjct  306   YTGTFMGSALVVIGLYGVLWGKDREMNENQDEEEN  340



>ref|XP_007031215.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY11717.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
Length=369

 Score =   372 bits (954),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 246/350 (70%), Gaps = 9/350 (3%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D +P    V+VQLGYAG+NI +   M +GM P I +AY+Q+FAT+A+AP AYFLERK+RP
Sbjct  4     DFVPFLANVLVQLGYAGMNITSKLAMESGMKPLILVAYRQIFATLAIAPFAYFLERKTRP  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T +I FQIFL +  G T +Q+ YFVGL NS+ TVA AL N++PA TF  A L R E+V
Sbjct  64    KITKHILFQIFLCSLTGATANQVFYFVGLENSSATVACALNNVLPAATFALAALCRQEAV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G++   GQAK+LGTL+C+GGAMLL+ Y G  + IG S+IHW YA     K SSS+  N  
Sbjct  124   GIKKASGQAKVLGTLVCVGGAMLLSFYHGHTIGIGDSSIHWAYADKMTSK-SSSNGSNFF  182

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP +V+ S  +++ +LI Q + SK + APY+ TAL CF+A  EC II +  DH +S W+
Sbjct  183   LGPFLVMASAVAWAVWLIIQGQTSKNFPAPYTCTALMCFMASIECTIIGIFSDHKISAWS  242

Query  670   L-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L + MR ++  Y G+V +A+  C+ SW I++KGPLYV+VF+PLLLV+ A+LSWA LREK+
Sbjct  243   LSSSMRLIAALYAGIVCNAMTFCVLSWSIQKKGPLYVSVFSPLLLVIVAVLSWALLREKL  302

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVIN------VEDNNKLKEKDAEK  362
             Y GTV+GS+LIV GLY VLWGK  E++ +        E+  K +EKD + 
Sbjct  303   YVGTVVGSVLIVGGLYAVLWGKDREIKQMKSNELETAEEATKAREKDGKD  352



>gb|AAM65466.1| putative nodulin protein, N21 [Arabidopsis thaliana]
Length=363

 Score =   371 bits (953),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 244/346 (71%), Gaps = 8/346 (2%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             MV+VQ+GYAG+NI +   M AGM P I +AY+Q+FATIA  P+A+FLERK+RPK+T  I 
Sbjct  1     MVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATFPVAFFLERKTRPKITLRIL  60

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
              Q+F  +  G TG+Q+ YFVGL NS+PT+A AL NL+PA+TF+ A +FR E+VG++   G
Sbjct  61    VQVFFCSITGATGNQVLYFVGLQNSSPTIACALTNLLPAVTFLLAAIFRQETVGIKKASG  120

Query  1006  QAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILGPIMVI  830
             Q K++GTL+C+ GAM+L+ Y G  + IG+S IHW YA+N     SSS H N  LGP +++
Sbjct  121   QTKVIGTLVCVIGAMVLSFYHGHTIGIGESKIHWAYAENITKHGSSSGHSNFFLGPFLIM  180

Query  829   LSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-TPMRA  653
              +  S++A+ I Q ++S+ + APY+ST L C +   +C  IAL  DH +SDW+L +P+R 
Sbjct  181   AAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALISDHTISDWSLSSPLRF  240

Query  652   VSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMG  473
             +S  Y G+V SALA CL SW ++RKGPLYV+VF+PLLLV+ AI SWA L EK+YTGT MG
Sbjct  241   ISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWALLEEKLYTGTFMG  300

Query  472   SILIVVGLYIVLWGKK------NELQVINVEDNNKLKEKDAEKTEA  353
             S L+V+GLY VLWGK        E +    + N+K+K +  E  E+
Sbjct  301   SALVVIGLYGVLWGKDREVSEKEEEREKVKQQNHKVKSESNEDIES  346



>ref|XP_006417578.1| hypothetical protein EUTSA_v10007900mg [Eutrema salsugineum]
 gb|ESQ35931.1| hypothetical protein EUTSA_v10007900mg [Eutrema salsugineum]
Length=385

 Score =   371 bits (953),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 246/351 (70%), Gaps = 4/351 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             DLLP   MV+VQ+GYAG+NI +   M +GM P I +AY+Q+FATIA  P+AYF+ERK+RP
Sbjct  6     DLLPSLAMVLVQIGYAGMNITSKMAMDSGMKPLILVAYRQIFATIATFPVAYFIERKTRP  65

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  +  Q+F  +  G TG+Q+ YF+GL NS+PT+A AL NL+PA+TF+ A +FR E+V
Sbjct  66    KITLRVLVQVFFCSITGATGNQVLYFIGLQNSSPTIACALTNLLPAVTFILAAIFRQEAV  125

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G++   GQAK++GT++C+ GAM+L+ Y G  + IG+S IHW YA+N       S+  N  
Sbjct  126   GIKKASGQAKVIGTVVCVAGAMVLSFYHGHTIGIGESKIHWGYAQNITSHGPDSTGSNFF  185

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP +++ +  S++ + I Q ++S+ + APY+ST L C +   +C  IAL  DH +SDW+
Sbjct  186   LGPFLIMAAAVSWAVWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALISDHKLSDWS  245

Query  670   LT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             LT P+R +S  Y G+V SALA CL SW I+ KGPLYV+VF+PLLLV+ A+ SW FL EK+
Sbjct  246   LTSPIRLISALYAGVVASALAFCLMSWAIQLKGPLYVSVFSPLLLVVVAVFSWTFLEEKL  305

Query  493   YTGTVMGSILIVVGLYIVLWGKKNEL--QVINVEDNNKLKEKDAEKTEAGE  347
             YTGT +GS L+V+GLY VLWGK  E+  +    E+  K+K++   K +  E
Sbjct  306   YTGTFVGSALVVIGLYGVLWGKDREMNGKEEGEENQKKVKQQHIVKRDINE  356



>ref|XP_010475772.1| PREDICTED: WAT1-related protein At1g09380 [Camelina sativa]
Length=375

 Score =   370 bits (950),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 249/350 (71%), Gaps = 2/350 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             SDLLP   MV+VQ+GYAG+NI +   M AGM P I +AY+Q+FATIA  P+A+FLERK+R
Sbjct  5     SDLLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATFPVAFFLERKTR  64

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T  +  QIF  +  G TG+Q+ YF+GL NS+PT+A AL NL+PA+TF+ A +FR E+
Sbjct  65    PKITLKVLVQIFFCSITGATGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQET  124

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             VG++   GQAK++GTL+C+ GAM+L+ Y G  + IG+S IHW YA+N   + SSSS  N 
Sbjct  125   VGIKKASGQAKVIGTLVCVIGAMVLSFYHGHTLGIGESKIHWAYAENITSQGSSSSSSNF  184

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
              LGP +++ +  S+SA+ I Q ++S+ + APY+ST L C +   +C  IAL  DH VSDW
Sbjct  185   FLGPFLIMAAAVSWSAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALITDHKVSDW  244

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L +P+R +S  Y G+V SALA CL SW ++RKGPLYV+VF+PLLLV+ AI SW  L EK
Sbjct  245   SLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWTLLDEK  304

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             +YTGT +GS L+++GLY VLWGK  E+     E     +++   K+E+ E
Sbjct  305   LYTGTFLGSALVIIGLYGVLWGKDREVSEKEEEAEKVKQQQRKVKSESNE  354



>emb|CDY69907.1| BnaA06g37940D [Brassica napus]
Length=385

 Score =   370 bits (951),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 172/335 (51%), Positives = 240/335 (72%), Gaps = 2/335 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             DLLP   MV+VQ+GYAG+NI +   M +GM P I +AY+Q+FATIA  P+A+FLERK+RP
Sbjct  6     DLLPSLAMVLVQIGYAGMNITSKMAMESGMKPLILVAYRQIFATIATFPVAFFLERKTRP  65

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  +  QIF  +  G+TG+Q+ YF+GL NS+PT+A AL NL+PA+TF+ A +FR E+V
Sbjct  66    KITLTVLVQIFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQEAV  125

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G+R   GQAK++GT++C+ GAM+L+ Y G  + IG+S IHW YA+N  +  S S+  +  
Sbjct  126   GIRKASGQAKVIGTVVCVAGAMVLSFYHGHTIGIGESKIHWAYAQNITNHGSDSNGSSFF  185

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP M++ +  S++ + I Q ++S+ + APY+ST L C +   EC  IAL  DH ++DW+
Sbjct  186   LGPFMIMAAAVSWAVWFIIQTKMSETFAAPYTSTLLMCLMGSIECGGIALISDHKLADWS  245

Query  670   L-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L +P+R +S  Y G+V SALA CL SW I+ KGPLYV+VF+PLLLV+ A+ SW  L EK+
Sbjct  246   LSSPLRLISALYAGVVASALAFCLMSWAIQIKGPLYVSVFSPLLLVVVAVFSWTLLEEKL  305

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNN  389
             YTGT MGS L+V+GLY VLWGK  E+     E+ N
Sbjct  306   YTGTFMGSALVVIGLYGVLWGKDREMNENQDEEEN  340



>ref|XP_006305109.1| hypothetical protein CARUB_v10009476mg [Capsella rubella]
 gb|EOA38007.1| hypothetical protein CARUB_v10009476mg [Capsella rubella]
Length=373

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/354 (51%), Positives = 250/354 (71%), Gaps = 3/354 (1%)
 Frame = -1

Query  1399  MGCS-DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLE  1223
             MG S D+LP   MV+VQ+GYAG+NI +   M AGM P I +AY+Q+FATIA  P+A FLE
Sbjct  1     MGKSRDMLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATLPVAIFLE  60

Query  1222  RKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLF  1043
             RK+RPK+T  +  QIF  +  G TG+Q+ YF+GL NS+PT+A AL NL+PA+TF+ A +F
Sbjct  61    RKTRPKITLKVLVQIFFCSITGATGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIF  120

Query  1042  RLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSS  866
             R E+VG++   GQAK++GTL+C+ GAM+L+ Y G  + IG+S IHW YA+N   + SSSS
Sbjct  121   RQETVGIKKASGQAKVIGTLVCVIGAMVLSFYHGHTIGIGESKIHWAYAENITSQGSSSS  180

Query  865   HGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN  686
               N  LGP +++ +  S++A+ I Q ++S+ + APY+ST L C +   +C  IAL  DH 
Sbjct  181   SSNFFLGPFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALISDHK  240

Query  685   VSDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAF  509
             +SDW+L +P+R +S  Y G+V SALA CL SW ++RKGPLYV+VF+PLLLV+ AI SW  
Sbjct  241   LSDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWTL  300

Query  508   LREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             L EK+YTGT +GS L+++GLY VLWGK  E+   + E     +++   K E+ E
Sbjct  301   LDEKLYTGTFLGSALVIIGLYGVLWGKDREVTEKDEEAEKVKQQQHKVKIESNE  354



>ref|XP_006344801.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Solanum 
tuberosum]
Length=376

 Score =   369 bits (948),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/346 (54%), Positives = 253/346 (73%), Gaps = 5/346 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             ++L+   +MVIVQ+ YAG+ I++  VM  GMN F+  AY+ +FATI++AP A+FLERK+R
Sbjct  3     NELMVFMIMVIVQVAYAGMVIISKLVMDGGMNAFVQSAYRPIFATISIAPFAFFLERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PKMT +I FQIFL + FG+T +Q  YF+GL NSTPT+ SA+ NLIPA TF+ AV   +E 
Sbjct  63    PKMTRSILFQIFLCSIFGITANQNIYFIGLKNSTPTIVSAIDNLIPAFTFIIAVPLGIEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             +GLR+  GQ K  GT+IC+GGAMLL+LY G VVIGQ   HWKYA+NT  K+ +S++ N  
Sbjct  123   LGLRSIAGQTKFWGTIICVGGAMLLSLYHGKVVIGQLGFHWKYAENT-SKDVNSANSNFF  181

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP ++ILS  +Y+ +LI QAR++++Y APY+ST L C +A  EC+II  CV   +S+WT
Sbjct  182   LGPFLLILSSLTYAIWLIIQARVNEKYAAPYTSTTLMCLMASVECVIIGFCVVPKLSEWT  241

Query  670   LTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
             L P+RAVS  YNG + ++    L+SWCIE+KGPLYV++FNPL LV++A LSW  LREK+Y
Sbjct  242   LNPIRAVSVVYNGAMATSFTYFLSSWCIEKKGPLYVSMFNPLFLVISAFLSWILLREKLY  301

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEA  353
              G V+GSI++V G+Y  LWGK+ E    N ED + L E   EK ++
Sbjct  302   LGVVVGSIIVVAGMYGFLWGKRME---TNAEDIDVL-ELTKEKKQS  343



>ref|XP_002512549.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF50001.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=370

 Score =   369 bits (946),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/350 (51%), Positives = 252/350 (72%), Gaps = 3/350 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             +D  P   MVIVQ G+AG+NI +   M +GM P + ++Y+Q+FATIA+ P AYF E K+R
Sbjct  5     NDFFPFLAMVIVQFGFAGMNITSKLAMDSGMKPLVLVSYRQIFATIAMVPFAYFFEWKTR  64

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T  +  QIF+ +  G+TG+Q+ YF+GL NSTPT+  AL N++PA+TF+ AVL R ES
Sbjct  65    PKITKPLLIQIFICSLTGVTGNQVFYFIGLENSTPTIGCALTNILPAVTFILAVLLRQES  124

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             VG++   GQAK+LGT+IC+GGAMLL+ Y GP++ IG+S+IHWKYA  T   NS+++  + 
Sbjct  125   VGIKKISGQAKLLGTVICVGGAMLLSFYHGPMINIGESSIHWKYADETGSSNSAAAKSSF  184

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             ILGP+ ++ S  S++ +   QA++S  + APY+ST L CF+   EC++I L  +H +S W
Sbjct  185   ILGPVFIMASAVSWAVWFTLQAKVSVTFPAPYTSTLLMCFMGSIECVVIGLGANHELSQW  244

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L +P R ++  Y G+V SALA  LTSW I++KG LYV+VF+PLLLV+ A+LSWA LREK
Sbjct  245   SLRSPGRLIAALYAGIVCSALAFSLTSWSIQKKGALYVSVFSPLLLVIVAVLSWALLREK  304

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             +Y GTV+GS LIV GLY VLWGK  E+++  +ED   +K+    K E G+
Sbjct  305   LYLGTVVGSGLIVAGLYAVLWGKDKEMKMKGIEDIEAIKQGGG-KEERGD  353



>ref|XP_010026174.1| PREDICTED: WAT1-related protein At1g09380-like [Eucalyptus grandis]
 gb|KCW58627.1| hypothetical protein EUGRSUZ_H01288 [Eucalyptus grandis]
Length=367

 Score =   368 bits (944),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 168/350 (48%), Positives = 252/350 (72%), Gaps = 4/350 (1%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             M   D +P   MVI+Q+GYAG+NI +   M +GMNPF+ + Y+Q+FAT+A  P A  LER
Sbjct  1     MAIVDFMPFLAMVIIQVGYAGMNITSKLAMDSGMNPFVLVTYRQIFATLATVPFALILER  60

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
             K+RPK+T  I  QIF+ +  G   +Q+ +F+GLNNS+PT+A AL N++PA+TF+ A++FR
Sbjct  61    KTRPKITMPILLQIFICSLTGAFMNQVFFFIGLNNSSPTIACALTNILPAMTFLFALIFR  120

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSH  863
              ES+G++++ GQAK++GTL+C+GGAMLL+ Y G  + IG S IHWK+A+   D++ ++  
Sbjct  121   QESLGIKSRAGQAKVIGTLVCVGGAMLLSFYHGRNIGIGNSAIHWKFAEKMTDEHPTNKS  180

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
                 LGP  +  S  +++ + I QA+LS ++ APY++T L C +A  EC+++ + V+H+V
Sbjct  181   N--FLGPFFIFASTAAWALWFIIQAKLSTKFPAPYTTTTLMCLMASIECVVVGVAVEHHV  238

Query  682   SDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             + W+L + +R +S  Y G V SALA C+ +WCIERKGPLY +VF+PL+LV+TA+LSWA L
Sbjct  239   AAWSLKSGIRLISVVYAGFVCSALAFCVMTWCIERKGPLYTSVFSPLMLVITAVLSWALL  298

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTE  356
             REK++ GT++GSILI+VGLY VLWGK  E +  N+ +  +   K+ EK +
Sbjct  299   REKLFVGTLVGSILIIVGLYSVLWGKDKEAKQANITEEMEAAVKNREKED  348



>ref|XP_010458220.1| PREDICTED: WAT1-related protein At1g09380-like [Camelina sativa]
Length=375

 Score =   367 bits (943),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 182/354 (51%), Positives = 251/354 (71%), Gaps = 3/354 (1%)
 Frame = -1

Query  1399  MGCS-DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLE  1223
             MG S DLLP   MV+VQ+GYAG+NI +   M AGM P I +AY+Q+FATIA  P+A+FLE
Sbjct  1     MGKSRDLLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATFPVAFFLE  60

Query  1222  RKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLF  1043
             RK+RPK+T  +  QIF  +  G TG+Q+ YF+GL NS+PTVA AL NL+PA+TF+ A +F
Sbjct  61    RKTRPKITLKVLVQIFFCSMTGATGNQVLYFIGLQNSSPTVACALTNLLPAVTFLLAAIF  120

Query  1042  RLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSS  866
             R E+VG++   GQAK++GTL+C+ GAM+L+ Y G  + IG+S IHW YA+N   + SSSS
Sbjct  121   RQETVGIKKASGQAKVIGTLVCVIGAMVLSFYHGHTLGIGESKIHWAYAENITSQGSSSS  180

Query  865   HGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN  686
               N  LGP +++ +  S++A+ I Q ++S+ + APY+ST L C +   +C  IAL  DH 
Sbjct  181   SSNFFLGPFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALITDHK  240

Query  685   VSDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAF  509
             VSDW+L +P+R +S  Y G+V SALA CL SW ++RKGPLYV+VF+PLLLV+ AI SW  
Sbjct  241   VSDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWTL  300

Query  508   LREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             L EK+YTGT +GS L+++GLY VLWGK  E+     E     +++   K+E+ E
Sbjct  301   LDEKLYTGTFLGSALVIIGLYGVLWGKDREVSEKEEEAERVKQQQRKVKSESNE  354



>gb|KDP23359.1| hypothetical protein JCGZ_23192 [Jatropha curcas]
Length=370

 Score =   367 bits (941),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/340 (51%), Positives = 244/340 (72%), Gaps = 3/340 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             DLLP   MV+VQ G+AG+NI++   M +GM P + +AY+Q+FATIA+ P AYF E K+RP
Sbjct  6     DLLPFLAMVLVQFGFAGMNIISKLAMDSGMKPLVLVAYRQIFATIAMVPFAYFFEWKTRP  65

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  + FQIF+ +  G TG+Q+ YF+GL NSTPT+  AL N++PA+TF+ AVL R ESV
Sbjct  66    KITKELLFQIFICSLTGATGNQVFYFIGLQNSTPTIGCALTNILPAVTFILAVLLRQESV  125

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSS-SHGNV  854
             G++   GQAK+LGT IC+GGAMLL+ Y G  + +G+S+IHWKYA +   +NS+  S  N 
Sbjct  126   GIKKLSGQAKLLGTAICVGGAMLLSFYHGSRINVGESSIHWKYADDIGSQNSNDGSKSNF  185

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             ILGP+ ++ S   ++ +   QA++S+++ APY+ST L CF+   +C++I    +H  +DW
Sbjct  186   ILGPLFILASAVCWAIWFTIQAKVSEKFPAPYTSTFLLCFMGSIQCVLIGFGANHEAADW  245

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L  P R V+  Y  +V SALA  LTSW I++KG LYV+VF+PLLLV+ A+LSWA LREK
Sbjct  246   SLRDPGRLVAALYAAIVCSALAFSLTSWSIQKKGALYVSVFSPLLLVIVAVLSWALLREK  305

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKE  377
             +Y GTV+GS LIV GLY VLWGK  E+++  +E+    K+
Sbjct  306   LYVGTVVGSALIVAGLYAVLWGKDKEMKLKVIEEIEARKQ  345



>gb|KEH24463.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=382

 Score =   366 bits (940),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 250/346 (72%), Gaps = 11/346 (3%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             MG + ++PL +M+++QL YAG+NI +   +  GMNP I +AY+Q+FAT+++AP AY+LER
Sbjct  1     MGSASIIPLVLMIVMQLAYAGMNITSKIAILGGMNPLILVAYRQIFATVSIAPFAYWLER  60

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
                P+MT  I  QI L++  G+TG+Q+ YF GL  +T T+A AL NL+PA TFV A+LFR
Sbjct  61    DMVPRMTKRIMVQILLSSITGVTGNQVLYFAGLKYTTATIACALTNLLPAFTFVLAILFR  120

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTV---DKNSS  872
              E++G++ K G AK++GT++C+GGA+LL+ Y G V+ I +S IHW YA+      D +S+
Sbjct  121   QENLGIKKKSGIAKVVGTVLCVGGAILLSFYHGQVIGIPESKIHWSYAERIEGAGDNSSA  180

Query  871   SSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVD  692
             +   NV+LGPI++ILS   +S + I QA +SK +  PY+STA  CFLA F+C+ IALC D
Sbjct  181   AQSNNVLLGPILLILSALIWSLWFIIQADMSKNFPVPYTSTAYMCFLASFQCVFIALCFD  240

Query  691   HNVSDWTLTP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSW  515
             H VS W+L+  MR  S+ Y G++ + L+ C+ SW IERKGPLYV+VF PL L++TA +SW
Sbjct  241   HRVSSWSLSDAMRLTSSLYAGIICTGLSYCIISWTIERKGPLYVSVFTPLQLIITAFISW  300

Query  514   AFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKE  377
             AFLREK+Y GT +GS+LIV GLY VLWGK  E+      DNNK+++
Sbjct  301   AFLREKLYVGTALGSLLIVGGLYSVLWGKSKEV------DNNKVED  340



>emb|CBI39638.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   373 bits (958),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/341 (53%), Positives = 248/341 (73%), Gaps = 4/341 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D LP   M +VQ+GYAG+NI     M +GMNPFI +AY+Q+FAT+A+ P AYFLERK+RP
Sbjct  4     DYLPFLAMFLVQMGYAGMNIFVKLAMDSGMNPFILVAYRQIFATVAMIPFAYFLERKTRP  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  + FQ FL++ FG T +QI YF+GL +S PT+  A  NL PA+TF+ AV FRLE+V
Sbjct  64    KITRIVLFQAFLSSIFGATLNQILYFIGLKHSNPTLGCAFNNLFPAMTFLLAVPFRLETV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G++T+ GQAK+LGT++CIGGAM+LT Y G  + IG+S IHWKYA+    ++S S   N I
Sbjct  124   GIKTRPGQAKVLGTVVCIGGAMILTFYRGHAINIGESGIHWKYAEQLKTRDSQSG-ANFI  182

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP ++I SC S++ + I Q R+  ++ APY+S+ L CF+A  EC +I L VDH  S W+
Sbjct  183   LGPFLLITSCISWAIWFIIQGRMCVKFAAPYTSSTLMCFMASIECGVIGLFVDHQPSAWS  242

Query  670   LTP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L   +R ++  Y+ +V +ALA CL SW I+RKGPLYV+VF+PLLLV+ AILSWA LR+K+
Sbjct  243   LNDSIRLIAALYSAIVCTALAFCLMSWTIQRKGPLYVSVFSPLLLVIVAILSWALLRDKL  302

Query  493   YTGTVMGSILIVVGLYIVLWGK-KNELQVINVEDNNKLKEK  374
             + GTV+GS+ +V+GLY VLWGK K E Q  + E+  + KE 
Sbjct  303   HFGTVVGSLFVVLGLYAVLWGKGKEENQRGSREEAEEGKED  343



>ref|XP_010489953.1| PREDICTED: WAT1-related protein At1g09380-like [Camelina sativa]
Length=375

 Score =   364 bits (934),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/354 (51%), Positives = 250/354 (71%), Gaps = 3/354 (1%)
 Frame = -1

Query  1399  MGCS-DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLE  1223
             MG S DLLP   MV+VQ+GYAG+NI +   M AGM P I +AY+Q+FATIA  P+A+FLE
Sbjct  1     MGKSRDLLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATFPVAFFLE  60

Query  1222  RKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLF  1043
             RK+RPK+T  +  QI   +  G TG+Q+ YF+GL NS+PTVA AL NL+PA+TF+ A +F
Sbjct  61    RKTRPKITLKVLVQICFCSMTGATGNQVLYFIGLQNSSPTVACALTNLLPAVTFLLAAIF  120

Query  1042  RLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSS  866
             R E+VG++   GQAK++GTL+C+ GAM+L+ Y G  + IG+S IHW YA+N   + SSSS
Sbjct  121   RQETVGIKKASGQAKVIGTLVCVIGAMVLSFYHGHTLGIGESKIHWAYAENITSQGSSSS  180

Query  865   HGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN  686
               N  LGP +++ +  S++A+ I Q ++S+ + APY+ST L C +   +C  IAL  DH 
Sbjct  181   SSNFFLGPFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGTIALITDHK  240

Query  685   VSDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAF  509
             VSDW+L +P+R +S  Y G+V SALA CL SW ++RKGPLYV+VF+PLLLV+ AI SW  
Sbjct  241   VSDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWTL  300

Query  508   LREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             L EK+YTGT +GS L+++GLY VLWGK  E+     E     +++   K+E+ E
Sbjct  301   LDEKLYTGTFLGSALVIIGLYGVLWGKDREVSEKEEEAEKVRQQQRKVKSESNE  354



>ref|XP_011038989.1| PREDICTED: WAT1-related protein At1g09380 [Populus euphratica]
Length=367

 Score =   363 bits (932),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 248/347 (71%), Gaps = 4/347 (1%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             M  +D+LP   M IVQ GYAG+NI +   M +GM P + + Y+Q+FATIA+ P AYF E 
Sbjct  1     MDMADVLPFLAMAIVQFGYAGMNITSKLAMDSGMKPLVLVGYRQIFATIAMVPFAYFFEW  60

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
             ++RPK+T ++  QIF+ +  G+TG+Q+ YF+GL NSTPT+  AL N++PA+TF+ AVLFR
Sbjct  61    RTRPKITMSLLLQIFICSLTGVTGNQVFYFIGLENSTPTIGCALTNILPAVTFILAVLFR  120

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSH  863
              ESVG++   GQAK+LGT++C+GGAMLL+ Y G ++ IG+S+IHW YA +T   ++++  
Sbjct  121   QESVGIKKASGQAKLLGTIVCVGGAMLLSFYHGHMINIGESSIHWNYADST-GNSTTNKK  179

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
              N +LG + +I S  S++ +   QA++S ++ APY+ T L CF+   EC++I +  +H V
Sbjct  180   SNFVLGSLCIIASAISWAIWFTVQAKVSLKFPAPYTCTLLMCFMGSIECVVIGIGANHKV  239

Query  682   SDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             S+W+L +P R ++  Y G+V SALA  LTSW I+RKG LYV+VF+PLLLV+ A+LSWA L
Sbjct  240   SEWSLRSPGRLIAALYAGIVCSALAFSLTSWSIQRKGALYVSVFSPLLLVIVAVLSWALL  299

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAE  365
              EKIY GT +GSILIV GLY VLWGK  EL+   +E+   +K  + E
Sbjct  300   HEKIYVGTAVGSILIVAGLYAVLWGKDKELKE-EIEETKVMKLGNKE  345



>ref|XP_010270886.1| PREDICTED: WAT1-related protein At1g09380 isoform X1 [Nelumbo 
nucifera]
Length=362

 Score =   362 bits (930),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 171/349 (49%), Positives = 249/349 (71%), Gaps = 3/349 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             + LP   M++VQ+GYAG+NI++   + +GM+P + + Y+Q+ ATI ++P AYF ERK+RP
Sbjct  4     EFLPCIAMIMVQIGYAGMNILSKLAIDSGMSPLVMVTYRQIVATIIISPFAYFWERKTRP  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             ++T    FQIFL++ FG+ G+Q  YF+GL  STPT+  AL NL+PA+TF+ AV F +E V
Sbjct  64    RITSATLFQIFLSSLFGIAGNQCLYFIGLKYSTPTIGCALTNLLPAVTFIMAVPFGMEKV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             GLR K GQAK+LGT++C+GGAML++ Y G  + I  S IHW+Y  +++ ++ SS+    +
Sbjct  124   GLRRKAGQAKVLGTVMCVGGAMLMSFYKGIRIPIPDSAIHWRYV-DSITESGSSNDKVTL  182

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LG +++I S  S+ A+ I QA++S+ + APYSSTAL C +   EC IIA+  DH VS W+
Sbjct  183   LGSLILIASVISWGAWFIMQAKVSETFSAPYSSTALMCLMGSIECGIIAVTADHQVSAWS  242

Query  670   L-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L + +R +++ Y+GLV SA AI L SWCIE+KGPLYV+ F+PLLLV+ A++ WA L +K+
Sbjct  243   LHSSIRLITSLYSGLVASAFAIYLMSWCIEKKGPLYVSAFSPLLLVIVAVIGWALLADKL  302

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             Y G+V+GS+LIV+GLY VLWGK  E++  N  D   L  +  E  E G+
Sbjct  303   YMGSVVGSVLIVMGLYAVLWGKDMEMKEKNSVDEKNLSLEGEEDKEKGK  351



>ref|XP_003536035.1| PREDICTED: WAT1-related protein At1g09380-like [Glycine max]
 gb|KHN16036.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=377

 Score =   363 bits (931),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 180/355 (51%), Positives = 255/355 (72%), Gaps = 6/355 (2%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
              S ++PL  M+IVQLGYAG+NI +   + +GM+P + +AY+Q+FATI+LAP A++LER +
Sbjct  2     ASSVIPLLAMIIVQLGYAGMNITSKLAIQSGMHPLVLVAYRQIFATISLAPFAFWLERNT  61

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
              P+MT +I FQI L++  G+TG+QI YF+GL  STPT+A AL NL+PA TF+ AVL R E
Sbjct  62    APRMTKHIAFQILLSSLTGVTGNQILYFLGLKYSTPTIACALNNLLPAFTFILAVLSRQE  121

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHG-  860
              + ++T+ G AK LGT++ +GGA+LL+ Y G V+ +G+S IHW+YA+N   ++SSS  G 
Sbjct  122   YLRIKTRAGVAKALGTVLSVGGAVLLSFYHGKVLGLGESKIHWRYAENMQRESSSSGGGR  181

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             N +LGP+ VI+S   ++ + I Q  +SK Y APY+ST   C +A  +C++IAL  +HNVS
Sbjct  182   NHLLGPVAVIVSALVWAVWFIVQKNMSKSYPAPYTSTFYMCLMASIQCVVIALAAEHNVS  241

Query  679   DWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W+L + +R  S  Y G + +ALA  L +W IERKGPLYV+VF+PLLLV+ A+ SWAFL 
Sbjct  242   AWSLHSTIRLTSALYAGTISTALAYVLLAWTIERKGPLYVSVFSPLLLVIIAVASWAFLH  301

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKK---NELQVINVEDNNKLKEKDAEKTEAGE  347
             E++Y GTV+GS+LIV+GLY VLWGK    N++ V+ VE       KD+EK E  +
Sbjct  302   EQLYVGTVIGSLLIVLGLYFVLWGKNKEMNKIDVVEVEGTVMEAIKDSEKDEVKD  356



>ref|XP_009118319.1| PREDICTED: WAT1-related protein At1g09380-like [Brassica rapa]
Length=364

 Score =   362 bits (929),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 242/351 (69%), Gaps = 4/351 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D+LP   MV+VQ+GYAG+NI +   M AGM P I +AY+Q+FA+IA  P+A+FLERK+ P
Sbjct  6     DMLPSLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFASIATLPVAFFLERKTIP  65

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  +  Q F  +  G+TG+Q+ YF+GL NS+PT+A AL NL+PA+TF+ A +FR ESV
Sbjct  66    KITMRVLVQAFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQESV  125

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G+R   GQAK++GT++C+ GAMLL+ Y G  + IG+S IHW YA+N     S S+  N  
Sbjct  126   GIRKVSGQAKVIGTVVCVAGAMLLSFYHGHTIGIGESKIHWTYAQNITAHGSDSAGSNFF  185

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP +++ +  S + + I Q ++S+ + APY+ST L C +   +C ++AL  DH ++DW+
Sbjct  186   LGPFLIMAAAVSCAGWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGVVALISDHKLADWS  245

Query  670   L-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L +P+R +S  Y G+V SALA CL SW I  KGPLYV+VF+PL+LV+ A+ SW  L EK+
Sbjct  246   LSSPLRLISALYAGVVASALAFCLMSWAINIKGPLYVSVFSPLVLVIVAVFSWTLLEEKL  305

Query  493   YTGTVMGSILIVVGLYIVLWGKKNEL--QVINVEDNNKLKEKDAEKTEAGE  347
             YTGT MGS L+V+GLY VLWGK  E+  +   VE     K++   K +  E
Sbjct  306   YTGTFMGSALVVIGLYGVLWGKDREMNEKEDEVEIQKMAKQQPTVKRDINE  356



>ref|XP_010674547.1| PREDICTED: WAT1-related protein At1g09380 [Beta vulgaris subsp. 
vulgaris]
Length=381

 Score =   361 bits (927),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 183/363 (50%), Positives = 257/363 (71%), Gaps = 19/363 (5%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             MG ++LLP F MVIVQ+GYAG+NI +   M +GM P + +AY+Q+FATI L P AYF ER
Sbjct  1     MGRNELLPFFAMVIVQIGYAGMNISSKVAMESGMAPLVLVAYRQLFATIVLVPFAYFSER  60

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
             + RPK+T  I FQ+FL + FG T +QI YF+GL  +T T+A AL N++PA+TF+ AV F 
Sbjct  61    EKRPKITKQILFQVFLCSLFGATLNQICYFIGLKETTATIACALNNILPAMTFLLAVPFG  120

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTV---DKNSS  872
             LE+VG+R +GGQAKI+GTL+C+GGAMLL+ Y G ++ I Q  IHW Y  +       N S
Sbjct  121   LEAVGIRKRGGQAKIVGTLVCVGGAMLLSFYHGHLIYIRQPDIHWHYDGDDSMNNRNNGS  180

Query  871   SSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVD  692
             +SH N+ LGP++++ S  + + + I QA++SK + APY+S+AL C +A  +C +IA C +
Sbjct  181   NSHLNLFLGPLLLLASNLAMAIWFILQAKMSKNFAAPYTSSALMCLMATIQCTVIAACTN  240

Query  691   HNVSDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSW  515
             H +SDW+L + +R VS+ Y G+V SA+A+CL SW I++KGPLYV+VFNPLLLV+ A+LSW
Sbjct  241   HKISDWSLKSHIRMVSSIYAGIVGSAVAVCLMSWTIQKKGPLYVSVFNPLLLVIVALLSW  300

Query  514   AFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKL----------KEKDAE  365
             A   EK+Y GT +GS+ IV+GLY VLWGK  E+    ++D N++          K  D+E
Sbjct  301   ALRMEKLYIGTAIGSLFIVLGLYAVLWGKNKEM----LDDGNQIGLNGTHIEEGKYNDSE  356

Query  364   KTE  356
             K +
Sbjct  357   KED  359



>ref|XP_006382304.1| hypothetical protein POPTR_0005s00820g [Populus trichocarpa]
 gb|ERP60101.1| hypothetical protein POPTR_0005s00820g [Populus trichocarpa]
Length=374

 Score =   359 bits (922),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 246/353 (70%), Gaps = 14/353 (4%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             M  +D+LP   M IVQ GYAG+NI +   M +GM P + + Y+Q+FATIA+ P AYF E 
Sbjct  1     MDMADVLPFLAMAIVQFGYAGMNITSKLAMDSGMKPLVLVGYRQIFATIAMVPFAYFFEW  60

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
             K+RPK+T ++  QIF+ +  G+TG+Q+ YF+GL NSTPT+  AL N++PA+TF+ AVLFR
Sbjct  61    KTRPKITMSLLLQIFICSLTGVTGNQVFYFIGLENSTPTIGCALTNILPAVTFILAVLFR  120

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSH  863
              ESVG++   GQAK+LGT++C+GGAMLL+ Y G ++ IG+S+IHW YA +T   +S+   
Sbjct  121   QESVGIKKTSGQAKLLGTIVCVGGAMLLSFYHGHMINIGESSIHWNYADST-GNSSTDKK  179

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
              N++LG + +I S  S++ +   QA++S ++ APY+ T L CF+   EC +I +  +H V
Sbjct  180   SNLVLGSLFIIASAVSWAIWFTVQAKVSLKFPAPYTCTLLMCFMGSIECGVIGIGANHKV  239

Query  682   SDWTL-TPMRAVSTTY-------NGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTA  527
             S+W+L +P R ++  Y        G+V SALA  LTSW I+RKG LYV+VF+PLLLV+ A
Sbjct  240   SEWSLRSPGRLIAALYALFPSQFQGIVCSALAFSLTSWSIQRKGALYVSVFSPLLLVIVA  299

Query  526   ILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDA  368
             +LSWA L EKIY GT +GSILIV GLY VLWGK  EL+    E+  + K KD 
Sbjct  300   VLSWALLHEKIYVGTAVGSILIVAGLYAVLWGKDKELK----EEIEETKLKDG  348



>ref|XP_010544146.1| PREDICTED: WAT1-related protein At1g09380 [Tarenaya hassleriana]
Length=385

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/354 (50%), Positives = 250/354 (71%), Gaps = 5/354 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D+LP   MV+VQ+GYAG+NI +   M AGM P I +AY+Q+FAT+A  P+AYF+ERK+RP
Sbjct  5     DMLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATVATFPVAYFIERKTRP  64

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T N+  Q F  +  G+TG+Q+ YFVGL NS+PT+A AL NL+PA+TF+ A +FR E V
Sbjct  65    KVTLNVLVQAFFCSVTGVTGNQVFYFVGLQNSSPTIACALTNLLPAVTFLLAAIFRQEVV  124

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G++ K GQAK++GT++C+ GAMLL+ Y G  + IG+S IHW YA+      SSS+  +  
Sbjct  125   GIKKKSGQAKVVGTIVCVAGAMLLSFYHGHTIGIGESKIHWTYAEKISSLGSSSNGSSFF  184

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP +V+    S++A+ I Q ++ + + APY+ST L C +   +C  IAL  DH +SDW+
Sbjct  185   LGPFLVMAGAVSWAAWFILQTKMGETFAAPYTSTLLMCLMGSIQCGGIALISDHKLSDWS  244

Query  670   L-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L +P+R +S  Y G+V SALA CL SW I+++GPLYV+VF+P+LLV+ AI+SWA L+EK+
Sbjct  245   LRSPIRVISAVYAGVVASALAFCLMSWTIQKRGPLYVSVFSPMLLVVVAIISWALLQEKL  304

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEK-DAEKTEAGEC*LS  335
             Y GT++GS L+V+GLY VLWGK  E    ++E   +LK     ++ E  E  LS
Sbjct  305   YLGTLVGSALVVIGLYGVLWGKDKE--TADMEQTQELKHNVKTDQKEDVESRLS  356



>ref|XP_003520787.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Glycine 
max]
 gb|KHN03917.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=366

 Score =   357 bits (916),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 175/350 (50%), Positives = 248/350 (71%), Gaps = 6/350 (2%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             + L+   +MV+VQL YA +NI +   + +GM+P + +AY+Q+FAT+++AP AY+LE  + 
Sbjct  3     AGLVAFLLMVLVQLVYAVMNITSKLAIESGMSPLVLVAYRQLFATVSIAPFAYWLEWNTL  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             P++T  +  QI  ++  G+TG+Q+ YFVGL  S+ T+A AL NL+PA TF+ AVLFR E+
Sbjct  63    PRITKRLMLQILFSSLTGVTGNQMLYFVGLKYSSATIACALTNLLPAFTFILAVLFRQEN  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             +G++ + G AK+ GT++C+ GA+LL+ Y G  + +GQS+IHW+YA+  ++  SSS  GN+
Sbjct  123   LGIKKRAGLAKVFGTILCVSGALLLSFYHGKTIGLGQSSIHWRYAEK-MEGTSSSGKGNM  181

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
              LGP++VILS   ++A+ I Q  +SK + APY+ST L CF+A F+C+IIA+CVDH  S W
Sbjct  182   FLGPLVVILSTLVWAAWFIIQKDISKTFSAPYTSTGLMCFMASFQCIIIAVCVDHTASAW  241

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L   MR  S  Y G+  + LA CL SW IERKGPLYV+VF PL LVLTAILSWA LREK
Sbjct  242   SLHNAMRLSSALYAGIFCTGLAYCLMSWTIERKGPLYVSVFTPLQLVLTAILSWALLREK  301

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             +Y GT +GS+LIV+GLY VLWGK  E   +N ED  +   K+A K    +
Sbjct  302   LYVGTAVGSLLIVLGLYSVLWGKSEE---VNKEDGIEDAFKEAVKDPKND  348



>ref|XP_007208228.1| hypothetical protein PRUPE_ppa018179mg, partial [Prunus persica]
 gb|EMJ09427.1| hypothetical protein PRUPE_ppa018179mg, partial [Prunus persica]
Length=361

 Score =   356 bits (914),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/352 (49%), Positives = 248/352 (70%), Gaps = 7/352 (2%)
 Frame = -1

Query  1396  GCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERK  1217
             G  D LP   MV+VQ+ YAG+NI++   + + MNP + +AY+Q+FAT+++AP AY++E K
Sbjct  3     GYGDYLPFLAMVLVQMSYAGMNIISKLAIESDMNPLVLVAYRQVFATLSIAPFAYWMEWK  62

Query  1216  SRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRL  1037
             +RP++T  I FQ FL +  G T +Q+ YFVGL  STPT+A AL N +PA+TF+ A++FR 
Sbjct  63    TRPRITMPILFQTFLCSLTGATANQVFYFVGLKTSTPTIACALTNTLPAMTFILALIFRQ  122

Query  1036  ESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHG  860
             ES  +++K G +K++GT++C+ GAMLL+ Y G ++ +G+S IHW YA+   ++ +SSS+G
Sbjct  123   ESAKIKSKPGLSKVMGTVVCVSGAMLLSFYHGHIIGLGESKIHWAYAQRMGEQANSSSNG  182

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             +  +GP+ VI+S   ++ + I QA++ + + APY+ST L C +A FEC IIA+  DH VS
Sbjct  183   SSFVGPLCVIISTLGWAFWFIIQAKVGENFPAPYTSTTLMCLMASFECGIIAVIADHKVS  242

Query  679   DWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W+L  PMR +S  Y G++ SALA  L+SW I+RKGPLYV+VF+PLLL++ AI SWA L 
Sbjct  243   AWSLKNPMRLISALYCGILGSALAFFLSSWSIQRKGPLYVSVFSPLLLIIVAISSWALLE  302

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             EK+Y GT +GSILIV GLY+VLWGK  E +V         KE D  K +  +
Sbjct  303   EKLYLGTAIGSILIVCGLYLVLWGKNKETEV-----EKPTKETDTTKADHAK  349



>ref|XP_008246269.1| PREDICTED: WAT1-related protein At1g09380 [Prunus mume]
Length=372

 Score =   355 bits (912),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/352 (49%), Positives = 248/352 (70%), Gaps = 7/352 (2%)
 Frame = -1

Query  1396  GCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERK  1217
             G  D LP   MV+VQ+ YAG+NI++   + + MNP + +AY+Q+FAT+++AP AY++E K
Sbjct  3     GYGDYLPFLAMVLVQMSYAGMNIISKLAIESDMNPLVLVAYRQVFATLSIAPFAYWMEWK  62

Query  1216  SRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRL  1037
             +RP++T  I FQ FL +  G T +Q+ YFVGL  STPT+A AL N +PA+TF+ A++FR 
Sbjct  63    TRPRITVPILFQTFLCSLTGATANQVFYFVGLKTSTPTIACALTNTLPAMTFILALIFRQ  122

Query  1036  ESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHG  860
             ES  +++K G +K++GT++C+ GAMLL+ Y G ++ +G+S IHW YA+   ++ +SSS+G
Sbjct  123   ESAKIKSKPGLSKVMGTVVCVSGAMLLSFYHGHIIGLGESKIHWAYAQRMGEQANSSSNG  182

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             +  +GP+ VI+S   ++ + I QA++ + + APY+ST L C +A FEC IIA+  DH VS
Sbjct  183   SSFVGPLCVIISTLGWAFWFIIQAKVGENFPAPYTSTTLMCLMASFECGIIAVIADHKVS  242

Query  679   DWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W+L  PM  +S  Y G++ SALA  L+SW I+RKGPLYV+VF+PLLL++ AI SWA L 
Sbjct  243   AWSLKNPMWLISALYCGILGSALAFFLSSWSIQRKGPLYVSVFSPLLLIIVAISSWALLE  302

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             EK+Y GT +GSILIV GLY+VLWGK NE +V         KE D  K +  +
Sbjct  303   EKLYLGTAIGSILIVCGLYLVLWGKNNETEV-----EKPTKETDTTKADHAK  349



>gb|KFK43234.1| hypothetical protein AALP_AA1G097400 [Arabis alpina]
Length=387

 Score =   355 bits (912),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 168/327 (51%), Positives = 235/327 (72%), Gaps = 3/327 (1%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L+P   MV+VQ+GYAG+NI +   M +GM P I +AY+Q+FAT+A  P+A  LERK+RPK
Sbjct  7     LMPFLAMVLVQIGYAGMNITSKMAMESGMKPLILVAYRQIFATLATLPVALILERKTRPK  66

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  +  QIFL +  G+TG+Q+ YFVGL NS+PT+A AL NL+PA+TF+ A L R E+VG
Sbjct  67    ITLRVLVQIFLCSVTGVTGNQVLYFVGLQNSSPTIACALTNLLPAVTFLLAALCRQEAVG  126

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKN-TVDKNSSSSHGNVI  851
             ++   GQAK++GT++C+ GAM+L+ Y G  + IG+S IHW Y +N T    +S+   N  
Sbjct  127   IKKPSGQAKVVGTIVCVVGAMVLSFYHGHTIGIGESKIHWAYGQNITSHGTNSTGSSNFF  186

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP +++ +  S++ + I Q ++S+ + APY+ST L C +   +C+ IAL  DH +SDW+
Sbjct  187   LGPFLIMAAAVSWAVWFIIQTKMSETFAAPYTSTLLMCLMGSIQCVAIALTSDHKLSDWS  246

Query  670   LT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             LT P+R  S  Y G+V SALA CL SW I+RKGPLYV+VF+PLLLV+ A+ SW+ L EK+
Sbjct  247   LTSPLRLTSALYAGVVASALAFCLMSWAIQRKGPLYVSVFSPLLLVVVAVFSWSLLDEKL  306

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQ  413
             YTGT MGS L+V+GLY VLWGK  E+ 
Sbjct  307   YTGTFMGSALVVIGLYGVLWGKDREIS  333



>ref|XP_004494524.1| PREDICTED: WAT1-related protein At1g09380-like [Cicer arietinum]
Length=377

 Score =   354 bits (909),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/338 (51%), Positives = 248/338 (73%), Gaps = 3/338 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             + L+PLF+M+++QL YAG+NI +   +  GMNP I +AY+Q+FAT+++AP AYFLER   
Sbjct  5     AGLVPLFLMILIQLAYAGMNITSKLAILGGMNPLILVAYRQIFATVSIAPFAYFLERNMV  64

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             P+MT  I  QI L++  G+TG+Q+ YFVGL  ST T+A AL NL+PA TF+ A+LFR E+
Sbjct  65    PRMTKRIMVQILLSSLTGVTGNQVLYFVGLKYSTATIACALTNLLPAFTFILAILFRQEN  124

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             +G++ K G AK +GT++C+GGA+LL+ Y G V+ IG+S+IHW YA+     ++SS+  + 
Sbjct  125   LGIKKKSGVAKTIGTILCVGGAILLSFYHGKVIGIGESSIHWGYAEKIEGGSNSSAAQSN  184

Query  853   IL-GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSD  677
              L GPI+++LS   +SA+ I QA +SK +  PY+STA  CFLA F+C+ IALC D  VS 
Sbjct  185   SLKGPIVLVLSALIWSAWFIIQADMSKNFPVPYTSTAYMCFLASFQCVFIALCFDRKVSS  244

Query  676   WTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W+L   MR  S+ Y G++ + L+ C+ SW IERKGPLYV+VF PL L+LTAI+SWAF+RE
Sbjct  245   WSLHDAMRLTSSLYAGVICTGLSYCIISWTIERKGPLYVSVFTPLQLILTAIISWAFIRE  304

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNK  386
             K+Y GT +GS+LIV GLY VLWGK  E+ + + + +++
Sbjct  305   KLYVGTALGSLLIVAGLYAVLWGKSKEVVIKDPDADHE  342



>ref|XP_003554607.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Glycine 
max]
 ref|XP_003554614.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Glycine 
max]
Length=367

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 249/347 (72%), Gaps = 5/347 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             + L+   +MV+VQL YA +NI +   + +GM+P + +AY+Q+FAT+++AP AY+LE  + 
Sbjct  3     AGLVAFLLMVLVQLVYAVMNITSKLAIESGMSPLVLVAYRQLFATVSIAPFAYWLEWNTL  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             P++T  +  QI  ++  G+TG+Q+ YFVGL  S+ T+A AL NL+PA TF+ AVLFR E+
Sbjct  63    PRITQRLMIQILFSSLTGVTGNQMLYFVGLKYSSATIACALTNLLPAFTFILAVLFRQEN  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             +G++ + G AK+ GT++C+ GA+LL+ Y G  + +GQS+IHW+YA+  ++  SSS  GN+
Sbjct  123   LGIKKRAGLAKVFGTILCVSGALLLSFYHGKTIGLGQSSIHWRYAEK-MEGTSSSGKGNM  181

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
              LGP++VILS   ++A+ I Q  +SK + APY+ST L CF+A F+C+IIA+CVDH  S W
Sbjct  182   FLGPLVVILSTLVWAAWFIIQKDISKTFPAPYTSTGLMCFMASFQCVIIAVCVDHRASAW  241

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L   MR  S  Y G+  + LA CL SW IERKGPLYV+VF PL LVLTAILSWA LREK
Sbjct  242   SLHNAMRLSSALYAGIFCTGLAYCLMSWTIERKGPLYVSVFTPLQLVLTAILSWALLREK  301

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKE--KDAEK  362
             +Y GT +GS+LIV+GLY VLWGK  E+   +  + + +KE  KD++ 
Sbjct  302   LYVGTAVGSLLIVLGLYSVLWGKSEEVNKGDGIEEDAVKEAVKDSKN  348



>gb|AFK39803.1| unknown [Lotus japonicus]
Length=374

 Score =   351 bits (901),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/355 (49%), Positives = 244/355 (69%), Gaps = 10/355 (3%)
 Frame = -1

Query  1396  GCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERK  1217
             G S L+P F+M+++QL YA +NI +   + +GMNP I +AY+Q+FATI++ P AYF E K
Sbjct  5     GGSSLIPFFIMILIQLAYAVMNITSKLAIQSGMNPLILVAYRQIFATISIIPFAYFFEWK  64

Query  1216  SRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRL  1037
               P+MT  I  QIFL++  G+TG+Q+ YFVGL  ST T+A AL NL+PA TFV A++FR 
Sbjct  65    ILPRMTKRIMVQIFLSSLTGVTGNQVLYFVGLKYSTATIACALTNLLPAFTFVLALIFRQ  124

Query  1036  ESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHG  860
             E++ ++   GQ K+LGT++C+ GA+LL+ Y G  + +G+S+IHW YA      +S+SS  
Sbjct  125   ENLRIKKMSGQTKVLGTVLCVSGALLLSFYHGKTIGLGESSIHWSYADKMQGGSSTSSAA  184

Query  859   ---NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH  689
                N++LGPI +ILS   ++ + I QA +SK +  PY+ST   CFLA F+C+IIALC +H
Sbjct  185   GKTNLLLGPIALILSALVWAFWFIIQADMSKNFPVPYTSTGYMCFLASFQCVIIALCFEH  244

Query  688   NVSDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWA  512
               S W+L   MR  S+ Y G++ + L+ C+ SW IERKGPLYV+VF P+ LVLTAI+SW+
Sbjct  245   RPSAWSLQNAMRLTSSLYAGVICTGLSYCVISWTIERKGPLYVSVFTPMQLVLTAIISWS  304

Query  511   FLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
              L+EK+Y GT +GS+LIV GLY VLWGK  E     V   +  +E D EK +  E
Sbjct  305   LLQEKLYVGTAIGSLLIVGGLYAVLWGKSKE-----VVKKDSTEEPDMEKMQDNE  354



>gb|EPS65422.1| hypothetical protein M569_09355 [Genlisea aurea]
Length=340

 Score =   350 bits (897),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/336 (51%), Positives = 245/336 (73%), Gaps = 6/336 (2%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             DL+PLF M  VQ+G+AG+NI++   M +GM+PF+H+AY+Q+ AT+AL PLAYF +RK+RP
Sbjct  4     DLVPLFSMAAVQVGFAGMNIISKIAMDSGMDPFVHVAYRQIVATLALLPLAYFFDRKTRP  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             KM+  I F IFL + FG+T +QI Y VGL  STPT+A ALAN+ PA+T++ A+  RLE +
Sbjct  64    KMSGEILFLIFLCSIFGVTVNQITYIVGLKYSTPTIACALANISPAVTYLIALPLRLERL  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             GLR+K G AK+LGT +C+GGA+LL+ Y G  + +G    H + + +         H N+I
Sbjct  124   GLRSKAGLAKVLGTGVCVGGALLLSFYHGSAINVGHFQTHHRESPSAA--GGGGGHANLI  181

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH-NVSDW  674
             +GP +++LS  S+S +LI Q+ ++++Y AP+S++A+ C +A FEC+I A+C D    S W
Sbjct  182   MGPFLLVLSAVSFSIWLIIQSGVNRRYNAPFSTSAMMCLMASFECVIAAVCFDGLKPSAW  241

Query  673   TLTP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L+P +R +S  Y+G+V SALA C+ SWC++ KGPLYV+VF+PL+LV+ AILSW  L EK
Sbjct  242   GLSPYIRVLSCAYSGVVCSALAYCVMSWCVDVKGPLYVSVFSPLMLVVVAILSWGILGEK  301

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNE-LQVINVEDN  392
             +Y GT+MGSILIV+G+Y VLWG K E    + VED+
Sbjct  302   LYLGTLMGSILIVLGVYGVLWGNKEEATAAVEVEDD  337



>ref|XP_010026177.1| PREDICTED: WAT1-related protein At1g09380-like [Eucalyptus grandis]
 gb|KCW58638.1| hypothetical protein EUGRSUZ_H01299 [Eucalyptus grandis]
Length=367

 Score =   350 bits (899),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/352 (49%), Positives = 240/352 (68%), Gaps = 14/352 (4%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             M   D +P   MV VQ+GYAG+ I +   M +GMNPF+ + Y+Q+FAT+A  P A  LER
Sbjct  1     MANVDFVPFLAMVTVQVGYAGMMITSKLAMDSGMNPFVLVTYRQVFATLATIPFALLLER  60

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
             K+RP++T  I   IFL +  G   +Q+ YFVGLNNSTPT+A A+ N++PA+TF+ A++FR
Sbjct  61    KTRPRITVPILLHIFLCSITGAFMNQVFYFVGLNNSTPTIACAMGNILPAMTFLFALIFR  120

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSH  863
              ES G+++K GQAK++GTL+C+GGAMLL+ Y GP + IG S IHW YA    DK+ ++  
Sbjct  121   QESFGIKSKAGQAKVIGTLVCVGGAMLLSFYHGPYIGIGDSRIHWTYANKMTDKHPTNK-  179

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
             GN +LGP +++    +++ + I QA+LS+++ APY++T L   +A  EC +    ++H V
Sbjct  180   GNFLLGPFLLLSISAAWALWFIIQAKLSRKFPAPYTTTTLMSLMASIECAVTGAAIEHRV  239

Query  682   SDWTLTP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             + W+L+  +R +S  Y G + SALA C+ SWCIERKGPLY AVFNPLLLV+TAILSWA L
Sbjct  240   TAWSLSSGIRLISAIYAGCICSALAFCVMSWCIERKGPLYTAVFNPLLLVITAILSWALL  299

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAG  350
             +EK+  G ++GS LI+ GLY VLWGK  E            K K AE+ EA 
Sbjct  300   QEKLTVGILVGSTLIIAGLYCVLWGKDKE-----------AKAKIAEEMEAA  340



>ref|XP_003555788.1| PREDICTED: WAT1-related protein At1g09380-like [Glycine max]
Length=375

 Score =   350 bits (899),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 250/355 (70%), Gaps = 6/355 (2%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
              S ++PL  M+IVQLGYAG+NI +   + +GM P + +AY+Q+FATI+LAP A++ ER +
Sbjct  2     ASSIIPLLAMIIVQLGYAGMNITSKLAIQSGMQPLVLVAYRQIFATISLAPFAFWFERNT  61

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
              P+MT +I  QI L++  G+TG+QI YF+GL  ST T+A AL NL+PA TFV AVL R E
Sbjct  62    APRMTKHIALQILLSSLTGVTGNQILYFLGLKYSTATIACALNNLLPAFTFVLAVLSRQE  121

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHG-  860
             ++ ++T+ G AK LGT++ +GGA+LL+ Y G V+ +G+S IHW+YA+    ++SSS  G 
Sbjct  122   NLRIKTRAGVAKALGTVLSVGGAVLLSFYHGEVLGLGESEIHWRYAEKMQRESSSSGGGT  181

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             N+ILGP+ VI+S   ++ + I QA +SK Y APY+ST   C +A  +C+ IAL  +HNVS
Sbjct  182   NLILGPVAVIVSALLWAVWFIVQANMSKSYPAPYTSTFYMCLMASIQCVAIALSAEHNVS  241

Query  679   DWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W+L + +R  S  Y G + + LA  L SW IERKGPLYV+VF+PLLLV+ A+ SWA L 
Sbjct  242   AWSLHSTIRLTSALYAGTISTGLAYVLMSWTIERKGPLYVSVFSPLLLVIIAVASWALLH  301

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVIN-VEDNNKLKE--KDAEKTEAGE  347
             E++Y GT +GS+LIV+GLY VLWGK  E+  I+ VE    + E  K++EK E  +
Sbjct  302   EQLYVGTAIGSLLIVLGLYFVLWGKNKEMNKIDMVEVEGTVMEAIKESEKDEVKD  356



>ref|XP_007163305.1| hypothetical protein PHAVU_001G223600g [Phaseolus vulgaris]
 gb|ESW35299.1| hypothetical protein PHAVU_001G223600g [Phaseolus vulgaris]
Length=361

 Score =   350 bits (897),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/347 (49%), Positives = 252/347 (73%), Gaps = 5/347 (1%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
              S L+PL +M++VQL YAG+NI +   + AGMNP I +AY+Q+FAT+++AP AY+LE K+
Sbjct  2     ASGLVPLILMIVVQLIYAGMNITSKLALEAGMNPLILVAYRQLFATLSIAPFAYWLEWKT  61

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
              P++T  + F++ +++  G+TG+QI +F+GL  ST T+A AL NL+PA TF+ AV+FR E
Sbjct  62    LPRLTKPLMFRLLMSSLTGVTGNQILFFLGLKFSTATIACALTNLLPAFTFILAVMFRQE  121

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGN  857
             ++G++ + G AK+ GT++C+ GA+LL+ Y G  + +GQS+IHW+YA+  ++  +SS  GN
Sbjct  122   NLGIKQRSGLAKLSGTILCVSGALLLSFYHGKEIGLGQSSIHWRYAEK-MEGTASSGSGN  180

Query  856   VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSD  677
             + +GP ++I S   ++ + + Q  +SK++ APY+ST L CFLA F+C+IIALC +H+ S 
Sbjct  181   MFIGPFLLIGSTLVWALWFVIQTDISKKFPAPYTSTGLMCFLASFQCIIIALCFNHSASA  240

Query  676   WTLTP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W+L   ++  S  Y G++ + L   L SW IERKGPLYV+VF PL LVLTAILSWA LRE
Sbjct  241   WSLHDGIKLSSALYAGVLSTGLGYSLMSWAIERKGPLYVSVFTPLQLVLTAILSWALLRE  300

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQVIN--VEDNNKLKEKDAE  365
             K+Y GT +GS+LIV+GLY VLWGK  E++ I+  V++  K  + D E
Sbjct  301   KLYVGTAIGSLLIVLGLYSVLWGKSEEVKTIDDAVKETVKDPKNDTE  347



>ref|XP_006344802.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Solanum 
tuberosum]
Length=373

 Score =   350 bits (898),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 179/347 (52%), Positives = 248/347 (71%), Gaps = 10/347 (3%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             S+LL   VMVIVQLG+AG+ I++  VM  GMNPF+  AY+ +FATI++AP A++ ERK+ 
Sbjct  3     SELLAFVVMVIVQLGFAGMIIISKLVMDGGMNPFVQSAYRPIFATISIAPFAFYFERKNE  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
              K+T ++ FQIFL + FG+T +Q A+F+GL NSTPT+ASA+ NLIPA TF+ AV   +E 
Sbjct  63    SKLTVSVLFQIFLCSIFGITANQYAWFIGLTNSTPTIASAIDNLIPAFTFIIAVPLGIEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNT-VDKNSSSSHGNV  854
             +GLR+  GQAK  GT++C+GGAMLL+LY G VVIGQ   HWK+A+NT  D NS     N 
Sbjct  123   LGLRSIAGQAKFWGTIVCVGGAMLLSLYHGKVVIGQLGFHWKFAENTGKDVNS-----NF  177

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
              LGP ++I+   +Y+ +LI Q +++++Y APY+   L C +A  E +II  C+   +S+W
Sbjct  178   FLGPFLLIVCSLTYAIWLIIQTKVNEKYAAPYTCITLMCLMASVESVIIGFCIVPKLSEW  237

Query  673   TLTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
              L P+RA+S  YNG V ++L   L+SWCIE+KGPLYV++FNPLLLV++A LSW  LREK+
Sbjct  238   ALNPIRAISVVYNGAVSTSLVFFLSSWCIEKKGPLYVSMFNPLLLVISAFLSWTLLREKL  297

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEA  353
             Y G V+GSI++V G+Y  LWGK+ E    N ED + L E   EK ++
Sbjct  298   YLGVVVGSIIVVAGMYGFLWGKRME---TNAEDIDVL-ELTKEKKQS  340



>ref|XP_010921389.1| PREDICTED: WAT1-related protein At1g09380 [Elaeis guineensis]
Length=397

 Score =   350 bits (898),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 245/336 (73%), Gaps = 3/336 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D  P   MV+VQ+G+AG+N+V+   +  GM+P++ IAY+Q+ AT+ ++P+A+FLERK+R 
Sbjct  4     DCTPTLAMVLVQVGFAGLNVVSKLALDDGMSPYVMIAYRQIVATLFISPIAFFLERKTRM  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
              ++  I FQIFL + FG T +Q+ YF+GL  STPT+ASAL N++PAITF+ AV FR+E++
Sbjct  64    AISGKIIFQIFLCSLFGATMNQLLYFIGLKYSTPTIASALNNMLPAITFIMAVPFRIETI  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G+RT  GQAK++GT++C+GG+M +TLY G +V I  S +HW+YA+N    + S    N+ 
Sbjct  124   GIRTLAGQAKVIGTMLCVGGSMEMTLYKGSLVKIWSSHVHWRYAENMTSSSGSDGGHNMA  183

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LG  +VI SC +++ + I QA++S+ + +PY+S+AL CF+A  +CL+I   V+  +S W+
Sbjct  184   LGAALVIASCTTWAIWFIIQAKMSESFSSPYTSSALLCFMAAIQCLVIGAGVERKLSAWS  243

Query  670   LT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L   +R  ++ Y G+V S LA+ L SWCIE+KGPLYV++F+PL LV+ A+L WA L EK+
Sbjct  244   LGWDIRLAASLYIGIVGSGLAVSLMSWCIEKKGPLYVSMFSPLQLVVVAVLGWAILDEKL  303

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVI-NVEDNN  389
             Y G+V GSILIV GLY VLWGK+ EL+ + N+   N
Sbjct  304   YVGSVAGSILIVAGLYFVLWGKRRELKKLSNIGGKN  339



>ref|XP_006428234.1| hypothetical protein CICLE_v10012006mg [Citrus clementina]
 ref|XP_006480702.1| PREDICTED: WAT1-related protein At1g09380-like [Citrus sinensis]
 gb|ESR41474.1| hypothetical protein CICLE_v10012006mg [Citrus clementina]
 gb|KDO46013.1| hypothetical protein CISIN_1g037942mg [Citrus sinensis]
Length=369

 Score =   348 bits (893),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 245/350 (70%), Gaps = 4/350 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              DL+P   MV VQLGYAG+N  +   + +GM P + +AY+QMFAT+A  P AYF+E K+R
Sbjct  5     DDLMPFLAMVTVQLGYAGMNFTSKLALDSGMKPLVLVAYRQMFATLATIPFAYFIEWKTR  64

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T  I FQIFL +  G TG+Q+ YFVGL NSTPT+  AL N++PAITFV AV+FR E 
Sbjct  65    PKITWPILFQIFLCSVTGATGNQVLYFVGLENSTPTIGCALTNILPAITFVLAVIFRQEY  124

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             V ++TK GQAK+ GT+IC+GGAM+L+ Y G    I  S+IHWKYA+   ++N S +  N+
Sbjct  125   VAIKTKPGQAKVFGTIICVGGAMVLSFYHGKTFGIPNSSIHWKYAEKMSEEN-SGNKSNL  183

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             ILG I +I S  S++A++I Q +LSK++ APY+ T L C ++   C +I L V+   + W
Sbjct  184   ILGSIAIIASSISWAAWVIIQTKLSKKFPAPYTCTTLMCLISSIMCSVIGLIVERKRAAW  243

Query  673   TLTP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +R VS  Y+G+V SALA CL  W I+RKGPLYV+VF+PLLLV+ AI+SWA  +EK
Sbjct  244   KLNATIRLVSALYSGIVCSALAFCLIVWSIQRKGPLYVSVFSPLLLVIVAIVSWALFQEK  303

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             ++ GT +GS+LIV GLY VLWGK  EL+  NV    +L  KDAE  + G+
Sbjct  304   LFIGTAIGSVLIVTGLYAVLWGKDKELKPDNVIVEPEL-TKDAESGDIGQ  352



>ref|XP_004166072.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=371

 Score =   348 bits (893),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 247/353 (70%), Gaps = 7/353 (2%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D LP  VM++VQ  YAG+NI +   M  GMNP + +AY+QMFATIA+AP AY+ ERK RP
Sbjct  6     DFLPXLVMLVVQFLYAGLNITSKLAMEFGMNPLVLVAYRQMFATIAIAPCAYWFERKGRP  65

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  I FQI L +  G T +Q+ Y+VGL  STPT+A AL N++PA TFV AVLFR ESV
Sbjct  66    KITKPILFQILLCSLTGATANQVFYYVGLKYSTPTIACALTNVLPAATFVLAVLFRQESV  125

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G++T  G AK++GT++C+GGAMLL+ Y G  + +G+S IHWKYA+  +   SSS+ G+ I
Sbjct  126   GIKTSPGAAKVIGTVVCVGGAMLLSFYRGQTIELGKSGIHWKYAE-LMRGESSSNQGSSI  184

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN-VSDW  674
              G + +I+S  +++A+ + QAR+++++ APY+STAL  F+A  +C  IA+ V+H  ++ W
Sbjct  185   WGSLCLIISSVAWAAWFVIQARVNEKFPAPYTSTALMTFMATIQCGAIAVGVEHKTLAAW  244

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L + +R V   Y G+  S +A CLTSW I+++GPLY +VF+P LLV+ AI SWAF +EK
Sbjct  245   SLKSSIRLVGALYAGVACSGMAFCLTSWSIQKRGPLYASVFSPFLLVIVAIFSWAFFQEK  304

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNEL---QVINVEDNNKLKEKDAEKTEAGE  347
             +Y GTV+GS+LIVVGLY VLWGK  E+   Q I +    + K  D    E  E
Sbjct  305   LYVGTVVGSLLIVVGLYSVLWGKTKEVKLQQHIEMTAAAEAKLDDYNNKEDLE  357



>ref|XP_008781052.1| PREDICTED: WAT1-related protein At1g09380 [Phoenix dactylifera]
Length=377

 Score =   347 bits (891),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/331 (50%), Positives = 243/331 (73%), Gaps = 3/331 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D +P   MV+VQ+G+AG+N+V+   +  GM+P++ I Y+Q+ AT+ +AP+A+FLERK+R 
Sbjct  4     DCIPTLAMVLVQVGFAGLNVVSKLALDDGMSPYVMITYRQIVATLFIAPIAFFLERKTRM  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
              ++  I FQIFL + FG T +Q+ YF+GL  STPT+ASAL N++PAITFV AV FR+E++
Sbjct  64    AISGKIIFQIFLCSLFGATANQLLYFLGLKYSTPTIASALNNMLPAITFVMAVPFRMETI  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHG-NV  854
             G+RT  GQAK++GT++C+GG+M +T Y G +V I  S IHW+YA+        S  G ++
Sbjct  124   GIRTLAGQAKVIGTVLCVGGSMEMTFYKGSLVKIWSSRIHWRYAEGMASSTGGSDDGRSM  183

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
              LG  ++I SC +++ + I QA++S+ + +PY+S+AL CF+A  +CL+I   V+  +S W
Sbjct  184   ALGAALIIASCIAWAVWFIIQAKMSESFSSPYTSSALLCFMAAIQCLVIGAGVERKLSAW  243

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +R V+T YNG+V SALA+ L SWCIE+KGPLYV++F+PL LV+ A+L WA L E+
Sbjct  244   RLGWDIRLVTTLYNGVVGSALAVSLMSWCIEKKGPLYVSMFSPLQLVVVAVLGWAVLDER  303

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVIN  404
             +Y G+V GSILIV GLY+VLWGK  EL+ ++
Sbjct  304   LYVGSVTGSILIVGGLYLVLWGKGRELKKLS  334



>ref|XP_004139525.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN65022.1| hypothetical protein Csa_1G181350 [Cucumis sativus]
Length=371

 Score =   347 bits (890),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 247/353 (70%), Gaps = 7/353 (2%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D LP  VM++VQ  YAG+NI +   M  GMNP + +AY+QMFATIA+AP AY+ ERK RP
Sbjct  6     DFLPPLVMLVVQFLYAGLNITSKLAMEFGMNPLVLVAYRQMFATIAIAPCAYWFERKGRP  65

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  I FQI L +  G T +Q+ Y+VGL  STPT+A AL N++PA TFV AVLFR ESV
Sbjct  66    KITKPILFQILLCSLTGATANQVFYYVGLKYSTPTIACALTNVLPAATFVLAVLFRQESV  125

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G++T  G AK++GT++C+GGAMLL+ Y G  + +G+S IHWKYA+  +   SSS+ G+ I
Sbjct  126   GIKTSPGAAKVIGTVVCVGGAMLLSFYRGQTIELGKSGIHWKYAE-LMRGESSSNQGSSI  184

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN-VSDW  674
              G + +I+S  +++A+ + QAR+++++ APY+STAL  F+A  +C  IA+ V+H  ++ W
Sbjct  185   WGSLCLIISSVAWAAWFVIQARVNEKFPAPYTSTALMTFMATIQCGAIAVGVEHKTLAAW  244

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L + +R V   Y G+  S +A CLTSW I+++GPLY +VF+P LLV+ AI SWAF +EK
Sbjct  245   SLKSSIRLVGALYAGVACSGMAFCLTSWSIQKRGPLYASVFSPFLLVIVAIFSWAFFQEK  304

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNEL---QVINVEDNNKLKEKDAEKTEAGE  347
             +Y GTV+GS+LIVVGLY VLWGK  E+   Q I +    + K  D    E  E
Sbjct  305   LYVGTVVGSLLIVVGLYSVLWGKTKEVKLQQHIEMTAAAEAKLDDYNNKEDLE  357



>gb|KHG28119.1| Auxin-induced protein 5NG4 [Gossypium arboreum]
Length=374

 Score =   347 bits (889),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 242/337 (72%), Gaps = 4/337 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             +D +P    V++Q+GYAG+NI +   + +GM P I +AY+Q+FAT+A+AP A+FLERK+R
Sbjct  3     ADFMPFLANVLLQVGYAGMNITSKLALESGMKPLILVAYRQIFATLAIAPFAFFLERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T  I FQIFL +  G T +Q+ YFVGL N+T T+A AL N++PA TF+ A + R E+
Sbjct  63    PKLTMPILFQIFLCSLTGATANQVFYFVGLQNTTATIACALNNVLPAATFLLAAICRQEA  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             VG++   GQAK++GTL+C+GGAMLL+ Y G ++ IG+S+IHW YA    + + S S  N 
Sbjct  123   VGIKKASGQAKVIGTLVCVGGAMLLSFYHGHIIGIGESSIHWNYANKMANSSPSPSGSNF  182

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
              LGP +V+ S  +++ + I Q + SK + APY+ST L CF+A  EC II +  D   S W
Sbjct  183   FLGPFLVMASAVAWALWFIIQGQTSKSFPAPYTSTTLMCFMASIECTIIGIFSDPKPSAW  242

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L + MR ++  Y G++ +A+A C+ SWCI+++GPLYV+VF+PLLLV+ AILSWA LREK
Sbjct  243   SLSSSMRLIAALYAGIICNAVAFCVMSWCIQKRGPLYVSVFSPLLLVIVAILSWALLREK  302

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNK  386
             +Y GTV+GS+LIV GLY VLWGK  E++   ++ N K
Sbjct  303   LYVGTVVGSLLIVGGLYAVLWGKDKEMK--QMKGNEK  337



>gb|AAO60108.1| nodulin-like protein [Gossypium hirsutum]
Length=376

 Score =   346 bits (888),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 242/337 (72%), Gaps = 4/337 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             +D +P    V++Q+GYAG+NI +   + +GM P I +AY+Q+FAT+A+AP A+FLERK+R
Sbjct  3     ADFMPFLANVLLQVGYAGMNITSKLALESGMKPLILVAYRQIFATLAIAPFAFFLERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T  I FQIFL +  G T +Q+ YFVGL N+T T+A AL N++PA TF+ A + R E+
Sbjct  63    PKLTMPILFQIFLCSLTGATANQVFYFVGLQNTTATIACALNNVLPAATFLLAAICRQEA  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             VG++   GQAK++GTL+C+GGAMLL+ Y G ++ IG+S+IHW YA    + + S S  N 
Sbjct  123   VGIKKASGQAKVIGTLVCVGGAMLLSFYHGHIIGIGESSIHWNYANKMANSSPSPSGSNF  182

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
              LGP +V+ S  +++ + I Q + SK + APY+ST L CF+A  EC II +  D   S W
Sbjct  183   FLGPFLVMASAVAWALWFIIQGQTSKSFPAPYTSTTLMCFMASIECTIIGIFSDPKPSAW  242

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L + MR ++  Y G++ +A+A C+ SWCI+++GPLYV+VF+PLLLV+ AILSWA LREK
Sbjct  243   SLSSSMRLIAALYAGIICNAVAFCVMSWCIQKRGPLYVSVFSPLLLVIVAILSWALLREK  302

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNK  386
             +Y GTV+GS+LIV GLY VLWGK  E++   ++ N K
Sbjct  303   LYVGTVVGSLLIVGGLYAVLWGKDKEMK--QMKGNEK  337



>gb|AAO60157.1| putative nodulin protein [Gossypium hirsutum]
Length=374

 Score =   345 bits (886),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 241/337 (72%), Gaps = 4/337 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             +D +P    V++Q+GYAG+NI +   + +GM P I +AY+Q+FAT+A+AP A+FLERK+R
Sbjct  3     ADFMPFLANVLLQVGYAGMNITSKLALESGMKPLILVAYRQIFATLAIAPFAFFLERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T  I FQIFL +  G T +Q+ YFVGL N+T T+A AL N++PA TF+ A + R E+
Sbjct  63    PKLTMPILFQIFLCSLTGATANQVFYFVGLQNTTATIACALNNVLPAATFLLAAICRQEA  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             VG++   GQAK++GTL C+GGAMLL+ Y G ++ IG+S+IHW YA    + + S S  N 
Sbjct  123   VGIKKASGQAKVIGTLACVGGAMLLSFYHGHIIGIGESSIHWNYANKMANSSPSPSGSNF  182

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
              LGP +V+ S  +++ + I Q + SK + APY+ST L CF+A  EC II +  D   S W
Sbjct  183   FLGPFLVMASAVAWALWFIIQGQTSKSFPAPYTSTTLMCFMASIECTIIGIFSDPKPSAW  242

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L + MR ++  Y G++ +A+A C+ SWCI+++GPLYV+VF+PLLLV+ AILSWA LREK
Sbjct  243   SLSSSMRLIAALYAGIICNAVAFCVMSWCIQKRGPLYVSVFSPLLLVIVAILSWALLREK  302

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNK  386
             +Y GTV+GS+LIV GLY VLWGK  E++   ++ N K
Sbjct  303   LYVGTVVGSLLIVGGLYAVLWGKDKEMK--QMKGNEK  337



>ref|XP_009794905.1| PREDICTED: WAT1-related protein At1g09380-like, partial [Nicotiana 
sylvestris]
Length=321

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 218/287 (76%), Gaps = 2/287 (1%)
 Frame = -1

Query  1225  ERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVL  1046
              RK+RPK+TP+  F IFL + FG+T  Q+ Y +GL NST T+ +ALANL+PAITF+ AVL
Sbjct  5     HRKTRPKLTPSTVFLIFLCSIFGVTAMQMTYLIGLKNSTATITTALANLVPAITFLLAVL  64

Query  1045  FRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSS  866
               LE VGLRTK GQAK+LGT++CI GA+LL+LY G VVIGQ  IHWKY++ T     +++
Sbjct  65    SGLEKVGLRTKAGQAKVLGTILCICGAILLSLYHGKVVIGQLRIHWKYSEQTSKNIEANT  124

Query  865   HGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN  686
             HGN  LGP +VI+S   YS +LI Q R++++Y APYSST L CF+A  EC+I+A+CV+ +
Sbjct  125   HGNFFLGPFLVIISTIVYSLWLIIQPRVNERYAAPYSSTTLMCFMASLECVIVAVCVNRD  184

Query  685   VSDWTLTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
              + W+L P+RA+S  YNG++ SALA  L +WCI+RKGPLYV+VF PLLLV++A LSW  L
Sbjct  185   KTAWSLNPIRAISVLYNGIISSALAFYLMTWCIKRKGPLYVSVFLPLLLVISAFLSWTLL  244

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQ--VINVEDNNKLKEKD  371
              EK+Y GTV+GSIL V+GLY  LWGKK E++   +++++   LKEK+
Sbjct  245   GEKLYVGTVVGSILTVIGLYGFLWGKKKEMERNTVHIKEEKVLKEKN  291



>ref|XP_010026180.1| PREDICTED: WAT1-related protein At1g09380-like [Eucalyptus grandis]
 gb|KCW58640.1| hypothetical protein EUGRSUZ_H01303 [Eucalyptus grandis]
Length=367

 Score =   344 bits (882),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 164/348 (47%), Positives = 242/348 (70%), Gaps = 5/348 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D++    MVIVQ+G+ G++ ++   M  G+NPF+ IAY+Q+ AT+A+ P A FLERK+RP
Sbjct  5     DVMSFLAMVIVQVGFTGMSFISKLAMDDGINPFVLIAYRQIIATVAITPFALFLERKTRP  64

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  I F IFL++  G + +Q+ +F+GLNNS+P +A A+ N +P +TFV A++F+ ES 
Sbjct  65    KITVPILFYIFLSSITGASVNQVFFFMGLNNSSPMIAGAMTNTLPVLTFVFALIFKQESF  124

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQST-IHWKYAKNTVDKNSS-SSHGNV  854
             G++TK GQAK++GT++C+GGAMLL+ Y G  +   S+ I W YA+   DK S+  SH   
Sbjct  125   GIKTKTGQAKVIGTVLCVGGAMLLSFYHGHTIADSSSGIRWNYAEKMTDKRSTYKSHS--  182

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             ILGP ++  S CS + + I QA+LS ++ APY++T L C +A  EC II      NV+DW
Sbjct  183   ILGPFLLFCSACSCALWFIIQAKLSPKFPAPYTATMLMCLMASVECSIIGAATKCNVADW  242

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L + +R ++  Y G+V SALA C+ SWC+ RKGPLY ++F+PLLLV++ ILSWA L EK
Sbjct  243   SLRSKIRLIAVFYVGIVCSALAFCIMSWCVHRKGPLYTSIFSPLLLVMSTILSWALLHEK  302

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEA  353
             +Y GT++G++LI+VGLY VLWGK  E +   + D  +   K  EK ++
Sbjct  303   LYIGTLVGTVLIIVGLYSVLWGKGKEAEQARIADEMEAAGKYREKEDS  350



>ref|XP_004302299.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=364

 Score =   341 bits (874),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/340 (49%), Positives = 239/340 (70%), Gaps = 3/340 (1%)
 Frame = -1

Query  1381  LPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKM  1202
             LP   MV VQ  YAG+NI +   + A M+P + +AY+Q+FAT+A+AP AY++E K+RP++
Sbjct  10    LPFLAMVFVQACYAGMNITSKLALEAEMSPLVLVAYRQVFATLAIAPFAYWMEWKTRPQI  69

Query  1201  TPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGL  1022
             T  I FQIFL +  G T +Q+ YFVGLN S+ TVA AL N +PA+TF+ AVLFR ES  +
Sbjct  70    TMPILFQIFLCSLTGATANQVLYFVGLNKSSATVACALTNTLPAMTFILAVLFRQESAKM  129

Query  1021  RTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
             ++K G AK++GT +C+ GAM+L+ Y G  + IG+S IHW YA+  + ++SS ++ N  +G
Sbjct  130   KSKAGLAKVMGTAVCVCGAMILSFYHGKNIGIGESKIHWSYAQK-MGESSSGNNANSFVG  188

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
             PI+V++S   ++ + I QA++S  + APY+ST L C +A  EC +IA+ V+HN   W LT
Sbjct  189   PILVLVSTLGWAMWFIIQAKVSDSFPAPYTSTTLMCLMASLECGLIAVSVEHNAQAWALT  248

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
              PM+  +  Y+G++ SA+A   TSWCI+RKGPLYV+VF+PLLL++ A+ SWA L EK+Y 
Sbjct  249   NPMKLTAGLYSGIMGSAVAFFFTSWCIQRKGPLYVSVFSPLLLIIVAVSSWALLDEKLYL  308

Query  487   GTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDA  368
             GT +GSILIV GLY VLWGK  E   +  ++ +   + DA
Sbjct  309   GTALGSILIVAGLYSVLWGKTRETAKLEGKETDADTKLDA  348



>gb|KHG28117.1| ADP-ribosylation factor 2 [Gossypium arboreum]
Length=538

 Score =   347 bits (889),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 242/337 (72%), Gaps = 4/337 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             +D +P    V++Q+GYAG+NI +   + +GM P I +AY+Q+FAT+A+AP A+FLERK+R
Sbjct  3     ADFMPFLANVLLQVGYAGMNITSKLALESGMKPLILVAYRQIFATLAIAPFAFFLERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T  I FQIFL +  G T +Q+ YFVGL N+T T+A AL N++PA TF+ A + R E+
Sbjct  63    PKLTMPILFQIFLCSLTGATANQVFYFVGLQNTTATIACALNNVLPAATFLLAAICRQEA  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             VG++   GQAK++GTL+C+GGAMLL+ Y G ++ IG+S+IHW YA    + + S S  N 
Sbjct  123   VGIKKASGQAKVIGTLVCVGGAMLLSFYHGHIIGIGESSIHWNYANKMANSSPSPSGSNF  182

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
              LGP +V+ S  +++ + I Q + SK + APY+ST L CF+A  EC II +  D   S W
Sbjct  183   FLGPFLVMASAVAWALWFIIQGQTSKSFPAPYTSTTLMCFMASIECTIIGIFSDPKPSAW  242

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L + MR ++  Y G++ +A+A C+ SWCI+++GPLYV+VF+PLLLV+ AILSWA LREK
Sbjct  243   SLSSSMRLIAALYAGIICNAVAFCVMSWCIQKRGPLYVSVFSPLLLVIVAILSWALLREK  302

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNK  386
             +Y GTV+GS+LIV GLY VLWGK  E++   ++ N K
Sbjct  303   LYVGTVVGSLLIVGGLYAVLWGKDKEMK--QMKGNEK  337



>ref|XP_008453225.1| PREDICTED: WAT1-related protein At1g09380 [Cucumis melo]
Length=357

 Score =   339 bits (869),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 162/342 (47%), Positives = 252/342 (74%), Gaps = 6/342 (2%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             M+I+Q+ YAG+NI++   M +GMNP + + Y+Q+F T+A+AP A+F ERK+RPK+T  + 
Sbjct  1     MIILQICYAGINIISKLAMQSGMNPLVLLTYRQIFGTLAIAPFAFFTERKTRPKITFTVL  60

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
             FQIF+ +  G TG+QI +FVGL  + PT++SA+AN++PA TF+ AVLFR ESV ++TK G
Sbjct  61    FQIFVCSLSGATGNQIFFFVGLKYTNPTISSAMANVLPAATFILAVLFRQESVRIKTKSG  120

Query  1006  QAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNS-SSSHGNVILGPIMV  833
              AK++GT++C+ GAMLL+ Y G ++ +G+S IHW Y +  + + + ++  G  +LG I++
Sbjct  121   FAKVIGTIVCVSGAMLLSFYHGHIINLGESKIHWSYVERLIKETTPTNGQGKHVLGSILL  180

Query  832   ILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-TPMR  656
             +LS  +++ + + QARLS ++ APY+STAL CF+A F+C +IA+  +HN++ W+L + +R
Sbjct  181   LLSSFAWALWFVIQARLSVKFKAPYTSTALLCFMAFFQCGLIAVISEHNIAAWSLKSTIR  240

Query  655   AVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVM  476
              ++  Y G+V SAL   +TSW I+RKGPLYV++F+PLLL++ AILSWA L ++++ GTV+
Sbjct  241   LIAALYAGVVCSALTFSITSWAIQRKGPLYVSIFSPLLLIIVAILSWALLHQQLHVGTVI  300

Query  475   GSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAG  350
             GS+LI++GLY VLWGK  E++   VED+    EK   +   G
Sbjct  301   GSVLIIIGLYAVLWGKSKEMK---VEDHQHNMEKATIEKHNG  339



>ref|XP_009794851.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Nicotiana 
sylvestris]
Length=299

 Score =   337 bits (863),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 164/297 (55%), Positives = 218/297 (73%), Gaps = 5/297 (2%)
 Frame = -1

Query  1249  LAPLAYFLERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPA  1070
             L  L     RK++P++T +I F IFL +  GLT  QIAYFVGL NSTPT+A AL+NLIPA
Sbjct  2     LNQLCLIQSRKTKPQLTSSILFWIFLCSFSGLTVSQIAYFVGLKNSTPTIACALSNLIPA  61

Query  1069  ITFVAAVLFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNT  890
              TF+ A+ F LE VG R+K GQAK  GT+IC+GGAMLL+LY GP+VIGQS IHWK+A+NT
Sbjct  62    ATFLLAIPFGLEKVGFRSKAGQAKACGTIICVGGAMLLSLYHGPIVIGQSGIHWKFAENT  121

Query  889   VDKNSSSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLI  710
              +KNS+  H N+ILGP+++I+S   YS ++I QAR+S++Y APY+ST L C +A F+C+I
Sbjct  122   EEKNSTG-HVNLILGPLLLIVSTIFYSLWIIFQARVSEKYAAPYTSTMLMCLMASFQCVI  180

Query  709   IALCVDHNVSDWTLTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLT  530
             I + V  + + W+L  MR ++  YNG+V +AL  CLTSWCI+RKGPLYV+VF PL+L++T
Sbjct  181   IGVFVVRDKAAWSLDRMRTIAVLYNGIVCTALGYCLTSWCIQRKGPLYVSVFYPLMLIIT  240

Query  529   AILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVED----NNKLKEKD  371
             A+LSW  LREK+Y GT++GS L VVG Y  LWGK  E   +  E      +KLK++ 
Sbjct  241   AVLSWTLLREKLYLGTIVGSFLTVVGFYGALWGKDKEKSKLETESLEIKTDKLKQQS  297



>ref|XP_008463595.1| PREDICTED: WAT1-related protein At1g09380-like [Cucumis melo]
Length=372

 Score =   336 bits (862),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 247/354 (70%), Gaps = 7/354 (2%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             +D LP  VM++VQ  YAG+NI +   M  GMNP + +AY+QMFATIA+AP AY+ ERK R
Sbjct  6     ADFLPPLVMLVVQFLYAGLNITSKLAMEFGMNPLVLVAYRQMFATIAIAPCAYWFERKGR  65

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T  I FQI L +  G TG+Q+ Y+VGL  STPT+A AL N++PA TFV AVLFR ES
Sbjct  66    PKITKPILFQILLCSLTGATGNQVFYYVGLKYSTPTIACALTNVLPAATFVLAVLFRQES  125

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             V ++T  G AK++GT++C+GGAMLL+ Y G  + +G+S IHWKYA   +   SSS+ G+ 
Sbjct  126   VRIKTSPGAAKVIGTVVCVGGAMLLSFYRGQTIELGESGIHWKYA-GLMRGGSSSNQGSS  184

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN-VSD  677
             I G + +I+S  +++A+ + QAR+++++ APY+STAL  F+A  +C  IA+ ++H  ++ 
Sbjct  185   IWGSLCLIISSVAWAAWFVIQARVNEKFPAPYTSTALMTFMATIQCGAIAVGIEHKTLAA  244

Query  676   WTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W+L + +R V   Y G+  S +A CLTSW I++KGPLY +VF+P LLV+ AI SWAF +E
Sbjct  245   WSLKSSIRLVGALYAGVACSGMAFCLTSWSIQKKGPLYASVFSPFLLVIVAIFSWAFFQE  304

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNEL---QVINVEDNNKLKEKDAEKTEAGE  347
             K+Y GTV+GS+LIVVGLY VLWGK  E+   Q I +    + K  D    E  E
Sbjct  305   KLYVGTVVGSLLIVVGLYAVLWGKTKEVKLQQHIEMTAAAEAKLDDYNNKEDLE  358



>ref|XP_010092938.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB52991.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=389

 Score =   335 bits (858),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 164/350 (47%), Positives = 243/350 (69%), Gaps = 8/350 (2%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D +P  VMV VQ+ YAG+NI +   + +GMNP + +AY+Q+FAT+A+ P +Y +E K+ P
Sbjct  10    DCVPFLVMVFVQVCYAGMNITSKVALESGMNPLVLVAYRQIFATMAIGPFSYIMEWKTMP  69

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  I FQIFL +  G   +Q+ YF+GL  S+  +ASAL+N++PA+TF+ AV+FR ES 
Sbjct  70    KITFPILFQIFLCSLTGAVANQVFYFLGLKYSSAIIASALSNILPAVTFLLAVIFRQESA  129

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSS-HGNV  854
              +R K G AKI+GT++C+GGAM+L+ Y G V+ +G+  ++W Y +   +  +S++ + N 
Sbjct  130   EIRKKSGIAKIVGTILCVGGAMMLSFYQGKVIGLGEPNMNWSYLQKVRESTTSNTVNSNP  189

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             +LGPI +ILS   ++A+ I QA +S+++ APY+ST L CF+A  EC  I   ++H +S W
Sbjct  190   LLGPIFIILSTVGWAAWFIIQAGMSEKFPAPYTSTTLMCFMATVECGAIGFVLEHKISAW  249

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L    R V++ Y G++ SA+A  LTSW I+RKGPLYV+VF+PLLL++ AILSWA L+EK
Sbjct  250   SLRNDTRLVASLYAGIMGSAIAFFLTSWSIQRKGPLYVSVFSPLLLIIVAILSWALLKEK  309

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVIN-----VEDNNKLKEKDAEK  362
             IY GTV+GS  I+ GLY VLWGK  E++ I       ED  K  + + +K
Sbjct  310   IYIGTVLGSTFIIAGLYAVLWGKGKEMERIQEIMTIAEDAIKASKANHDK  359



>ref|XP_008364022.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At1g09380-like 
[Malus domestica]
Length=365

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/348 (47%), Positives = 237/348 (68%), Gaps = 12/348 (3%)
 Frame = -1

Query  1381  LPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKM  1202
             +P   MV+VQ  YAG+NI++   + + M+P + +AY+Q+ A +A+APLAY LE K+RPK+
Sbjct  1     MPFMAMVLVQASYAGMNIISKLAIESNMDPXVLVAYRQVXAXVAIAPLAYLLEWKTRPKI  60

Query  1201  TPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGL  1022
             T  I FQ FL +  G T +Q+ YF+GL +ST T+A AL N +PA+TF+ AV+FR ES  L
Sbjct  61    TLPILFQTFLCSLTGATANQVFYFLGLKSSTATIACALTNTLPAMTFILAVIFRQESAKL  120

Query  1021  RTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
             ++K G +K++GT++C+ GAML++ Y   ++ +G+S IHW YA+ T + NSS+   + I G
Sbjct  121   KSKAGISKVMGTIVCVSGAMLISFYHXHIIGLGESKIHWTYAQRTGEANSSTKSSSFI-G  179

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-  668
             P+ VILS   +  + I QAR+ + + APY+ST L C +A FEC IIA+  DH V+ W+L 
Sbjct  180   PLFVILSTLGWXFWFIIQARVGESFPAPYTSTTLMCLMASFECGIIAVIADHKVASWSLK  239

Query  667   TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
              P R +++ Y G++ SALA  L+SW I+RKGPLYV+VF+PL L++ AI SW  L EK+Y 
Sbjct  240   DPTRLIASLYAGIMGSALAFFLSSWSIQRKGPLYVSVFSPLRLIIVAIASWGLLEEKLYV  299

Query  487   GTVMGSILIVVGLYIVLWGKKNELQ---------VINVEDNNKLKEKD  371
             GT +GS+LIV GLY +LWGK  E +         + N+ D  K  EK+
Sbjct  300   GTAVGSVLIVAGLYXLLWGKNKETKDEKPTKATGMTNMTDQAKAYEKN  347



>ref|XP_008370594.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At1g09380 
[Malus domestica]
Length=365

 Score =   333 bits (853),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/348 (47%), Positives = 236/348 (68%), Gaps = 12/348 (3%)
 Frame = -1

Query  1381  LPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKM  1202
             +P   MV+VQ  YAG+NI++   + + M+P + +AY+Q+ A +A+APLAY LE K+RPK+
Sbjct  1     MPFMAMVLVQASYAGMNIISKLAIESNMDPXVLVAYRQVXAXVAIAPLAYLLEWKTRPKI  60

Query  1201  TPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGL  1022
             T  I FQ FL +  G T +Q+ YF+GL +ST T+A AL N +PA+TF+ AV+FR ES  L
Sbjct  61    TLPILFQTFLCSLTGATANQVFYFLGLKSSTATIACALTNTLPAMTFILAVIFRQESAKL  120

Query  1021  RTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
             ++K G +K++GT++C+ GAML++ Y   ++ +G+S IHW YA+ T + NSS+   + I G
Sbjct  121   KSKAGISKVMGTIVCVSGAMLISFYHXHIIGLGESKIHWTYAQRTGEANSSTKSSSFI-G  179

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-  668
             P+ VILS   +  + I QAR+ + + APY+ST L C +A FEC IIA+  DH V+ W+L 
Sbjct  180   PLFVILSTLGWXFWFIIQARVGESFPAPYTSTTLMCLMASFECGIIAVIADHKVASWSLK  239

Query  667   TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
              P R +++ Y G++ SALA  L+SW I+RKGPLYV+VF+PL L++ AI SW  L EK+Y 
Sbjct  240   DPTRLIASLYAGIMGSALAFFLSSWSIQRKGPLYVSVFSPLRLIIVAIASWGLLEEKLYV  299

Query  487   GTVMGSILIVVGLYIVLWGKKNELQ---------VINVEDNNKLKEKD  371
             GT +GS+LIV GLY  LWGK  E +         + N+ D  K  EK+
Sbjct  300   GTAVGSVLIVAGLYXCLWGKNKETKDEKPTKATGMTNMTDQAKXYEKN  347



>ref|XP_009366070.1| PREDICTED: WAT1-related protein At1g09380 [Pyrus x bretschneideri]
Length=372

 Score =   332 bits (852),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 243/351 (69%), Gaps = 12/351 (3%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             S  +P   MV+VQ  YAG+NI++   + + M+P + +AY+Q+FA +A+APLAY LE K+R
Sbjct  5     SAYMPFMAMVLVQASYAGMNIISKLAIESDMDPLVLVAYRQVFAAVAIAPLAYLLEWKTR  64

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T  I FQ FL +  G T +Q+ YF+GL +ST T+A AL N +PA+TF+ AV+FR ES
Sbjct  65    PKITLAILFQTFLCSLTGATANQVFYFLGLKSSTATIACALTNTLPAMTFILAVIFRQES  124

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
               L++K G +K++GT++C+ GAMLL+ Y G ++ + +S IHW YA+  + + SSS+  + 
Sbjct  125   AKLKSKPGLSKVMGTIVCVSGAMLLSFYHGHIIGLSESKIHWTYAQR-MGEASSSTKSSS  183

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
              +GP+ VILS   ++ + I QAR+ + + APY+ST L C +A FEC IIA+  DH V+ W
Sbjct  184   FIGPLFVILSTLGWAFWFIIQARVGESFPAPYTSTTLMCLMASFECGIIAVIADHKVASW  243

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
             +L  P R +++ Y G++ SALA  L+SW I++KGPLYV+VF+PLLL++ AI SWA L EK
Sbjct  244   SLKDPTRLIASLYAGIMGSALAFFLSSWSIQQKGPLYVSVFSPLLLIIVAIASWALLEEK  303

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQ---------VINVEDNNKLKEKD  371
             +Y GT +GS+LIV GLY+VLWGK  E +         + N+ D  K  EK+
Sbjct  304   LYVGTAVGSVLIVAGLYLVLWGKNKETKDEKPAKATGMTNMTDQAKAYEKN  354



>ref|XP_009387482.1| PREDICTED: WAT1-related protein At1g09380-like [Musa acuminata 
subsp. malaccensis]
Length=375

 Score =   331 bits (849),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/344 (47%), Positives = 242/344 (70%), Gaps = 3/344 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D  P   MV VQ+G+AG+N+++   +  GM+PF+ IAY+Q+ AT+ L+PLA FLERK+  
Sbjct  4     DCTPTLAMVAVQVGFAGLNVLSKLALDDGMSPFVMIAYRQLVATLFLSPLAIFLERKACR  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             ++T  +  QIF  + FG T +Q+ YF+GL  S+PT+A AL N++PAITF+ AV FR+E+V
Sbjct  64    EITRRVIIQIFFCSVFGATLNQVLYFLGLKYSSPTIACALNNMLPAITFIMAVPFRMETV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKN-TVDKNSSSSHGNV  854
             G+RT GGQAK++GTL+C+ G+ML+T Y G ++ + +S IHW+YA+  T+   +++S  N+
Sbjct  124   GIRTLGGQAKVMGTLLCVSGSMLMTFYRGSLIKVWRSHIHWRYAEEMTISSANNASDQNM  183

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
              +G  +VI SC +++ + I QA++SK + +PY+S+AL CF+A  +C +IA  V+ + S W
Sbjct  184   AVGAALVISSCLAWAVWFIIQAKMSKSFSSPYTSSALMCFMAGVQCFVIAAGVERSFSAW  243

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +R  ++ Y GLV S LA+ L SWCI+++GPL+V++F+PLLLV+ +IL WA L EK
Sbjct  244   ALGWDIRLAASLYTGLVGSGLAVSLMSWCIQKRGPLFVSMFSPLLLVIVSILGWAILDEK  303

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAE  365
             +Y G+V GS LIV GLY VLWGK  E++ +         + D E
Sbjct  304   LYVGSVTGSALIVGGLYSVLWGKGREIKKLRDVCQRTNGDGDDE  347



>gb|AAC33198.1| Similar to MtN21, gi|2598575, Megicago truncatula nodulation 
induced gene [Arabidopsis thaliana]
Length=385

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/368 (46%), Positives = 235/368 (64%), Gaps = 19/368 (5%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPL------  1238
             M  SD+LP   MV+VQ+GYAG+NI +   M A  +  I I                    
Sbjct  1     MAKSDMLPFLAMVLVQIGYAGMNITSKMAMEAENDEIIFININVKMNVKKNVVKKKKTKK  60

Query  1237  ---AYFL--ERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIP  1073
                A F+  + K+RPK+T  I  Q+F  +  G TG+Q+ YFVGL NS+PT+A AL NL+P
Sbjct  61    WCRAIFICQDTKTRPKITLRILVQVFFCSITGATGNQVLYFVGLQNSSPTIACALTNLLP  120

Query  1072  AITFVAAVLFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAK  896
             A+TF+ A +FR E+VG++   GQAK++GTL+C+ GAM+L+ Y G  + IG+S IHW YA+
Sbjct  121   AVTFLLAAIFRQETVGIKKASGQAKVIGTLVCVIGAMVLSFYHGHTIGIGESKIHWAYAE  180

Query  895   NTVDKNSSSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFEC  716
             N     SSS H N  LGP +++ +  S++A+ I Q ++S+ + APY+ST L C +   +C
Sbjct  181   NITKHGSSSGHSNFFLGPFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQC  240

Query  715   LIIALCVDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLL  539
               IAL  DH +SDW+L+ P+R +S  Y G+V SALA CL SW ++RKGPLYV+VF+PLLL
Sbjct  241   GAIALISDHTISDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLL  300

Query  538   VLTAILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKK------NELQVINVEDNNKLKE  377
             V+ AI SWA L EK+YTGT MGS L+V+GLY VLWGK        E +    + N+K+K 
Sbjct  301   VVVAIFSWALLEEKLYTGTFMGSALVVIGLYGVLWGKDREVSEKEEEREKVKQQNHKVKS  360

Query  376   KDAEKTEA  353
             +  E  E+
Sbjct  361   ESNEDIES  368



>ref|XP_004144805.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 ref|XP_004158740.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=357

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 245/328 (75%), Gaps = 3/328 (1%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             M+I+Q+ YAG+NI++   M +GMNP + + Y+Q+F T+A+AP A+  ERK+RPK+T  + 
Sbjct  1     MIILQICYAGINIISKLAMQSGMNPLVLLTYRQIFGTLAIAPFAFLTERKTRPKITFAVL  60

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
             FQIF+ +  G TG+QI +FVGL  + PT++SA+AN++PA TF+ AVLFR ESV ++TK G
Sbjct  61    FQIFVCSLSGATGNQIFFFVGLKYTNPTISSAMANVLPAATFILAVLFRQESVRIKTKSG  120

Query  1006  QAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNS-SSSHGNVILGPIMV  833
              AK++GT++C+ GAMLL+ Y G  + +G+S IHW Y +  + + + ++  G  +LG I++
Sbjct  121   FAKVIGTIVCVSGAMLLSFYHGHTIDLGESRIHWSYVERLIKETTPTNGQGKHVLGSILL  180

Query  832   ILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-TPMR  656
             +LS  S++ + + QARLS ++ APY+STAL CF+A F+C +IA+  +HN++ W+L + +R
Sbjct  181   LLSSFSWALWFVIQARLSVKFKAPYTSTALLCFMAFFQCGLIAVISEHNIAAWSLKSSIR  240

Query  655   AVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVM  476
              V+  Y G+V SAL   +TSW I+RKGPLYV++F+PLLL++ AI+SWA L ++++ GTV+
Sbjct  241   LVAALYAGVVCSALTFSITSWTIQRKGPLYVSIFSPLLLIIVAIISWALLHQQLHAGTVI  300

Query  475   GSILIVVGLYIVLWGKKNELQVINVEDN  392
             GS+LI+ GLY VLWGK  E++V + + N
Sbjct  301   GSVLIITGLYAVLWGKSKEMKVEDAQHN  328



>ref|XP_008350587.1| PREDICTED: WAT1-related protein At1g09380-like [Malus domestica]
Length=371

 Score =   328 bits (842),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/348 (48%), Positives = 237/348 (68%), Gaps = 8/348 (2%)
 Frame = -1

Query  1396  GCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERK  1217
             G S+ +P   MV+VQ  YAG+NI++   + + M+P + +AY+Q+FAT  +APLAY +E K
Sbjct  3     GYSEYMPFMAMVLVQASYAGMNIISKLAIESDMDPLVLVAYRQVFATAVIAPLAYLMEWK  62

Query  1216  SRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRL  1037
             +RPK+T  I FQ FL +  G T +Q+ YF+GL  ST T+A AL N +PA+TF+ AV+FR 
Sbjct  63    TRPKITLPILFQTFLCSLTGATANQVFYFLGLKTSTATIACALQNTLPAMTFILAVIFRQ  122

Query  1036  ESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHG  860
             ES  L++K G +K +GT++C+ GAMLL+ Y G ++ +G S IHW YA+  + + SSS+  
Sbjct  123   ESAKLKSKAGLSKAMGTIVCVSGAMLLSFYHGHIIGLGDSKIHWTYAQR-MGEASSSTKS  181

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             +  +GP+ VILS   ++ + I QAR+ + + APY+ST L C +A FEC IIA+  DH   
Sbjct  182   SSFIGPLFVILSTLGWAFWFIIQARVGESFPAPYTSTTLMCLMASFECGIIAVIADHKAV  241

Query  679   DWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W+L  P+R V++ + G++ SALA  L+SW I+RKGPLYV+VF+PLLL++ AI SWA L 
Sbjct  242   SWSLKDPIRLVASLFAGIMGSALAFFLSSWSIQRKGPLYVSVFSPLLLIIVAIASWALLD  301

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKT  359
             EK+Y GT +GS+LIV GLY+VLWGK  E      +D    K     KT
Sbjct  302   EKLYVGTAVGSVLIVAGLYLVLWGKNKE-----TKDEKPTKATGMTKT  344



>ref|XP_006344800.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Solanum 
tuberosum]
Length=275

 Score =   323 bits (829),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/266 (58%), Positives = 208/266 (78%), Gaps = 3/266 (1%)
 Frame = -1

Query  1147  DQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGGQAKILGTLICIGG  968
             +QI YFVGL N+TPT++ AL+NL PA+TF+ A+ F LE VGL +K GQAK+LGT++C+GG
Sbjct  2     NQITYFVGLKNTTPTISCALSNLTPAVTFLLAIPFGLERVGLGSKAGQAKMLGTILCVGG  61

Query  967   AMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILGPIMVILSCCSYSAFLITQ  791
             AMLL+ Y G +V I Q  IHWKYA++     S++SHGN ILGP ++I+S  S+  + I Q
Sbjct  62    AMLLSFYHGSIVPIDQPNIHWKYAQDMTQNKSTTSHGNFILGPFLLIISAVSWGIWSILQ  121

Query  790   ARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-PMRAVSTTYNGLVYSAL  614
             A+LS  Y APYSS+AL C +A F+C+I+ +C DHN+SDW+L+  +RAVS+ Y+G+V +AL
Sbjct  122   AKLSMVYAAPYSSSALMCLMASFQCVIVGICFDHNISDWSLSHSIRAVSSIYSGVVCTAL  181

Query  613   AICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMGSILIVVGLYIVLW  434
             A CL SWCIERKGPLYV+VFNPLLLV+ AILSW  L+EKIY GTV+GSILIV+GLY VLW
Sbjct  182   AYCLMSWCIERKGPLYVSVFNPLLLVIVAILSWGLLQEKIYIGTVVGSILIVLGLYGVLW  241

Query  433   GKKNELQVINVEDNNKLKEKDAEKTE  356
             GK NEL+ + +E + ++ + + EK +
Sbjct  242   GKNNELK-LPIEFDEEIGDIEKEKQK  266



>ref|XP_009417762.1| PREDICTED: WAT1-related protein At1g09380-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   325 bits (833),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/348 (47%), Positives = 246/348 (71%), Gaps = 6/348 (2%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D  P   MV VQ+G+AG+N+++   M  GM+PF+ IAY+Q+ ATI L+P+A+FLERK+  
Sbjct  4     DCTPTLAMVFVQVGFAGLNVLSKLAMDDGMSPFVMIAYRQIVATIFLSPIAFFLERKASK  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             ++T  + FQIFL + FG T +QI YFVGL  S+PT+A AL+N++PAITFV AV FR+E+V
Sbjct  64    EITGKVLFQIFLCSVFGATSNQILYFVGLKFSSPTIACALSNMLPAITFVIAVPFRMETV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             G+RT  GQAK++GT++C+GG+ML+T Y G ++ + QS +HW+YA+      + S +  + 
Sbjct  124   GIRTVAGQAKVVGTVLCVGGSMLMTFYRGGLIKMWQSPLHWRYAERMTTGEAGSDYQRMG  183

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVD-HNVSDW  674
              G ++VI SC +++ + I QA++S+ + +PY+S+A+ CF+A  +C+++A  V+   +S W
Sbjct  184   FGAVLVIASCFAWAIWFIIQAKMSQSFSSPYTSSAIMCFMASVQCIVVAAAVERRRLSAW  243

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +R  ++ Y GLV S LA  L SWC++++GPL+V++F+PLLLV+ A+L WA L EK
Sbjct  244   ALGWNIRLAASLYIGLVGSGLAFALMSWCLQKRGPLFVSMFSPLLLVVVAVLGWAILDEK  303

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEA  353
              Y G+V GS++IV GLY+VLWGK  E +     D +  KE +AE  E 
Sbjct  304   QYVGSVAGSVVIVGGLYLVLWGKGRETK--KTRDASG-KETEAEHEEG  348



>ref|XP_009335510.1| PREDICTED: WAT1-related protein At1g09380-like [Pyrus x bretschneideri]
Length=371

 Score =   325 bits (832),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/348 (47%), Positives = 236/348 (68%), Gaps = 8/348 (2%)
 Frame = -1

Query  1396  GCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERK  1217
             G S+ +P   MV+VQ  YAG+NI++   + + M+P + +AY+Q+FAT  +AP AY +E K
Sbjct  3     GYSEYMPFMAMVLVQASYAGMNIISKLAIESDMDPLVLVAYRQVFATAVIAPFAYLMEWK  62

Query  1216  SRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRL  1037
             +RPK+T  I FQ FL +  G T +Q+ YF+GL  ST T+A AL N +PA+TF+ AV+FR 
Sbjct  63    TRPKITLPILFQTFLCSLTGATANQVFYFLGLKTSTATIACALQNTLPAMTFILAVIFRQ  122

Query  1036  ESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHG  860
             ES  L++K G +K +GT++C+ GAMLL+ Y G ++ +G S IHW YA+  + + SSS+  
Sbjct  123   ESAKLKSKAGLSKAMGTIVCVSGAMLLSFYHGHIIGLGDSKIHWTYAQR-MGEASSSTKS  181

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             +  +GP+ VILS   ++ + I QAR+ + + APY+ST L C +A FEC IIA+  DH  +
Sbjct  182   SSFIGPLFVILSTLGWAFWFIIQARVGESFPAPYTSTTLMCLMASFECGIIAVIADHKAA  241

Query  679   DWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W+L  P+R V++ + G++ SALA  L+SW I+ KGPLYV+VF+PLLL++ AI SWA L 
Sbjct  242   SWSLKDPIRLVASLFAGIMGSALAFFLSSWSIQLKGPLYVSVFSPLLLIIVAIASWALLD  301

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKT  359
             EK+Y GT +GS+LIV GLY+VLWGK  E      +D    K     KT
Sbjct  302   EKLYVGTAVGSVLIVAGLYLVLWGKNKE-----TKDEKPTKATGMTKT  344



>ref|XP_009794852.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Nicotiana 
sylvestris]
Length=286

 Score =   320 bits (821),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 159/297 (54%), Positives = 210/297 (71%), Gaps = 18/297 (6%)
 Frame = -1

Query  1249  LAPLAYFLERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPA  1070
             L  L     RK++P++T +I F IFL +  GLT  QIAYFVGL NSTPT+A AL+NLIPA
Sbjct  2     LNQLCLIQSRKTKPQLTSSILFWIFLCSFSGLTVSQIAYFVGLKNSTPTIACALSNLIPA  61

Query  1069  ITFVAAVLFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNT  890
              TF+ A+ F LE VG R+K GQAK  GT+IC+GGAMLL+LY GP+VIGQS IHWK+A+NT
Sbjct  62    ATFLLAIPFGLEKVGFRSKAGQAKACGTIICVGGAMLLSLYHGPIVIGQSGIHWKFAENT  121

Query  889   VDKNSSSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLI  710
              +KNS+  H N+ILGP+++I             AR+S++Y APY+ST L C +A F+C+I
Sbjct  122   EEKNSTG-HVNLILGPLLLI-------------ARVSEKYAAPYTSTMLMCLMASFQCVI  167

Query  709   IALCVDHNVSDWTLTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLT  530
             I + V  + + W+L  MR ++  YNG+V +AL  CLTSWCI+RKGPLYV+VF PL+L++T
Sbjct  168   IGVFVVRDKAAWSLDRMRTIAVLYNGIVCTALGYCLTSWCIQRKGPLYVSVFYPLMLIIT  227

Query  529   AILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVED----NNKLKEKD  371
             A+LSW  LREK+Y GT++GS L VVG Y  LWGK  E   +  E      +KLK++ 
Sbjct  228   AVLSWTLLREKLYLGTIVGSFLTVVGFYGALWGKDKEKSKLETESLEIKTDKLKQQS  284



>ref|XP_010270887.1| PREDICTED: WAT1-related protein At1g09380 isoform X2 [Nelumbo 
nucifera]
Length=331

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 221/305 (72%), Gaps = 3/305 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             + LP   M++VQ+GYAG+NI++   + +GM+P + + Y+Q+ ATI ++P AYF ERK+RP
Sbjct  4     EFLPCIAMIMVQIGYAGMNILSKLAIDSGMSPLVMVTYRQIVATIIISPFAYFWERKTRP  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             ++T    FQIFL++ FG+ G+Q  YF+GL  STPT+  AL NL+PA+TF+ AV F +E V
Sbjct  64    RITSATLFQIFLSSLFGIAGNQCLYFIGLKYSTPTIGCALTNLLPAVTFIMAVPFGMEKV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             GLR K GQAK+LGT++C+GGAML++ Y G  + I  S IHW+Y  +++ ++ SS+    +
Sbjct  124   GLRRKAGQAKVLGTVMCVGGAMLMSFYKGIRIPIPDSAIHWRYV-DSITESGSSNDKVTL  182

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LG +++I S  S+ A+ I QA++S+ + APYSSTAL C +   EC IIA+  DH VS W+
Sbjct  183   LGSLILIASVISWGAWFIMQAKVSETFSAPYSSTALMCLMGSIECGIIAVTADHQVSAWS  242

Query  670   L-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L + +R +++ Y+GLV SA AI L SWCIE+KGPLYV+ F+PLLLV+ A++ WA L +K+
Sbjct  243   LHSSIRLITSLYSGLVASAFAIYLMSWCIEKKGPLYVSAFSPLLLVIVAVIGWALLADKL  302

Query  493   YTGTV  479
             Y G +
Sbjct  303   YMGRI  307



>ref|XP_009623882.1| PREDICTED: WAT1-related protein At1g09380-like [Nicotiana tomentosiformis]
Length=441

 Score =   317 bits (811),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/339 (47%), Positives = 235/339 (69%), Gaps = 10/339 (3%)
 Frame = -1

Query  1354  QLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIFFQIF  1175
             ++GYAG+N++    M  GMNPF+H+AY+Q FA + + P+AYF ER SRP MT +I  +IF
Sbjct  107   KIGYAGMNLLTKMAMNTGMNPFVHVAYRQTFAALIMCPIAYFSERHSRPAMTRSILLKIF  166

Query  1174  LTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGGQAKI  995
             + + FG + +QI Y VGL N   TVASAL NL+PA TFV AV+   E V   T+ G AK+
Sbjct  167   MCSIFGGSINQITYIVGLQNCNTTVASALTNLMPAFTFVLAVITGHEKVRF-TRVGIAKM  225

Query  994   LGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILGPIMVILSCC  818
             +GT++ IGGAM+L++Y GP + IGQ  I+WK  +     +SS   G   LGP++VI S  
Sbjct  226   MGTVLSIGGAMMLSIYHGPRLPIGQPKINWKLLEGIAHHSSS---GTNYLGPLLVITSAL  282

Query  817   SYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLTP-MRAVSTT  641
             S+S + I QAR++++Y A YSSTAL CF+A   CL+   C DH++SDW+L   +RA+ST 
Sbjct  283   SWSIWSIIQARVNQEYAATYSSTALMCFMASCICLVFGFCFDHDLSDWSLNSGVRAISTI  342

Query  640   YNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMGSILI  461
             Y+G+  SAL+  + SWCI+R+GP +V++FNPL +++ A LSW  L E+I+TGT++GS+LI
Sbjct  343   YSGVFCSALSYFVMSWCIQREGPFFVSIFNPLPIIVVAALSWLLLGEEIFTGTIVGSMLI  402

Query  460   VVGLYIVLWGK----KNELQVINVEDNNKLKEKDAEKTE  356
             V+GL++VLWG     K    +IN E +  +++ ++++ +
Sbjct  403   VLGLFMVLWGNWVESKRARTIINSEQDMAVEDLESQQQK  441



>ref|XP_003589590.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES59841.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=373

 Score =   312 bits (799),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 224/333 (67%), Gaps = 10/333 (3%)
 Frame = -1

Query  1354  QLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIFFQIF  1175
             QL YA +NI +   +  GMNP I +AY+Q+F  +++AP AY++ER   P+MT  I  QI 
Sbjct  16    QLAYAWMNITSKLSILGGMNPLILVAYRQIFGAVSIAPFAYWIERDKVPRMTKRIMVQIL  75

Query  1174  LTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGGQAKI  995
             L++  G+TG QI YF+GL  STP +A AL NL  A TFV A+LFR E++G++ K G AK+
Sbjct  76    LSSLTGVTGSQILYFIGLKYSTPIIACALTNLDTAFTFVLAILFRQENLGIKKKSGVAKV  135

Query  994   LGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDK--NSSSSHGNVILGPIMVILS  824
             +GT++CIGGA++L+ Y   V+ + +S +HW YA+       N S++    +LGP+++IL+
Sbjct  136   VGTVLCIGGAVVLSFYHAKVIDVPESRVHWSYAEKLEHGHLNFSAAQSTSLLGPVLLILN  195

Query  823   CCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-TPMRAVS  647
                +S + I QA +SK +  PY+STA  C L   +C+ IALC DH+VS W+L   MR  S
Sbjct  196   ALVWSLWFIIQADMSKNFPVPYTSTAYMCILGSIQCVFIALCFDHSVSAWSLHDAMRLAS  255

Query  646   TTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMGSI  467
             + ++G++ + ++  + SW I RKGPLYV+VF PL L+LTA +SWAF++EK+Y GT +GS+
Sbjct  256   SLHSGVICTGISFPIISWTIGRKGPLYVSVFTPLQLILTAFISWAFIQEKLYVGTAIGSL  315

Query  466   LIVVGLYIVLWGKKNELQVINVEDNNKLKEKDA  368
             LIV GLY  LWGK  E+      DNNK+   +A
Sbjct  316   LIVGGLYAFLWGKSKEV------DNNKVDHDEA  342



>ref|XP_009616810.1| PREDICTED: WAT1-related protein At1g09380-like isoform X4 [Nicotiana 
tomentosiformis]
Length=281

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 197/259 (76%), Gaps = 3/259 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             +++LP  +MV VQ+GYAG+NIV T VM AGM+PF+HIAY+Q+ ATI+L P AYF E K++
Sbjct  3     NEVLPFLLMVTVQVGYAGMNIVGTLVMDAGMDPFVHIAYRQIIATISLVPFAYFFEWKTK  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             P++T +I F IFL +  GLT  QIAYFVGL NSTPT+A AL+NLIPA TF+ A+ F LE 
Sbjct  63    PQLTSSILFWIFLCSLSGLTASQIAYFVGLKNSTPTIACALSNLIPAATFLLAIPFGLEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             VG R+K GQAK+ GT+IC+GGAMLL+LY GP+VIGQS IHWK+A+NT  KN S+ H N+I
Sbjct  123   VGFRSKSGQAKVWGTIICVGGAMLLSLYHGPIVIGQSGIHWKFAENTEKKN-STDHVNLI  181

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP+++I+S  SYS ++I QAR+S++Y APY+ST L C +A F+C+II + V H+ + W 
Sbjct  182   LGPLLLIVSTVSYSLWIIFQARVSEKYAAPYTSTMLMCLMASFQCVIIGVFVIHDKAAWF  241

Query  670   LTP--MRAVSTTYNGLVYS  620
             L    M  V    N +VY+
Sbjct  242   LDRNCMYCVRILSNFMVYT  260



>ref|XP_004253026.2| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Solanum 
lycopersicum]
Length=299

 Score =   298 bits (763),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 159/343 (46%), Positives = 214/343 (62%), Gaps = 57/343 (17%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              D+LPL +MVIVQLGYAG  IV+  VM  GM+P++H++Y+Q+ ATI++AP AYF ERK+R
Sbjct  3     KDVLPLLLMVIVQLGYAGTAIVSKLVMDEGMDPYVHLSYRQILATISIAPFAYFFERKTR  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+TP   F IFL +  G+T  Q+   +GL NST T+ SA+ANLIPA TF+ A++ RLE 
Sbjct  63    PKLTPFSLFLIFLCSVLGVTAMQMTCIIGLRNSTATITSAMANLIPANTFLLALICRLEK  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAK-NTVDKNSSSSHGNV  854
             +GL+TK GQAK++GT++CIGGAMLL+LY G VVIG+    WKY++ N   KN  +SHGN 
Sbjct  123   LGLKTKAGQAKMMGTIMCIGGAMLLSLYHGKVVIGKLGFQWKYSQHNNTSKN--NSHGNF  180

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
               GP +VI+S   YS +LI Q                                       
Sbjct  181   FNGPFLVIISTMVYSLWLIIQ---------------------------------------  201

Query  673   TLTPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
                          G+V SALA+ L +WCI+RKGPLYV++F PL L+ +A LSW  L EK+
Sbjct  202   -------------GIVSSALALYLVTWCIKRKGPLYVSMFLPLQLIFSAFLSWTLLGEKL  248

Query  493   YTGTVMGSILIVVGLYIVLWGKKNEL--QVINVEDNNKLKEKD  371
             YTGT +GSI  ++GLY  LWGKK ++    INV++    ++K 
Sbjct  249   YTGTFIGSITTIIGLYCFLWGKKKDMNDNTINVKEEISKEKKQ  291



>gb|EMS59309.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=385

 Score =   301 bits (770),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/327 (43%), Positives = 228/327 (70%), Gaps = 2/327 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              + LP   MV+VQLG+AG+N+++   +  GM+P++ IAY+ + A + LAP AY+ ER+S 
Sbjct  3     KECLPTVAMVLVQLGFAGMNVLSKLALDTGMSPYVLIAYRNLIAGVFLAPGAYYFERRSG  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
               +T  +  QIF ++ FG T +Q+ YFVGL ++TPTVA AL+N +PA+TFV AV+ ++E+
Sbjct  63    MVITKKVLTQIFFSSIFGATLNQVLYFVGLKSTTPTVACALSNTLPALTFVMAVVLKMET  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             V L T  GQAK+ GT++C+GG+M++  Y GP++ +  S +HW+YA++  D  +  S    
Sbjct  123   VRLGTPSGQAKVFGTVVCVGGSMIMPFYKGPLLKVWASPMHWRYAEHATDATALPSGNAA  182

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             I+G +++ILSC +++ + I Q+++S+++ APY+ST +   +A  +C  ++  +D +VS W
Sbjct  183   IVGDVLIILSCVAWAVWFILQSKMSERFSAPYTSTTIMSLMAGVQCAGVSAVMDRSVSAW  242

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +R  +  Y G+V S +A  + SWCI+ +GPL+V++F+PL+LV+ A++ WA L EK
Sbjct  243   KLGFDIRLYAALYVGVVGSGIAFAVMSWCIQSRGPLFVSMFSPLMLVVVAVVGWAILEEK  302

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNEL  416
             I+ G+ +GS LIV GLY+VLWGK  E+
Sbjct  303   IHVGSAIGSSLIVAGLYMVLWGKGREM  329



>ref|XP_006577206.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Glycine 
max]
Length=297

 Score =   297 bits (761),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 199/277 (72%), Gaps = 6/277 (2%)
 Frame = -1

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
              QI  ++  G+TG+Q+ YFVGL  S+ T+A AL NL+PA TF+ AVLFR E++G++ + G
Sbjct  2     LQILFSSLTGVTGNQMLYFVGLKYSSATIACALTNLLPAFTFILAVLFRQENLGIKKRAG  61

Query  1006  QAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILGPIMVI  830
              AK+ GT++C+ GA+LL+ Y G  + +GQS+IHW+YA+  ++  SSS  GN+ LGP++VI
Sbjct  62    LAKVFGTILCVSGALLLSFYHGKTIGLGQSSIHWRYAEK-MEGTSSSGKGNMFLGPLVVI  120

Query  829   LSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-TPMRA  653
             LS   ++A+ I Q  +SK + APY+ST L CF+A F+C+IIA+CVDH  S W+L   MR 
Sbjct  121   LSTLVWAAWFIIQKDISKTFSAPYTSTGLMCFMASFQCIIIAVCVDHTASAWSLHNAMRL  180

Query  652   VSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMG  473
              S  Y G+  + LA CL SW IERKGPLYV+VF PL LVLTAILSWA LREK+Y GT +G
Sbjct  181   SSALYAGIFCTGLAYCLMSWTIERKGPLYVSVFTPLQLVLTAILSWALLREKLYVGTAVG  240

Query  472   SILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEK  362
             S+LIV+GLY VLWGK  E   +N ED  +   K+A K
Sbjct  241   SLLIVLGLYSVLWGKSEE---VNKEDGIEDAFKEAVK  274



>emb|CDY64772.1| BnaC08g49990D, partial [Brassica napus]
Length=303

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 202/295 (68%), Gaps = 4/295 (1%)
 Frame = -1

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
             K+ PK+T  +  Q F  +  G+TG+Q+ YF+GL NS+PT+A AL NL+PA+TF+ A +FR
Sbjct  1     KTIPKITIRVLVQAFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFR  60

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSH  863
              E+VG+R   GQAK++GT++C+ GAMLL+ Y G  + IG+S IHW YA+N     S S+ 
Sbjct  61    QEAVGIRKVSGQAKVIGTVVCVAGAMLLSFYHGHTIGIGESKIHWTYAQNITTHGSDSAG  120

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
              N  LGP +++ +  S + + I Q ++S+ + APY+ST L C +   +C ++AL  DH +
Sbjct  121   SNFFLGPFLIMAAAVSCAGWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGVVALISDHKL  180

Query  682   SDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             +DW+L+ P+R +S  Y G+V SALA CL SW I  KGPLYV+VF+PL+LV+ A+ SW  L
Sbjct  181   ADWSLSSPLRLISVLYAGVVASALAFCLMSWAINIKGPLYVSVFSPLVLVIVAVFSWTLL  240

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNEL--QVINVEDNNKLKEKDAEKTEAGE  347
              EK+YTGT MGS L+V+GLY VLWGK  E+  +   VE+  K+K++   K +  E
Sbjct  241   EEKLYTGTFMGSALVVIGLYGVLWGKDREMNEKEDEVENQKKVKQQPTVKRDVNE  295



>ref|XP_010230816.1| PREDICTED: WAT1-related protein At1g09380-like [Brachypodium 
distachyon]
Length=396

 Score =   299 bits (766),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/349 (41%), Positives = 233/349 (67%), Gaps = 6/349 (2%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             + LP   MV+VQLG+AG+N+++   +  GM+P++ I+Y+ + A + LAPLAY+ ER+S  
Sbjct  4     ECLPTIAMVLVQLGFAGMNVLSKLALDTGMSPYVLISYRNLIAGVFLAPLAYYFERRSEM  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
              +T  +  QIF ++ FG T +Q+ YFVGL  +T TVA AL+N +PA+TFV A + ++E+V
Sbjct  64    VITKKVLLQIFFSSIFGATLNQVLYFVGLKTTTATVACALSNTLPALTFVMAAVLKMETV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
              LRT  G AK+ GT +C+GG+M++  Y GP++ +  S +HW+YA++  +  + ++    +
Sbjct  124   RLRTYSGFAKVFGTAVCVGGSMVMPFYHGPLLKVWASPLHWRYAEHATNTAAPTTGSAAV  183

Query  850   LGPIMVILSCCSYSAFLITQARLSKQ-YGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             +G +++ILSC +++ + I Q ++S + Y APY+ST +   +A  +C  I+  +D N++ W
Sbjct  184   VGDVLIILSCAAWAIWFIIQRKMSTEGYSAPYTSTTIMSLMAGVQCAGISAALDRNLAVW  243

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +R  S  Y G+V S +A  + SWCI+ +GPL+V++F+PL+LV+ AI+ WA L EK
Sbjct  244   KLGLDIRLYSVLYIGIVGSGIAFAVMSWCIQSRGPLFVSMFSPLMLVVVAIVGWAILEEK  303

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAG  350
             I+ GT +GS+LIV GLY+VLWGK  E+   + E  ++  + D   +  G
Sbjct  304   IHLGTAIGSVLIVAGLYLVLWGKGREM---DRERADRHADDDGASSSGG  349



>gb|EMT10029.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=385

 Score =   299 bits (765),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/327 (43%), Positives = 228/327 (70%), Gaps = 2/327 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              + LP   MV+VQLG+AG+N+++   +  GM+P++ IAY+ + A + LAP AY+ E +S 
Sbjct  3     KECLPTVAMVLVQLGFAGMNVLSKLALDTGMSPYVLIAYRNLIAGVFLAPGAYYFEWRSG  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
               +T  +  QIF ++ FG T +Q+ YFVGL ++TPTVA AL+N +PA+TFV A + ++E+
Sbjct  63    MVITKKVLTQIFFSSIFGATLNQVLYFVGLKSTTPTVACALSNTLPALTFVMAAVLKMET  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             V L T  GQAK+LGT++C+GG+M++  Y GP++ +  S +HW+YA++  D  +  S    
Sbjct  123   VRLGTPSGQAKVLGTVVCVGGSMIMPFYKGPLLKVWASPMHWRYAEHATDATTLPSGNAA  182

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             I+G +++ILSC +++ + I Q+++S+++ APY+ST +   +A  +C  I++ +D +VS W
Sbjct  183   IVGDVLIILSCVAWAVWFILQSKMSERFSAPYTSTTIMSLMAGVQCAGISVVMDRSVSAW  242

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +R  +  Y G+V S +A  + SWCI+ +GPL+V++F+PL+LV+ A++ WA L EK
Sbjct  243   KLGFDIRLYAALYVGVVGSGIAFAVMSWCIQSRGPLFVSMFSPLMLVVVAVVGWAILEEK  302

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNEL  416
             I+ G+ +GS LIV GLY+VLWGK  E+
Sbjct  303   IHVGSAIGSSLIVAGLYMVLWGKGREM  329



>ref|XP_006604784.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Glycine 
max]
 ref|XP_006604787.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Glycine 
max]
Length=298

 Score =   295 bits (755),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 146/277 (53%), Positives = 201/277 (73%), Gaps = 5/277 (2%)
 Frame = -1

Query  1183  QIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGGQ  1004
             QI  ++  G+TG+Q+ YFVGL  S+ T+A AL NL+PA TF+ AVLFR E++G++ + G 
Sbjct  3     QILFSSLTGVTGNQMLYFVGLKYSSATIACALTNLLPAFTFILAVLFRQENLGIKKRAGL  62

Query  1003  AKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILGPIMVIL  827
             AK+ GT++C+ GA+LL+ Y G  + +GQS+IHW+YA+  ++  SSS  GN+ LGP++VIL
Sbjct  63    AKVFGTILCVSGALLLSFYHGKTIGLGQSSIHWRYAEK-MEGTSSSGKGNMFLGPLVVIL  121

Query  826   SCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-TPMRAV  650
             S   ++A+ I Q  +SK + APY+ST L CF+A F+C+IIA+CVDH  S W+L   MR  
Sbjct  122   STLVWAAWFIIQKDISKTFPAPYTSTGLMCFMASFQCVIIAVCVDHRASAWSLHNAMRLS  181

Query  649   STTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMGS  470
             S  Y G+  + LA CL SW IERKGPLYV+VF PL LVLTAILSWA LREK+Y GT +GS
Sbjct  182   SALYAGIFCTGLAYCLMSWTIERKGPLYVSVFTPLQLVLTAILSWALLREKLYVGTAVGS  241

Query  469   ILIVVGLYIVLWGKKNELQVINVEDNNKLKE--KDAE  365
             +LIV+GLY VLWGK  E+   +  + + +KE  KD++
Sbjct  242   LLIVLGLYSVLWGKSEEVNKGDGIEEDAVKEAVKDSK  278



>ref|NP_001042809.1| Os01g0297700 [Oryza sativa Japonica Group]
 dbj|BAD86902.1| putative MtN21 [Oryza sativa Japonica Group]
 dbj|BAD86994.1| putative MtN21 [Oryza sativa Japonica Group]
 dbj|BAF04723.1| Os01g0297700 [Oryza sativa Japonica Group]
 gb|EAZ11555.1| hypothetical protein OsJ_01420 [Oryza sativa Japonica Group]
 dbj|BAG97761.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score =   296 bits (758),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/327 (44%), Positives = 224/327 (69%), Gaps = 3/327 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             + LP   MV+VQLG+AG+N+V+   +  GM+P++ IAY+ + A + LAP AY+ ERKS  
Sbjct  4     ESLPTLAMVMVQLGFAGMNVVSKLALDTGMSPYVLIAYRNIIAAVFLAPFAYYFERKSGM  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
              +T  +  QIF ++ FG T +Q+ YFVGL ++TPTVA AL+N +PA+TF  A  FR+ESV
Sbjct  64    VITKKVLVQIFFSSIFGATLNQVLYFVGLKSTTPTVACALSNTLPALTFAMAAAFRMESV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKY-AKNTVDKNSSSSHGNV  854
              L    GQAK+ GT++C+GG+M++  Y GP++ +  S IHW++         + ++ G  
Sbjct  124   RLSAAAGQAKVFGTVVCVGGSMIMPFYKGPLLRLWASPIHWRFAESAASGAAAPAAGGAA  183

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             +LG +++ILSC +++ + I Q ++S+++ APY+ST + C +A  +C  ++  +D +V+ W
Sbjct  184   VLGDVLIILSCAAWAVWFIIQTKMSERFSAPYTSTTIMCLMAGVQCAGVSAAMDRSVAVW  243

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +R  S  Y G+V S +A  L SWCI+ +GPL+V++F+PL+LV+ AI+ WA L EK
Sbjct  244   KLGFDIRLYSVLYIGVVGSGIAFALMSWCIQVRGPLFVSMFSPLMLVVVAIVGWAILDEK  303

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNEL  416
             I+ G+ +GS+LIV GLY+VLWGK  E+
Sbjct  304   IHVGSAIGSVLIVAGLYMVLWGKAREM  330



>emb|CDM82961.1| unnamed protein product [Triticum aestivum]
Length=385

 Score =   295 bits (756),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/327 (42%), Positives = 226/327 (69%), Gaps = 2/327 (1%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
              + LP   MV+VQLG+AG+N+++   +  GM+P++ IAY+ + A + LAP AY+ ER+S 
Sbjct  3     KECLPTVAMVLVQLGFAGMNVLSKLALDTGMSPYVLIAYRNLIAGVFLAPGAYYFERRSG  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
               +T  +  QIF ++ FG T +Q+ YFVGL ++TP VA AL+N +PA+TFV A + ++E+
Sbjct  63    MVITKKVLTQIFFSSIFGATLNQVLYFVGLKSTTPIVACALSNTLPALTFVMAAVLKMET  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNV  854
             V L T  GQAK+LGT++C+GG+M++  Y G ++ +  S +HW+YA++  D  +  S    
Sbjct  123   VRLGTPSGQAKVLGTVVCVGGSMIMPFYKGSLLKVWASPMHWRYAEHATDATALPSGNAA  182

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             I+G +++ILSC +++ + I Q+++S+++ APY+ST +   +A  +C  ++  +D +VS W
Sbjct  183   IVGDVLIILSCVAWAVWFILQSKMSERFSAPYTSTTIMSLMAGVQCAGVSAVMDRSVSAW  242

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +R  +  Y G+V S +A  + SWCI+ +GPL+V++F+PL+LV+ A++ WA L EK
Sbjct  243   KLGFEIRLYAALYVGVVGSGIAFAVMSWCIQSRGPLFVSMFSPLMLVVVAVVGWAILEEK  302

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNEL  416
             I+ G+ +GS LIV GLY+VLWGK  E+
Sbjct  303   IHVGSAIGSSLIVAGLYMVLWGKGREM  329



>gb|EAY73629.1| hypothetical protein OsI_01515 [Oryza sativa Indica Group]
Length=375

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/349 (41%), Positives = 230/349 (66%), Gaps = 4/349 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             + LP   MV+VQLG+AG+N+V+   +  GM+P++ IAY+ + A + LAP AY+ ERKS  
Sbjct  4     ESLPTLAMVMVQLGFAGMNVVSKLALDTGMSPYVLIAYRNIIAAVFLAPFAYYFERKSGM  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
              +T  +  QIF ++ FG T +Q+ YFVGL ++TPTVA AL+N +PA+TF  A  FR+ESV
Sbjct  64    VITKKVLVQIFFSSIFGATLNQVLYFVGLKSTTPTVACALSNTLPALTFAMAAAFRMESV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKY-AKNTVDKNSSSSHGNV  854
              L    GQAK+ GT++C+GG+M++  Y GP++ +  S IHW++         + ++ G  
Sbjct  124   RLSAAAGQAKVFGTVVCVGGSMIMPFYKGPLLRLWASPIHWRFAESAASGAAAPAAGGAA  183

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             +LG +++ILSC +++ + I Q ++S+++ APY+ST + C +A  +C  ++  +D +V+ W
Sbjct  184   VLGDVLIILSCAAWAVWFIIQTKMSERFSAPYTSTTIMCLMAGVQCAGVSAAMDRSVAVW  243

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +R  S  Y G+  S +A  L SWCI+ +GPL+V++F+PL+LV   I+ WA L EK
Sbjct  244   KLGFDIRLYSVLYIGVFGSGIAFALMSWCIQVRGPLFVSMFSPLMLVFVPIVGWAILDEK  303

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNEL-QVINVEDNNKLKEKDAEKTEA  353
             I+ G+ +GS+LIV GLY+VLWGK  E+    +++    + E + +  +A
Sbjct  304   IHVGSAIGSVLIVAGLYMVLWGKAREMGSPSDLDGGGGVVELNGKGADA  352



>ref|XP_002455503.1| hypothetical protein SORBIDRAFT_03g012300 [Sorghum bicolor]
 gb|EES00623.1| hypothetical protein SORBIDRAFT_03g012300 [Sorghum bicolor]
Length=400

 Score =   291 bits (745),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 144/348 (41%), Positives = 227/348 (65%), Gaps = 9/348 (3%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             + +P   MV+VQLG+AG+N+V+   + AGM+P++ IAY+ + A   ++P+AYF+ER+S  
Sbjct  4     NCVPPVAMVLVQLGFAGMNVVSKLALEAGMSPYVLIAYRNLIAAAVISPVAYFVERRSGA  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
              +T  +  QIF ++ FG T +Q+ YFVGL +++PTVA AL N +PA+TFV A   ++ESV
Sbjct  64    TITKKVLLQIFFSSIFGATLNQVLYFVGLKSTSPTVACALTNTLPALTFVMAAALKMESV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKN------TVDKNSSS  869
                T  GQAK++GT +C+GG+M++  Y GP + +  S IHW++A+            +  
Sbjct  124   RPGTAAGQAKLVGTAVCVGGSMVIPFYKGPELGLWASPIHWRFAEEHSIAAAPSSAAAGG  183

Query  868   SHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH  689
               G  +LG +++I SC +++ + I   ++S+ + APY+STA+ C +A  +C  ++  +D 
Sbjct  184   HAGAAVLGDVLIIASCVAWAVWFILHTKMSEGFSAPYTSTAIMCLMAGVQCAGVSAAMDR  243

Query  688   NVSDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWA  512
             ++  W L   +R  S  Y G+V S +   + SWCI+ +GPLYV++F+PLLLV+ A++ WA
Sbjct  244   SLDVWKLGCDIRLYSVLYIGIVGSGIGFTVMSWCIQARGPLYVSMFSPLLLVIVAVVGWA  303

Query  511   FLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDA  368
              L EKI  GT +GS+LIV GLY+VLWGK  E+    V DN+K  E+ A
Sbjct  304   ILGEKIRVGTAVGSVLIVAGLYMVLWGKGREMDRPGV-DNDKGDEESA  350



>ref|XP_004967586.1| PREDICTED: WAT1-related protein At1g09380-like [Setaria italica]
Length=392

 Score =   290 bits (743),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/346 (42%), Positives = 233/346 (67%), Gaps = 7/346 (2%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             +D +P   MV+VQLG+AG+N+V+   + AGM+P++ IAY+ + A   +AP+AY LE +S 
Sbjct  3     NDCVPPVAMVLVQLGFAGMNVVSKLALDAGMSPYVLIAYRNLIAAAFIAPIAYLLESRSG  62

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
              K+T  +  QIF+++ FG T +Q+ YFVGL ++TPTVA AL+N +PA+TFV A   ++E+
Sbjct  63    AKITKKVLLQIFISSIFGATLNQVLYFVGLKSTTPTVACALSNTLPALTFVMAAALKMET  122

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNT-----VDKNSSS  869
             V   T  GQAK++GT +C+GG+M++  Y GPV+ + +S IHW++A++T         ++ 
Sbjct  123   VRPGTPAGQAKLVGTAVCVGGSMIIPFYKGPVLRLWESPIHWRFAEHTSAASAPAAAAAG  182

Query  868   SHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH  689
              H   ILG +++I SC +++ + + Q R+++ + APY+STA+ C +A  +C  ++  +D 
Sbjct  183   GHSGAILGDVLIIASCAAWAVWFVMQTRMAEDFSAPYTSTAIMCLMAGAQCAGVSAAMDR  242

Query  688   NVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWA  512
             ++  W L   +R  S  Y G+V S +   + SWCI+ +GPLYV++F+PLL+V+ AI+ WA
Sbjct  243   SLDVWKLGFDIRLYSVLYIGVVGSGIGFAIMSWCIQVRGPLYVSMFSPLLMVVVAIVGWA  302

Query  511   FLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEK  374
              L EKI  G+ +GS+LIV GLY+VLWGK  E+      DN+K  E+
Sbjct  303   ILGEKIRVGSAIGSVLIVAGLYMVLWGKGREMDKPGGLDNDKGDEE  348



>emb|CDY06357.1| BnaA09g48460D [Brassica napus]
Length=296

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/287 (47%), Positives = 193/287 (67%), Gaps = 4/287 (1%)
 Frame = -1

Query  1195  NIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRT  1016
              +  Q F  +  G+TG+Q+ YF+GL NS+PT+A AL NL+PA+TF+ A +FR ESVG+R 
Sbjct  2     RVLVQAFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQESVGIRK  61

Query  1015  KGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILGPI  839
               GQAK++GT++C+ GAMLL+ Y G  + IG+S IHW YA+N     S S+  N  LGP 
Sbjct  62    VSGQAKVIGTVVCVAGAMLLSFYHGHTIGIGESKIHWTYAQNITAHGSDSAGSNFFLGPF  121

Query  838   MVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-P  662
             +++ +  S + + I Q ++S+ + APY+ST L C +   +C ++AL  DH ++DW+L+ P
Sbjct  122   LIMAAAVSCAGWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGVVALISDHKLADWSLSSP  181

Query  661   MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGT  482
             +R +S  Y G+V SALA CL SW I  KGPLYV+VF+PL+LV+ A+ SW  L EK+YTGT
Sbjct  182   LRLISALYAGVVASALAFCLMSWAINIKGPLYVSVFSPLVLVIVAVFSWTLLEEKLYTGT  241

Query  481   VMGSILIVVGLYIVLWGKKNEL--QVINVEDNNKLKEKDAEKTEAGE  347
              MGS L+V+GLY VLWGK  E+  +   VE     K++   K +  E
Sbjct  242   FMGSALVVIGLYGVLWGKDREMNEKEDEVEIQKMAKQQPTVKRDINE  288



>gb|KHN43359.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=349

 Score =   281 bits (720),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/261 (54%), Positives = 190/261 (73%), Gaps = 5/261 (2%)
 Frame = -1

Query  1135  YFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGGQAKILGTLICIGGAMLL  956
             YFVGL  S+ T+A AL NL+PA TF+ AVLFR E++G++ + G AK+ GT++C+ GA+LL
Sbjct  3     YFVGLKYSSATIACALTNLLPAFTFILAVLFRQENLGIKKRAGLAKVFGTILCVSGALLL  62

Query  955   TLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILGPIMVILSCCSYSAFLITQARLS  779
             + Y G  + +GQS+IHW+YA+  ++  SSS  GN+ LGP++VILS   ++A+ I Q  +S
Sbjct  63    SFYHGKTIGLGQSSIHWRYAEK-MEGTSSSGKGNMFLGPLVVILSTLVWAAWFIIQKDIS  121

Query  778   KQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-TPMRAVSTTYNGLVYSALAICL  602
             K + APY+ST L CF+A F+C+IIA+CVDH  S W+L   MR  S  Y G+  + LA CL
Sbjct  122   KTFPAPYTSTGLMCFMASFQCIIIAVCVDHTASAWSLHNAMRLSSALYAGIFCTGLAYCL  181

Query  601   TSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKN  422
              SW IERKGPLYV+VF PL LVLTAILSWA LREK+Y GT +GS+LIV+GLY VLWGK  
Sbjct  182   MSWTIERKGPLYVSVFTPLQLVLTAILSWALLREKLYVGTAVGSLLIVLGLYSVLWGKSE  241

Query  421   ELQVINVEDNNKLKE--KDAE  365
             E+   +  + + +KE  KD++
Sbjct  242   EVNKGDGIEEDAVKEAVKDSK  262



>ref|NP_001145854.1| hypothetical protein [Zea mays]
 gb|ACL52732.1| unknown [Zea mays]
 tpg|DAA54313.1| TPA: hypothetical protein ZEAMMB73_784335 [Zea mays]
Length=391

 Score =   283 bits (724),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 139/326 (43%), Positives = 219/326 (67%), Gaps = 4/326 (1%)
 Frame = -1

Query  1381  LPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKM  1202
             +P   MV+VQLG+AG+N+V+   + AGM+P++ IAY+ + A   ++P+AY LER+S   +
Sbjct  6     VPPVAMVLVQLGFAGMNVVSKLALDAGMSPYVLIAYRNLIAAAVISPVAYLLERRSGATI  65

Query  1201  TPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGL  1022
             T  +  QIF+++ FG T +Q+ YFVGL +++PTVA AL N +PA+TFV A   ++ESV  
Sbjct  66    TKKVLLQIFVSSIFGATLNQVLYFVGLKSTSPTVACALTNTLPALTFVMAAALKMESVRP  125

Query  1021  RTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKY--AKNTVDKNSSSSHGNVI  851
              T  GQAK++GT +C+GG+M++  Y GPV+ +  S +HW++          +++  G  +
Sbjct  126   GTPAGQAKLVGTAVCVGGSMVIPFYKGPVLGLWASPLHWRFVADHAPSPAAAAAHSGAAV  185

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LG +++I SC +++ + I   ++S+ + APY+STA+ C +A  +C  ++  +D ++  W 
Sbjct  186   LGDVLIIASCVAWAVWFILHTKMSEGFSAPYTSTAIMCLMAGVQCAGVSAAMDRSLDVWK  245

Query  670   L-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L   +R  S  Y G+V S +   L SWCI+ +GPLYV++F+PLLLV+ AI+ WA L EKI
Sbjct  246   LGCDIRLYSVLYIGIVGSGIGFTLMSWCIQVRGPLYVSMFSPLLLVVVAIIGWAILGEKI  305

Query  493   YTGTVMGSILIVVGLYIVLWGKKNEL  416
               GT +GS+LIV GLY+VLWGK  E+
Sbjct  306   RVGTAVGSVLIVAGLYMVLWGKGREM  331



>gb|KHN02821.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=311

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/292 (50%), Positives = 203/292 (70%), Gaps = 6/292 (2%)
 Frame = -1

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             MT +I  QI L++  G+TG+QI YF+GL  ST T+A AL NL+PA TFV AVL R E++ 
Sbjct  1     MTKHIALQILLSSLTGVTGNQILYFLGLKYSTATIACALNNLLPAFTFVLAVLSRQENLR  60

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHG-NVI  851
             ++T+ G AK LGT++ +GGA+LL+ Y G V+ +G+S IHW+YA+    ++SSS  G N+I
Sbjct  61    IKTRAGVAKALGTVLSVGGAVLLSFYHGEVLGLGESEIHWRYAEKMQRESSSSGGGTNLI  120

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LGP+ VI+S   ++ + I QA +SK Y APY+ST   C +A  +C+ IAL  +HNVS W+
Sbjct  121   LGPVAVIVSALLWAVWFIVQANMSKSYPAPYTSTFYMCLMASIQCVAIALSAEHNVSAWS  180

Query  670   L-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L + +R  S  Y G + + LA  L SW IERKGPLYV+VF+PLLLV+ A+ SWA L E++
Sbjct  181   LHSTIRLTSALYAGTISTGLAYVLMSWTIERKGPLYVSVFSPLLLVIIAVASWALLHEQL  240

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVIN-VEDNNKLKE--KDAEKTEAGE  347
             Y GT +GS+LIV+GLY VLWGK  E+  I+ VE    + E  K++EK E  +
Sbjct  241   YVGTAIGSLLIVLGLYFVLWGKNKEMNKIDMVEVEGTVMEAIKESEKDEVKD  292



>ref|XP_008654544.1| PREDICTED: hypothetical protein isoform X6 [Zea mays]
Length=397

 Score =   279 bits (713),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/351 (40%), Positives = 223/351 (64%), Gaps = 8/351 (2%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             MG  D +P   MV+VQLG+A +NIV+   + AGM+P++ IAY+ + A   ++P+AY LER
Sbjct  4     MGGKDCVPPVAMVLVQLGFAVMNIVSKLALDAGMSPYVLIAYRNLIAAAVISPIAYLLER  63

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
             +S   +T  +  QIF ++ FG T +Q+ + VGL +++ TVA AL N +PA+TFV A   +
Sbjct  64    RSGATITKKVLLQIFCSSIFGATLNQVLFVVGLKSTSATVACALTNTLPALTFVMAAALK  123

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKY-----AKNTVDKN  878
             +E V   T  GQAK++GT +C+GG+ML+  Y GPV+ +  S IHW++             
Sbjct  124   MEPVRPGTAAGQAKLVGTAVCVGGSMLIPFYKGPVLRVWASPIHWRFAEHASPPAAAAAA  183

Query  877   SSSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALC  698
              + +    +LG ++VI SC +++ + I   ++S+ + APY+STA+ C +A  +C  ++  
Sbjct  184   GAHTGPAAVLGDVLVIASCVAWAVWFILHTKISQGFSAPYTSTAIMCLMAGVQCAGVSAA  243

Query  697   VDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAIL  521
             +D +++ W L   +R  S  Y G+V S     L SWCI+ +GPLYV++F+PLLLV+ A++
Sbjct  244   LDRSLAVWKLGFDIRLYSVLYIGIVGSGAGFTLMSWCIQVRGPLYVSMFSPLLLVIVAVV  303

Query  520   SWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDA  368
              WA L +KI  G+ +GS+LIV GLY+VLWGK  E+    + DN+K  E+ A
Sbjct  304   GWAILGDKIRLGSAIGSVLIVAGLYMVLWGKGREMDRPGL-DNDKGDEETA  353



>ref|XP_008785911.1| PREDICTED: WAT1-related protein At1g25270-like [Phoenix dactylifera]
Length=356

 Score =   277 bits (709),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 152/349 (44%), Positives = 218/349 (62%), Gaps = 23/349 (7%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             MV+VQL +AGVNI     +  GM+  I + Y+ +FAT  L PLA+FLERKSRPK+T  + 
Sbjct  1     MVLVQLVFAGVNIFYKLAINDGMDMRILVTYRFLFATAFLGPLAFFLERKSRPKITWKVL  60

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
                FL   FG    Q  Y   +  ++ T ASA+ NLIPAITF+ AVLFRLES+G  +  G
Sbjct  61    MLAFLCGLFGGALAQNLYVSSMKLTSATFASAMTNLIPAITFILAVLFRLESLGFHSISG  120

Query  1006  QAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSH----GNVILGPI  839
             QAK+LGTL+ IGGAMLLT Y G          W    N ++   +++     GN ++G +
Sbjct  121   QAKVLGTLVGIGGAMLLTFYKGV-----DINLWSTNLNLLNSERAAARHQEPGNHVMGSL  175

Query  838   MVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-P  662
             + + SC  Y+ +LI QA++ K+Y   YSSTAL C +   + +I ALCV+ +   W L   
Sbjct  176   LAVASCVCYAIWLIIQAKMMKEYPCHYSSTALMCLMGTVQSIIFALCVEKDWGQWRLGFD  235

Query  661   MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGT  482
             +R ++  Y+G+V SAL + + +WCI++KGPL+ ++FNPL+LV+ A+LS   L EK+Y G+
Sbjct  236   IRLLAVVYSGVVGSALILTVLAWCIKKKGPLFASIFNPLMLVIVALLSSLLLNEKLYLGS  295

Query  481   VMGSILIVVGLYIVLWGKKNE-------------LQVINVEDNNKLKEK  374
             V+G++LIV+GLY+VLWGK  E             + VI V  +N L+E+
Sbjct  296   VLGAVLIVIGLYMVLWGKGREAAAKVGELPADESIDVIIVSGDNGLQEQ  344



>ref|XP_006644097.1| PREDICTED: WAT1-related protein At1g09380-like [Oryza brachyantha]
Length=382

 Score =   278 bits (710),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 149/352 (42%), Positives = 230/352 (65%), Gaps = 13/352 (4%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             D LP   MV+VQLG+AG+N+V+   +  GM+P++ IAY+ + A + LAP AY+ ERKS  
Sbjct  4     DSLPTLAMVMVQLGFAGMNVVSKLALDTGMSPYVLIAYRNIIAAVFLAPFAYYFERKSGM  63

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
              +T  +  QIF ++ FG T +Q+ YFVGL ++TPTVA AL+N +PA+TF  A   R+ESV
Sbjct  64    MITKKVLVQIFFSSIFGATLNQVLYFVGLKSTTPTVACALSNTLPALTFAMAAALRMESV  123

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWK-YAKNTVDKNSSSSHGNV  854
              LR   GQAK++GT++C+GG+M++  Y GP++ +  S IHW+          +  +    
Sbjct  124   RLRAAAGQAKVVGTVVCVGGSMIMPFYKGPLLRLWASPIHWRGGGGGGGGGAAPGAGHAA  183

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             +LG +++ILSC +++ + I Q ++S+++ APY+ST + C +A  +C  ++  +D  V+ W
Sbjct  184   VLGDVLIILSCAAWAVWFIIQTKMSERFSAPYTSTTIMCLMAGAQCAGVSAAMDRTVAVW  243

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +R  S  Y G+V S +A  L SWCI+ +GPL+V++F+PL+LV+ A++ WA L EK
Sbjct  244   KLGFDIRLYSVLYIGVVGSGIAFALMSWCIQVRGPLFVSMFSPLMLVVVAVVGWAILDEK  303

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQ---------VINVEDNNKLKEKDA  368
             I+ G+ +GS+LIV GLY+VLWGK  E+          V  VE + K K+ DA
Sbjct  304   IHVGSAIGSVLIVAGLYVVLWGKAREMDSPADLDGVGVGGVELHGK-KDADA  354



>ref|XP_008654543.1| PREDICTED: hypothetical protein isoform X5 [Zea mays]
Length=407

 Score =   271 bits (692),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 144/361 (40%), Positives = 229/361 (63%), Gaps = 18/361 (5%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             MG  D +P   MV+VQLG+A +NIV+   + AGM+P++ IAY+ + A   ++P+AY LER
Sbjct  4     MGGKDCVPPVAMVLVQLGFAVMNIVSKLALDAGMSPYVLIAYRNLIAAAVISPIAYLLER  63

Query  1219  KSRPKMTPNIFFQIFLTATFGL----------TGDQIAYFVGLNNSTPTVASALANLIPA  1070
             +S   +T  +  QIF ++ FG           T +Q+ + VGL +++ TVA AL N +PA
Sbjct  64    RSGATITKKVLLQIFCSSIFGYASGCMHGCRATLNQVLFVVGLKSTSATVACALTNTLPA  123

Query  1069  ITFVAAVLFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKN  893
             +TFV A   ++E V   T  GQAK++GT +C+GG+ML+  Y GPV+ +  S IHW++A++
Sbjct  124   LTFVMAAALKMEPVRPGTAAGQAKLVGTAVCVGGSMLIPFYKGPVLRVWASPIHWRFAEH  183

Query  892   TVDKNSSSSHGNV-----ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLA  728
                  ++++ G       +LG ++VI SC +++ + I   ++S+ + APY+STA+ C +A
Sbjct  184   ASPPAAAAAAGAHTGPAAVLGDVLVIASCVAWAVWFILHTKISQGFSAPYTSTAIMCLMA  243

Query  727   IFECLIIALCVDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFN  551
               +C  ++  +D +++ W L   +R  S  Y G+V S     L SWCI+ +GPLYV++F+
Sbjct  244   GVQCAGVSAALDRSLAVWKLGFDIRLYSVLYIGIVGSGAGFTLMSWCIQVRGPLYVSMFS  303

Query  550   PLLLVLTAILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKD  371
             PLLLV+ A++ WA L +KI  G+ +GS+LIV GLY+VLWGK  E+    + DN+K  E+ 
Sbjct  304   PLLLVIVAVVGWAILGDKIRLGSAIGSVLIVAGLYMVLWGKGREMDRPGL-DNDKGDEET  362

Query  370   A  368
             A
Sbjct  363   A  363



>ref|XP_009616814.1| PREDICTED: WAT1-related protein At1g09380-like, partial [Nicotiana 
tomentosiformis]
Length=320

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 195/280 (70%), Gaps = 6/280 (2%)
 Frame = -1

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
             F     A   +T +Q  YF+GL NSTPTV SA+ NLIPA TF+ AV    E + LR+  G
Sbjct  21    FYFIYRAICRITVNQYVYFIGLKNSTPTVVSAIDNLIPAFTFLIAVPVGAEKLRLRSIAG  80

Query  1006  QAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPIMVIL  827
             QAK+LGT++C+GGAMLL+LY G VVIGQ   HWKYA++T    +SS HGN   GP +VI+
Sbjct  81    QAKLLGTIVCVGGAMLLSLYHGKVVIGQLGFHWKYAESTGKDVNSSGHGNFFSGPFLVIM  140

Query  826   SCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLTPMRAVS  647
             S  +Y+ +LI Q +++++Y APY+   L C +A  E +II  CV   +S+W L P+RA+S
Sbjct  141   SSLTYAIWLIIQGKVNEKYAAPYTCITLMCLMASVESVIIGFCVVPKLSEWALNPIRAIS  200

Query  646   TTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMGSI  467
               YNG+V ++ A  L+SWCIERKGPLYV++FNPLLLV++A LSW  LREK+Y G V+GSI
Sbjct  201   VVYNGVVCTSFAYFLSSWCIERKGPLYVSMFNPLLLVISAFLSWTLLREKLYLGVVVGSI  260

Query  466   LIVVGLYIVLWGKK------NELQVINVEDNNKLKEKDAE  365
             +IV+GLY  LWG+K      ++++V+  ++ N+  + D E
Sbjct  261   IIVIGLYGFLWGQKMETSTDDDIEVVVNKEKNQSTKIDLE  300



>ref|XP_009399308.1| PREDICTED: WAT1-related protein At1g68170-like [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 146/347 (42%), Positives = 217/347 (63%), Gaps = 15/347 (4%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P+  MV+VQ+ +AGVNI     +  GM+  I +AY+ +FA   L PLA+F+ER++RPKMT
Sbjct  6     PVAGMVLVQVVFAGVNIFYKLALNDGMDSRILVAYRYLFAAAFLCPLAFFMERQTRPKMT  65

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +    F +   G T  Q  Y   +  ++ T ASA+ NLIPAITF+ AVLFRLES+ + 
Sbjct  66    WKVLMLSFFSGLLGGTISQNLYLSCVRITSATFASAMTNLIPAITFILAVLFRLESLAVL  125

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSS-----SSHGNV  854
             T  GQAK LGTL  +GGAMLLT Y G  +   ST H    ++  D+  +      + GN 
Sbjct  126   TVSGQAKALGTLTGVGGAMLLTFYKGATINLWST-HIDLLRSHNDEGGAQPQPQQASGNH  184

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             ++G +  ++SC SY+ +LI Q R+SKQY   Y+ TAL CF+A  + ++ ALC D ++S W
Sbjct  185   VMGSLFAVISCLSYAMWLIIQTRMSKQYPCHYTGTALLCFMAAAQSVVYALCGDRSMSSW  244

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              +   +R ++T Y+G+  S + + + SWCI+++GPL+ ++FNPL+L++ A+LS   L E+
Sbjct  245   RMRLDVRLLTTIYSGVAASGIILIVLSWCIKKRGPLFASIFNPLMLIIVALLSTFLLNEQ  304

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTE  356
             ++ G+V+GS LIV GLY VLWGK  E          K++E   E T+
Sbjct  305   LHLGSVIGSALIVAGLYAVLWGKSRE--------AAKVEESPPELTD  343



>ref|XP_010911986.1| PREDICTED: WAT1-related protein At1g25270-like [Elaeis guineensis]
Length=374

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 218/351 (62%), Gaps = 14/351 (4%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P   MV+VQ+ +AGVN+     +  GM+  + + Y+ +FA++ L PLA+FLERKSRPK
Sbjct  12    LKPAGGMVLVQVVFAGVNVFYKLAINDGMDMRVLVTYRFLFASVFLGPLAFFLERKSRPK  71

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  +     L   FG +  Q  Y   +  ++ T ASA+ NLIPAITF+ AVLFRLES+G
Sbjct  72    ITWKVLMLASLCGLFGGSLAQNLYVSSMKLTSATFASAMTNLIPAITFILAVLFRLESLG  131

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIHWKYAKNTVDKNSSSSHGNVIL  848
             + +  GQAK+LGT+  I GAMLLT Y G  + I  + I+   + +          GN ++
Sbjct  132   IHSLSGQAKVLGTIFGISGAMLLTFYRGVDINIWSTNINLLKSHSEGAAAPHQEPGNHVM  191

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             G ++ + SC  Y+ +LI QA++ K+Y   YS+TAL C +   + +I ALCV+ +   W L
Sbjct  192   GSLLAVASCVCYAIWLIIQAKMMKEYPCHYSTTALMCLMGTVQSIIFALCVERDWEQWRL  251

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                +R ++  Y+G+V S L + + +WCI++KGPLY ++FNPL+LV+ A+LS   L EK++
Sbjct  252   CFDIRLLAVIYSGVVGSGLILTVLAWCIKKKGPLYASIFNPLMLVIVALLSSLLLNEKLH  311

Query  490   TGTVMGSILIVVGLYIVLWGKKNE------------LQVINVEDNNKLKEK  374
              G+V+G++LIV+GLYIVLWGK  E            + VI V  +  L+E+
Sbjct  312   LGSVLGAVLIVIGLYIVLWGKGREAAKVGELSADESIDVIIVSGDKGLQEQ  362



>ref|XP_004166799.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=384

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/348 (42%), Positives = 219/348 (63%), Gaps = 6/348 (2%)
 Frame = -1

Query  1396  GCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERK  1217
             G  D  P+F+M + Q  YAGVN++    +  GMN  I IA++ +FA++ + PLA+FLERK
Sbjct  12    GLHDAKPVFLMALTQSVYAGVNVLYKLAINDGMNLMILIAFRFLFASLFMLPLAFFLERK  71

Query  1216  SRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRL  1037
              RPKMT +I F  F    FG T  Q  Y   L  ++ T  SA+ NL PAITF+ A+ FR+
Sbjct  72    KRPKMTWSILFYGFFCGLFGGTLSQNLYVQSLAMTSATFVSAMQNLSPAITFLLALSFRM  131

Query  1036  ESVGLRTKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIHWKYAKNTVDKNSSSSHG  860
             E + ++ K G AK+LGTL+ IGGAM+LTLY G  + I  + ++  + ++      +S   
Sbjct  132   EKLNVKKKEGVAKVLGTLLGIGGAMILTLYKGFEINIWTTRVNLLHGRHMSHLPQNSHSH  191

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             N++LG ++   SC SYS++LI QA++ K Y   YSSTAL C +   + + I++CV+ +  
Sbjct  192   NLLLGSLLAFASCLSYSSWLILQAKMMKIYPCQYSSTALMCVMGAIQGVAISICVERDWK  251

Query  679   DWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W L   +R ++ T+ G+V S   + + +WC+  +GPLYV+VF+PL+L++ AI    FL 
Sbjct  252   QWKLGWNIRLITVTFAGIVGSGAMVTVMAWCVRMRGPLYVSVFSPLMLLIVAIAGSLFLD  311

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNE----LQVINVEDNNKLKEKD  371
             EK++ G+V+G++LIV GLY+VLWGK  E    LQ+   E   +L+ KD
Sbjct  312   EKLHLGSVVGAMLIVCGLYMVLWGKSKEMNKCLQLTPSESIGQLELKD  359



>ref|XP_010684310.1| PREDICTED: WAT1-related protein At1g68170-like [Beta vulgaris 
subsp. vulgaris]
Length=391

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 210/325 (65%), Gaps = 2/325 (1%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P+  M++VQ  +AGVNI        GMN  + +AY+ +FA   + PLA+FLERKSRPK
Sbjct  11    LKPIVFMILVQTSFAGVNIFYKLAAIDGMNLRVLVAYRILFAAAFIVPLAFFLERKSRPK  70

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  +  Q FL   FG +  Q  Y   L  ++ T  +A+ANLIPA+TF+ AV FRLE V 
Sbjct  71    LTWTVLGQAFLCGLFGGSLVQNLYLESLVLTSATFTAAMANLIPAVTFILAVCFRLEKVS  130

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
             L++  G+AKILGTL+ IGGAM+LT Y G  V   ST +  + K T          N ++G
Sbjct  131   LKSVSGKAKILGTLLGIGGAMILTFYKGIEVKLWST-NSHFLKQTTMGLVIHDGQNRLVG  189

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
               + + SC SY+A+LI QA++S+ YG+PYSSTAL   +   + ++ ALCVD ++S W L 
Sbjct  190   SFLALGSCFSYAAWLIVQAKMSESYGSPYSSTALMSIMGSVQAVVFALCVDRDLSLWKLG  249

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               +R ++  Y+G+V S +++ + +WC+  +GPL+V++FNPL L+L A+     L EK+Y 
Sbjct  250   WNIRLLTVAYSGIVASGVSVTVIAWCVRVRGPLFVSIFNPLTLILVALAGSLILDEKLYI  309

Query  487   GTVMGSILIVVGLYIVLWGKKNELQ  413
             G+V+G+ILIV GLY V+WGK  E++
Sbjct  310   GSVIGAILIVFGLYAVIWGKGKEIK  334



>ref|XP_006838307.1| hypothetical protein AMTR_s00103p00127060 [Amborella trichopoda]
 gb|ERN00876.1| hypothetical protein AMTR_s00103p00127060 [Amborella trichopoda]
Length=347

 Score =   263 bits (671),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 145/348 (42%), Positives = 213/348 (61%), Gaps = 19/348 (5%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P  VM+ +QL  A  +IV+   M  GM+  + I Y+ + AT+ L+P AYFLERK+RP +T
Sbjct  6     PYVVMISLQLLVASADIVSKRAMERGMSYHVFIVYRHIVATLVLSPFAYFLERKTRPSLT  65

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +FF++FL A  G+TG Q  YFVGL +S+PTV  A+ NL PAITF+ A +FRLESV +R
Sbjct  66    RPVFFKLFLLALCGITGTQNTYFVGLMHSSPTVVGAMNNLCPAITFILAAIFRLESVNIR  125

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMG----PVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             ++ GQ K+LGT ICIGGAML T Y G    P+ I    IH  ++    +     +  + +
Sbjct  126   SRRGQGKLLGTSICIGGAMLFTFYKGHLFPPLKISFFNIHGYHSGGGAEH----AKPDWV  181

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
              G    I+S   +S FLI QA L K Y AP S  A   FLA+ +   +A+  +   S W 
Sbjct  182   KGSSFAIVSTLCWSVFLILQASLYKVYPAPLSMNAWISFLAMMQSAAVAVIFERTASPWK  241

Query  670   LT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             +   ++ +S  Y G++ SA+   L +WCI ++GP++VA+F PL L++ AILS   L+E++
Sbjct  242   IGWDLKLLSYFYYGILVSAIGYSLNAWCISKRGPVFVALFFPLQLIIAAILSALILKERL  301

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKE----KDAEK  362
             + G+V+G  LI++G Y V+WGK  +      ++N K++E    KD EK
Sbjct  302   HLGSVIGGCLIILGFYCVMWGKSKD------DNNEKVEEKRGIKDVEK  343



>ref|XP_008781415.1| PREDICTED: WAT1-related protein At1g68170-like [Phoenix dactylifera]
Length=407

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/348 (43%), Positives = 214/348 (61%), Gaps = 13/348 (4%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P  +MV+VQ+ +AG+NI     +  GM+  + +AY+ +FA   + PLA+FLERKSRP +T
Sbjct  15    PAALMVLVQVAFAGLNIFCKLALNDGMDVRVLVAYRYIFAITFIGPLAFFLERKSRPSLT  74

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               I  Q FL   FG T  Q  Y   L  ++ T A+AL+NL+PA TF+ AV FRLE + +R
Sbjct  75    WMILLQSFLCGLFGGTLAQNLYVASLKLTSATFANALSNLMPASTFILAVSFRLEILRIR  134

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQST------IHWKYAKNTVDKNSSSSHGN  857
                GQAK+LGTL+ +GGA LLT Y GP +   ST      IH +   +    +  S    
Sbjct  135   QASGQAKVLGTLVGLGGATLLTFYKGPEINPWSTNLNLLKIHQEGDHHQALPHEPSKR--  192

Query  856   VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSD  677
              I+G  +VI SC  YS +LI QA++S+ Y   YSS+AL   +   + ++IALC + +++ 
Sbjct  193   -IMGAFLVIASCFFYSLWLIIQAKMSRAYPCHYSSSALMNLMGAIQTILIALCTNRDMNK  251

Query  676   WTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W L   +R ++ +Y G+V S L I +  WCI++KGPLY +VFNPL LV+ A+LS   L E
Sbjct  252   WRLGFDVRLLTISYAGVVASGLIIAVLMWCIKKKGPLYTSVFNPLQLVIVALLSSPLLGE  311

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTE  356
             +++ G+++G++LIV+GLY+VLWGKK E     V     L E  +E  E
Sbjct  312   RLHLGSILGAVLIVIGLYLVLWGKKKE---ATVAAEKSLVEAKSESVE  356



>ref|XP_002277022.1| PREDICTED: WAT1-related protein At1g68170-like isoform X1 [Vitis 
vinifera]
Length=382

 Score =   263 bits (671),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/345 (41%), Positives = 211/345 (61%), Gaps = 3/345 (1%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P  VMV+ QL   GV I+    +  GMN  + IAY+ +FAT  ++ LA+ LERKSRP++T
Sbjct  14    PAIVMVVAQLASGGVQILYKLAINDGMNTRVLIAYRYIFATAFISSLAFILERKSRPRLT  73

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               I  Q FL   FG    Q  Y   +  ++PT ++A+ANLIPA+TF+ A+   LE + +R
Sbjct  74    WMIALQGFLCGLFGGALGQNLYVESMVLTSPTFSAAMANLIPAVTFIFAIFLGLEKLAIR  133

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILGP  842
             T  G+AK+ GTL+ IGGAM+LT Y GP + I  + +H    KN     S     N +LG 
Sbjct  134   TWAGKAKVTGTLLGIGGAMVLTFYKGPQINIWSTKVHLLKHKNQHVAASHRGMDNRVLGS  193

Query  841   IMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-  665
             ++ + SC SY+ + I QA++ ++Y   YSSTAL C  A  + ++ A+C + N S W L  
Sbjct  194   LLAVASCFSYATWYIIQAKMGERYPFDYSSTALMCASASVQTVVYAMCKETNWSAWKLGW  253

Query  664   PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTG  485
              +R ++  Y G + S   + L +WC+ ++GPL+V+VFNPLLLV  AIL    L EK++ G
Sbjct  254   NIRLLTVAYTGYLSSGFMVVLANWCVRKRGPLFVSVFNPLLLVFVAILDSLLLDEKLHLG  313

Query  484   TVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAG  350
             +++G +LIV+GLY +LW K+ E++      ++K + K+AEK   G
Sbjct  314   SIIGGVLIVIGLYAMLWAKREEMKSKARLSHSK-RSKEAEKINVG  357



>ref|XP_010531902.1| PREDICTED: WAT1-related protein At1g68170-like isoform X1 [Tarenaya 
hassleriana]
Length=382

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/367 (41%), Positives = 214/367 (58%), Gaps = 36/367 (10%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P  +MV+VQ+ +AGVN++       GM+  + +AY+ +F+   + P+A   ER  RPK+T
Sbjct  20    PAMLMVVVQVAFAGVNVLYKLAANDGMSLRVVVAYRFIFSAAFMVPVALIFERGKRPKIT  79

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               + FQ FL   FG +  Q  Y  GL  ++ T  SAL NLIPAITF+ A+ FRLE + L 
Sbjct  80    WTVLFQAFLCGLFGGSLAQNLYLQGLALTSATFVSALTNLIPAITFILAISFRLERLELG  139

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSS----------  869
                G+AK+LGTL+ IGGAMLLT Y G V+         + K  +D  SSS          
Sbjct  140   KAAGKAKVLGTLMGIGGAMLLTFYKGFVI--------DFMKTDIDLLSSSGDRHVSSVRA  191

Query  868   SHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH  689
             S G+ +LG  + + SC SY+ +LI Q ++S++Y   YSSTAL   + + + ++ ALCV+ 
Sbjct  192   SSGHRVLGASLALGSCFSYAIWLIIQTKMSEKYPCYYSSTALMSIMGLIQAVLFALCVER  251

Query  688   NVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWA  512
             + S W L   +R  +  ++G++ S L + L SWC+  +GPL+V+VFNPLLLVL AI    
Sbjct  252   DWSQWKLGWNIRLWTVAFSGIMGSGLMVTLMSWCVRLRGPLFVSVFNPLLLVLVAIAGAL  311

Query  511   FLREKIYTGTVMGSILIVVGLYIVLWGKKNELQ-----------------VINVEDNNKL  383
             FL EK+Y G+V+G+ILIV GLY+VLWGK  E++                 V+    N K 
Sbjct  312   FLDEKLYLGSVLGAILIVCGLYVVLWGKGKEMKQMARLVPSRTLQETMDVVVESPGNIKA  371

Query  382   KEKDAEK  362
              EKD E 
Sbjct  372   TEKDKED  378



>ref|XP_006838306.1| hypothetical protein AMTR_s00103p00126500 [Amborella trichopoda]
 gb|ERN00875.1| hypothetical protein AMTR_s00103p00126500 [Amborella trichopoda]
Length=347

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/352 (40%), Positives = 216/352 (61%), Gaps = 23/352 (7%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P  VM+ +QL  A  +IV+   +  GM+  + I Y+ + A++ L+P AYFLERK+RP +T
Sbjct  6     PYVVMISLQLLVASADIVSKRALERGMSYHVFIVYRHIVASLVLSPFAYFLERKTRPSLT  65

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +F+++F+ A  G+TG Q AYF GL  S+PTV  A+ NL PAITF+ A++FR+ESV +R
Sbjct  66    RPVFYKLFMLALCGITGTQNAYFAGLMYSSPTVVGAMNNLCPAITFILAIIFRMESVNIR  125

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMG----PVVIGQSTIHWKYAKNTVDKNSSSSHG--N  857
             ++ GQ K+LGT IC+GGAML T Y G    P+ I    IH        +  SS+ H   +
Sbjct  126   SRRGQGKLLGTSICLGGAMLFTSYKGHLLPPLKIPFINIH------GYNSASSAKHAKPD  179

Query  856   VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSD  677
              + G    I+S   +S FLI QA + K Y AP S      FLA+ + ++IA+  +   S 
Sbjct  180   WVKGSSFAIVSTLCWSVFLILQASVYKVYPAPLSMNTWISFLAMMQSVVIAVIFERTASP  239

Query  676   WTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W +   ++ +S  Y G++ SA+   L +WCI ++GP++VA+F PL L++ AILS  FL+E
Sbjct  240   WKIGWDLKLLSYFYYGILVSAIGYSLNAWCISKRGPVFVALFFPLQLIIAAILSALFLKE  299

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEK----DAEKTE  356
             +++ G+V+G  LI++G Y V+WGK  +      ++N K++EK    D EK  
Sbjct  300   RLHLGSVIGGCLIILGFYCVMWGKSKD------DNNEKVEEKSLINDVEKAR  345



>gb|ABR16695.1| unknown [Picea sitchensis]
Length=406

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/366 (39%), Positives = 213/366 (58%), Gaps = 22/366 (6%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+NI+    +  GMN ++ + Y+   ATIA+AP A+F ERK RPK+T
Sbjct  18    PYIAMISLQFGYAGMNIMTKVSLNRGMNHYVLVVYRHAIATIAMAPFAFFFERKVRPKLT  77

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
                F  IF     G   DQ  Y+ GL  +TPT + AL+N +PA+TFV A++FR+E + ++
Sbjct  78    FLTFCLIFALGLLGPVIDQNVYYAGLKLTTPTFSCALSNTLPAMTFVMAIVFRMERLSMK  137

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPI  839
                 QAKI+GTL+ +GGAML+TLY GP V    + H  +    V   S+    + I G +
Sbjct  138   QVRSQAKIVGTLLSVGGAMLMTLYKGPAVHMFWSPHHHHHDKYVKSASAVPDKDWIKGSL  197

Query  838   MVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-P  662
             +VI SC +++ F + QA ++K+Y A  S T L CFL   +   + L ++H  S W +   
Sbjct  198   LVIASCLAWAGFFVLQAFVAKKYSAQLSLTTLICFLGTLQSAALTLVIEHKPSVWAIGWD  257

Query  661   MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGT  482
             M  ++  Y+G++ S +A  + S C+E KGP++   F+PL++++ A++    L E IY G+
Sbjct  258   MNLLTAVYSGVIASGIAYYVQSLCMELKGPVFATAFSPLMMIIVAVMGSIILAETIYLGS  317

Query  481   VMGSILIVVGLYIVLWGK---------KNELQVINVED----------NNKLKE--KDAE  365
             V+G+ILIVVGLY VLWGK         KN LQV+  ED           NK+ E  K  +
Sbjct  318   VLGAILIVVGLYAVLWGKVKDHKIPSGKNSLQVLPTEDVKANYDTEAAYNKITEAVKRGD  377

Query  364   KTEAGE  347
             + E  E
Sbjct  378   ENEQTE  383



>gb|AFK33606.1| unknown [Lotus japonicus]
Length=278

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 185/269 (69%), Gaps = 5/269 (2%)
 Frame = -1

Query  1396  GCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERK  1217
             G S L+P F+M+++QL YA VNI +   + +GMNP I +AY+Q+FATI++ P AYF E K
Sbjct  5     GGSSLIPFFIMILIQLAYAVVNITSKLAIQSGMNPLILVAYRQIFATISIIPFAYFFEWK  64

Query  1216  SRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRL  1037
               P+MT  I  QIFL++  G+TG+Q+ YFVGL  ST T+A AL NL+PA TFV A++FR 
Sbjct  65    ILPRMTKRIMVQIFLSSLTGVTGNQVLYFVGLKYSTATIACALTNLLPAFTFVLALIFRQ  124

Query  1036  ESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHG  860
             E++ ++   GQ K+LGT++C+ GA+LL+ Y G  + +G+S+IHW YA      +S+SS  
Sbjct  125   ENLRIKKMSGQTKVLGTVLCVSGALLLSFYHGKTIGLGESSIHWSYADKMQGGSSTSSAA  184

Query  859   ---NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH  689
                N++LGPI +ILS   ++ + I QA +SK +  PY+ST   CFLA F+C+IIALC +H
Sbjct  185   GKTNLLLGPIALILSALVWAFWFIIQADMSKNFPVPYTSTGYMCFLASFQCVIIALCFEH  244

Query  688   NVSDWTL-TPMRAVSTTYNGLVYSALAIC  605
               S W+L   MR  S+ Y G++ + L++C
Sbjct  245   RPSAWSLQNAMRLTSSLYAGVICTGLSLC  273



>ref|XP_006432264.1| hypothetical protein CICLE_v10003704mg, partial [Citrus clementina]
 gb|ESR45504.1| hypothetical protein CICLE_v10003704mg, partial [Citrus clementina]
Length=401

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/345 (41%), Positives = 215/345 (62%), Gaps = 3/345 (1%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P   MV+VQ+ +AGVN+        GM+  + +AY+ +FAT  + P+   LERKSRPK
Sbjct  11    LKPALTMVVVQVAFAGVNVFYKLAANNGMSLRVIVAYRFIFATAFMVPVTIILERKSRPK  70

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +   I FQ FL   FG +  Q  Y   L  ++ T ASA+ANL+PAITFV ++ F LE +G
Sbjct  71    LNLKILFQAFLCGLFGGSLSQNLYLESLVLTSATFASAMANLVPAITFVLSISFGLEKLG  130

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIHWKYAKNTVDKNSSSSHGNVIL  848
             +RT+ G+AK+LG+LI IGGAM+LT Y G  + I  + I+  ++   V  +  +  G   L
Sbjct  131   IRTRAGKAKVLGSLIGIGGAMILTFYRGVEINIWSTNINLIHSNGHV-ASLHADPGKRFL  189

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             G +  + SC  Y+ +L+ QA++S++Y   +SSTAL C +   + ++ ALC++ + S W L
Sbjct  190   GALFALGSCFGYAIWLVIQAKMSEEYPCQFSSTALMCVMGAIQAVVFALCMEKDWSQWKL  249

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                +R ++  Y+G+V S L + L SWC+  +GPL+ ++FNPL+LV+ AILS   L EK++
Sbjct  250   GWNIRLLTVAYSGIVASGLMVTLISWCVRTRGPLFASIFNPLMLVVVAILSSLILDEKLH  309

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTE  356
              G+++G+ LIV GLY VLWGK  E++ I      K+  + ++  E
Sbjct  310   LGSILGATLIVCGLYAVLWGKGKEMKKITQLVPAKINGESSKSIE  354



>ref|XP_010068198.1| PREDICTED: WAT1-related protein At1g68170-like [Eucalyptus grandis]
Length=389

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/334 (43%), Positives = 215/334 (64%), Gaps = 11/334 (3%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             ++  L +MV+VQ+ +AGVNI+       GMN  I +AY+  FAT+ +APLA+FLERKSRP
Sbjct  3     EMKALLMMVVVQVAFAGVNILYKLAASDGMNLMILVAYRFTFATLFMAPLAFFLERKSRP  62

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  +  Q F +  FG +  Q  Y   L+ ++ T A+A+ANL+PA+TFV AV   LE V
Sbjct  63    KITWTVLVQAFFSGLFGGSLGQNLYLASLSMTSATYATAMANLVPAVTFVLAVSLGLEKV  122

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGN---  857
              +RT  G+AK+ GTL+ IGGAMLLT Y G  V       W    N +   +++  G    
Sbjct  123   KMRTAAGKAKVAGTLMGIGGAMLLTFYKGMEV-----NMWSTHVNLLRHVAATQRGQEGS  177

Query  856   --VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
               ++LG ++ + SC  Y+ +LI QA++S+++  PY+STAL  F+A  + ++ ALC + + 
Sbjct  178   SNLLLGSLLAVASCFCYALWLIIQAKMSERFPCPYTSTALMTFMASIQAVVYALCRERDW  237

Query  682   SDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             S W L   +R ++ +Y+G+V S L   L +WC+  +GP++V+VFNPL+LV  A++    L
Sbjct  238   SQWKLGWNIRLLTVSYSGIVASGLCYALITWCVRMRGPVFVSVFNPLMLVTVALVGSMVL  297

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQVIN  404
              EK++ G+++GS LIV+GLY VLWGKK E + +N
Sbjct  298   DEKLHLGSILGSGLIVLGLYAVLWGKKRENKWMN  331



>ref|XP_010261295.1| PREDICTED: WAT1-related protein At1g68170, partial [Nelumbo nucifera]
Length=410

 Score =   258 bits (658),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 144/356 (40%), Positives = 224/356 (63%), Gaps = 11/356 (3%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P  VMV+VQ+ +AGVN+        GM+  + +AY+ +FAT+ LAPLA+F+ERK+RPK
Sbjct  11    LKPAMVMVLVQVVFAGVNVFYKLAAIDGMSLRVLVAYRYLFATVFLAPLAFFVERKTRPK  70

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  +  Q FL   FG T  Q  Y   L  ++ T ASA++NLIPAITF+ AV F LE + 
Sbjct  71    LTRMVLLQAFLCGLFGGTLAQNLYVASLALTSATFASAMSNLIPAITFIMAVAFGLERLN  130

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTI---HWKYAKNTVDKNSSSSHGN  857
             +RT  G+AK++GTL+ I GAM+LT Y G  + +  S +   H  +  +  + ++ S  GN
Sbjct  131   IRTMVGKAKVVGTLLGISGAMILTFYKGVEINLWSSKVDLTHRIHHGHVAESHAES--GN  188

Query  856   VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSD  677
              +LG ++ + SC SY+ +LI Q ++S++Y   YSSTAL C +   + ++ ALC++ + S 
Sbjct  189   RVLGSLLAVASCFSYAIWLIIQTKMSERYPCQYSSTALMCVMGSIQAVVFALCMERDWSQ  248

Query  676   WTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W L   +R  +  Y+G+  S L + L +W +  +GPL+V+VFNPL+LVL A++    L E
Sbjct  249   WKLGWNIRLFTVAYSGIFASGLVVSLIAWGVMVRGPLFVSVFNPLMLVLVALMGSILLNE  308

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGEC*LSN  332
             K++ G+V+G+ LIV GLY+VLWGK  E++ +       +  K + ++E  E  ++N
Sbjct  309   KLHLGSVIGAALIVCGLYVVLWGKGKEMKRM----ARLMPSKSSRESEPIEVVVAN  360



>ref|XP_011029206.1| PREDICTED: WAT1-related protein At1g25270-like [Populus euphratica]
Length=376

 Score =   256 bits (655),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 215/347 (62%), Gaps = 8/347 (2%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P  +MV+VQ+ +A VN++       GMN  I +AY+ +FAT  +APLA+ +ERK+R +
Sbjct  11    LKPALLMVLVQVAFAAVNVLYKLAANDGMNLKIIVAYRFIFATAFMAPLAFIVERKNRGE  70

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  I  Q F    FG +  Q AY   L   + T A A+ANLIPA+TF+ A++FR+E + 
Sbjct  71    LTWTIIIQAFFCGLFGCSFAQNAYIESLALISATFACAMANLIPAVTFILALIFRMERME  130

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIHWKYAKNTVDKNSSSSHGNVIL  848
             L +  G+AK +GTL+ IGGAMLLT Y G  +  G + ++  + +      SS  HG  IL
Sbjct  131   LASAKGKAKAIGTLMGIGGAMLLTFYKGVEINNGSAKVNLLHHRQYAHAASSHGHGR-IL  189

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             G  M +L+C SYS++LI QA++S +Y + YS++AL C +   +  + ALC++ + + W L
Sbjct  190   GFFMALLNCLSYSSWLIVQAKMSARYRSHYSNSALVCAMGAIQATVFALCLERDWNQWKL  249

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                +R ++  ++G+  S L   L SWC+  +GPL+VA+F+PL+LVL AI     L EK+Y
Sbjct  250   GWNIRLLTAAFSGVAGSGLMGILISWCLAMRGPLFVAIFSPLMLVLVAIAGSLLLAEKLY  309

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAG  350
              G+++G++LI+ GLY VLWGK  E++        +L   + E ++ G
Sbjct  310   LGSIVGALLIICGLYFVLWGKSKEMKA-----KKQLAPSETETSQEG  351



>gb|KHG16428.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=381

 Score =   256 bits (654),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 136/324 (42%), Positives = 209/324 (65%), Gaps = 4/324 (1%)
 Frame = -1

Query  1369  VMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNI  1190
             +MV++Q+ +AGV+++       GM+  I +AY+ +FAT  + P+A  +ER+ RPK+T  I
Sbjct  16    LMVVIQVIFAGVSVLYKLAANDGMSLRIIVAYRFLFATAVMVPVALLVERE-RPKLTWTI  74

Query  1189  FFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKG  1010
               Q FL A  G T  Q  Y   +  ++ T  SA+ANL PAITF  A++  LE +G RT  
Sbjct  75    LLQAFLCALLGGTLSQNLYIESMALTSATFVSAMANLTPAITFTMAIIMGLEKLGFRTMA  134

Query  1009  GQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPIMV  833
             G+AK+LGT+I +GGAMLLT Y G  + IG +  H   +   +  N+ S++ + +LG ++ 
Sbjct  135   GRAKVLGTVIGVGGAMLLTFYKGLQINIGSTHFHLLLSHGPISSNAPSTNHH-LLGALLA  193

Query  832   ILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-PMR  656
               SC SYS +L  QA++S+ Y   YSSTAL C +   + +  ALC++ ++S W L   +R
Sbjct  194   FTSCISYSLWLNIQAKMSENYPCYYSSTALICIIGTIQAVAFALCMEKDMSQWKLGWNIR  253

Query  655   AVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVM  476
              ++  Y+G++ S L   + SWC+  KGPLYV+VF+PL++VL A+    FL EK+Y G+++
Sbjct  254   LLTVAYSGILASGLVFSVVSWCVRMKGPLYVSVFSPLMVVLVALAGTLFLEEKLYLGSII  313

Query  475   GSILIVVGLYIVLWGKKNELQVIN  404
             G++LIV+GLY+VLWGK  E +V+N
Sbjct  314   GAVLIVMGLYVVLWGKSKETKVVN  337



>ref|XP_007148451.1| hypothetical protein PHAVU_006G210000g [Phaseolus vulgaris]
 gb|ESW20445.1| hypothetical protein PHAVU_006G210000g [Phaseolus vulgaris]
Length=402

 Score =   257 bits (656),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 144/330 (44%), Positives = 207/330 (63%), Gaps = 5/330 (2%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P  VM++VQ+GYAGVNI     +  GMN  I +AY+ +FATI +APLA  LERK R K
Sbjct  11    LKPTLVMLVVQVGYAGVNIFYKLAVNDGMNLRIVVAYRFLFATIFMAPLALILERKKRTK  70

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             M+  I FQ F    FG +  Q  Y   L+ ++ T  SA+ANL+P ITF+ A+ F LE + 
Sbjct  71    MSWRILFQSFFCGLFGGSLAQNFYLQALSLTSATFTSAMANLVPGITFILALCFGLERLN  130

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIHWK-YAKNTVDKNSSSSHGNVI  851
             LRT  G+AKI GTLI IGGAM+LT   G  + IG  T H+    +N     + +S    +
Sbjct  131   LRTAAGKAKIAGTLIGIGGAMVLTFVKGKEIKIG--TFHFNLLHQNGARPPAQASGAKTV  188

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LG +  + S  SY+ +LI QA++ ++Y  PYSSTAL         ++IALC++ + + W 
Sbjct  189   LGSLSALASGVSYALWLIIQAKMIERYPCPYSSTALMSMWGALVSIVIALCLERDWTQWR  248

Query  670   LT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L   +R  +  Y+G+V S + + + SWCI  +GPL+ +VFNPL+LVL A+ S   L+E +
Sbjct  249   LGWNIRLWTAAYSGIVVSGIMVVMISWCIRMRGPLFASVFNPLMLVLVALASSTMLKETL  308

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVIN  404
             + G ++G++LIV+GLY+VLWGK  E++  N
Sbjct  309   HLGCIIGAVLIVLGLYLVLWGKSEEMKKKN  338



>gb|EEE60997.1| hypothetical protein OsJ_14806 [Oryza sativa Japonica Group]
Length=345

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 208/333 (62%), Gaps = 4/333 (1%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             MV +QL ++ + +     +  GM+  + +AY+ MFA   L P+A+  ERK RP +T  + 
Sbjct  1     MVSLQLLFSALQVFIKLALNDGMDARVLVAYRFMFAATFLCPIAFLRERKKRPPLTMKVV  60

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
              Q+FL   FG + +Q  Y + +  ++ T  +A++NL PA TF+ A+L RLE++ L+   G
Sbjct  61    LQLFLCGLFGFSINQNLYVLAIKLTSATFITAISNLTPATTFLLAILTRLETLKLKKPAG  120

Query  1006  QAKILGTLICIGGAMLLTLYMGP-VVIGQSTIHWKYAKNTVDKNSSS-SHGNVILGPIMV  833
             QAK+LGTL+ +GGAMLLT Y GP +++     H K+A  T +  S   S GN I+G  + 
Sbjct  121   QAKLLGTLVGMGGAMLLTFYKGPKIMVLDQLPHPKFAHLTENPQSHPISTGNQIIGSFLG  180

Query  832   ILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-TPMR  656
             I+SC +Y+ +L+ QA++SK Y   YS  A+ C     +  ++ALCV  ++  W L   +R
Sbjct  181   IISCFTYATWLVIQAKVSKVYPCHYSIAAMVCLFGALQSTVMALCVHRDMEHWRLGLNIR  240

Query  655   AVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVM  476
               S+ Y GL+ S  A  L SWC+ +KGPL+++VF+PL+L+  A++S   L E ++ G+V+
Sbjct  241   LYSSAYAGLIASGSAFPLLSWCLRKKGPLFISVFSPLMLIFVALMSSIILNEALHLGSVL  300

Query  475   GSILIVVGLYIVLWGKKNELQVINVEDNNKLKE  377
             GS+LIV GLY+VLWGK  E   ++ ED N+ KE
Sbjct  301   GSVLIVGGLYMVLWGKAKEAADLS-EDENQGKE  332



>emb|CAE05944.3| OSJNBb0088C09.3 [Oryza sativa Japonica Group]
 emb|CAH66932.1| H0525E10.16 [Oryza sativa Indica Group]
Length=356

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/344 (40%), Positives = 211/344 (61%), Gaps = 4/344 (1%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             MG      +  MV +QL ++ + +     +  GM+  + +AY+ MFA   L P+A+  ER
Sbjct  1     MGSESGRAVAAMVSLQLLFSALQVFIKLALNDGMDARVLVAYRFMFAATFLCPIAFLRER  60

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
             K RP +T  +  Q+FL   FG + +Q  Y + +  ++ T  +A++NL PA TF+ A+L R
Sbjct  61    KKRPPLTMKVVLQLFLCGLFGFSINQNLYVLAIKLTSATFITAISNLTPATTFLLAILTR  120

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGP-VVIGQSTIHWKYAKNTVDKNSSS-S  866
             LE++ L+   GQAK+LGTL+ +GGAMLLT Y GP +++     H K+A  T +  S   S
Sbjct  121   LETLKLKKPAGQAKLLGTLVGMGGAMLLTFYKGPKIMVLDQLPHPKFAHLTENPQSHPIS  180

Query  865   HGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN  686
              GN I+G  + I+SC +Y+ +L+ QA++SK Y   YS  A+ C     +  ++ALCV  +
Sbjct  181   TGNQIIGSFLGIISCFTYATWLVIQAKVSKVYPCHYSIAAMVCLFGALQSTVMALCVHRD  240

Query  685   VSDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAF  509
             +  W L   +R  S+ Y GL+ S  A  L SWC+ +KGPL+++VF+PL+L+  A++S   
Sbjct  241   MEHWRLGLNIRLYSSAYAGLIASGSAFPLLSWCLRKKGPLFISVFSPLMLIFVALMSSII  300

Query  508   LREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKE  377
             L E ++ G+V+GS+LIV GLY+VLWGK  E   ++ ED N+ KE
Sbjct  301   LNEALHLGSVLGSVLIVGGLYMVLWGKAKEAADLS-EDENQGKE  343



>ref|XP_006399183.1| hypothetical protein EUTSA_v10015938mg [Eutrema salsugineum]
 gb|ESQ40636.1| hypothetical protein EUTSA_v10015938mg [Eutrema salsugineum]
Length=406

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/352 (37%), Positives = 216/352 (61%), Gaps = 9/352 (3%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P F MV +Q GYAG+NI+    +  GM+ ++ + Y+   AT  +AP A+F ERK++PK+T
Sbjct  18    PYFAMVSLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFFERKAQPKIT  77

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               IF Q+F+    G   DQ  Y+VGL  ++PT + A++N++PA+TF+ AVLFR+E + ++
Sbjct  78    FTIFVQLFILGLLGPVIDQNFYYVGLKYTSPTFSCAMSNMLPAMTFILAVLFRMEMLDVK  137

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
                 QAKI GT++ + GAML+T+Y GP+V       +H ++A +T   N+ +   + + G
Sbjct  138   KLWCQAKIAGTVVTVAGAMLMTIYKGPIVELFWTKYMHLQHANDTTSSNNPNDSKDFLKG  197

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSS-TALACFLAIFECLIIALCVDHNVSDWTL  668
              I++IL+  ++++  + QA + K Y     S T L CF+   + +++   ++HN S W +
Sbjct  198   SILLILATLAWASLFVLQANILKTYAKHQISLTTLICFIGTLQAVVVTFAMEHNPSAWRI  257

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                M  ++  Y+G+V S+++  +    +++KGP++   F+PL++V+ AI+    L EKIY
Sbjct  258   GWDMNLLAAAYSGIVASSISYYVQGVVMKKKGPVFATAFSPLMMVIVAIMGSFVLAEKIY  317

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKE-----KDAEKTEAG  350
              G V+G++LIV+GLY VLWGKK E QV+N E +   K      K  E  EA 
Sbjct  318   LGGVIGAVLIVIGLYAVLWGKKKESQVVNCEISEPTKNIGSSCKVTEDVEAN  369



>gb|ABK25095.1| unknown [Picea sitchensis]
Length=392

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/340 (39%), Positives = 214/340 (63%), Gaps = 11/340 (3%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+NI+    +  GMN F+ + Y+   AT+ LAP A+F+ERK RPK+T
Sbjct  10    PYVAMISLQFGYAGMNIITKVSLNRGMNHFVLVVYRHAAATVVLAPFAFFIERKVRPKLT  69

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
              +IF QIF+    G   DQ  Y++GL  ++PT A AL+N++PA+TFV A+LFR+E+V ++
Sbjct  70    FSIFCQIFVLGLLGPVIDQNFYYLGLKLTSPTYACALSNVLPAMTFVIALLFRMENVNIK  129

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPI  839
                 QAKI+GT++C+GGAML+TLY GP+V    + H +  + +    ++  + N I+G +
Sbjct  130   KLRSQAKIVGTIVCVGGAMLMTLYKGPIVKMVWSAHHQSPQTSAA--AAIDNKNWIIGSV  187

Query  838   MVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-P  662
             ++I +  ++S   I QA + K+Y A  S   L CFL   +  +++L V  + S W L   
Sbjct  188   LIIAATLAWSGLFILQAAVLKKYSAQLSLATLICFLGTLQATVLSLAVVRDPSQWALGWD  247

Query  661   MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGT  482
             +  ++  Y+G+V SA+A  +   C+  KGP++   F+PL++++ AI++   L E I+ G+
Sbjct  248   LNLLTAVYSGVVASAIAYYVQGLCMRVKGPVFATAFSPLMMIIVAIMASIILAENIFLGS  307

Query  481   VMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEK  362
             V+G +LIV+GLY VLWGK        V+D+  L +K++ +
Sbjct  308   VLGGVLIVIGLYAVLWGK--------VKDSKILTDKNSTE  339



>dbj|BAF46315.1| nodulin-like protein [Ipomoea nil]
Length=255

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 172/236 (73%), Gaps = 13/236 (6%)
 Frame = -1

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYA-----KNTVDKNSSSSH  863
             +RT  G+AK++GT++C+GGAMLL+ Y G  + IG+S+IHWKYA     +N  +  S+++ 
Sbjct  2     IRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQ  61

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
              N ILGP ++I+S  S++ + I Q R+S++Y APYSSTAL CF++  +C++ A+C DH  
Sbjct  62    PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  121

Query  682   SDWTLTP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             +DW+L   +RA S  Y G+V +ALA CL SWCIE+KGPLYV+VFNPLLLV+ A+LSW  L
Sbjct  122   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  181

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQVINV------EDNNKLKEKDAEKTE  356
             ++KIY GT++GS+LIVVGLY VLWGK+ ELQVI V      E  N+++ K+    E
Sbjct  182   QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  237



>emb|CBI37609.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   253 bits (647),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 213/347 (61%), Gaps = 14/347 (4%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER-KSRPKMTPNI  1190
             MV+ QLG+ GVNI     +  GMN  + IAY+ +FAT  + PLA+ LER KS P++T  I
Sbjct  1     MVVAQLGFGGVNIFYKLAVNDGMNVRVLIAYRFIFATAFICPLAFILERRKSGPRLTWMI  60

Query  1189  FFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKG  1010
               Q FL   FG    Q  Y   L  ++PT ++A+ANLIPA+TF+ A+   LE + +RT  
Sbjct  61    ALQGFLCGLFGGALGQNLYLESLALTSPTFSAAMANLIPAVTFIFALFLGLERLKIRTWA  120

Query  1009  GQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTV---DKNSSSSHG---NVIL  848
             G+AK++GT++ IGGAM+LT Y GP    Q  I W    N +   D++ ++SHG   N +L
Sbjct  121   GRAKVIGTVLGIGGAMVLTFYKGP----QINI-WSTKVNLLKHKDQHVAASHGELDNHVL  175

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             G I+ + SC SY+ +LI QA++ ++Y   YS TAL C  A  + ++ A+C + N S W L
Sbjct  176   GSILAVASCFSYAIWLIIQAKMGERYPFDYSCTALMCASATVQAIVYAMCKEKNWSAWKL  235

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                +R ++  Y G   S   + L SWC+ ++GPL+V++FNPL+LV  AIL    L EK++
Sbjct  236   GWNIRLLTVAYTGFFASGFMVVLVSWCVRKRGPLFVSIFNPLMLVFVAILGSLILDEKLH  295

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAG  350
              G+++G +LIV+GLY +LW K  E++ +    ++K   K+AE    G
Sbjct  296   LGSIIGGVLIVIGLYAMLWAKGAEMKSMATLSHSK-SSKEAEIINVG  341



>gb|EEC77269.1| hypothetical protein OsI_15893 [Oryza sativa Indica Group]
Length=345

 Score =   253 bits (645),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 208/333 (62%), Gaps = 4/333 (1%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             MV +QL ++ + +     +  GM+  + +AY+ MFA   L P+A+  ERK RP +T  + 
Sbjct  1     MVSLQLLFSALQVFIKLALNDGMDARVLVAYRFMFAASFLWPIAFLRERKKRPPLTMKVV  60

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
              Q+FL   FG + +Q  Y + +  ++ T  +A++NL PA TF+ A+L RLE++ L+   G
Sbjct  61    LQLFLCGLFGFSINQNLYVLAIKLTSATYITAISNLTPATTFLLAILTRLETLKLKKPAG  120

Query  1006  QAKILGTLICIGGAMLLTLYMGP-VVIGQSTIHWKYAKNTVDKNSSS-SHGNVILGPIMV  833
             QAK+LGTL+ +GGAMLLT Y GP +++     H K+A  T +  S   S GN I+G  + 
Sbjct  121   QAKLLGTLVGMGGAMLLTFYKGPKIMVLDQLPHPKFAHLTENPQSHPISTGNQIIGSFLG  180

Query  832   ILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-TPMR  656
             I+SC +Y+ +L+ QA++SK Y   YS  A+ C     +  ++ALCV  ++  W L   +R
Sbjct  181   IISCFTYATWLVIQAKVSKVYPCHYSIAAMVCLFGALQSTVMALCVHRDMEHWRLGLNIR  240

Query  655   AVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVM  476
               S+ Y GL+ S  A  L SWC+ +KGPL+++VF+PL+L+  A++S   L E ++ G+V+
Sbjct  241   LYSSAYAGLIASGSAFPLLSWCLRKKGPLFISVFSPLMLIFVALMSSIILNEALHLGSVL  300

Query  475   GSILIVVGLYIVLWGKKNELQVINVEDNNKLKE  377
             GS+LIV GLY+VLWGK  E   ++ ED N+ KE
Sbjct  301   GSVLIVGGLYMVLWGKAKEAADLS-EDENQGKE  332



>ref|XP_008457201.1| PREDICTED: WAT1-related protein At1g25270-like [Cucumis melo]
Length=365

 Score =   253 bits (646),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 212/344 (62%), Gaps = 8/344 (2%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             M +VQ  YAGVN++    +  GMN  I IA++ +FA++ + PLA+FLER  RPKMT +  
Sbjct  1     MALVQSVYAGVNVLYKLAVNDGMNLMILIAFRFLFASLFMLPLAFFLERNKRPKMTWSFL  60

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
             F  F    FG T  Q  Y   L  ++ T  SA+ NL PAITF+ A+ FR+E + ++ K G
Sbjct  61    FYGFFCGLFGGTLSQNLYVQSLAMTSATFVSAMQNLCPAITFLLALSFRMEKLKIKKKEG  120

Query  1006  QAKILGTLICIGGAMLLTLYMG-PVVIGQSTIHWKYAKNT--VDKNSSSSHGNVILGPIM  836
              AK+LGTL+ IGGAM+LT Y G  + I  + +   + +N   +  +S S   N++LG ++
Sbjct  121   VAKVLGTLMGIGGAMILTFYKGFEINIWTTHVDLLHGRNVSHLPPHSHSHSHNLLLGSVL  180

Query  835   VILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-PM  659
              + SC SYS +LI QA++ K Y   YSSTAL C +   + + I++C + +   W L   +
Sbjct  181   ALASCLSYSFWLILQAKMMKIYPCQYSSTALMCVMGAIQGVAISICTERDWKQWKLGWNI  240

Query  658   RAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTV  479
             R ++ T+ G+V +   + +T+WC+  KGPLYV+VF+PL+L++ AI    FL EK++ G+V
Sbjct  241   RLLTVTFAGIVGTGATVTITAWCVRMKGPLYVSVFSPLMLLIVAIAGSLFLDEKLHLGSV  300

Query  478   MGSILIVVGLYIVLWGKKNE----LQVINVEDNNKLKEKDAEKT  359
             +G++LIV GLY+VLWGK  E    LQ+   E   +L  KD   T
Sbjct  301   VGAMLIVCGLYMVLWGKSKEMNKCLQLTPSESIGQLALKDVAVT  344



>ref|XP_008457270.1| PREDICTED: WAT1-related protein At1g25270-like [Cucumis melo]
Length=392

 Score =   254 bits (648),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 145/332 (44%), Positives = 209/332 (63%), Gaps = 9/332 (3%)
 Frame = -1

Query  1381  LPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKM  1202
             LP  VM++VQ G+AGVNI        GM+  I IAY+ +FA+  + P+A+FLER  RPK+
Sbjct  10    LPTIVMILVQFGFAGVNICYKLAAADGMSFRIIIAYRFLFASAFILPIAFFLERGRRPKL  69

Query  1201  TPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGL  1022
             T ++ F  FL   FG +  Q  Y   L  ++ T ASA+ NL+PAITF+ AV FRLE + +
Sbjct  70    TWSVIFYAFLCGLFGGSLSQNLYVESLALTSATYASAIGNLVPAITFILAVSFRLERMNI  129

Query  1021  RTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQST----IHWKYAKNTVDKNSSSSHG--  860
              T  G+AK++GTLI IGGAM+LT Y G  +   ST    +H   A N+    +   H   
Sbjct  130   GTMRGKAKVMGTLIGIGGAMILTFYKGVELHPWSTRVDLLH--KAHNSTGHAAPPEHKIH  187

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             + +LG +M + SC SY+ +LI QA++S+ Y   YSSTAL C +   + +  ALCV+   S
Sbjct  188   SQVLGSVMGVGSCFSYALWLIVQAKMSECYPCHYSSTALMCMMGSVQAVGFALCVETQWS  247

Query  679   DWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W L   +R  S  Y G+V S + + L +WC+  +GP++V+VF+PL+L+L AI +  FL+
Sbjct  248   RWKLGWNIRLFSVAYTGIVASGVMVTLITWCVRMRGPMFVSVFSPLILLLVAIAASLFLQ  307

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVI  407
             EK+Y G V+G +L+V GLY+VLWGK  E++ I
Sbjct  308   EKLYIGCVVGGMLMVCGLYMVLWGKSKEIRKI  339



>ref|XP_006846485.1| hypothetical protein AMTR_s00018p00139030 [Amborella trichopoda]
 gb|ERN08160.1| hypothetical protein AMTR_s00018p00139030 [Amborella trichopoda]
Length=349

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/349 (40%), Positives = 211/349 (60%), Gaps = 15/349 (4%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P  +M+ +QL Y   +IV+   M  GM+  + I Y+ + +T+ L+P A++LERK+RP +T
Sbjct  6     PYAMMIFLQLAYGTADIVSKGAMERGMSYHVFIMYRHVVSTLVLSPFAFYLERKTRPSLT  65

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               IFF++FL A  G T  Q AYF GL  S+PTV  A+ N+ PAITF+ A++FR+ESV ++
Sbjct  66    RPIFFKLFLLALCGFTATQNAYFAGLMYSSPTVVGAMNNICPAITFILAMIFRMESVKIK  125

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMG----PVVIGQSTIHWKYAKNTVDKNSSSSHG--N  857
             +  GQAK+LGT ICIGGAML   Y G    P+ I    IH      + +    + H   +
Sbjct  126   SPRGQAKLLGTSICIGGAMLFAFYKGHLFPPLKIPFINIH------SYNSAGGTEHAKPD  179

Query  856   VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSD  677
              + G  + I++   +S FLI Q  + K Y AP S  A   FLA+ +   +A+  D   S 
Sbjct  180   WVKGSSIAIVATSCWSVFLILQNSVYKLYPAPLSMNAWISFLAVMQSAAVAVIFDRTASP  239

Query  676   WTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W +   +  +S  Y G++ SA+   L +WCI ++GP++VA+F PL L++ AIL+  F +E
Sbjct  240   WKIGWNLELLSYVYYGILVSAVGYSLQAWCIAKRGPVFVALFFPLQLIIAAILTALFFKE  299

Query  499   KIYTGTVMGSILIVVGLYIVLWGK-KNELQVINVEDNNKLKEKDAEKTE  356
             +++ G+V+G+ILI+VG Y V+WGK K++     VE+ N++   D EK  
Sbjct  300   RLHLGSVVGAILIIVGFYCVMWGKSKDDKNDEKVEEKNEMIA-DVEKAS  347



>ref|XP_004249118.1| PREDICTED: WAT1-related protein At5g07050 [Solanum lycopersicum]
Length=383

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/330 (39%), Positives = 207/330 (63%), Gaps = 6/330 (2%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+N++    +  GM+ ++ + Y+  FAT+A+AP A  LERK RPKMT
Sbjct  20    PYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATLAIAPFALLLERKLRPKMT  79

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +FFQIF+    G   DQ  Y+ GL  ++PT + A++N++PA+TFV AVL R+E V ++
Sbjct  80    FMMFFQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVHIK  139

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
                 QAK++GT++ + GAML+TLY G V+  +  + IH     N V +++ +S  + + G
Sbjct  140   KLRCQAKVIGTIVTVAGAMLMTLYKGHVINLVWSNNIH---TNNNVSQSNETSDKDWLKG  196

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
              I++I +  ++++F I QA   K+Y AP S T L CF+   + + + L ++H  S W + 
Sbjct  197   SILLIGATFAWASFFILQAITMKKYTAPLSLTTLVCFMGTLQSIAVTLVMEHKPSAWAVG  256

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               M  ++  Y G+V S+LA  +    +E++GP++V  F+PL++++ AI+    L EKIY 
Sbjct  257   FDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYL  316

Query  487   GTVMGSILIVVGLYIVLWGKKNELQVINVE  398
             G V+G++LIV GLY VLWGK  E Q   +E
Sbjct  317   GGVLGAVLIVAGLYSVLWGKYKEYQEKEIE  346



>dbj|BAK02715.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/367 (37%), Positives = 214/367 (58%), Gaps = 18/367 (5%)
 Frame = -1

Query  1396  GCSDLL----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYF  1229
             G  DL     P   M+ +Q GYAG+N++    +  GM+ ++ + Y+ +FAT+++AP A  
Sbjct  7     GYGDLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHVFATVSIAPFALI  66

Query  1228  LERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAV  1049
             LERK RPKMT + F QIF+ A  G   DQ  Y+VGL  + PT A A++N++PA+TFV A 
Sbjct  67    LERKVRPKMTWSSFLQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAF  126

Query  1048  LFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSS  869
             +FR+E V LR    QAK+ GT++ + GAML+TLY GP++    T H +   N  +  +  
Sbjct  127   IFRMEKVDLRKVRCQAKVAGTVVTVAGAMLMTLYKGPLMRMAWTNHGQ--ANGGEAPAID  184

Query  868   SHGNV-ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVD  692
               G    LG + +I++  ++++  I QA   KQY AP S T L CF+   + +++   ++
Sbjct  185   PTGREWFLGSLFIIIATLAWASLFILQAHTLKQYSAPLSLTTLICFVGTLQAIVVTFAME  244

Query  691   HNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSW  515
             H  S WT+   M  ++  Y G+V S++A  +    I++ GP++ + F+PL++++ A++  
Sbjct  245   HRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIVVAVMGS  304

Query  514   AFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQV----------INVEDNNKLKEKDAE  365
               L EKIY G ++GS+LIV+GLY VLWGK  E Q           + +  +N   E DA 
Sbjct  305   FILSEKIYLGGILGSVLIVIGLYSVLWGKHKETQAESAALREALPMAMASSNSKGEGDAV  364

Query  364   KTEAGEC  344
             +    EC
Sbjct  365   QGHDPEC  371



>ref|XP_003572196.1| PREDICTED: WAT1-related protein At1g09380-like [Brachypodium 
distachyon]
Length=329

 Score =   249 bits (636),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/331 (37%), Positives = 221/331 (67%), Gaps = 5/331 (2%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             MGC   +P   M++VQ+G+AG+N+++   +  GM+P++ + Y+ + A + L+P A + ER
Sbjct  1     MGC---MPTVAMLLVQIGFAGMNLLSKMALDNGMSPYVLVTYRSLIAAVFLSPFAVYFER  57

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
                  MT  +  QIFL+++ G+T  ++ +F G   ++ TVA A+ N++PA+TFV A   +
Sbjct  58    NMWILMTKKVIIQIFLSSSLGMTLSEVLFFTGFRWTSATVAVAIGNIVPALTFVIAAALK  117

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSH  863
             +E+V L+T  GQAK++GT +C+GG+M++ +Y GP++ +  S IHW+YA++     ++ + 
Sbjct  118   METVQLKTAAGQAKVMGTAVCVGGSMIMPIYKGPLLKVWASPIHWRYAEHAAAAAAAPTP  177

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
              +  LG +++ILSC S++A+L+   + S+ + APY+S+ +   +   E   ++  VD ++
Sbjct  178   ASAALGDVLIILSCVSWAAWLVMTNKTSESFSAPYTSSTIMSLIVGAESAAVSAAVDRSL  237

Query  682   SDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
               W L   +R  S  Y G++   +   + +WC++ +GPL+V++FNP++LV+ A+L WAFL
Sbjct  238   WAWKLGLGIRLYSVLYMGIIGWGVTFAVMTWCVQTRGPLFVSMFNPVVLVVVALLGWAFL  297

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQ  413
              E+++ G+V+G++LIVVGLY+VLWGK+ E+ 
Sbjct  298   DEQLHLGSVIGAVLIVVGLYMVLWGKRKEID  328



>ref|XP_006644860.1| PREDICTED: WAT1-related protein At5g07050-like [Oryza brachyantha]
Length=394

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/327 (39%), Positives = 200/327 (61%), Gaps = 5/327 (2%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P F M+ +Q GYAG+N++    +  GM+ ++ + Y+  FATI++AP A  LERK RPKMT
Sbjct  13    PYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALLLERKVRPKMT  72

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
              ++F QIF+ A  G   DQ  Y+ GL  + PT A A++N++PA+TFV AV+FR+E V L+
Sbjct  73    WSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAVIFRMEKVDLK  132

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV----IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
                 QAK+ GTL+ + GAM++TLY GP++       +  H   A+  V      S     
Sbjct  133   KVRCQAKVAGTLVTVAGAMMMTLYKGPLMQMAWTSHAQPHGHGAEAPVAAAIDPSGREWF  192

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LG + VI++  ++++  I QA   KQY AP S T L CF+   + +++   ++H  S WT
Sbjct  193   LGSLFVIIATLAWASLFILQAHTLKQYSAPLSLTTLICFVGTLQAIVVTFAMEHRPSVWT  252

Query  670   LT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             +   M  ++  Y G+V S++A  +    I++ GP++ + F+PL++++ A +    L EKI
Sbjct  253   IGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAGMGSFILAEKI  312

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQ  413
             Y G V+G++LIV+GLY VLWGK  E Q
Sbjct  313   YLGGVLGAVLIVIGLYSVLWGKHKETQ  339



>gb|KFK25097.1| hypothetical protein AALP_AA8G066000 [Arabis alpina]
Length=406

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/372 (35%), Positives = 225/372 (60%), Gaps = 17/372 (5%)
 Frame = -1

Query  1396  GCSDLL----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYF  1229
             GC   L    P F M+ +Q GYAG+NI+    +  GM+ ++ + Y+   AT  +AP A+F
Sbjct  8     GCDSFLKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFF  67

Query  1228  LERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAV  1049
              ERK++PK+T  IF Q+F+    G   DQ  Y+VGL  ++PT + A++N++PA+TF+ AV
Sbjct  68    FERKAQPKITFTIFVQLFILGLLGPVIDQNFYYVGLKYTSPTFSCAMSNMLPAMTFILAV  127

Query  1048  LFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWKYAKNTVDKNS  875
             +FR+E + ++    QAKI+GT++ + GAML+T+Y GP+V       +H + + +  + ++
Sbjct  128   IFRMEMLDVKKLWCQAKIIGTVVTVAGAMLMTIYKGPIVELFWTKYLHLQDSSHANESSN  187

Query  874   SSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGA-PYSSTALACFLAIFECLIIALC  698
             ++S  + + G I++IL+  ++++  + QAR+ K Y     S T L CF+   + + +   
Sbjct  188   NTSDKDFLKGSILLILATLAWASLFVLQARILKTYAKHQLSLTTLVCFIGTLQAIAVTFV  247

Query  697   VDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAIL  521
             ++HN S W +   M  ++  Y+G+V S++A  +    ++++GP++   F+PL++V+ A++
Sbjct  248   MEHNPSAWRIGWDMNLLAAAYSGIVASSIAYYVQGIVMKKRGPVFATAFSPLMMVIVAVM  307

Query  520   SWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVE-------DN--NKLKEKDA  368
                 L EKI+ G V+G++LIV+GLY VLWGKK E QV N E       D+  +K+  +D 
Sbjct  308   GSFVLAEKIFLGGVIGAVLIVIGLYAVLWGKKKENQVTNCEILVPIKIDSSVSKVTHEDV  367

Query  367   EKTEAGEC*LSN  332
             E     E  +S 
Sbjct  368   EANNGIEMNISK  379



>ref|XP_006364778.1| PREDICTED: WAT1-related protein At5g07050-like [Solanum tuberosum]
Length=382

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 206/330 (62%), Gaps = 7/330 (2%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+N++    +  GM+ ++ + Y+  FAT+A+AP A  LERK RPKMT
Sbjct  20    PYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATLAIAPFALLLERKLRPKMT  79

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +F QIF+    G   DQ  Y+ GL  ++PT + A++N++PA+TFV AVL R+E V ++
Sbjct  80    FMMFLQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVHIK  139

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNT--VDKNSSSSHGNVILG  845
                 QAK++GT++ + GAML+TLY G V+     + W    NT  V +++ +S  + + G
Sbjct  140   KLRCQAKVIGTIVTVAGAMLMTLYKGHVI----NLVWANTNNTSNVSQSNETSDKDWLKG  195

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
              I++I +  ++++F I QA   ++Y AP S TAL CF+   + + + L ++H  S W + 
Sbjct  196   SILLIGATFAWASFFILQAITMRKYTAPLSLTALVCFMGTLQSIAVTLVMEHKPSAWAIG  255

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               M  ++  Y G+V S+LA  +    +E++GP++V  F+PL++++ AI+    L EKIY 
Sbjct  256   FDMNLLAAVYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYL  315

Query  487   GTVMGSILIVVGLYIVLWGKKNELQVINVE  398
             G V+G++LIV GLY VLWGK  E Q   +E
Sbjct  316   GGVLGAVLIVAGLYSVLWGKYKEYQEKEIE  345



>ref|XP_010941182.1| PREDICTED: WAT1-related protein At3g30340-like [Elaeis guineensis]
Length=350

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 204/344 (59%), Gaps = 2/344 (1%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
             C +  P+FVM+ V++ YA +N V       GMN  I I  +Q+ AT+ +AP+AYF ERK+
Sbjct  4     CEEWKPIFVMLAVEVAYAAMNTVIKTATDEGMNGLIFITLRQLIATLFMAPVAYFRERKT  63

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
             RPK+T  I   +F +A FG +  Q  +F GL N+T T A A  N++P +TF+ A+ FRLE
Sbjct  64    RPKLTTEIIVYLFFSAMFGTSLTQYLFFFGLRNTTATFACAFLNMVPVLTFLIALPFRLE  123

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNV  854
             ++ ++T+ G AK+LGT+IC+ GA LLT Y G V +  +T     +K     N+S S    
Sbjct  124   TLNVKTRAGIAKLLGTIICLVGATLLTFYKG-VALTNTTHQSSVSKQQGRYNASYSTKQW  182

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             ++G +  +  C S+S++ + Q+++ K+Y A YS + L  FL   +  +++L    + S W
Sbjct  183   MMGSMAYLAGCLSWSSWFLLQSKVGKKYPALYSGSFLIFFLGFLQGAVLSLATQKSFSVW  242

Query  673   TL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +  ++   +G+  S       SWC+E++GP++ A F PLL +L A + ++ L E 
Sbjct  243   VLKKKVEIITVIVSGIAGSGFCFLAMSWCVEKRGPVFTAAFTPLLQILVAGIDFSILHEP  302

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAE  365
             +Y G+V+GS+L++ GLY +LWGK+ E Q    +   + +E   +
Sbjct  303   LYLGSVLGSVLVIPGLYFLLWGKRKEAQSSAAKTTEENEEHQVQ  346



>emb|CDM84603.1| unnamed protein product [Triticum aestivum]
Length=387

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 206/345 (60%), Gaps = 10/345 (3%)
 Frame = -1

Query  1396  GCSDLL----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYF  1229
             G  DL     P   M+ +Q GYAG+N++    +  GM+ ++ + Y+  FAT+++AP A  
Sbjct  3     GYGDLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATVSIAPFALI  62

Query  1228  LERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAV  1049
              ERK RPKMT + F QIF+ A  G   DQ  Y+VGL  + PT A A++N++PA+TFV A 
Sbjct  63    FERKVRPKMTWSSFLQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAF  122

Query  1048  LFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSS  869
             +FR+E V LR    QAK+ GT++ + GAML+TLY GP++    T H +      D     
Sbjct  123   IFRMEKVDLRKVRCQAKVAGTVVTVAGAMLMTLYKGPLIRMAWTSHGQ-PHGGEDPAVDP  181

Query  868   SHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH  689
             +     LG + +I++  ++++  I QA   KQY AP S T L CF+   + +++ L ++H
Sbjct  182   TGREWFLGSLFIIIATLAWASLFILQAHTLKQYSAPLSLTTLICFVGTLQAIVVTLAMEH  241

Query  688   NVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWA  512
               S WT+   M  ++  Y G+V S++A  +    I++ GP++ + F+PL++++ A++   
Sbjct  242   RPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIVVAVMGSF  301

Query  511   FLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKE  377
              L EKIY G V+GS+LIV+GLY VLWGK  E Q     ++  L+E
Sbjct  302   ILSEKIYLGGVLGSVLIVIGLYSVLWGKHKETQA----ESAALRE  342



>gb|EMT31802.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=387

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 133/345 (39%), Positives = 207/345 (60%), Gaps = 10/345 (3%)
 Frame = -1

Query  1396  GCSDLL----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYF  1229
             G  DL     P   M+ +Q GYAG+N++    +  GM+ ++ + Y+  FAT+++AP A  
Sbjct  3     GYGDLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATVSIAPFALI  62

Query  1228  LERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAV  1049
             LERK RPKMT + F QIF+ A  G   DQ  Y+VGL  + PT A A++N++PA+TFV A 
Sbjct  63    LERKVRPKMTWSSFLQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAF  122

Query  1048  LFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSS  869
             +FR+E V LR    QAK+ GT++ + GAML+TLY GP++    T H + A          
Sbjct  123   IFRMEKVDLRNLRCQAKVAGTVVTVAGAMLMTLYKGPLMRRAWTSHGQ-AHGGEAPAVDP  181

Query  868   SHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH  689
             +     LG + +I++  ++++  I QA   KQY AP S T L CF+   + +++ L ++H
Sbjct  182   TGREWFLGSLFIIIATLAWASLFILQAHTLKQYSAPLSLTTLICFVGTLQAIVVTLAMEH  241

Query  688   NVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWA  512
               S WT+   M  ++  Y G+V S++A  +    I++ GP++ + F+PL++++ A++   
Sbjct  242   RPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIVVAVMGSF  301

Query  511   FLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKE  377
              L EKIY G V+GS+LIV+GLY VLWGK  E Q     ++  L+E
Sbjct  302   ILSEKIYLGGVLGSVLIVIGLYSVLWGKHKETQA----ESAALRE  342



>ref|XP_007041588.1| Mtn21-like protein, putative isoform 2 [Theobroma cacao]
 gb|EOX97419.1| Mtn21-like protein, putative isoform 2 [Theobroma cacao]
Length=374

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 139/353 (39%), Positives = 206/353 (58%), Gaps = 10/353 (3%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
               L P  VMV+VQ  +AG+N++       GM+  I  AY+ +FA   + PLA  +ERK R
Sbjct  9     QGLKPAMVMVVVQTTFAGMNLLYKLAANDGMSLRIITAYRFVFAVPVMVPLALLVERK-R  67

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T  I FQ FL   FG    Q  Y   L  ++ T  SA+ NLIP  TF+ AV  R+E 
Sbjct  68    PKLTWAILFQAFLCGLFGGALSQNLYIASLALTSATFVSAMTNLIPVTTFILAVFLRMEK  127

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQST----IHWKYAKNTVDKNSSSSH  863
             +   T  G+AK+LGTLI IGGAMLLT Y G  +   ST    +H  +  +    +S+S+H
Sbjct  128   LAFGTMAGKAKVLGTLIGIGGAMLLTFYKGVQIKMWSTHIDLVH--HGGHGASSHSASAH  185

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
               ++ G ++   SC +Y+ +LI QA++SK+Y  PYS+TAL C +   + ++ ALC + + 
Sbjct  186   --ILWGALLAFTSCITYTLWLIVQAKMSKKYPCPYSTTALMCVMGAIQSIVYALCTERDW  243

Query  682   SDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             S W L   +R ++  Y G+V S L   +  WC+  KGPLY ++FNPL++VL A+    FL
Sbjct  244   SQWKLGWNVRLLTVAYAGIVVSGLTCVMVCWCVRIKGPLYGSIFNPLMVVLVALAETLFL  303

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
               K+Y G+++G++LIV+GLY+VLWGK  E++ +          +     E+ E
Sbjct  304   GAKLYLGSILGAVLIVLGLYVVLWGKGKEMEKVAAPSKEGPSTRSLPGDESIE  356



>ref|XP_004139017.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN61512.1| hypothetical protein Csa_2G151030 [Cucumis sativus]
Length=392

 Score =   249 bits (637),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 144/332 (43%), Positives = 209/332 (63%), Gaps = 9/332 (3%)
 Frame = -1

Query  1381  LPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKM  1202
             LP  VM++VQ G+AGVNI        GM+  I IAY+ +FA+  + P+A+FLER  RPK+
Sbjct  10    LPTIVMMLVQFGFAGVNIFYKLAAADGMSFRIIIAYRFLFASAFILPIAFFLERGRRPKL  69

Query  1201  TPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGL  1022
             T ++ F  FL   FG +  Q  Y   L  ++ T ASA+ NL PAITF+ AV FRLE + +
Sbjct  70    TWSVIFYAFLCGLFGGSLSQNLYVESLALTSATYASAIGNLAPAITFILAVSFRLERMNI  129

Query  1021  RTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQST----IHWKYAKNTVDKNSSSSH--G  860
              T  G+AK++GTLI I GAM+LT Y G  +   ST    +H     N+ +  + + H   
Sbjct  130   GTMRGKAKVMGTLIGIVGAMILTFYKGVELHPWSTRVDLLH--KGHNSTEHVAPTEHTIH  187

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             + +LG +M + SC SY+ +LI QA++S+ Y   YSSTAL C +   + +  ALCV+   S
Sbjct  188   SHVLGSVMGVGSCFSYALWLIVQAKMSECYPCHYSSTALMCMMGSVQAVGFALCVETQWS  247

Query  679   DWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W L   +R +S  Y G+V S + + L +WC+  +GP++V+VF+PL+LVL AI +  FL+
Sbjct  248   RWKLGWNIRLLSVAYTGIVASGVMVTLITWCVRIRGPMFVSVFSPLILVLVAIAASLFLQ  307

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVI  407
             EK+Y G V+G +L+V GLY+VLWGK  E++ I
Sbjct  308   EKLYLGCVVGGMLMVCGLYMVLWGKSKEIRKI  339



>ref|XP_008342773.1| PREDICTED: WAT1-related protein At1g25270-like [Malus domestica]
Length=396

 Score =   249 bits (637),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 135/349 (39%), Positives = 210/349 (60%), Gaps = 7/349 (2%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P+ +M++VQ  Y G+NI    V   GM+  + +AY+ MF+   + PLA   ERKSRPK
Sbjct  16    LKPVLMMLVVQTAYTGMNIFYKLVAEVGMSLTVLVAYRNMFSAALMLPLALICERKSRPK  75

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T +I  Q FL+   G T  Q  Y   L  ++ T  +A  NL+P IT + AV FRLES+ 
Sbjct  76    LTLDILLQGFLSGLLGATMAQNFYIESLALTSTTYVAACNNLVPVITLIIAVCFRLESLA  135

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNS--SSSHGNV-  854
             L T  G+AK++GTL+CIGG ML T Y G  +   ST H+   +N + ++S  +S H N  
Sbjct  136   LGTHAGRAKVVGTLVCIGGTMLFTFYKGKPIAMWST-HFNLLRNCLHESSHVASLHKNTH  194

Query  853   --ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
               +LG  + + S  S++ +LI Q +++K Y   YSSTAL   +A  + ++ ALC + + +
Sbjct  195   TQLLGSFLALCSSTSFACWLIFQTKMTKXYPCHYSSTALMSLMASIQSVVFALCKERDWN  254

Query  679   DWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W L   +R ++  Y G+V + L + LT+WC+  +GPL+V+VFNPL L+L A  +   L 
Sbjct  255   QWKLGWDIRLLAALYTGVVTTGLVVTLTAWCVRMRGPLFVSVFNPLCLLLIAFAAPLLLN  314

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTE  356
             EK+Y G+++G +L+V GLY VLWGK  E++++       L+++ +   +
Sbjct  315   EKLYLGSILGGLLVVCGLYTVLWGKSKEMKMMTQLPQPPLQDQHSHSID  363



>gb|AES63368.2| auxin-induced 5NG4-like protein [Medicago truncatula]
Length=394

 Score =   249 bits (635),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 137/329 (42%), Positives = 208/329 (63%), Gaps = 3/329 (1%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P  +MV+VQ+ +AGVN++    +  GM+  I +AY+ +FAT  +AP+A+ LERK R K
Sbjct  14    LKPTLLMVMVQIAFAGVNVLYKLAVNDGMSLRIVVAYRFIFATAFIAPIAFILERKKRAK  73

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             MT  I FQ FL   FG +  Q  Y   L  ++ T ASA+ANLIPA+TF+ AV   +E + 
Sbjct  74    MTWTILFQSFLCGLFGGSLAQNFYLQALTLTSATFASAMANLIPAVTFIMAVSLGMEKLN  133

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIHWKYAKNTVDKNSSSSHGNVIL  848
             LRTK G+AKILGTL  IGGAM+LT   G  + +G   ++  + +N V  ++ S+  N I 
Sbjct  134   LRTKAGKAKILGTLTGIGGAMVLTFVKGVEIKMGSFHLNLLHHQNGVVTHTIST-ANTIS  192

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             G +  + S  SY+ +LI Q ++S++Y   YSSTAL  F A    +++ALC + ++S W L
Sbjct  193   GSLCALASSISYALWLIIQTKMSERYPTHYSSTALISFWASLVSIVLALCFERDLSQWKL  252

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                +R ++  Y G+V S   + + SWC+  +GPL+ +VF PL+L++ A+     L EK++
Sbjct  253   GWNIRLLTVAYAGIVVSGAMVAVISWCVHMRGPLFASVFTPLMLLMVALAGCTILNEKLH  312

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVIN  404
              G+++G++LIV GLY V+WGK  E++  N
Sbjct  313   LGSIIGAVLIVCGLYAVVWGKSKEMKKKN  341



>ref|XP_003593117.1| Auxin-induced protein 5NG4 [Medicago truncatula]
Length=392

 Score =   249 bits (635),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 137/329 (42%), Positives = 208/329 (63%), Gaps = 3/329 (1%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P  +MV+VQ+ +AGVN++    +  GM+  I +AY+ +FAT  +AP+A+ LERK R K
Sbjct  12    LKPTLLMVMVQIAFAGVNVLYKLAVNDGMSLRIVVAYRFIFATAFIAPIAFILERKKRAK  71

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             MT  I FQ FL   FG +  Q  Y   L  ++ T ASA+ANLIPA+TF+ AV   +E + 
Sbjct  72    MTWTILFQSFLCGLFGGSLAQNFYLQALTLTSATFASAMANLIPAVTFIMAVSLGMEKLN  131

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIHWKYAKNTVDKNSSSSHGNVIL  848
             LRTK G+AKILGTL  IGGAM+LT   G  + +G   ++  + +N V  ++ S+  N I 
Sbjct  132   LRTKAGKAKILGTLTGIGGAMVLTFVKGVEIKMGSFHLNLLHHQNGVVTHTIST-ANTIS  190

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             G +  + S  SY+ +LI Q ++S++Y   YSSTAL  F A    +++ALC + ++S W L
Sbjct  191   GSLCALASSISYALWLIIQTKMSERYPTHYSSTALISFWASLVSIVLALCFERDLSQWKL  250

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                +R ++  Y G+V S   + + SWC+  +GPL+ +VF PL+L++ A+     L EK++
Sbjct  251   GWNIRLLTVAYAGIVVSGAMVAVISWCVHMRGPLFASVFTPLMLLMVALAGCTILNEKLH  310

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVIN  404
              G+++G++LIV GLY V+WGK  E++  N
Sbjct  311   LGSIIGAVLIVCGLYAVVWGKSKEMKKKN  339



>ref|XP_004959978.1| PREDICTED: WAT1-related protein At1g25270-like [Setaria italica]
Length=401

 Score =   249 bits (636),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 137/328 (42%), Positives = 211/328 (64%), Gaps = 8/328 (2%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P+  MV+VQ+ +AGVNI     +  GM+  + +AY+ +FA+  LAPLAYF+ER++R K+T
Sbjct  13    PVAAMVLVQVIFAGVNIFYKLAVCDGMDMRVLVAYRYLFASAFLAPLAYFIERRNRTKLT  72

Query  1198  PNIFFQIFLTATFGLTGDQIA---YFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
               +   + L+   GLTG  +A   Y  G+  ++ T ASA  NLIPA TFV A++FR E +
Sbjct  73    WRV---VVLSFICGLTGGSLAQNLYISGMKLTSATFASATTNLIPAATFVLALIFRYERL  129

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIG-QSTIHWKYAKNTVDKNSSSSHGNVI  851
              +RT  GQAK+ GTL+ +GGAMLLT Y G  V    S+++    ++       +   N +
Sbjct  130   AIRTFSGQAKLAGTLLGVGGAMLLTFYKGADVTPWHSSVNLVAHQHRQQLEVVAEATNRV  189

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             +G ++ I SC  Y+ +LI QA+LSK+Y   YSSTAL C ++  + +  ALC D +   W 
Sbjct  190   MGSLLCISSCFFYAIWLILQAKLSKEYPFHYSSTALMCAMSTLQSVAFALCYDRDPGQWR  249

Query  670   LT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L   +R +S  Y+G++ S + + + SWC++R+GPL+ +VFNPL+L++ A+LS   L EK+
Sbjct  250   LGFDVRLLSVVYSGVLASGVMLVVLSWCVKRRGPLFASVFNPLMLLVVAVLSSLLLGEKL  309

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQV  410
             + G+ +G++LIV+GLY VLWGK  E ++
Sbjct  310   HLGSALGAVLIVMGLYAVLWGKGRETEL  337



>gb|KHN43349.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=251

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 167/232 (72%), Gaps = 5/232 (2%)
 Frame = -1

Query  1048  LFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSS  872
             + R E++G++ + G AK+ GT++C+ GA+LL+ Y G  + +GQS+IHW+YA+  ++  SS
Sbjct  1     MVRQENLGIKKRAGLAKVFGTILCVSGALLLSFYHGKTIGLGQSSIHWRYAEK-MEGTSS  59

Query  871   SSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVD  692
             S  GN+ LGP++VILS   ++A+ I Q  +SK + APY+ST L CF+A F+C+IIA+CVD
Sbjct  60    SGKGNMFLGPLVVILSTLVWAAWFIIQKDISKTFPAPYTSTGLMCFMASFQCIIIAVCVD  119

Query  691   HNVSDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSW  515
             H  S W+L   MR  S  Y G+  + LA CL SW IERKGPLYV+VF PL LVLTAILSW
Sbjct  120   HTASAWSLHNAMRLSSALYAGIFCTGLAYCLMSWTIERKGPLYVSVFTPLQLVLTAILSW  179

Query  514   AFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKE--KDAE  365
             A LREK+Y GT +GS+LIV+GLY VLWGK  E+   +  + + +KE  KD++
Sbjct  180   ALLREKLYVGTAVGSLLIVLGLYSVLWGKSEEVNKGDGIEEDAVKEAVKDSK  231



>ref|XP_010103862.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB97303.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=455

 Score =   250 bits (639),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 136/324 (42%), Positives = 205/324 (63%), Gaps = 7/324 (2%)
 Frame = -1

Query  1360  IVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIFFQ  1181
             +VQ  + GVN++       GMN  + +AY+ +FAT  + PLA F+ERKSR K+T  I FQ
Sbjct  74    LVQFVFTGVNVLYKLAANDGMNLKVIVAYRLVFATAFILPLALFIERKSRRKLTWTILFQ  133

Query  1180  IFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGGQA  1001
              FL   FG +  Q  Y   L  ++ T+ASA+ NLIPAITF  AV+FRLE +   T GG+A
Sbjct  134   AFLCGLFGASLPQNLYLESLVLTSATLASAMTNLIPAITFFLAVIFRLEKLNFGTPGGKA  193

Query  1000  KILGTLICIGGAMLLTLYMGPVVIGQST----IHWKYAKNTV--DKNSSSSHGNVILGPI  839
             K+LG+L+ +GGA++LT Y G  +   ST    +H  +  N +    ++++  GN +LG +
Sbjct  194   KVLGSLLGVGGALILTFYKGVDINIWSTHVDLLHRDHHHNNMASSHDAAAGSGNHVLGCL  253

Query  838   MVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-P  662
             + + S   +S + I QA++S++Y   YSSTAL   +A  + +I ALC + + S W L   
Sbjct  254   LAVASSACFSVWFILQAKMSEKYPCYYSSTALMSIMATIQTIIFALCTERDWSQWKLGWN  313

Query  661   MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGT  482
             +R ++  Y+G V S L + L +WC+++KGPLY +VFNPL+LVL  I+    L EK++ G+
Sbjct  314   IRLLTVAYSGTVASGLMMTLIAWCVQKKGPLYASVFNPLMLVLVTIVGSLVLNEKLHLGS  373

Query  481   VMGSILIVVGLYIVLWGKKNELQV  410
             V+ ++LIV GLY VLWGK  E+++
Sbjct  374   VLAAVLIVFGLYFVLWGKGKEMKM  397



>ref|XP_010068190.1| PREDICTED: WAT1-related protein At1g68170-like [Eucalyptus grandis]
Length=392

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/329 (43%), Positives = 205/329 (62%), Gaps = 11/329 (3%)
 Frame = -1

Query  1372  FVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPN  1193
              +MV+VQ+ +AGVNI+       GMN  + IAY+ MFAT  LAPLA+FLERKSRPK+T  
Sbjct  5     LMMVVVQVAFAGVNILYKLAASDGMNLSVVIAYRFMFATALLAPLAFFLERKSRPKITWT  64

Query  1192  IFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTK  1013
             +  Q F    FG +  Q  Y   L+ ++ T ASA+ANL+PA+TFV AV    E V +RT 
Sbjct  65    VLVQAFFCGLFGGSMGQNLYLASLSMTSATYASAMANLVPAVTFVLAVFLGFEKVRVRTV  124

Query  1012  GGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGN-----VIL  848
              G+AK  GTL+ IGGAMLLT Y G  V       W    N +   +++  G      ++L
Sbjct  125   AGKAKAAGTLMGIGGAMLLTFYKGAEV-----NLWSTHVNLLRHVAATQRGQEGSSDLLL  179

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             G ++ + SC  Y+++LI QA++S+ +   Y+STAL  F+   +  + ALC + + S W L
Sbjct  180   GSLLAVASCFCYASWLIIQAKMSEGFPHQYTSTALMTFMGSIQAAVYALCRERDWSQWKL  239

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                +R ++ +Y+G+V SAL   L +WC+  +GP++V++FNPL+LV  A+     L EK++
Sbjct  240   GWNIRLLTVSYSGIVASALCYTLIAWCVRMRGPVFVSIFNPLMLVTVALAGSMVLDEKLH  299

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVIN  404
              G+++GS LIV+GLY VLWGK+ E +  N
Sbjct  300   MGSILGSGLIVLGLYAVLWGKRKEDKKTN  328



>ref|XP_006844156.1| hypothetical protein AMTR_s00006p00261210 [Amborella trichopoda]
 gb|ERN05831.1| hypothetical protein AMTR_s00006p00261210 [Amborella trichopoda]
Length=352

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/350 (39%), Positives = 209/350 (60%), Gaps = 13/350 (4%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P  VM+ +QL  A  +I++   +  GM+  + I Y+ + + + L+P AYFL+RK+RP +T
Sbjct  6     PYMVMIGLQLVIAIADIMSKGALERGMSFHVFIVYRLIVSILLLSPFAYFLDRKTRPSLT  65

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +FF++FL A  G+TG Q AYF GL  S+PTV  A+ NL PAITF+ A+LFR+E V +R
Sbjct  66    RPVFFKLFLLALCGITGTQHAYFAGLMYSSPTVVGAMNNLCPAITFILAILFRMECVNIR  125

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMG---PVVIGQSTIHWKYAKNTVDKNSSSSHG--NV  854
                GQAK+LGT ICIGGAML T Y G   P +   STI+       +   S + +   N 
Sbjct  126   MHRGQAKLLGTSICIGGAMLFTFYKGDKFPPLKVPSTIN-------IHGTSGAKYAKPNW  178

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             + G    I+S   +S FLI QA + K Y A  S  A   FL + +  ++A+  +   S W
Sbjct  179   VKGSCFAIVSTLCWSVFLILQASIYKVYPATLSMNAWISFLGVLQSAVVAVIFERTASPW  238

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              +   +  ++  Y G++ SA+   L +WCI ++GP++VA+F PL L++ AILS  FL+E+
Sbjct  239   MIGWDLELLACLYYGILVSAIGYSLNAWCISKRGPVFVALFFPLQLIIAAILSAFFLKER  298

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             ++ G+V+G  LI++G Y V+WGK  +      ED   +K++  + + + E
Sbjct  299   LHLGSVIGGCLIILGFYCVMWGKSKDDNNEKAEDKIPIKDEVEKASNSRE  348



>ref|XP_002277059.2| PREDICTED: uncharacterized protein LOC100243646 [Vitis vinifera]
Length=754

 Score =   256 bits (655),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 215/351 (61%), Gaps = 14/351 (4%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER-KSRPKM  1202
             P  VMV+ QLG+ GVNI     +  GMN  + IAY+ +FAT  + PLA+ LER KS P++
Sbjct  385   PAIVMVVAQLGFGGVNIFYKLAVNDGMNVRVLIAYRFIFATAFICPLAFILERRKSGPRL  444

Query  1201  TPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGL  1022
             T  I  Q FL   FG    Q  Y   L  ++PT ++A+ANLIPA+TF+ A+   LE + +
Sbjct  445   TWMIALQGFLCGLFGGALGQNLYLESLALTSPTFSAAMANLIPAVTFIFALFLGLERLKI  504

Query  1021  RTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTV---DKNSSSSHG---  860
             RT  G+AK++GT++ IGGAM+LT Y GP    Q  I W    N +   D++ ++SHG   
Sbjct  505   RTWAGRAKVIGTVLGIGGAMVLTFYKGP----QINI-WSTKVNLLKHKDQHVAASHGELD  559

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             N +LG I+ + SC SY+ +LI QA++ ++Y   YS TAL C  A  + ++ A+C + N S
Sbjct  560   NHVLGSILAVASCFSYAIWLIIQAKMGERYPFDYSCTALMCASATVQAIVYAMCKEKNWS  619

Query  679   DWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W L   +R ++  Y G   S   + L SWC+ ++GPL+V++FNPL+LV  AIL    L 
Sbjct  620   AWKLGWNIRLLTVAYTGFFASGFMVVLVSWCVRKRGPLFVSIFNPLMLVFVAILGSLILD  679

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAG  350
             EK++ G+++G +LIV+GLY +LW K  E++ +    ++K   K+AE    G
Sbjct  680   EKLHLGSIIGGVLIVIGLYAMLWAKGAEMKSMATLSHSK-SSKEAEIINVG  729


 Score =   142 bits (358),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 125/206 (61%), Gaps = 6/206 (3%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P+ VMV VQL + GVNI+    +  GMN  + +AY+ +FAT  ++PLA+ LERKS P++T
Sbjct  31    PVIVMVAVQLVFGGVNILYKLAINDGMNTRVLVAYRFIFATAFISPLAFILERKSSPRLT  90

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               I  Q FL   FG    Q  Y   L  ++PT ++A+ NLIPA+TF+ A+   LE + +R
Sbjct  91    WMIALQGFLCGLFGGALGQNLYLESLALTSPTFSAAMVNLIPAVTFIFAISLGLEKLAIR  150

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSH---GNVIL  848
             T  G+AK+ GTL+ IGGAM+LT Y GP +   ST   K      D++ ++SH    N +L
Sbjct  151   TWAGKAKVGGTLLGIGGAMVLTFYKGPQINIWST---KVHLLNKDQHVAASHRMMDNHVL  207

Query  847   GPIMVILSCCSYSAFLITQARLSKQY  770
             G ++ + SC SY+ +LI  +  S  +
Sbjct  208   GSLLDVASCFSYAIWLIIHSIFSPMH  233



>ref|XP_003564421.1| PREDICTED: WAT1-related protein At5g07050 [Brachypodium distachyon]
Length=392

 Score =   247 bits (631),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/373 (37%), Positives = 214/373 (57%), Gaps = 21/373 (6%)
 Frame = -1

Query  1399  MGC-SDLL----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLA  1235
             MGC  D      P   M+ +Q GYAG+N++    +  GM+ ++ + Y+  FAT+++AP A
Sbjct  1     MGCYGDFFEKAKPYIAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPFA  60

Query  1234  YFLERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVA  1055
               LERK RPKMT + F QIF+ A  G   DQ  Y+ GL  + PT A A++N++PA+TFV 
Sbjct  61    LLLERKVRPKMTWSSFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVM  120

Query  1054  AVLFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWK------YAKN  893
             AV+FR+E V +R    QAK+ GT++ + GAML+TLY GP++    T H +          
Sbjct  121   AVIFRMEKVDIRKVRCQAKVAGTVVTVAGAMLMTLYKGPLMQMVWTSHAQPHGNGGGEGG  180

Query  892   TVDKNSSSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECL  713
              V      +     LG + VI++  ++++  I QA   KQY AP S T L CF+   + +
Sbjct  181   PVAAAVDPTGREWFLGSLFVIIATLAWASLFILQAHTLKQYSAPLSLTTLICFVGTLQAI  240

Query  712   IIALCVDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLV  536
             ++   ++H  S WT+   M  ++  Y G+V S++A  +    I++ GP++ + F+PL+++
Sbjct  241   VVTFAMEHRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMI  300

Query  535   LTAILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQ----VINVE-----DNNKL  383
             + A++    L EKIY G V+GS+LIV+GLY VLWGK  E Q     + +E       +KL
Sbjct  301   VVAVMGSFILAEKIYLGGVLGSVLIVIGLYSVLWGKHKETQEESRALAMELPMAVAASKL  360

Query  382   KEKDAEKTEAGEC  344
              + DA   +  EC
Sbjct  361   GDADAAFAKDSEC  373



>ref|XP_004163894.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=392

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 143/332 (43%), Positives = 208/332 (63%), Gaps = 9/332 (3%)
 Frame = -1

Query  1381  LPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKM  1202
             LP  VM++VQ G+AGVNI        GM+  I IAY+ +FA+  + P+A+FLER  RPK+
Sbjct  10    LPTIVMMLVQFGFAGVNIFYKLAAADGMSFRIIIAYRFLFASAFILPIAFFLERGRRPKL  69

Query  1201  TPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGL  1022
             T ++ F  FL   FG +  Q  Y   L  ++   ASA+ NL PAITF+ AV FRLE + +
Sbjct  70    TWSVIFYAFLCGLFGGSLSQNLYVESLALTSAIYASAIGNLAPAITFILAVSFRLERMNI  129

Query  1021  RTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQST----IHWKYAKNTVDKNSSSSH--G  860
              T  G+AK++GTLI I GAM+LT Y G  +   ST    +H     N+ +  + + H   
Sbjct  130   GTMRGKAKVMGTLIGIVGAMILTFYKGVELHPWSTRVDLLH--KGHNSTEHVAPTEHTIH  187

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             + +LG +M + SC SY+ +LI QA++S+ Y   YSSTAL C +   + +  ALCV+   S
Sbjct  188   SHVLGSVMGVGSCFSYALWLIVQAKMSECYPCHYSSTALMCMMGSVQAVGFALCVETQWS  247

Query  679   DWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W L   +R +S  Y G+V S + + L +WC+  +GP++V+VF+PL+LVL AI +  FL+
Sbjct  248   RWKLGWNIRLLSVAYTGIVASGVMVTLITWCVRIRGPMFVSVFSPLILVLVAIAASLFLQ  307

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVI  407
             EK+Y G V+G +L+V GLY+VLWGK  E++ I
Sbjct  308   EKLYLGCVVGGMLMVCGLYMVLWGKSKEIRKI  339



>ref|XP_009354252.1| PREDICTED: WAT1-related protein At1g25270-like [Pyrus x bretschneideri]
Length=395

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/349 (38%), Positives = 209/349 (60%), Gaps = 7/349 (2%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P+ +M++VQ  Y G+NI    V   GM+  + +AY+ MF+   + PLA   ERKSRPK
Sbjct  16    LKPVLMMLMVQTAYTGMNIFYKLVAEVGMSLTVLVAYRNMFSAALMLPLALICERKSRPK  75

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T +I  Q FL+   G T  Q  Y   L  ++ T  +A  NL+P IT + AV FRLES+ 
Sbjct  76    LTLDILLQGFLSGLLGATMAQNFYIESLALTSTTYVAACNNLVPVITLIIAVCFRLESLA  135

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNS--SSSHGNV-  854
             L T  G+AK+ GTL+CIGG ML T Y G  +   ST H+   +N + +NS  +S H N  
Sbjct  136   LGTHAGRAKVAGTLVCIGGTMLFTFYKGKPIAMWST-HFNLLRNHLHENSHVASLHKNTH  194

Query  853   --ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
               +LG  + + S  S++ +LI Q +++K+Y   YSSTAL   +A  + ++ ALC + + +
Sbjct  195   TQLLGSFLALCSSTSFACWLIFQTKMTKRYPCHYSSTALMSLMASIQSVVFALCKERDWN  254

Query  679   DWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W L   +R ++  Y G+V + L + LT+WC+  +GPL+V++FNPL L+L    +   L 
Sbjct  255   QWKLGWDIRLLAALYTGVVTTGLVVTLTAWCVRTRGPLFVSIFNPLCLLLITFAAPFLLN  314

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTE  356
             EK+Y G+++G +L+V GLY VLWGK  E++++       L+++ +   +
Sbjct  315   EKLYLGSMLGGLLVVCGLYTVLWGKSKEMKMMTQLPQPPLQDQYSHSID  363



>ref|XP_003572197.1| PREDICTED: WAT1-related protein At1g09380-like [Brachypodium 
distachyon]
Length=361

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/355 (36%), Positives = 224/355 (63%), Gaps = 8/355 (2%)
 Frame = -1

Query  1399  MGCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLER  1220
             MGC   +P   M++VQ+G+AG+N+++   +  GM+P++ +AY+ + A + LAPLA + ER
Sbjct  1     MGC---MPTVAMLLVQIGFAGMNLLSKMALDNGMSPYVLVAYRSLVAAVFLAPLAVYFER  57

Query  1219  KSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFR  1040
                  MT  +  +I L+++ G+T  ++ +FVG  +++ TVASA+ N++PA+TF  A   +
Sbjct  58    DMWKLMTKKVTIEIILSSSLGMTLCELLFFVGFQSTSATVASAIVNIVPALTFAIAAALK  117

Query  1039  LESVGLRTKGGQAKILGTLICIGGAMLLTLYMGP-VVIGQSTIHWKYAKNTVDKNSSSSH  863
             +E    RT   QAK++GT++C+GG+M++  Y GP + +  S IHW YA++ V   + +  
Sbjct  118   MEPFRPRTAASQAKVIGTVVCVGGSMVMPFYKGPQLKLWDSPIHWHYAEHAVAAAAPAPA  177

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
              +  +G +++ILS  S++ +L+   + S+ + APY+ST +   +   EC  ++  VD ++
Sbjct  178   -SSAVGDVLIILSAVSWAGWLLMTNKTSESFPAPYTSTTIMSLIVGVECGAVSAAVDRSL  236

Query  682   SDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             S W+L   +R  S  Y G++   +   + +WCI+ +GPL+V++F+P++LV+ A+L WAFL
Sbjct  237   SAWSLGLGIRLYSVLYMGIIGWGVTFAVMTWCIQVRGPLFVSMFSPVVLVVVALLGWAFL  296

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNEL--QVINVEDNNKLKEKDAEKTEAGE  347
              EK++ G+ +G++LIVVGLY+VLWGK  E+  +   +  N   KE    K    E
Sbjct  297   DEKLHLGSAIGAVLIVVGLYMVLWGKGREIISRPAQLHGNRASKEGLGSKENDAE  351



>ref|NP_001172290.1| Os01g0296900 [Oryza sativa Japonica Group]
 dbj|BAB55753.1| putative MtN21 [Oryza sativa Japonica Group]
 dbj|BAH91020.1| Os01g0296900 [Oryza sativa Japonica Group]
Length=358

 Score =   246 bits (627),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 133/330 (40%), Positives = 203/330 (62%), Gaps = 27/330 (8%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
             S  LPL  MV+VQLG AG+N+++   M +GM+P++ +AY+   A   LAP+A+ +ER   
Sbjct  7     STYLPLLAMVLVQLGLAGLNVMSKLTMASGMSPYVLLAYRNFIAAAFLAPIAFLVERA--  64

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
                                T +Q+ YFVGL  S+PTVASAL N +PA+TF+ A L ++E 
Sbjct  65    -------------------TLNQVLYFVGLKYSSPTVASALNNTLPAVTFLLAALLKMEP  105

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIG-QSTIHWKYAKNTVDKNSSSSHGN-  857
             V  R   G+AK+ GT +C+ G+ML+T Y GP+V    S +HW Y + T+   +++  G  
Sbjct  106   VAGRA--GRAKVAGTALCVAGSMLMTFYRGPLVRTLASPVHWPYVQGTMAAEAAAHAGGH  163

Query  856   -VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
              V+LG ++VI S  +++ + I Q  LSK +  PY+STAL   +A  +C  IA   +   S
Sbjct  164   AVVLGAVLVIGSNVAWAIWFIIQKNLSKSFACPYTSTALMALIASVQCAAIAGAAERRFS  223

Query  679   DWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W L   +R V   Y G+V S +   + SWCI+ +GP++V++F+PL+L++ A++ W  L 
Sbjct  224   AWELGLDIRLVGALYAGIVASGMVCTVMSWCIQERGPVFVSMFSPLMLIVVAVVGWGILG  283

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQ  413
             EKI+ G+V+G+++IVVGLY VLWGK  +L 
Sbjct  284   EKIHVGSVIGAVIIVVGLYTVLWGKGRDLD  313



>ref|XP_008378803.1| PREDICTED: WAT1-related protein At1g25270-like [Malus domestica]
Length=393

 Score =   247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 210/345 (61%), Gaps = 3/345 (1%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P+ +MV+VQ  +AGVN++       GMN  I +AY+ +FAT  + P+A F+ERKSRPK
Sbjct  13    LKPVLLMVVVQFAFAGVNVLYKLAANDGMNLRILVAYRFIFATAFILPIALFIERKSRPK  72

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  +  Q FL+  FG +  Q  Y   L  ++ T ASA+  L PAITF+ A+ FRLE++ 
Sbjct  73    LTWMVLLQGFLSGLFGGSLSQNLYIESLALTSATFASAIVQLTPAITFILAITFRLENLS  132

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
             LR+  G+AK+LGTL+ IGGAMLLT Y G V     + H     + +  +  +  GN +LG
Sbjct  133   LRSPAGKAKMLGTLMGIGGAMLLTFYKG-VEFNIWSTHVDLLHSHLASSPHTDSGNRLLG  191

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
              ++ + SC  Y+ +LI Q ++S  Y   YSSTAL   +   + +  ALC +   S W L 
Sbjct  192   CLLALGSCFCYATWLIIQTKMSATYTCYYSSTALMSAMGSIQAVGFALCKEREWSQWKLG  251

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               +R ++  Y+G + + L++   + CI  +GPL+V+VFNPL+LVL AI+    L EK++ 
Sbjct  252   WNIRLLTAAYSGTMATGLSVTFIALCIRMRGPLFVSVFNPLMLVLVAIVGSLVLDEKLHL  311

Query  487   GTVMGSILIVVGLYIVLWGKKNELQVI-NVEDNNKLKEKDAEKTE  356
             G+V+G++LIV+GLY VLWGK  E++ + N   +     +D+   +
Sbjct  312   GSVLGAVLIVIGLYAVLWGKGKEIEKMSNSVPSTSFHHQDSGSID  356



>emb|CDX70003.1| BnaA10g23520D [Brassica napus]
Length=399

 Score =   247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/360 (35%), Positives = 221/360 (61%), Gaps = 11/360 (3%)
 Frame = -1

Query  1399  MGCSDLL-----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLA  1235
             +GC +       P F M+ +Q GYAG+NI+    +  GM+ ++ + Y+   AT  +AP A
Sbjct  6     LGCCESFLKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFA  65

Query  1234  YFLERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVA  1055
             +F ERK++PK+T  IF Q+F+    G   DQ  Y++GL  ++PT + A++N++PA+TF+ 
Sbjct  66    FFFERKAQPKITFTIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLPAMTFIL  125

Query  1054  AVLFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWKYAKNTVDK  881
             AVLFR+E + ++    QAKI GT++ + GAML+T+Y GP+V       +H ++A +T   
Sbjct  126   AVLFRMEVLDVKKLWCQAKIAGTVVTVAGAMLMTIYKGPIVELFWTKYMHLQHANDTTPS  185

Query  880   NSSSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGA-PYSSTALACFLAIFECLIIA  704
             ++S+ + + + G I++I +  ++++  + QA++ K Y     + T L CF+   + + + 
Sbjct  186   SNSNDNKDFLKGSILLIFATLAWASLFVLQAKILKTYSKHQLTLTTLVCFIGTLQAVAVT  245

Query  703   LCVDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTA  527
               ++HN S W +   M  ++  Y+G+V S++A  +    ++++GP++   F+PL++V+ A
Sbjct  246   FVMEHNPSAWRIGWDMNLLAAAYSGIVASSIAYYVQGIVMKKRGPVFATAFSPLMMVIVA  305

Query  526   ILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVE--DNNKLKEKDAEKTEA  353
             I+    L EKI+ G V+G++LIV+GLY VLWGK+ E +V + E  +  K  +K  E  EA
Sbjct  306   IMGSFVLAEKIFLGGVIGAVLIVIGLYAVLWGKQKENEVTHCEMLEPTKNIDKVTEDVEA  365



>ref|XP_009341318.1| PREDICTED: WAT1-related protein At1g25270-like [Pyrus x bretschneideri]
Length=391

 Score =   246 bits (629),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 145/363 (40%), Positives = 213/363 (59%), Gaps = 24/363 (7%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P+ +MV+VQ  +AGVN++       GMN  I +AY+ +FAT  L P+A F+ERKSRPK
Sbjct  13    LKPVLLMVVVQFAFAGVNVLYKLAANDGMNLRILVAYRFIFATAFLLPIAIFIERKSRPK  72

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  +  Q FL+  FG +  Q  Y  GL  ++ T ASA+  L PAITF+ A+ FRLE++ 
Sbjct  73    LTWMVLLQGFLSGLFGGSLTQNLYIEGLALTSATFASAIVQLTPAITFILAITFRLENLS  132

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
             LR+  G+AK+LGTL+ IGGAMLLT Y G V    ST H     + +  +  +  GN +LG
Sbjct  133   LRSPAGKAKMLGTLMGIGGAMLLTFYKG-VEFNIST-HVDLLHSHLATSLHTDSGNRLLG  190

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
              ++ + SC  Y+ +LI Q ++S  Y   YSSTAL   +   + +  ALC +   S W L 
Sbjct  191   CLLALGSCLCYATWLIIQTKMSATYTCYYSSTALMSAMGSIQAVGFALCKEREWSQWKLG  250

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               +R ++  Y+G + + L++   + CI  +GPL+V+VF+PL+LVL AI+    L EK++ 
Sbjct  251   WNIRLLTAAYSGTMATGLSVTFIALCIRMRGPLFVSVFSPLMLVLVAIVGSLVLDEKLHL  310

Query  487   GTVMGSILIVVGLYIVLWGKKNELQ---------------------VINVEDNNKLKEKD  371
             G+V+G++LIV+GLY VLWGK  E++                     V+   DNNK    +
Sbjct  311   GSVLGAVLIVIGLYAVLWGKGKEIEKMSNSVPSTSFHHQDSGSIDIVVMSPDNNKGNSNN  370

Query  370   AEK  362
              E 
Sbjct  371   TES  373



>ref|XP_010649426.1| PREDICTED: WAT1-related protein At1g68170-like isoform X2 [Vitis 
vinifera]
Length=377

 Score =   246 bits (628),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/345 (40%), Positives = 206/345 (60%), Gaps = 8/345 (2%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P  VMV+ QL   GV I+    +  GMN  + IAY+ +FAT  ++ LA+ LER     +T
Sbjct  14    PAIVMVVAQLASGGVQILYKLAINDGMNTRVLIAYRYIFATAFISSLAFILER-----LT  68

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               I  Q FL   FG    Q  Y   +  ++PT ++A+ANLIPA+TF+ A+   LE + +R
Sbjct  69    WMIALQGFLCGLFGGALGQNLYVESMVLTSPTFSAAMANLIPAVTFIFAIFLGLEKLAIR  128

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILGP  842
             T  G+AK+ GTL+ IGGAM+LT Y GP + I  + +H    KN     S     N +LG 
Sbjct  129   TWAGKAKVTGTLLGIGGAMVLTFYKGPQINIWSTKVHLLKHKNQHVAASHRGMDNRVLGS  188

Query  841   IMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-  665
             ++ + SC SY+ + I QA++ ++Y   YSSTAL C  A  + ++ A+C + N S W L  
Sbjct  189   LLAVASCFSYATWYIIQAKMGERYPFDYSSTALMCASASVQTVVYAMCKETNWSAWKLGW  248

Query  664   PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTG  485
              +R ++  Y G + S   + L +WC+ ++GPL+V+VFNPLLLV  AIL    L EK++ G
Sbjct  249   NIRLLTVAYTGYLSSGFMVVLANWCVRKRGPLFVSVFNPLLLVFVAILDSLLLDEKLHLG  308

Query  484   TVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAG  350
             +++G +LIV+GLY +LW K+ E++      ++K + K+AEK   G
Sbjct  309   SIIGGVLIVIGLYAMLWAKREEMKSKARLSHSK-RSKEAEKINVG  352



>ref|XP_010068193.1| PREDICTED: WAT1-related protein At1g68170-like [Eucalyptus grandis]
Length=393

 Score =   246 bits (627),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 141/329 (43%), Positives = 204/329 (62%), Gaps = 11/329 (3%)
 Frame = -1

Query  1372  FVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPN  1193
              +MV+VQ+ + G+NI+    +  GMN  + IAY+ MFAT  LAPLA+FLERKSRPK+T  
Sbjct  5     LMMVVVQVAFGGINILYKLTVSNGMNLSVVIAYRFMFATAVLAPLAFFLERKSRPKITWT  64

Query  1192  IFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTK  1013
             +  Q F  A  G +  Q  Y   L+ ++ T ASA+ANL+PA+TFV AV   LE V +RT 
Sbjct  65    VLVQAFFCALLGGSMGQNLYLASLSMTSATYASAMANLVPAVTFVLAVSLGLEKVRVRTV  124

Query  1012  GGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNV-----IL  848
              G+AK  GTL+ IGGAMLLT Y G  V       W    N +   +++  G V     +L
Sbjct  125   AGKAKAAGTLMGIGGAMLLTFYKGAEV-----NLWSTHVNLLRHVAATRRGQVGSSDLLL  179

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             G ++ + SC  Y+++LI QA++S+ +   Y+STAL  FL   +  + ALC + + S W L
Sbjct  180   GSLLAVASCFCYASWLIIQAKMSEDFPYQYTSTALMTFLGSIQATVYALCRERDWSQWKL  239

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                +R ++ +Y G+V S L   L  WC+  +GP++V+VFNPL+LV  A++    L EK++
Sbjct  240   GWNIRLLTVSYAGIVASGLCYTLIVWCVRMRGPVFVSVFNPLMLVTVALVGSMVLDEKLH  299

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVIN  404
              G+++GS LIV+GLY VLWGK+ E +  N
Sbjct  300   MGSILGSGLIVLGLYAVLWGKRKEDKKTN  328



>ref|XP_009391606.1| PREDICTED: WAT1-related protein At5g07050-like [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/348 (38%), Positives = 206/348 (59%), Gaps = 14/348 (4%)
 Frame = -1

Query  1396  GCSDLL----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYF  1229
             GC+       P   M+ +Q GYAG+NI+    +  GM+ ++ + Y+  FAT+++AP A  
Sbjct  3     GCNKFFQKCKPYVAMISLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFATLSIAPFALI  62

Query  1228  LERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAV  1049
             LERK RPKMT +IF QIF     G   DQ  Y+ GL  ++PT + A++N++PA+TFV AV
Sbjct  63    LERKVRPKMTFSIFMQIFALGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLAV  122

Query  1048  LFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSS  869
             + R+E V L+    QAK++GTL+ + GAML+TLY GP++    T H +     V   + S
Sbjct  123   ICRMEKVHLKKVRCQAKVVGTLVTVAGAMLMTLYKGPIMDMAWTKHAQLQHANVPAVADS  182

Query  868   SHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH  689
             +  + + G I +I++  ++++  I QA   K+Y AP S T+L CF+   +   + L ++H
Sbjct  183   TDKDWLKGCIFLIIATLAWASLFILQAATLKKYDAPLSLTSLICFMGTLQATAVTLFMEH  242

Query  688   NVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWA  512
               S W +   M  ++  Y G+V S++A  +    I+ KGP++ + F+PL++++ AI+   
Sbjct  243   KPSVWRIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQDKGPVFASAFSPLMMIIVAIMGSF  302

Query  511   FLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDA  368
              L EKIY G ++G+ LIV GLY VLWGK  E         NK KE +A
Sbjct  303   ILAEKIYLGGIVGAALIVAGLYSVLWGKHKE---------NKEKEMEA  341



>ref|XP_009621489.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Nicotiana 
tomentosiformis]
Length=397

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/330 (38%), Positives = 206/330 (62%), Gaps = 5/330 (2%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+N++    +  GM+ ++ + Y+  FAT A+AP A  LERK RPKMT
Sbjct  17    PYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAIAPFALVLERKLRPKMT  76

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +F QIF+    G   DQ  Y++GL  ++PT + A++N++PA+TFV AVL R+E V ++
Sbjct  77    FMMFLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVHIK  136

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
                 QAK++GT++ + GAML+TLY G V+  +  + IH     + V + +  +  +++ G
Sbjct  137   KLRCQAKVVGTIVTVAGAMLMTLYKGHVINLVWSNNIHTN--TSNVPEPNEVTDKDLLKG  194

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
              I++IL+  ++++F I Q    ++Y AP S TAL CF+   + + + L ++H  S W + 
Sbjct  195   SILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSIAVTLVMEHKTSAWAIG  254

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               M  ++  Y G+V S+LA  +    +E++GP++V  F+PL++++ AI+    L EKIY 
Sbjct  255   FDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYI  314

Query  487   GTVMGSILIVVGLYIVLWGKKNELQVINVE  398
             G V+G++LIV GLY VLWGK  E +   +E
Sbjct  315   GGVLGAVLIVAGLYSVLWGKYKEYKEKEIE  344



>ref|XP_008788560.1| PREDICTED: WAT1-related protein At5g07050-like [Phoenix dactylifera]
Length=400

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 203/330 (62%), Gaps = 5/330 (2%)
 Frame = -1

Query  1393  CSDLL----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFL  1226
             CS  L    P   M+ +Q GYAG+NI+    +  GM+ ++ + Y+  FAT+++AP A  L
Sbjct  4     CSGFLQRAKPYIAMISLQFGYAGMNIITKVSLNNGMSHYVLVVYRHAFATLSIAPFALIL  63

Query  1225  ERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVL  1046
             ERK  PK+T +IF QIF+    G   DQ  Y+ GL  ++PT + A++N++PA+TFV AVL
Sbjct  64    ERKVWPKITFSIFVQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNILPAMTFVIAVL  123

Query  1045  FRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSS  866
              R+E V L+    QAK++GT + + GAML+TLY GP++    T H    +++  + + SS
Sbjct  124   CRMEKVDLKKVRCQAKVVGTFVTVAGAMLMTLYKGPIMEMVWTKHVHPHRSSAPETTDSS  183

Query  865   HGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN  686
               + I G I VI++  ++++  + QA   KQY A  S T L CF+   + + + L ++H 
Sbjct  184   DKDWIKGSIFVIIATLAWASLFVLQAVTLKQYSAQLSLTTLICFMGTLQAIAVTLVMEHK  243

Query  685   VSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAF  509
              S WT+   M  ++  Y G+V S++A  +    I+R+GP++ + F+PL++++ AI+    
Sbjct  244   PSAWTIGWDMNLLAAAYAGIVTSSIAYYVQGLVIQRRGPVFASAFSPLMMIIVAIMGSFI  303

Query  508   LREKIYTGTVMGSILIVVGLYIVLWGKKNE  419
             L EKIY G V+G++LI VGLY VLWGK  E
Sbjct  304   LAEKIYLGGVLGAVLIAVGLYSVLWGKYKE  333



>ref|XP_002447365.1| hypothetical protein SORBIDRAFT_06g033770 [Sorghum bicolor]
 gb|EES11693.1| hypothetical protein SORBIDRAFT_06g033770 [Sorghum bicolor]
Length=374

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 207/333 (62%), Gaps = 9/333 (3%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
             C+   P+  MV+ Q+ +AG+NI     +  GM+  + IAY+ +FA+  LAPLAYFLERK+
Sbjct  4     CAGAGPVLGMVVFQILFAGLNIFYKLAVSDGMDLRVLIAYRYLFASAFLAPLAYFLERKT  63

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
             R K+T  +    F+    G T  Q  Y  G+  ++ T ASA  NL+PA TFV A++FR E
Sbjct  64    RTKLTWRVLMLSFVCGLSGGTVAQNLYIAGMKLTSATFASATTNLLPAWTFVIALVFRYE  123

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQ-------STIHWKYAKNTVDKNS  875
              + +R    QAK+ GTL+ IGGAMLLTLY G  +          +T+  ++    V  ++
Sbjct  124   RLDIRAFSSQAKVTGTLLSIGGAMLLTLYKGVDITPWHSHLNLVATLAQRHG-GQVGASA  182

Query  874   SSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCV  695
              +S  N  +G +M + SC  Y+ +++ QA+LS +Y   YSSTAL C +   +  + A+C 
Sbjct  183   MASKTNYGMGSLMCVSSCFFYALWIVVQAKLSNEYPFHYSSTALMCIMISLQSAVFAICF  242

Query  694   DHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILS  518
             D + S W L   +R +S  Y+G+  S +A+ + +WC++++GPL+V+VF+PL+L++ A+LS
Sbjct  243   DRDASQWRLKFNIRLLSCAYSGIFASGIALVIMAWCVKQRGPLFVSVFSPLMLLMVAVLS  302

Query  517   WAFLREKIYTGTVMGSILIVVGLYIVLWGKKNE  419
                L EK++ GT +G++LIV+GLY VLWGK  E
Sbjct  303   SLLLGEKLHLGTALGAVLIVMGLYAVLWGKGRE  335



>ref|XP_009790909.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/358 (36%), Positives = 216/358 (60%), Gaps = 19/358 (5%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+N++    +  GM+ ++ + Y+  FAT A+AP A  LERK RPKMT
Sbjct  17    PYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAIAPFALVLERKLRPKMT  76

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +F QIF+    G   DQ  Y++GL  ++PT + A++N++PA+TFV AVL R+E V ++
Sbjct  77    FMMFLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVHIK  136

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
                 QAK++GT++ + GAML+TLY G V+  +  + IH     + V +++  +  + + G
Sbjct  137   KLRCQAKVVGTIVTVAGAMLMTLYKGHVINLVWSNNIHTN--TSNVPESNEPTDKDWLKG  194

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
              I++IL+  ++++F I Q    ++Y AP S TAL CF+   + + + L ++H  S W + 
Sbjct  195   SILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSIAVTLVMEHKASAWAIG  254

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               M  ++  Y G+V S+LA  +    +E++GP++V  F+PL++++ AI+    L EKIY 
Sbjct  255   FDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYL  314

Query  487   GTVMGSILIVVGLYIVLWGKKNELQVINVE-----------DNN---KLKEKDAEKTE  356
             G V+G++LIV GLY VLWGK  E +   +E           +NN   +L++++    E
Sbjct  315   GGVLGAVLIVAGLYSVLWGKYKEYKEKEIEAAIPEPVKGITENNQMMRLEDREVNDIE  372



>ref|XP_010934894.1| PREDICTED: WAT1-related protein At3g30340-like [Elaeis guineensis]
Length=350

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/341 (37%), Positives = 203/341 (60%), Gaps = 7/341 (2%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
             C +  P+F M+ V +  A +N +  +V+  GMN  + I  +Q+ AT+ +AP+AYF ERK+
Sbjct  4     CEEWKPIFAMLAVNVALAAMNTMIKSVIDEGMNRLVLITLRQLVATLFMAPIAYFGERKT  63

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
             RPK+T  IF  +F +A FG +  Q  +F+GL  +T T A A  N+ P +TF+ A+ FRLE
Sbjct  64    RPKLTVEIFVYLFFSAMFGASLTQYLFFLGLKYTTATFACAFLNMAPVLTFLLALPFRLE  123

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYA-KNTVDKNSSSSHGN  857
             ++ L+TK G AK+LG +IC+ GAM+LT Y G  +   S  H   A +     N+  S   
Sbjct  124   TLNLKTKAGIAKLLGAIICLTGAMVLTFYKGEALTNTS--HQLVASEQQQGHNAGYSTKQ  181

Query  856   VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSD  677
              ILG    +  C S+S++ + Q+++ K+Y A YS TA+  FL+  +  I++L  + + S 
Sbjct  182   WILGSTAYLAGCLSWSSWFLIQSKVGKKYPALYSGTAMIFFLSFLQAAILSLVTEKSFSV  241

Query  676   WTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W L   +  ++   +G+  S       SWC+E++GP++ A F PL+ ++ A + ++ L E
Sbjct  242   WALKRKLEIITVIVSGIAGSGFGFLAMSWCVEKRGPVFTAAFTPLVQIMVAAIDFSILHE  301

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQ---VINVEDNNK  386
              +Y G+V+GSIL++ GLY +LWGK  E +      VE+N +
Sbjct  302   PLYLGSVLGSILVIAGLYFLLWGKTKEARSSAAKTVEENGE  342



>ref|XP_010105267.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXC04202.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=382

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 197/326 (60%), Gaps = 2/326 (1%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             M+ +Q GYAG ++V+ A +  G++  +   Y+ + A + L P AYFLE+K RP MT N  
Sbjct  26    MLALQFGYAGFHVVSRAALNMGISKLVFPVYRNIIALLLLLPFAYFLEKKERPAMTLNFM  85

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
              Q FL A  G+T +Q  Y +GL+N++PT ASA+ N +PAITF+ A + R+E V L  K G
Sbjct  86    LQFFLLALVGITANQGFYLLGLDNTSPTFASAIQNSVPAITFLMAAILRIERVRLDRKDG  145

Query  1006  QAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHG-NVILGPIMVI  830
              AK+LGT+ C+ GA ++TLY GPV+   S    +  +  +  +   + G N  LG I +I
Sbjct  146   IAKVLGTIFCVAGASVITLYKGPVIYNPSPPGLQSVQEPMFPSLGDASGKNWTLGCIYLI  205

Query  829   LSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLTPMRAV  650
               C S+S +L+ QA L K+Y A  S T+  CF  + + +IIA  V+     W  T    V
Sbjct  206   GHCLSWSGWLVLQAPLLKKYPARLSVTSYTCFFGLIQFVIIAAIVEREAKAWIFTTGGEV  265

Query  649   STT-YNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMG  473
              T  Y G+V S +A  +  WCI+R GP++VAV+ P+  ++ AI++   L E+ Y G ++G
Sbjct  266   FTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIMASVALGEEFYLGGIIG  325

Query  472   SILIVVGLYIVLWGKKNELQVINVED  395
             ++LI+VGLY+VLWGK  E + +  E 
Sbjct  326   AVLIIVGLYLVLWGKSEEKKFMAQEK  351



>ref|XP_009122385.1| PREDICTED: WAT1-related protein At5g07050 [Brassica rapa]
Length=399

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 220/360 (61%), Gaps = 11/360 (3%)
 Frame = -1

Query  1399  MGCSDLL-----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLA  1235
             +GC +       P F M+ +Q GYAG+NI+    +  GM+ ++ + Y+   AT  +AP A
Sbjct  6     LGCCESFLKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFA  65

Query  1234  YFLERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVA  1055
             +F ERK++PK+T  IF Q+F+    G   DQ  Y++GL  ++PT + A++N++PA+TF+ 
Sbjct  66    FFFERKAQPKITFTIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAISNMLPAMTFIL  125

Query  1054  AVLFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWKYAKNTVDK  881
             AVLFR+E + ++    QAKI GT++ + GAML+T+Y GP+V       +H ++A +T   
Sbjct  126   AVLFRMEVLDVKKLWCQAKIAGTVVTVAGAMLMTIYKGPIVELFWTKYMHLQHANDTTPS  185

Query  880   NSSSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGA-PYSSTALACFLAIFECLIIA  704
             ++S+ + + + G I++I +  ++++  + QA++ K Y     + T L CF+   + + + 
Sbjct  186   SNSNDNKDFLKGSILLIFATLAWASLFVLQAKILKTYSKHQLTLTTLVCFIGTLQAVAVT  245

Query  703   LCVDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTA  527
               ++HN S W +   M  ++  Y+G+V S++A  +    ++++GP++   F+PL++V+ A
Sbjct  246   FVMEHNPSAWKIGWDMNLLAAAYSGIVASSIAYYVQGIVMKKRGPVFATAFSPLMMVIVA  305

Query  526   ILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVE--DNNKLKEKDAEKTEA  353
             I+    L E+I+ G V+G++LIV+GLY VLWGK+ E +V + E  +  K   K  E  EA
Sbjct  306   IMGSFVLAERIFLGGVIGAVLIVIGLYAVLWGKQKENEVTHCEMLEPTKNINKVTEDVEA  365



>ref|XP_007148017.1| hypothetical protein PHAVU_006G173600g [Phaseolus vulgaris]
 gb|ESW20011.1| hypothetical protein PHAVU_006G173600g [Phaseolus vulgaris]
Length=371

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/353 (37%), Positives = 218/353 (62%), Gaps = 11/353 (3%)
 Frame = -1

Query  1396  GCSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERK  1217
              C +  P  VM+     +A VN++   V+  G+N  + I Y+   ATI +AP+AYF ER 
Sbjct  4     ACDEWKPFIVMIASDFSFAVVNVLLKKVLEEGVNHLVFITYRLTIATIFIAPVAYFRERN  63

Query  1216  SRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRL  1037
              RP++T  I   +F +A  G +  Q    +G+  ++ T + A  N++P +TF+ A+ F L
Sbjct  64    DRPRLTFRILCYLFCSAIVGASVTQYFVLLGIQYTSATFSCAFINMVPVVTFMMALPFGL  123

Query  1036  ESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYA----KNTVDKN-SS  872
             E+V ++ K G+AKILG+L+CIGGA++LTLY G  +   S  H + A    K++ +K  S+
Sbjct  124   ETVKIKCKSGRAKILGSLVCIGGALMLTLYKGKPLFHFS--HHESAASMTKSSAEKPYST  181

Query  871   SSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVD  692
             ++ G   +G I +++    +S++ I Q+++SK+Y   YSSTA+  F    +  +I  C D
Sbjct  182   NTTGRWTIGVIAMVMGTMFWSSWYILQSKISKRYPCQYSSTAIMSFFGAVQAAVICFCTD  241

Query  691   HNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSW  515
             HN S W L   M+ ++  ++G+V S L     SWC++++GP++ A F+PL+ ++ A++  
Sbjct  242   HNFSIWVLKGKMQIIAFLFSGVVGSGLCFVGMSWCVKKRGPVFTAAFSPLVQIIAAMIDI  301

Query  514   AFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQ--VIN-VEDNNKLKEKDAE  365
               L E+++ G+VMGSIL+++GLYIVLWGK  E++  VI  V++  + KE++A+
Sbjct  302   PVLHEQLHLGSVMGSILVIIGLYIVLWGKSIEMKNRVIKLVQEAEETKEQEAQ  354



>ref|XP_006604312.1| PREDICTED: WAT1-related protein At5g07050-like [Glycine max]
 gb|KHN08914.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=392

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/352 (38%), Positives = 211/352 (60%), Gaps = 14/352 (4%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   MV +Q G+AG+NI+    +  GM+ ++ + Y+  FAT A+AP A  LERK RPKMT
Sbjct  16    PYIAMVSLQFGFAGMNIITKVSLNRGMSHYVLVVYRHAFATAAIAPFAIVLERKVRPKMT  75

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +F QIF+    G   DQ  Y+ GL  ++PT + A++N++PA+TFV A +FR+E + +R
Sbjct  76    FLMFMQIFVLGLLGPVIDQNLYYAGLKFTSPTYSCAISNILPAMTFVMAAIFRMEKLDMR  135

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSS-HGNVILGP  842
                 QAK++GT++ + GAML+TLY G V+    + +  + +N V +N++ S   +   G 
Sbjct  136   KVRCQAKVIGTIVTVAGAMLMTLYKGQVISFLGSKYMHHPRNYVPENTTDSGEKDWFKGS  195

Query  841   IMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-  665
             I++IL+  S+++F I QA   ++Y A  S TAL C L   + + +   ++H  S WT+  
Sbjct  196   ILLILATLSWASFFILQAVTLRKYPAQLSLTALVCALGTLQSIAVTFVMEHKPSVWTIGW  255

Query  664   PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTG  485
              M  ++  Y G++ S +   +    +++KGP++V  F+PL++++ AI+    L EKIY G
Sbjct  256   DMNLLAAAYAGIISSGITYYVQGIVMQKKGPVFVTAFSPLMMIIVAIMGAFILAEKIYLG  315

Query  484   TVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKT-EAGEC*LSN  332
              V+G+ILIV+GLY VLWGK  E            KEK+AE T E  +C   N
Sbjct  316   GVVGAILIVMGLYSVLWGKHKE-----------NKEKEAETTMEVMKCCSEN  356



>ref|XP_010103868.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB97309.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=398

 Score =   245 bits (625),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 141/332 (42%), Positives = 205/332 (62%), Gaps = 7/332 (2%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P  +MV+VQ+ YAGVN+        GMN  I +AY+ +FAT  + PLA F+ERKSRPK
Sbjct  13    LKPALLMVVVQIAYAGVNVFYKLAANDGMNLRIIVAYRFVFATAFILPLALFIERKSRPK  72

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  + FQ FL A FG       Y   LN ++   ASA++NL PAITFV A  FR+E V 
Sbjct  73    LTWMVLFQSFLCALFGGALTHNLYIESLNLTSAAFASAMSNLNPAITFVLAFSFRMEKVN  132

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQST-----IHWKYAKNTVDKNSSSSHG  860
             +    G+AK+LGTL+ IGGAM+LT Y G  +   ST      H +   + V    + S  
Sbjct  133   IGNLAGKAKVLGTLLGIGGAMILTFYKGVEIDIWSTNVDLLYHGQQKISHVAPPQTDS-S  191

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             N + G +  + S   YS +LI QA+++++Y   YSSTAL   + + + +  ALC + ++S
Sbjct  192   NRVWGCVFALGSSTCYSLWLIIQAKMNEKYPCFYSSTALMSTMGMIQTVGFALCTERDLS  251

Query  679   DWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W L   +R +S +Y+G++ S +A+ L +WC+  +GP++ +VFNPL+L+L AI     L 
Sbjct  252   QWKLGWNIRLLSVSYSGVMASGVAVTLVAWCVHARGPVFASVFNPLMLLLVAIAGSLVLD  311

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVI  407
             EK++ G+V+GSI IV+GLY+VLWGK  E + I
Sbjct  312   EKLHLGSVLGSIPIVIGLYMVLWGKNEETKKI  343



>ref|XP_007041587.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX97418.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
isoform 1 [Theobroma cacao]
Length=481

 Score =   247 bits (631),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/351 (40%), Positives = 206/351 (59%), Gaps = 10/351 (3%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P  VMV+VQ  +AG+N++       GM+  I  AY+ +FA   + PLA  +ERK RPK
Sbjct  11    LKPAMVMVVVQTTFAGMNLLYKLAANDGMSLRIITAYRFVFAVPVMVPLALLVERK-RPK  69

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  I FQ FL   FG    Q  Y   L  ++ T  SA+ NLIP  TF+ AV  R+E + 
Sbjct  70    LTWAILFQAFLCGLFGGALSQNLYIASLALTSATFVSAMTNLIPVTTFILAVFLRMEKLA  129

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQST----IHWKYAKNTVDKNSSSSHGN  857
               T  G+AK+LGTLI IGGAMLLT Y G  +   ST    +H  +  +    +S+S+H  
Sbjct  130   FGTMAGKAKVLGTLIGIGGAMLLTFYKGVQIKMWSTHIDLVH--HGGHGASSHSASAH--  185

Query  856   VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSD  677
             ++ G ++   SC +Y+ +LI QA++SK+Y  PYS+TAL C +   + ++ ALC + + S 
Sbjct  186   ILWGALLAFTSCITYTLWLIVQAKMSKKYPCPYSTTALMCVMGAIQSIVYALCTERDWSQ  245

Query  676   WTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W L   +R ++  Y G+V S L   +  WC+  KGPLY ++FNPL++VL A+    FL  
Sbjct  246   WKLGWNVRLLTVAYAGIVVSGLTCVMVCWCVRIKGPLYGSIFNPLMVVLVALAETLFLGA  305

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             K+Y G+++G++LIV+GLY+VLWGK  E++ +          +     E+ E
Sbjct  306   KLYLGSILGAVLIVLGLYVVLWGKGKEMEKVAAPSKEGPSTRSLPGDESIE  356



>ref|XP_009610629.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Nicotiana 
tomentosiformis]
Length=397

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/358 (36%), Positives = 216/358 (60%), Gaps = 19/358 (5%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+N++    +  GM+ ++ + Y+  FAT A+AP A  LERK RPKMT
Sbjct  17    PYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAIAPFALVLERKLRPKMT  76

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +F QIF+    G   DQ  Y++GL  ++PT + A++N++PA+TFV AVL R+E V ++
Sbjct  77    FMMFLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVHIK  136

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
                 QAK++GT++ + GAML+TLY G V+  +  + IH     + V + + ++  + + G
Sbjct  137   KLRCQAKVVGTIVTVAGAMLMTLYKGHVINLVWSNNIHTN--TSNVPEPNEATDKDWLKG  194

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
              I++IL+  ++++F I Q    ++Y AP S TAL CF+   + + + L ++H  S W + 
Sbjct  195   SILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSIAVTLVMEHKTSAWAIG  254

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               M  ++  Y G+V S+LA  +    +E++GP++V  F+PL++++ AI+    L EKIY 
Sbjct  255   FDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYL  314

Query  487   GTVMGSILIVVGLYIVLWGKKNELQVINVE-----------DNNK---LKEKDAEKTE  356
             G V+G++LIV GLY VLWGK  E +   +E           +NN+   L++++    E
Sbjct  315   GGVLGAVLIVAGLYSVLWGKYKEYKEKEIEGAIPEPVKGVTENNQMMILEDREVNDIE  372



>dbj|BAB92246.1| putative nodulin MtN21 [Oryza sativa Japonica Group]
 gb|EAZ13862.1| hypothetical protein OsJ_03785 [Oryza sativa Japonica Group]
Length=398

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/352 (38%), Positives = 206/352 (59%), Gaps = 10/352 (3%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P F M+ +Q GYAG+N++    +  GM+ ++ + Y+  FATI++AP A  LERK RPKMT
Sbjct  15    PYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALLLERKVRPKMT  74

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
              ++F QIF+ A  G   DQ  Y+ GL  + PT A A++N++PA+TFV AV+FR+E V L+
Sbjct  75    WSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAVIFRMEKVDLK  134

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKN------TVDKNSSSSHGN  857
                 QAK+ GTL+ + GAM++TLY GP++    T H +                  S   
Sbjct  135   KVRCQAKVAGTLVTVAGAMMMTLYKGPLMQMAWTSHVQAPHGHGAEAPAAAAAVDPSGRE  194

Query  856   VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSD  677
               LG + VI++  ++++  I QA   K+Y AP S T L CF+   + +++   ++H  S 
Sbjct  195   WFLGSLFVIIATLAWASLFILQAHTLKKYSAPLSLTTLICFVGTLQAIVVTFAMEHRPSV  254

Query  676   WTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W +   M  ++  Y G+V S++A  +    I++ GP++ + F+PL++++ A +    L E
Sbjct  255   WAIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAGMGSFILAE  314

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQVIN---VEDNNKLKEKDAEKTEA  353
             KIY G V+G++LIVVGLY VLWGK  E Q  +   +E     K  DAE T A
Sbjct  315   KIYLGGVLGAVLIVVGLYSVLWGKHKETQEQDAAMMELPVASKGNDAEFTAA  366



>ref|XP_004230592.1| PREDICTED: WAT1-related protein At1g68170-like isoform X1 [Solanum 
lycopersicum]
Length=390

 Score =   244 bits (623),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 132/350 (38%), Positives = 203/350 (58%), Gaps = 13/350 (4%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             PL +M++ Q+   G+NIV       GMN  + I Y+ +FA++ + PLA+F+ER  R K+T
Sbjct  13    PLLLMIMGQMILTGMNIVFKLATSDGMNSSVLIFYRSLFASVFMIPLAFFIERGKRVKLT  72

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               + FQ FL    G +  Q  Y   L  ++ T  SA+ NLIPA+TF+ A++ RLE +G  
Sbjct  73    KMVVFQGFLCGLLGGSIGQNMYLQSLVYTSATFVSAMFNLIPAMTFIVAIILRLERLGWH  132

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVILGP  842
             +  G+AK+ GT+ICI GAMLL+LY GP + +G + I      N +           ++G 
Sbjct  133   SAAGKAKVFGTIICISGAMLLSLYKGPEINMGSTHI------NLLHSTKHKVENKPLIGA  186

Query  841   IMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-  665
             I+ I  C  Y+  LI QA+ +K+Y  PYS TAL   +A  +C ++A+ V+ + + W L  
Sbjct  187   ILAIAGCTCYALLLIVQAKAAKRYPCPYSFTALLNVMAAVQCFVVAVLVERDWNQWKLGW  246

Query  664   PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTG  485
              +R  +  Y G+  S +   + +W +  KGP+Y ++FNPL+LV+ AI  + FL EK+  G
Sbjct  247   NIRLAAAAYTGVFCSGVLFTILAWVVRMKGPVYASIFNPLMLVMVAIAGYLFLGEKLVLG  306

Query  484   TVMGSILIVVGLYIVLWGKKNELQVI-----NVEDNNKLKEKDAEKTEAG  350
             T+MGS++IV GLYIVLWGK  E++ +     N E    +K    + +  G
Sbjct  307   TIMGSVIIVCGLYIVLWGKDKEIKKVSQLVPNEEGITDVKSSSRKGSSHG  356



>ref|XP_010241528.1| PREDICTED: WAT1-related protein At3g30340-like isoform X3 [Nelumbo 
nucifera]
 ref|XP_010241529.1| PREDICTED: WAT1-related protein At3g30340-like isoform X3 [Nelumbo 
nucifera]
Length=357

 Score =   243 bits (619),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/343 (38%), Positives = 210/343 (61%), Gaps = 5/343 (1%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P+FVMV +    A VNI+   V+  GMN  + I Y+Q  AT  LAP+AYF ERKSRPK+T
Sbjct  12    PVFVMVAINFFLAIVNILLKKVLDEGMNNLVIITYRQCLATSFLAPIAYFWERKSRPKLT  71

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               I   IFL A  G T  Q  + +G+  ++ T + A  N++P +TF+ A+ F LE+V L+
Sbjct  72    SRILCHIFLGAIVGPTLTQYFFLLGIQYTSATFSCAFINVVPVLTFLMALPFGLETVNLK  131

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIHWKYAKNTVDKNSSSSH--GNVIL  848
             +K G+AK+LGT++C+GGAM+LTLY G P+    S+       N      S         +
Sbjct  132   SKAGRAKLLGTVVCVGGAMMLTLYKGLPLTNRPSSQASTQMTNQASSRFSPQKRAERWTI  191

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             G I ++     +S++ + QAR+SKQY   YSSTA+  F +  +  +++L ++ ++S W L
Sbjct  192   GTIALVAGSIFWSSWFLIQARISKQYPCQYSSTAIMSFFSAIQSAVLSLVIERDISLWVL  251

Query  667   TPMRAVSTT-YNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                 A+ T  Y G++ S L+    SWC++++GPL+ + F+PL+ ++ AI+ +  L E++ 
Sbjct  252   RGKAAILTVLYAGIMGSGLSFVGMSWCVKKRGPLFTSAFSPLIQIIVAIIDFFILHEQLN  311

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEK  362
              G+V+GS+L+++GLYI+LWGK  E Q   ++    ++E++A +
Sbjct  312   LGSVLGSVLVIIGLYILLWGKSKEAQSCMIKP-QAVEEEEAHQ  353



>ref|XP_002873292.1| hypothetical protein ARALYDRAFT_487525 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49551.1| hypothetical protein ARALYDRAFT_487525 [Arabidopsis lyrata subsp. 
lyrata]
Length=404

 Score =   244 bits (623),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 216/350 (62%), Gaps = 12/350 (3%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P F M+ +Q GYAG+NI+    +  GM+ ++ + Y+   AT  +AP A+F ERK++PK+T
Sbjct  18    PYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFFERKAQPKIT  77

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
              +IF Q+F+    G   DQ  Y++GL  ++PT + A++N++PA+TF+ AVLFR+E + ++
Sbjct  78    FSIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLPAMTFILAVLFRMEMLDVK  137

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWK---YAKNTVDKNSSSSHGNV  854
                 QAKI GT++ +GGAM++T+Y GP+V       +H +   +A +T    +SSS    
Sbjct  138   KLWCQAKIGGTVVTVGGAMVMTIYKGPIVELFWTKYMHLQDSSHANHTTSSKNSSSDKEF  197

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGA-PYSSTALACFLAIFECLIIALCVDHNVSD  677
             + G I++I +  ++++  + QA++ K Y     S T L CF+   + + +   ++HN S 
Sbjct  198   LKGSILLIFATLAWASLFVLQAKILKTYAKHQLSLTTLICFIGTLQAVAVTFVMEHNPSV  257

Query  676   WTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W +   M  ++  Y+G+V S+++  +    ++++GP++   F+PL++V+ A+     L E
Sbjct  258   WRIGWDMNLLAAAYSGIVASSISYYVQGIVMKKRGPVFATAFSPLMMVIVAVTGSFVLAE  317

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKE-----KDAE  365
             KI+ G V+G++LIV+GLY VLWGK+ E QV   +D +K++      KD E
Sbjct  318   KIFLGGVIGAVLIVIGLYAVLWGKQKENQVTICDDQSKIESNSKVTKDVE  367



>gb|KDP46086.1| hypothetical protein JCGZ_06597 [Jatropha curcas]
Length=395

 Score =   244 bits (622),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 137/331 (41%), Positives = 199/331 (60%), Gaps = 4/331 (1%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             +L P+ +MV+ QL ++GVN+        GMN  + IAY+ +FA+  L PLA   ERK RP
Sbjct  11    ELKPILLMVVAQLSFSGVNVFYKLASYDGMNLRVLIAYRFIFASAFLIPLALIFERKIRP  70

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  I FQ FL    G +  Q  Y  GL  ++ T ASA+ NL PA+TFV A+LF LE +
Sbjct  71    KLTKTILFQAFLCGFIGGSLTQTLYVEGLVLTSATFASAMTNLTPAVTFVLAILFGLEKM  130

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAK--NTVDKNSSSSHGNV  854
             GLRT  G+AK++GTL+ IGGAMLL  + G  +   ST H    K       + ++S    
Sbjct  131   GLRTLAGKAKVMGTLLGIGGAMLLIFFKGAEIDIWST-HVNLMKLVKPHGGHVAASDSTR  189

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
             +LG ++ I +C S+S +LI QA++S  +  PYSS AL   +A    ++  LC+D ++S W
Sbjct  190   VLGSLLSICNCISFSVWLIIQAKMSANFPCPYSSAALMASVAAILQVVFTLCIDRDLSQW  249

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   +R  +  Y G+V   + I L +WC+  KGPLY ++FNPL LV +A+     + E 
Sbjct  250   KLGWNIRLFTAAYAGIVVQGVTITLITWCVSIKGPLYASIFNPLQLVFSALEGSLLIDEP  309

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQVIN  404
             ++ G+++G+ LIV GLY VLWGK  E + I+
Sbjct  310   LHVGSILGATLIVCGLYTVLWGKDTEAKKIS  340



>gb|EMS48876.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=389

 Score =   243 bits (620),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 127/340 (37%), Positives = 201/340 (59%), Gaps = 12/340 (4%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+N++    +  GM+ ++ + Y+  FAT+A+AP A FLERK RPKMT
Sbjct  13    PYISMISLQFGYAGMNVLTKVSLNGGMSHYVLVVYRHAFATLAIAPFALFLERKVRPKMT  72

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
              +IFFQIF+ A  G   DQ  Y+VGL  + PT A A++N++PA+TFV AV+FR+E + L+
Sbjct  73    WSIFFQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAVIFRMEKIELK  132

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNV-----  854
                 QAKI GT++ + GAML+TLY GP++     + W           +S    V     
Sbjct  133   KVRCQAKIFGTVVTVAGAMLMTLYKGPLM----HLPWTNGHAQPSGGEASGAAGVDPTAR  188

Query  853   --ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
                LG + +I++  ++++  I Q    ++Y A  S T L CF+   + + +   ++  VS
Sbjct  189   EWFLGSLFIIIATLAWASLFILQTHTIRKYTAQLSLTTLICFIGTIQAIAVTFVMERRVS  248

Query  679   DWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              WT+   M  ++  Y G+V S++A  +    I++ GP++ + F+PL++++ A++    L 
Sbjct  249   VWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAVMGSFILS  308

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKL  383
             EKIY G V+G+++IVVGLY VLWGK  E Q    +    L
Sbjct  309   EKIYLGAVLGAVVIVVGLYAVLWGKHKEKQEQEADAKAAL  348



>ref|XP_009620098.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana tomentosiformis]
Length=371

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 197/317 (62%), Gaps = 5/317 (2%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+NI+    +  GM+ ++ + Y+  FAT  +AP A  LERK RPKM+
Sbjct  15    PYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALILERKIRPKMS  74

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +F QIF+    G   DQ  Y+ GL  ++PT + A++N++PA+TFV AVL R+E V L+
Sbjct  75    LMMFLQIFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMAVLCRMEKVDLK  134

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPI  839
                 QAK+LGT++ + GAML+TLY G VV     + W    N  + + ++S  + + G I
Sbjct  135   KFRCQAKVLGTIVTVAGAMLMTLYKGHVV----NLLWSTNSNVPEVSGANSDKDWVKGSI  190

Query  838   MVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-P  662
             ++I +  ++++F I QA   ++Y AP S TAL CFL   + + +   ++H  S WT+   
Sbjct  191   LLIFATLAWASFFILQAITMRKYTAPLSLTALVCFLGTLQSIAVTFVMEHEPSVWTIGFD  250

Query  661   MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGT  482
             M  ++  Y G+V S++A  +    +E++GP++V  F+PL++++ AI+    L EKIY G 
Sbjct  251   MNLLAAAYAGIVSSSIAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYIGG  310

Query  481   VMGSILIVVGLYIVLWG  431
             ++G++LIV GLY VLWG
Sbjct  311   ILGAVLIVAGLYSVLWG  327



>ref|XP_003541692.1| PREDICTED: WAT1-related protein At3g30340-like [Glycine max]
Length=374

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/353 (36%), Positives = 213/353 (60%), Gaps = 15/353 (4%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
             C +  P  VM+ +   +A VNI+   V+  GMN  + I Y+   ATI +AP+ YF ER  
Sbjct  5     CDEWKPFIVMIAIDFSFAAVNILLKKVLEEGMNHLVFITYRLSIATIFIAPICYFRERND  64

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
             RP++T  I   +F +A  G +  Q  + +G+  ++ T + A  N++P +TF+ A+ F LE
Sbjct  65    RPRLTFRILCYLFCSAIVGASVTQYFFLMGIQYTSATFSCAFINMVPVVTFMMALPFGLE  124

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYA-----KNTVDKNSSS  869
             +V ++ K G+AKILG+L+CIGGA++LTLY G  +   S  H++        + V+  S+ 
Sbjct  125   TVKIKCKSGRAKILGSLVCIGGALMLTLYKGKPLFNFS--HYESVSPVANSSAVNLASTR  182

Query  868   SHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH  689
             + G   +G I ++L    +S++ I Q+++SK+Y   YSSTA+  F    +  +I    DH
Sbjct  183   TKGKWTIGVIALVLGTIFWSSWFILQSKISKRYPCQYSSTAIMSFFGAIQSAVICFFTDH  242

Query  688   NVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWA  512
             N+S W L   ++ ++  Y G++ S L     SWC++++GP++ A F+PL+ ++ A++   
Sbjct  243   NLSIWVLKGKIQIIAILYAGMIGSGLCFVGMSWCVKKRGPVFTAAFSPLVQIMAAMIDIP  302

Query  511   FLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLK-EKDAEKTE  356
              L E+++ G+VMGSIL+++GLYI+LWGK  E+Q      N  +K  ++AE+T+
Sbjct  303   VLHEQLHLGSVMGSILVIIGLYILLWGKSMEMQ------NRVVKLVQEAEETK  349



>ref|XP_006349811.1| PREDICTED: WAT1-related protein At3g30340-like [Solanum tuberosum]
Length=360

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/329 (36%), Positives = 202/329 (61%), Gaps = 6/329 (2%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P+ +M+ +    +  NI+   ++  GMN F+ I Y+Q  +T+ LAP+A+F ER  RPK+T
Sbjct  9     PIIIMLAIDFALSICNILLKKIIMDGMNHFVFITYRQSISTVFLAPVAFFFERNKRPKLT  68

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
             P I F +FL+A  G +  Q  + +G+  ++ T A A  N++P +TF+ A+LF LE+  ++
Sbjct  69    PQILFYLFLSAIVGASLTQYLFLLGIQYTSATFACAFLNMVPVVTFLMALLFGLETTNIK  128

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNV--ILG  845
              + G+AK++GTLIC+GGA LLT Y G  +I  S  H+K    T+++  SSS  NV  I G
Sbjct  129   DRSGRAKVIGTLICLGGAFLLTFYKGKPLIHFS--HFKDLSQTLEEPISSSKRNVQWIFG  186

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
              +++      +S++ + QA++ K+Y   YSST +  F +  +  I+    D  +S W   
Sbjct  187   SMILFAGTILWSSWFLIQAKIGKKYPCQYSSTVIMTFFSAIQSAILTFSTDRTLSIWIPK  246

Query  664   P--MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                +  +S  Y GL+ S L     SWC++++GP++ A F+PL+ V+ A+L    L E+++
Sbjct  247   EKIIDMLSVVYTGLIGSGLCFVGMSWCVKKRGPVFTAAFSPLIQVMAAVLDVPILHEQLH  306

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVIN  404
              G+V+GS+++++GLY +LWGK  E+Q ++
Sbjct  307   LGSVIGSVIVILGLYFLLWGKAKEMQKVS  335



>ref|NP_001054334.1| Os04g0687800 [Oryza sativa Japonica Group]
 emb|CAD41942.2| OSJNBa0070M12.19 [Oryza sativa Japonica Group]
 emb|CAJ86141.1| H0701F11.7 [Oryza sativa Indica Group]
 dbj|BAF16248.1| Os04g0687800 [Oryza sativa Japonica Group]
 gb|EAY96135.1| hypothetical protein OsI_18014 [Oryza sativa Indica Group]
 gb|EAZ32493.1| hypothetical protein OsJ_16712 [Oryza sativa Japonica Group]
 dbj|BAG98032.1| unnamed protein product [Oryza sativa Japonica Group]
Length=412

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 205/326 (63%), Gaps = 8/326 (2%)
 Frame = -1

Query  1339  GVNIV-ATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIFFQIFLTAT  1163
             GVNI    AV+  GM+  + +AY+ +FA+  LAPLAYF+ERK+R KMT  +    F+   
Sbjct  25    GVNIFYKLAVVCDGMDMRVLVAYRYLFASAVLAPLAYFVERKNRTKMTWRVLMLSFVCGL  84

Query  1162  FGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGGQAKILGTL  983
              G +  Q  Y  G+  ++ T A+A+ NLIPA+TFV AVL R E + +RT  GQAK+ GTL
Sbjct  85    SGGSLAQNLYISGMKLTSATFATAMTNLIPAVTFVLAVLCRYERLAIRTVAGQAKVAGTL  144

Query  982   ICIGGAMLLTLYMG----PVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPIMVILSCCS  815
             + +GGAMLLTLY G    P       +    A++     ++ ++  VI+G ++V+ SC  
Sbjct  145   LGVGGAMLLTLYKGAELNPWHTHLDLVAALEARHPAAAAATGNNDRVIMGSMLVVGSCVF  204

Query  814   YSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-PMRAVSTTY  638
             Y+ +LI QA+LS++Y   Y+STAL C ++  +    AL VD   + W L   +R +S  Y
Sbjct  205   YAVWLILQAKLSREYPFHYTSTALMCVMSGAQSAAFALLVDREPARWRLGLDIRLLSVVY  264

Query  637   NGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMGSILIV  458
             +G++ S + + + SWC++R+GPL+ +VFNPL+LV+ A+L    L EK++ GT++G+ LIV
Sbjct  265   SGVLASGVMLVVLSWCVKRRGPLFASVFNPLMLVVVAVLGSLLLDEKMHVGTLLGAALIV  324

Query  457   VGLYIVLWGKKNE--LQVINVEDNNK  386
             VGLY VLWGK  E  L+   V D+N 
Sbjct  325   VGLYAVLWGKGRETALEAAKVGDDND  350



>gb|EEC71658.1| hypothetical protein OsI_04113 [Oryza sativa Indica Group]
Length=398

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/352 (38%), Positives = 205/352 (58%), Gaps = 10/352 (3%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P F M+ +Q GYAG+N++    +  GM+ ++ + Y+  FATI++AP A  LERK RPKMT
Sbjct  15    PYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALLLERKVRPKMT  74

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
              ++F QIF+ A  G   DQ  Y+ GL  + PT A A++N++PA+TFV AV+FR+E V L+
Sbjct  75    WSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAVIFRMEKVDLK  134

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKN------TVDKNSSSSHGN  857
                 QAK+ GTL+ + GAM++TLY GP++      H +                  S   
Sbjct  135   KVRCQAKVAGTLVTVAGAMMMTLYKGPLMQMAWMSHVQAPHGHGAEAPAAAAAVDPSGRE  194

Query  856   VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSD  677
               LG + VI++  ++++  I QA   K+Y AP S T L CF+   + +++   ++H  S 
Sbjct  195   WFLGSLFVIIATLAWASLFILQAHTLKKYSAPLSLTTLICFVGTLQAIVVTFAMEHRPSV  254

Query  676   WTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W +   M  ++  Y G+V S++A  +    I++ GP++ + F+PL++++ A +    L E
Sbjct  255   WAIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAGMGSFILAE  314

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQVIN---VEDNNKLKEKDAEKTEA  353
             KIY G V+G++LIVVGLY VLWGK  E Q  +   +E     K  DAE T A
Sbjct  315   KIYLGGVLGAVLIVVGLYSVLWGKHKETQEQDAAMMELPVASKGNDAEFTAA  366



>ref|XP_004499808.1| PREDICTED: WAT1-related protein At5g07050-like [Cicer arietinum]
Length=398

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/336 (38%), Positives = 211/336 (63%), Gaps = 6/336 (2%)
 Frame = -1

Query  1381  LPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKM  1202
             +P   M+++Q GYAGVNI+    +  GM+ ++ + Y+  FATIA+AP A   ERK++PK+
Sbjct  17    MPYIAMILLQFGYAGVNIITKLSLNGGMSHYVLVVYRHAFATIAIAPFAIIFERKAQPKV  76

Query  1201  TPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGL  1022
             T  IFFQIFL A  G   DQ  Y+ GL  ++PT + A++N++PA+TF+ AVL R+E + +
Sbjct  77    TFQIFFQIFLLAVLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAMTFLMAVLCRMEKINM  136

Query  1021  RTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAK-NTVDKNSSSSHGNVILG  845
             +    QAK++GT++ + G ML++ Y GP+V    T    ++  N  +   SSS  + +LG
Sbjct  137   KKLICQAKLVGTILTVAGVMLMSFYKGPIVELLWTKDISHSNSNATNNTRSSSKNDWLLG  196

Query  844   PIMVILSCCSYSAFLITQARLSKQY-GAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
              I + +S  ++++F + QA+  + Y     + T+L CF+         + ++H  S WT+
Sbjct  197   SIFLTISTIAWASFFVLQAKALETYKNHQLTLTSLICFIGTLLAFATTMVMEHKTSVWTI  256

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                M  +++ Y+G+V S+++  +    I++KGP++   F+PL++++ AI+    L EKI+
Sbjct  257   GWDMNLLASAYSGIVSSSISYYVQGLVIKKKGPVFATSFSPLMMIIVAIMGSFILAEKIF  316

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVIN--VEDNN  389
              G+V+GSIL+V+GLY VLWGK  E QV N  V+DN+
Sbjct  317   LGSVIGSILVVIGLYSVLWGKHKE-QVNNRVVDDNS  351



>ref|XP_006645793.1| PREDICTED: WAT1-related protein At1g09380-like [Oryza brachyantha]
Length=487

 Score =   245 bits (626),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/326 (41%), Positives = 208/326 (64%), Gaps = 6/326 (2%)
 Frame = -1

Query  1381  LPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKM  1202
             LP+  MV+VQL  AG+N+++   M +GM+P++ +AY+   A   LAP+A+  ERK+   +
Sbjct  11    LPVLAMVLVQLALAGLNVMSKLTMASGMSPYVLLAYRNFNAAAFLAPIAFLFERKTWTAI  70

Query  1201  TPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGL  1022
             +  I FQIF+ +  G T +Q+ YFVGL  S+PTVASAL N +PA+TF+ A    +E   L
Sbjct  71    SKKILFQIFVCSRIGATLNQVLYFVGLKYSSPTVASALNNTLPAVTFLLAAALNMEP--L  128

Query  1021  RTKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWKYAKNTVDKNSSSSHGNVIL  848
               + G+AK+ GT +C+ G+ML+T Y GP+V  +  S + W Y + T+    +  H  V+L
Sbjct  129   EGRAGRAKVAGTAVCVAGSMLMTFYRGPLVRTLPASPVRWPYVQGTMAAAHAGGH-AVVL  187

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             G ++VI S  +++ + I Q  LSK + +PY+ST L   +A  +C  IA   +  ++ W L
Sbjct  188   GAVLVIASNVAWAIWFIIQKTLSKSFASPYTSTVLMALIASVQCAAIAGAAERRLAAWEL  247

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                +R V   Y G+V S +   + SWCI+ +GP++V++F+PL+LV+ A++ WA L EK +
Sbjct  248   GLDIRLVGALYAGIVASGIVCTVMSWCIQERGPVFVSMFSPLVLVVVAVVGWAILGEKTH  307

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQ  413
              G+V+G+ LIVVGLY VLWGK  ++ 
Sbjct  308   VGSVIGAALIVVGLYTVLWGKGRDMD  333



>ref|XP_003546041.1| PREDICTED: WAT1-related protein At3g30340 [Glycine max]
 gb|KHN28631.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=374

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 216/353 (61%), Gaps = 15/353 (4%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
             C +  P  VM+ +   +A VNI+   V+  GMN  + I Y+   ATI +AP+ YF ER  
Sbjct  5     CDEWKPFIVMIAIDFSFAAVNILLKKVLEEGMNHLVFITYRLSIATIFIAPIGYFRERND  64

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
             RP++T  I   +F +A  G +  Q  + +G+  ++ T + A  N++P +TF+ A+ F LE
Sbjct  65    RPRLTFRILCYLFCSAIVGASVTQYFFLLGIQYTSATFSCAFINMVPVVTFMMALPFGLE  124

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWK----YAKNT-VDKNSSS  869
             +V +++K G+AKILG+L+CIGGA++LTLY G  +   S  H++     AK++ V+  S+ 
Sbjct  125   TVKIKSKSGRAKILGSLVCIGGALMLTLYKGKPLFNFS--HYESVSPVAKSSEVNLASTR  182

Query  868   SHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH  689
             + G   +G I + L    +S++ I Q+++SK+Y   YSSTA+  F    +  +I    DH
Sbjct  183   TTGKWTIGVIALALGTIFWSSWFILQSKISKRYPCQYSSTAIMSFFGAIQSAVICFFTDH  242

Query  688   NVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWA  512
             N+S W L   ++ ++  Y G++ S L     SWC++++GP++ A F+PL+ ++ A++   
Sbjct  243   NLSIWVLQGKIQIIAILYAGMIGSGLCFVGMSWCVKKRGPVFTAAFSPLVQIMAAMIDIP  302

Query  511   FLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLK-EKDAEKTE  356
              L E+++ G+VMGSIL+++GLYI+LWGK  E+Q      N  +K  ++AE+T+
Sbjct  303   VLHEQLHLGSVMGSILVIIGLYILLWGKSMEMQ------NRVVKLVQEAEETK  349



>gb|KDP46080.1| hypothetical protein JCGZ_06591 [Jatropha curcas]
Length=392

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 197/328 (60%), Gaps = 4/328 (1%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P+ +MV+ QL ++GVN+        GMN  + IAY+ +FA+  L PLA   ERK RPK+T
Sbjct  14    PILLMVVAQLSFSGVNVFYKLASYDGMNLRVLIAYRFIFASAFLIPLALIFERKIRPKLT  73

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               I FQ FL    G +  Q  Y  GL  ++ T ASA+ NL PA+TFV A+LF LE +GLR
Sbjct  74    KTILFQAFLCGFIGGSLTQTLYVEGLVLTSATFASAMTNLTPAVTFVLAILFGLEKMGLR  133

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAK--NTVDKNSSSSHGNVILG  845
             T  G+AK++GTL+ IGGAMLL  + G  +   ST H    K       + ++S    +LG
Sbjct  134   TLAGKAKVMGTLLGIGGAMLLIFFKGAEIDIWST-HVNLMKLVKPHGGHVAASDSTRVLG  192

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
              ++ I +C S+S +LI QA++S  +  PYSS AL   +A    ++  LC+D ++S W L 
Sbjct  193   SLLSICNCISFSVWLIIQAKMSANFPCPYSSAALMASVAAILQVVFTLCIDRDLSQWKLG  252

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               +R  +  Y G+V   + I L +WC+  KGPLY ++FNPL LV +A+     + E ++ 
Sbjct  253   WNIRLFTAAYAGIVVQGVTITLITWCVSIKGPLYASIFNPLQLVFSALEGSLLIDEPLHV  312

Query  487   GTVMGSILIVVGLYIVLWGKKNELQVIN  404
             G+++G+ LIV GLY VLWGK  E + I+
Sbjct  313   GSILGATLIVCGLYTVLWGKDTEAKKIS  340



>ref|XP_010938846.1| PREDICTED: WAT1-related protein At5g07050-like [Elaeis guineensis]
Length=407

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/337 (38%), Positives = 203/337 (60%), Gaps = 9/337 (3%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+NI+    +  GM+ ++ + Y+  FAT+++AP A  LERK RPK+T
Sbjct  16    PYVAMISLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFATLSIAPFALILERKVRPKLT  75

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               IF QIF     G   DQ  Y+ GL  ++PT + A++N++PA+TFV AVL R+E V L+
Sbjct  76    FWIFMQIFALGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLAVLCRMEKVDLK  135

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPI  839
                 QAK++GTL+ + GAML+TLY GP++    T H    +  V     S+  +   G I
Sbjct  136   KVKCQAKVVGTLVTVAGAMLMTLYKGPIMEMVWTKHLHPHQANVPVAMDSTDKDWFKGSI  195

Query  838   MVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-P  662
              +I++  ++++  I QA   K+Y AP S T+L CF+   + +++ L ++   S W +   
Sbjct  196   FLIIATLAWASLFILQAATLKKYDAPLSLTSLICFVGTLQAIVVTLVMERKPSVWRIGWD  255

Query  661   MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGT  482
             M  ++  Y G+V S++A  +    I+ +GP++ + F+PL++++ AI+    L EKIY G 
Sbjct  256   MNLLAAAYAGIVTSSIAYYVQGLVIQDRGPVFASAFSPLMMIIVAIMGSFILAEKIYMGG  315

Query  481   VMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKD  371
             V+G++LIVVGLY VLWGK          DN + KE++
Sbjct  316   VLGAVLIVVGLYSVLWGK--------YRDNKEKKEQE  344



>dbj|BAJ87280.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=385

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 208/349 (60%), Gaps = 13/349 (4%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P+  MV+VQ  +AGVNI     +  GM+  + +AY+ +FA+  LAP+AYF+ERK R K+T
Sbjct  9     PVAAMVVVQFVFAGVNIFYKLAVSDGMDMRVLVAYRFLFASAVLAPIAYFVERKKRTKVT  68

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +    F+    G +  Q  Y  G+  ++ T ASA+ NLIPAITFV AVLFR E + +R
Sbjct  69    WRVLLLSFVCGLCGGSLAQNLYISGMKLTSATFASAMTNLIPAITFVLAVLFRYERLAIR  128

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSH--------  863
             T  GQAK+ GT++ +GGAMLLT Y G  V      H   A     ++    H        
Sbjct  129   TLAGQAKVTGTMLGVGGAMLLTFYKGAQVTLWPPTHINLAAQLAARHQHDDHNHASSAVH  188

Query  862   ---GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVD  692
                GN  +G ++   SC  Y+ +LI QARLS++Y   YS+TAL C ++  +    ALC D
Sbjct  189   PDSGNRAMGSLLCTGSCFFYALWLILQARLSREYPFHYSTTALMCAMSALQSAAFALCFD  248

Query  691   HNVSDWTLTP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSW  515
              ++  W L+  +R ++  Y G+V S + + + SWC++R+GPL+ +VFNP++LV+ A+LS 
Sbjct  249   RDLLQWRLSSGVRLLAVLYTGVVASGVMLVVLSWCVKRRGPLFASVFNPMMLVVVAVLSS  308

Query  514   AFLREKIYTGTVMGSILIVVGLYIVLWGKKNE-LQVINVEDNNKLKEKD  371
               L E+++ G+V+G++LIV GLY VLWGK  E  Q    +  N+L   D
Sbjct  309   LLLGEELHLGSVLGAVLIVTGLYAVLWGKGREAAQNEPAKAGNELPHID  357



>ref|XP_006491838.1| PREDICTED: WAT1-related protein At1g68170-like isoform X1 [Citrus 
sinensis]
Length=408

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/322 (41%), Positives = 198/322 (61%), Gaps = 11/322 (3%)
 Frame = -1

Query  1303  GMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVG  1124
             GM+  + +AY+ +FAT  + P+A  LERKSRPK+   I FQ FL   FG +  Q  Y   
Sbjct  44    GMSLRVIVAYRFIFATAFMVPVALILERKSRPKLNLKILFQAFLCGLFGGSLSQNLYLES  103

Query  1123  LNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYM  944
             L  ++ T ASA+ANL+PAITFV ++   LE +G+RT+ G+AK+LG+LI IGGAM+LT Y 
Sbjct  104   LVLTSATFASAMANLVPAITFVLSISIGLEKLGIRTRAGKAKVLGSLIGIGGAMILTFYR  163

Query  943   GPVVIGQSTIHWKYAKNTVDKNS--SSSH---GNVILGPIMVILSCCSYSAFLITQARLS  779
             G  +       W    N +  N   +S H   G   LG +  + SC  Y+ +L+ QA++S
Sbjct  164   GVEI-----NIWSTNINLIRSNGHVASLHADPGKRFLGALFALGSCFGYAIWLVIQAKMS  218

Query  778   KQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-PMRAVSTTYNGLVYSALAICL  602
             ++Y   +SSTAL C +   + ++ ALC++ + S W L   +R ++  Y+G+V S L + L
Sbjct  219   EEYPCQFSSTALMCVMGAIQAVVFALCMEKDWSQWKLGWNIRLLTVAYSGIVASGLMVTL  278

Query  601   TSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKN  422
              SWC+  +GPL+ ++FNPL+LV+ AIL    L EK++ G+++G+ LIV GLY VLWGK  
Sbjct  279   ISWCVRTRGPLFASIFNPLMLVVVAILGSLILDEKLHLGSILGATLIVCGLYAVLWGKGK  338

Query  421   ELQVINVEDNNKLKEKDAEKTE  356
             E++ I      K+  + +E  E
Sbjct  339   EMKKITQLVPAKINGESSESIE  360



>ref|XP_004294697.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=380

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/342 (37%), Positives = 208/342 (61%), Gaps = 19/342 (6%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+NI+    +  GM+ ++ + Y+  FAT A+AP A  LERK RPK+T
Sbjct  17    PYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAAIAPFALVLERKIRPKIT  76

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +F ++F+    G   DQ  Y+ GL  ++PT + A++N++PA+TFV AVL R+E + ++
Sbjct  77    FPVFMKLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKLEMK  136

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHG---NVIL  848
                 QAK++GT++ + GAML+TLY G ++    +  W    N  +  SS+++    + + 
Sbjct  137   KVRCQAKLIGTIVTVAGAMLMTLYKGNII----SFPWSAHSNNTNNASSATNNEDKDWLK  192

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             G I++IL+  ++++F I QA   K+Y AP S TA+ CFL   + + +   ++H  + WT+
Sbjct  193   GSILLILATFAWASFFIIQAVTQKRYQAPLSLTAIVCFLGTLQSIAVTFVMEHKPAAWTI  252

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                M  ++  Y G+V S+LA  +    +++ GP++V  F+PL++++ A++    L EKIY
Sbjct  253   GWDMNLLAAAYAGIVSSSLAYYIQGLVMQKTGPVFVTAFSPLMMIIVAVMGSFILAEKIY  312

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAE  365
              G V+G++LIV+GLY VLWGK  E            KEK+AE
Sbjct  313   LGGVLGAVLIVMGLYSVLWGKYKE-----------YKEKEAE  343



>ref|NP_001150619.1| nodulin-like protein [Zea mays]
 gb|ACG39776.1| nodulin-like protein [Zea mays]
Length=413

 Score =   243 bits (619),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 129/351 (37%), Positives = 206/351 (59%), Gaps = 20/351 (6%)
 Frame = -1

Query  1399  MGC--SDLL----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPL  1238
             MGC   D      P   M+ +Q GYAG+N++    +  GM+ ++ + Y+  FAT+++AP 
Sbjct  3     MGCCYGDFFDKAKPYLAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPF  62

Query  1237  AYFLERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFV  1058
             A  LERK RP MT ++F QIF+ A  G   DQ  Y+ GL  + PT A A++N++PA+TFV
Sbjct  63    ALILERKVRPNMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFV  122

Query  1057  AAVLFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKN  878
              AV+FR+E V L+    QAK+ GTL+ + GAM++TLY GP++     + W  + +     
Sbjct  123   MAVIFRMEKVDLKKMRCQAKVAGTLVTVAGAMMMTLYKGPLM----KMAWTSSGHAHGGG  178

Query  877   S-------SSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFE  719
                       S     LG + VI++  ++++  I QA   KQY AP S T L CF+   +
Sbjct  179   GGAEAAVIDPSGREWFLGSLFVIVATLAWASLFILQAHTLKQYAAPLSLTTLICFVGTLQ  238

Query  718   CLIIALCVDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLL  542
              +++   ++H  S WT+   M  ++  Y G+V S++A  +    I++ GP++ + F+PL+
Sbjct  239   AIVVTFAMEHRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLM  298

Query  541   LVLTAILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNN  389
             +++ A++    L EKI+ G V+G++LIV+GLY VLWGK  E Q  + ED+ 
Sbjct  299   MIIVAVMGSFILAEKIFLGGVLGAVLIVIGLYSVLWGKHKETQ--DKEDDE  347



>ref|XP_007051368.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOX95525.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=356

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/352 (37%), Positives = 203/352 (58%), Gaps = 13/352 (4%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
             C    P+  MV V    A  N +   ++  G++  I + Y+Q  + + LAP+AYF ERKS
Sbjct  4     CGQWKPVAAMVAVNFALAVTNFLVKRILDEGVSHIIILIYRQAISAVFLAPIAYFWERKS  63

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
             RPK+T  I   +F+TA  G T  Q  + +GL  +T T + A  N++PA+TF+ A+ F LE
Sbjct  64    RPKLTARILCHLFITALIGATLSQYFFLLGLEYTTATFSCAFINMVPAVTFMLALPFGLE  123

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVI---GQSTIHWKYAKNTVDKNSSSSH  863
              V +R K G AK+ GTL+CI GAM+LTLY G  ++    ++T H     NT+   S+   
Sbjct  124   KVDIRNKAGGAKVFGTLVCIAGAMVLTLYRGKTLVKSNSRATTHIINYANTMI--STKKK  181

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
                 +G I++ + C  +S++ + QAR+ K Y   YSSTA   F +  +  I++L  + N 
Sbjct  182   ERWAIGSILLTVGCIFWSSWFLLQARIGKTYPYQYSSTAFLSFFSAIQSAILSLVAERNF  241

Query  682   SDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             S W L   +  ++ TY G+V S L     SWC+++KGP++ + F PL+ +  A+  +  L
Sbjct  242   SKWILKGKLELITVTYAGMVASGLCYVGMSWCVKQKGPVFTSAFTPLVQIFVAMFDFFIL  301

Query  505   REKIYTG--TVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTE  356
               +IY G  +V+GSIL+V+GLYI+LWG+ +E      E+ N+ K+   E+ E
Sbjct  302   HGQIYFGRNSVVGSILVVIGLYILLWGRNSE-----AEETNQRKQPQVEQEE  348



>ref|XP_010260942.1| PREDICTED: WAT1-related protein At1g43650 [Nelumbo nucifera]
Length=362

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 129/348 (37%), Positives = 212/348 (61%), Gaps = 15/348 (4%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P FVM+ +Q  YAG+ + +   +  GMNPFI +AY+Q FA +ALAP A+FLERK  P ++
Sbjct  16    PYFVMIFIQFIYAGMALFSKVAIEKGMNPFIFVAYRQAFAVLALAPFAFFLERKKAPPIS  75

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +  ++FL A  G+T     Y+V +N ++ T A+A  N+IPA+TF+ AV  R+E++ L+
Sbjct  76    YALLCKVFLVALCGITLSSNLYYVAINYTSATFAAASTNVIPALTFIMAVFLRMENLSLK  135

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQS---TIHWKYAKNTVDKNSSSSHGNVIL  848
                G AK++G++ICIGGA++++LY GP +   +   ++H   A  +  K+SSS+      
Sbjct  136   HLYGVAKVVGSVICIGGALVVSLYQGPPIKFMNWYPSVHGDAAGQSAIKHSSSTDWK--R  193

Query  847   GPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL  668
             G ++++ +  ++S +L+ QA + K Y A  S T + CF +  +  I+A+ ++ N S W L
Sbjct  194   GSLVMLSANTAWSLWLVLQASIVKIYPAKLSLTTMQCFFSCIQSTILAIALERNPSSWKL  253

Query  667   T-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIY  491
                +  +S  Y G++ + +   L  WCIE+KGP++ A+F PL L++TAI S    +E ++
Sbjct  254   GWDVSLLSVAYCGIIVTGITYWLQVWCIEKKGPVFTAIFTPLALLITAIFSAFLWKETLH  313

Query  490   TGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
              G++ G+I++V GLY VLWGK  E           L E+  ++ EA E
Sbjct  314   WGSIGGAIILVGGLYSVLWGKTKE---------EGLSERSEQREEAKE  352



>gb|KHN47404.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=374

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 213/353 (60%), Gaps = 15/353 (4%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
             C +  P  VM+ +   +A VNI+   V+  GMN  + I Y+   ATI +AP+ YF +R  
Sbjct  5     CDEWKPFIVMIAIDFSFAAVNILLKKVLEEGMNHLVFITYRLSIATIFIAPIGYFRDRND  64

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
             RP++T  I   +F +A  G +  Q  + +G+  ++ T + A  N++P +TF+ A+ F LE
Sbjct  65    RPRLTFRILCYLFCSAIVGASVTQYFFLMGIQYTSATFSCAFINMVPVVTFMMALPFGLE  124

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYA-----KNTVDKNSSS  869
             +V ++ K G+AKILG+L+CIGGA++LTLY G  +   S  H++        + V+  S+ 
Sbjct  125   TVKIKCKSGRAKILGSLVCIGGALMLTLYKGKPLFNFS--HYESVSPVANSSAVNLASTR  182

Query  868   SHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDH  689
             + G   +G I ++L    +S++ I Q+++SK+Y   YSSTA+  F    +  +I    DH
Sbjct  183   TKGKWTIGVIALVLGTIFWSSWFILQSKISKRYPCQYSSTAIMSFFGAIQSAVICFFTDH  242

Query  688   NVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWA  512
             N+S W L   ++ ++  Y G++ S L     SWC++++GP++ A F+PL+ ++ A++   
Sbjct  243   NLSIWVLKGKIQIIAILYAGMIGSGLCFVGMSWCVKKRGPVFTAAFSPLVQIMAAMIDIP  302

Query  511   FLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLK-EKDAEKTE  356
              L E+++ G+VMGSIL+++GLYI+LWGK  E+Q      N  +K  ++AE+T+
Sbjct  303   VLHEQLHLGSVMGSILVIIGLYILLWGKSMEMQ------NRVVKLVQEAEETK  349



>ref|XP_003524084.1| PREDICTED: WAT1-related protein At1g68170-like [Glycine max]
Length=385

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/350 (37%), Positives = 212/350 (61%), Gaps = 12/350 (3%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             DL P+F+MV VQ+ Y+ VN++    +  GM+  +  AY+ MFA +  + LA   ERKSRP
Sbjct  10    DLKPVFLMVSVQIAYSSVNVLYKLAINDGMSIRVVTAYRLMFAVVFTSSLALIFERKSRP  69

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  + F  F +  FG +     +   L+  + T A+A+ NL+PA+TF+ A+L  +E +
Sbjct  70    KLTWRVLFMSFFSGLFGASLFHNLFLEALDLVSATFATAVYNLVPAVTFILAILCGMEKL  129

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSS-----SSH  863
              +RT  G+AK++GT+I IGG+MLLT + G  +  +S     +  N + KN       +  
Sbjct  130   NVRTAAGKAKVMGTIIGIGGSMLLTFFKGQEINVKS-----FGTNLLQKNEQVVALHTDS  184

Query  862   GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV  683
             G   LG +    SC S++ +LI Q+++SK+Y + +SSTAL   +A  +    AL V+ + 
Sbjct  185   GKKFLGVLCGFGSCFSFALWLIIQSKMSKEYPSHHSSTALMSLMAAIQATAFALYVEKDW  244

Query  682   SDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             S W L + +R ++  Y  +V S L + + +WC+  +GP++V+VFNPL+LVL A+      
Sbjct  245   SQWKLGSSIRILTVAYTAIVASGLVVIVIAWCVRMRGPMFVSVFNPLMLVLVAVADSLMF  304

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTE  356
              E +Y G+VMG++LIV GLY+VLWGK  E++  N+  ++++ + + E TE
Sbjct  305   GENLYVGSVMGAMLIVGGLYMVLWGKSKEMKKANLSVSSEINQ-EHEATE  353



>gb|ADE76940.1| unknown [Picea sitchensis]
Length=371

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/345 (39%), Positives = 208/345 (60%), Gaps = 24/345 (7%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P    V VQ+ YAG+NI+    +  GMN F+ + Y+Q+ AT+ +APLAY LER+ RP +T
Sbjct  13    PHIAQVAVQVAYAGMNIITRVALVDGMNNFVFVTYRQIVATLVIAPLAYVLEREQRPPLT  72

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
              +IF QIFL A  G+T +Q  YF GL  +  T ASA  NLIP +TFV A + R E V +R
Sbjct  73    RSIFLQIFLLALCGITVNQNLYFAGLYYTNSTFASATTNLIPVVTFVMATVLRYEKVEIR  132

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNV-----  854
                G+AK++GT IC+GGAM++TLY GPV+           K     NS++++ N+     
Sbjct  133   KMRGKAKVVGTTICVGGAMVITLYKGPVI-----------KLLTAYNSTANYNNILGSKR  181

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIA-LCVDHNVSD  677
             +LG I++  S  ++S+++  Q  ++K+Y A  S TAL C L   +  ++A +C     S 
Sbjct  182   VLGCILLFASVFTWSSWITFQVPVAKKYPAELSLTALMCMLGAVQSGVLAFICEYKTPSV  241

Query  676   WTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W+++  +  +S  Y G++ SA A  + +WC+  KGP++ A+FNPL  +L A+L      +
Sbjct  242   WSISWNIEPLSYVYTGVLCSAFAFFVQTWCVHTKGPVFAAIFNPLSTILVALLECLVFHD  301

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAE  365
              ++ G+V+G++LIV GLY VLWGK  + ++      ++  E +AE
Sbjct  302   NLHAGSVVGAVLIVGGLYSVLWGKAKDNEI------DQRGESEAE  340



>gb|ACL54205.1| unknown [Zea mays]
 tpg|DAA57217.1| TPA: nodulin-like protein [Zea mays]
Length=413

 Score =   242 bits (618),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 129/351 (37%), Positives = 206/351 (59%), Gaps = 20/351 (6%)
 Frame = -1

Query  1399  MGC--SDLL----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPL  1238
             MGC   D      P   M+ +Q GYAG+N++    +  GM+ ++ + Y+  FAT+++AP 
Sbjct  3     MGCCYGDFFDKAKPYLAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPF  62

Query  1237  AYFLERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFV  1058
             A  LERK RP MT ++F QIF+ A  G   DQ  Y+ GL  + PT A A++N++PA+TFV
Sbjct  63    ALILERKVRPNMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFV  122

Query  1057  AAVLFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKN  878
              AV+FR+E V L+    QAK+ GTL+ + GAM++TLY GP++     + W  + +     
Sbjct  123   MAVIFRMEKVDLKKVRCQAKVAGTLVTVAGAMMMTLYKGPLM----KMAWTSSGHAHGGG  178

Query  877   S-------SSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFE  719
                       S     LG + VI++  ++++  I QA   KQY AP S T L CF+   +
Sbjct  179   GGAEAAVIDPSGREWFLGSLFVIVATLAWASLFILQAHTLKQYAAPLSLTTLICFVGTLQ  238

Query  718   CLIIALCVDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLL  542
              +++   ++H  S WT+   M  ++  Y G+V S++A  +    I++ GP++ + F+PL+
Sbjct  239   AIVVTFAMEHRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLM  298

Query  541   LVLTAILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNN  389
             +++ A++    L EKI+ G V+G++LIV+GLY VLWGK  E Q  + ED+ 
Sbjct  299   MIIVAVMGSFILAEKIFLGGVLGAVLIVIGLYSVLWGKHKETQ--DKEDDE  347



>emb|CDP06236.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   242 bits (617),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 203/323 (63%), Gaps = 1/323 (0%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P F M+ +Q GYAG+N++    +  GM+ ++ + Y+  FAT  +AP A FLERK RPK+T
Sbjct  16    PYFAMICLQFGYAGMNVITKVSLNRGMSHYVLVVYRHAFATAVIAPFAIFLERKVRPKIT  75

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               IF QIF+    G   DQ  Y+ GL  ++PT + A++N++PA+TFV AVL R+E V ++
Sbjct  76    FPIFMQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVHIK  135

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPI  839
                 QAK++GT++ + GAML+TLY G V+    + H +   ++    ++ S  + + G I
Sbjct  136   KIRCQAKVIGTVVTVAGAMLMTLYKGHVINLVWSEHVQPHYSSAPAAAAISDKDWVKGSI  195

Query  838   MVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-P  662
             ++IL+  ++++F I QA   K+Y AP S T+L CF+   + + +   ++H  S WT+   
Sbjct  196   LLILATLAWASFFILQAFTMKRYTAPLSLTSLVCFMGTLQSIAVTFVMEHKASVWTIGWD  255

Query  661   MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGT  482
             +  ++  Y G+V S++A  +    +E++GP++V  F+PL++++ AI+    L EKIY G 
Sbjct  256   INLLAAAYAGIVSSSIAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYVGG  315

Query  481   VMGSILIVVGLYIVLWGKKNELQ  413
             V+G+ILIV GLY VLWGK  E Q
Sbjct  316   VLGAILIVFGLYSVLWGKYKEYQ  338



>ref|XP_010906409.1| PREDICTED: WAT1-related protein At5g07050-like [Elaeis guineensis]
Length=379

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/350 (37%), Positives = 211/350 (60%), Gaps = 19/350 (5%)
 Frame = -1

Query  1393  CSDLL----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFL  1226
             CSD L    P   M+ +Q GYAG+NI++   +  GM+ ++ + Y+  FAT+++AP A + 
Sbjct  4     CSDFLQRAKPYVAMISLQFGYAGMNIISKVSLNHGMSHYVLVVYRHAFATLSIAPFALYF  63

Query  1225  ERKSRPKMTPNIFFQIFLTATFGLTG------DQIAYFVGLNNSTPTVASALANLIPAIT  1064
             ER   P++T +IF QIF+    GL        DQ  Y+ GL  ++PT + A++N++PA+T
Sbjct  64    ERNVWPRITFSIFVQIFVLGLLGLVYVSRPVIDQNFYYAGLKFTSPTFSCAMSNILPAMT  123

Query  1063  FVAAVLFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVD  884
             FV AV+ R+E V L+    QAK++GTL+ + GAML+TLY GP++    T H +  +++V 
Sbjct  124   FVMAVICRMEKVDLKKIRCQAKVVGTLVTVAGAMLMTLYKGPIMEMVWTKHVQPHRSSVP  183

Query  883   KNSSSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIA  704
             + + SS  + + G I ++++  +++A  + QA   KQY A  S T L CF+   + + + 
Sbjct  184   ETTDSSDKDWLKGSIFLVIATLAWAALFVLQAVTLKQYSAQLSLTTLICFMGTLQAIAVT  243

Query  703   LCVDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTA  527
             L ++H  S W +   M  ++  Y G+V S++A  +    ++ +GP++ + F+PL++++ A
Sbjct  244   LVMEHKPSVWKIGWDMNLLAAAYAGIVTSSIAYYVQGLVMQSRGPVFASAFSPLMMIIVA  303

Query  526   ILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKE  377
             I+    L EKIY G V+G++LIVVGLY VLWGK  E        N  +KE
Sbjct  304   IMDSFILAEKIYLGGVLGAVLIVVGLYSVLWGKYKE--------NKDIKE  345



>ref|XP_009615510.1| PREDICTED: WAT1-related protein At1g68170-like isoform X1 [Nicotiana 
tomentosiformis]
Length=388

 Score =   241 bits (615),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 137/351 (39%), Positives = 216/351 (62%), Gaps = 10/351 (3%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             ++ PL +M++ Q+  AG+NIV       GMN  I I Y+ +FA++ + PLA+F+ER  R 
Sbjct  13    EMRPLLLMILGQIILAGMNIVFKLATSDGMNFSILIFYRCLFASVFMVPLAFFIERGKRS  72

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  + FQ FL    G +  Q  Y   L  ++ T  SA+ NLIPAITFV A++ RLE +
Sbjct  73    KLTKMVIFQGFLCGLLGGSLGQNMYLQSLVYTSATFVSAMFNLIPAITFVVAIILRLEKL  132

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             GL+T  G+AK+LGTL+CI GAMLLTLY GP + +G++ I      N +           +
Sbjct  133   GLKTPAGKAKVLGTLVCISGAMLLTLYKGPEINMGKTNI------NLLHSTHHKGESKPL  186

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             +G ++ +  C  Y+  LI QA+ +++Y  PYS TAL   +A  +C ++A+ V+ +  +W 
Sbjct  187   VGALLALAGCTCYALLLIVQAKAAQRYPCPYSFTALLNVMAAVQCFVVAVVVERDWKEWK  246

Query  670   LT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L   +R +++ Y G+  S +   + +W +  KGP+YV+VFNPL+LV+ AI  + FL EK+
Sbjct  247   LGWNVRLLASAYTGIFCSGVLFTIIAWVVRMKGPVYVSVFNPLMLVMVAISGYLFLEEKL  306

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVIN--VEDNNKLKEKDAEKTEAGE  347
             Y G+V+GSI+I+ GLY+VLWGK  E++ ++  V D  ++  K +   ++  
Sbjct  307   YLGSVLGSIVIICGLYVVLWGKDKEIKKLSQLVPDKEEIDIKSSSLKDSSR  357



>ref|XP_004485925.1| PREDICTED: WAT1-related protein At3g30340-like [Cicer arietinum]
Length=362

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/328 (37%), Positives = 197/328 (60%), Gaps = 4/328 (1%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
             C +  P  +M+ +   +A VNI+   V+  GMN  + I Y+   ATI +AP+ YF ER S
Sbjct  4     CDEWKPFMIMIAIDFSFAAVNILLKKVLDEGMNHLVFITYRLSIATIFVAPIGYFRERNS  63

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
             RP++T  I   +FL+A  G +  Q  + +G+ N++ T A A  N++P +TF+ A+ F LE
Sbjct  64    RPRLTLRILCYLFLSAIVGASVTQYFFLLGIENTSATFACAFVNMVPVVTFLLALPFGLE  123

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNV  854
             +V ++   G+AKI+GTL+CI GA+LLTLY G    G          ++V   S+ +    
Sbjct  124   TVDIKCNSGRAKIVGTLVCIVGALLLTLYKGK---GLFNFSQHDQSSSVKLASTRTPEKW  180

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDW  674
              +G I +IL    +S + I Q+++SK Y   YSSTA+  F    +  +I L +DHN+S W
Sbjct  181   SIGVIALILGTLFWSFWFILQSKISKTYPCQYSSTAIMSFFGAIQSAVICLFIDHNLSIW  240

Query  673   TLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREK  497
              L   ++ ++  Y G++ S L     SWC++++GP++ A F+P + ++ A++    L E+
Sbjct  241   VLRGKIQIIAILYAGIIGSGLCFVGMSWCVKKRGPVFTAAFSPFVQIMAAMIDIPVLHEQ  300

Query  496   IYTGTVMGSILIVVGLYIVLWGKKNELQ  413
             +Y G VMGSIL+++GLYI+LWGK  E++
Sbjct  301   LYLGNVMGSILVMIGLYILLWGKSKEMK  328



>ref|XP_007218191.1| hypothetical protein PRUPE_ppa007702mg [Prunus persica]
 gb|EMJ19390.1| hypothetical protein PRUPE_ppa007702mg [Prunus persica]
Length=358

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/347 (35%), Positives = 208/347 (60%), Gaps = 4/347 (1%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
             C    P+  M+++    A VN++    +  G+N  I + Y+Q  + + LAP+A+F ERKS
Sbjct  4     CEQWKPIVAMLVINFALAMVNVLLKKTLDQGLNHLIIVTYRQSISAVFLAPIAFFWERKS  63

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
             RP++T  I  Q+F +A  G+T  Q  + +GL  ++ T + A  N++P  TF+ A+ F LE
Sbjct  64    RPELTFRIICQLFFSALIGVTFTQYLFLIGLQYTSATYSCAFINMVPVFTFLLALPFGLE  123

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSH-GN  857
              V +++KGG AKILG LICI GA+ LTLY G  +   ++      +N V+  +S+   G 
Sbjct  124   KVNIKSKGGIAKILGALICIAGALSLTLYKGMPLTNPNSQDTTQMQNHVNTMTSAKKTGR  183

Query  856   VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN--V  683
               +G +++++ C  +S++ + QA++ K Y   YSSTA+  F    +  I+ L  + N  +
Sbjct  184   WAVGSVLLLVGCLLWSSWFLIQAKIGKSYPFQYSSTAILSFFGAIQAAILYLITERNLTM  243

Query  682   SDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFL  506
             S W +   +  +S TY G V S L     SWC+++KG L+ A F P + +  A++ ++F 
Sbjct  244   SMWAMKGKLEILSVTYAGAVGSGLCYVGMSWCVKQKGALFTAAFTPTIQIFVAMVDFSFF  303

Query  505   REKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAE  365
              E+IY G+V+GS+L+++G+YI+LWGK N+ ++I ++     +++DAE
Sbjct  304   HEQIYLGSVVGSVLVIIGMYILLWGKSNDPKLIVIKHTQAAEDEDAE  350



>ref|XP_006491488.1| PREDICTED: WAT1-related protein At3g30340-like [Citrus sinensis]
 gb|KDO86675.1| hypothetical protein CISIN_1g041425mg [Citrus sinensis]
Length=366

 Score =   240 bits (612),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 126/358 (35%), Positives = 206/358 (58%), Gaps = 11/358 (3%)
 Frame = -1

Query  1399  MGC-SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLE  1223
             M C    +P+ +MV V  G+A VN     ++  G+N  + +AY+Q  + + LAP+ YF E
Sbjct  1     MNCHGQWMPVLMMVAVNFGFATVNAFLRKIIDRGLNHLVIVAYRQSISVVFLAPIVYFRE  60

Query  1222  RKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLF  1043
             RK+RPK+T +I  Q+F +A  GLT  Q     GL  ++ T   A  N +P ITF+ A+ F
Sbjct  61    RKNRPKLTIHILCQLFFSALIGLTLTQYFLLRGLEYTSATFLCAFLNTVPVITFLLALPF  120

Query  1042  RLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKN-----  878
              LE V +    G+ K+LGT++C+GGA+LLTLY G ++   S  H       V  +     
Sbjct  121   GLEKVNVNGLAGKTKVLGTVVCVGGAVLLTLYKGKLI---SNPHLPATNYNVTSHAKMMI  177

Query  877   SSSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALC  698
             SS      I+G I +I  C ++S++ + QAR+ K++   YSST +  F    +  I++L 
Sbjct  178   SSKKTERWIIGSIFLIAGCTTWSSWFLMQARIGKRFPCQYSSTTIISFFGAIQSAILSLI  237

Query  697   VDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAIL  521
             ++ N+  W L   +  +   Y G+V S L     SWC++++GP++ + F+PL  ++ AI 
Sbjct  238   IERNLPGWVLKGKLETIGVIYCGMVGSGLCYVGMSWCVKKRGPVFTSAFSPLTQIVVAIF  297

Query  520   SWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
              ++ LRE+IY G+ +GSIL++VG+YI+LWGK  E++  +     +  ++D E+ +A  
Sbjct  298   DFSVLRERIYLGSALGSILVIVGMYILLWGKSKEIEEFDQMKQGQAAQQD-ERCDAAS  354



>emb|CDO97499.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   241 bits (616),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 149/332 (45%), Positives = 213/332 (64%), Gaps = 7/332 (2%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P  +MV+VQ+  AGVNI        GM+  I +AY+ MFA  A+ PLA + ER SRPK+T
Sbjct  15    PTMMMVMVQVALAGVNIFYKLAANDGMSMRIMVAYRFMFAAAAVVPLALYFERNSRPKLT  74

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               + F+ FL A FG +  Q  Y   L  ++ T ASA  NLIPA+TF+ AV FRLE   L+
Sbjct  75    WMVLFEAFLCAFFGGSLAQNLYAQSLILTSATFASATTNLIPALTFIIAVFFRLEKFELK  134

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQST-IHWKYAKNTVDKNS-SSSHGNV---  854
             TK G+AK+ GTLIC+GGAMLLT Y G  +   ST +   +  N +     ++SH N    
Sbjct  135   TKAGKAKVTGTLICLGGAMLLTFYKGAEINLWSTHLGLLHENNRLHAGHLAASHQNSRNH  194

Query  853   ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNV-SD  677
             ILGP++ I S  S +  LI QA++S++Y   YSSTAL C +   + +I ALCV++N  ++
Sbjct  195   ILGPLLAISSSFSAALSLIFQAKMSERYPCHYSSTALICLMGSLQTVIFALCVENNRWNE  254

Query  676   WTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W L   +R ++ +Y+G V S + I +T WC+  +GPL+V+VF+PL+L+L AI    FL E
Sbjct  255   WKLGWNIRLLAVSYSGTVASGIMITVTMWCVRMRGPLFVSVFSPLMLILVAIAGSLFLDE  314

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQVIN  404
             K++ G+V+G+ +I+VGLY VLWGK  E++ I+
Sbjct  315   KLHLGSVLGAFVIIVGLYSVLWGKGKEMKRIS  346



>ref|XP_006444680.1| hypothetical protein CICLE_v10023809mg [Citrus clementina]
 gb|ESR57920.1| hypothetical protein CICLE_v10023809mg [Citrus clementina]
Length=362

 Score =   240 bits (612),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 126/356 (35%), Positives = 206/356 (58%), Gaps = 11/356 (3%)
 Frame = -1

Query  1399  MGC-SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLE  1223
             M C    +P+ +MV V  G+A VN     ++  G+N  + +AY+Q  + + LAP+ YF E
Sbjct  1     MNCHGQWMPVLMMVAVNFGFATVNAFLRKIIDRGLNHLVIVAYRQSISVVFLAPIVYFRE  60

Query  1222  RKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLF  1043
             RK+RPK+T +I  Q+F +A  GLT  Q     GL  ++ T   A  N +P ITF+ A+ F
Sbjct  61    RKNRPKLTIHILCQLFFSALIGLTLTQYFLLRGLEYTSATFLCAFLNTVPVITFLLALPF  120

Query  1042  RLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKN-----  878
              LE V +    G+ K+LGT++C+GGA+LLTLY G ++   S  H       V  +     
Sbjct  121   GLEKVNVNGLAGKTKVLGTVVCVGGAVLLTLYKGKLI---SNPHLPATNYNVTSHAKMMI  177

Query  877   SSSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALC  698
             SS      I+G I +I  C ++S++ + QAR+ K++   YSST +  F    +  I++L 
Sbjct  178   SSKKTERWIIGSIFLIAGCTTWSSWFLMQARIGKRFPCQYSSTTIISFFGAIQSAILSLI  237

Query  697   VDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAIL  521
             ++ N+  W L   +  +   Y G+V S L     SWC++++GP++ + F+PL  ++ AI 
Sbjct  238   IERNLPGWVLKGKLETIGVIYCGMVGSGLCYVGMSWCVKKRGPVFTSAFSPLTQIVVAIF  297

Query  520   SWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEA  353
              ++ LRE+IY G+ +GSIL++VG+YI+LWGK  E++  +     +  ++D E+ +A
Sbjct  298   DFSVLRERIYLGSALGSILVIVGMYILLWGKSKEIEEFDQMKQGQAAQQD-ERCDA  352



>ref|NP_001242267.1| uncharacterized protein LOC100811617 [Glycine max]
 gb|ACU19947.1| unknown [Glycine max]
Length=393

 Score =   241 bits (614),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 128/342 (37%), Positives = 206/342 (60%), Gaps = 13/342 (4%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q G+AG+NI+    +  GM+ ++ + Y+  FAT A+AP A  LERK RPK+T
Sbjct  16    PYIAMISLQFGFAGMNIITKVSLNRGMSHYVLVVYRHAFATAAIAPFAIVLERKVRPKIT  75

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +F QIF+    G   DQ  Y+ GL  ++PT + A++N++PA TFV A +FR+E + +R
Sbjct  76    FLMFMQIFVLGLLGPVIDQNLYYAGLKFTSPTYSCAISNMLPATTFVMAAIFRMEKLNVR  135

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTV-DKNSSSSHGNVILGP  842
                 QAK++GT++ + GAML+TLY G V+    + +  + +N V + N+ S   +   G 
Sbjct  136   KVRCQAKVIGTVVTVAGAMLMTLYKGQVISFLGSKYMHHPRNYVPENNTDSGEKDWFKGS  195

Query  841   IMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-  665
             ++++L+  S+++F I QA   ++Y A  S TAL C L   + + +   ++H  S WT+  
Sbjct  196   VLLVLATLSWASFFILQAVTLRKYPAQLSLTALVCALGTLQSIAVTFVMEHKPSVWTIGW  255

Query  664   PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTG  485
              M  ++  Y G++ S +A  +    +++KGP++V  F+PL++++ AI+    L EKIY G
Sbjct  256   DMNLLAAAYAGIISSGIAYYVQGIVMQKKGPVFVTAFSPLMMIIVAIMGTFILAEKIYLG  315

Query  484   TVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKT  359
              V+G+ILIV+GLY VLWGK  E            KEK+AE T
Sbjct  316   GVIGAILIVMGLYSVLWGKHKE-----------NKEKEAEIT  346



>gb|ABR18253.1| unknown [Picea sitchensis]
Length=429

 Score =   242 bits (617),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 126/326 (39%), Positives = 201/326 (62%), Gaps = 8/326 (2%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+NI+    +  GM+ ++ + Y+   AT  +AP A+F+ERK RPK+T
Sbjct  21    PYIAMISLQFGYAGMNIITKVSLTNGMSHYVLVVYRHAVATAVIAPFAFFVERKVRPKLT  80

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
              ++F QIF     G   DQ  Y+ GL  ++PT A A++N++PA+TFV A LFR+E V ++
Sbjct  81    FSVFCQIFALGLLGPVIDQNFYYAGLKYTSPTFACAMSNVLPAMTFVMAALFRMEKVDIK  140

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
                 Q KI GT++C+ GAML+TLY GP+V   GQ+      + ++V  +   + G+V+L 
Sbjct  141   KVRSQTKIAGTVVCVAGAMLMTLYKGPIVPIFGQAHHSHFSSPSSVHSDKDWTKGSVLL-  199

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
                 + +C +++AF I QA + KQY A  S T L CF+   + + I L ++ + S W L 
Sbjct  200   ----VAACLAWAAFFILQAAVLKQYSAQLSLTTLICFMGTLQSITITLVIERDPSLWALG  255

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               M  ++  Y+G+V S +A  +   C++ KGP++   F+PL++++ AI+    L E IY 
Sbjct  256   WNMNLLTAVYSGIVASGIAYYVQGLCMKLKGPVFATAFSPLMMIIVAIMGSIILAESIYL  315

Query  487   GTVMGSILIVVGLYIVLWGKKNELQV  410
             G+V+G +LIV+GLY VLWGK  + ++
Sbjct  316   GSVVGGVLIVLGLYAVLWGKVKDHKI  341



>ref|XP_009601128.1| PREDICTED: WAT1-related protein At1g68170-like [Nicotiana tomentosiformis]
Length=401

 Score =   241 bits (614),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 138/348 (40%), Positives = 210/348 (60%), Gaps = 16/348 (5%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P+ +MV VQ+ YAG+++        GM+  + IAY+ +FA   + PLA + +RK RPK
Sbjct  11    LKPVIMMVFVQIAYAGMSLFYKLASNNGMSLRVLIAYRFLFAAATVIPLALYFDRKIRPK  70

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  +    FL A FG +  Q  +   L  ++ T A+A+ NLIP ITFV A+ FRLE +G
Sbjct  71    LTWMVMLLAFLCALFGGSMAQNLFAASLVLTSATFATAMINLIPGITFVIAIFFRLEKLG  130

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNV---  854
             L+T+ GQAK+LGTLI IGGAMLLT Y G  +   ST      K       ++SH +    
Sbjct  131   LKTRAGQAKVLGTLIGIGGAMLLTFYKGLEIKTWST------KIVFSGQMAASHQHQKPY  184

Query  853   --ILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
               ILGPI+ I SC S +  LI QA++S+ Y   +SSTAL   +   +  + ALC + + S
Sbjct  185   AHILGPILAICSCFSTALSLIFQAKMSELYPCHFSSTALISIMGALQAGVFALCTERDWS  244

Query  679   DWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W L   +R +   Y G+V S + I    +C+  +GPL++++F PL+LV  AI S+ FL 
Sbjct  245   QWKLGWNLRLLIVAYAGIVASGITIIFLMFCVRMRGPLFLSIFTPLMLVCVAIASFLFLN  304

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNEL----QVINVEDNNKLKEKD  371
             EK++ G+V+G+ +I+ GLY+VLWGK  E+    ++   + +++L+++D
Sbjct  305   EKLHLGSVIGAAIIIFGLYVVLWGKNQEIKRASKLTPSQSSDELEQED  352



>ref|XP_002298718.1| hypothetical protein POPTR_0001s31530g [Populus trichocarpa]
 gb|EEE83523.1| hypothetical protein POPTR_0001s31530g [Populus trichocarpa]
Length=367

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/361 (38%), Positives = 212/361 (59%), Gaps = 11/361 (3%)
 Frame = -1

Query  1399  MGCS---DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYF  1229
             M C+    + P   M+ VQ+ + G+NI    V+  GM+  + +AY+ +F    L P+A  
Sbjct  1     MACTCFGSVHPGIAMIFVQIVFGGINIFYKLVINDGMSIRVAVAYRLLFGAAFLCPIALI  60

Query  1228  LERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAV  1049
             +ER  RPK+T  +FFQIF  A FG +     Y   LN ++ T A+AL NL PA T++ A+
Sbjct  61    VERNKRPKLTWVVFFQIFFLALFGGSIYHNLYLASLNLTSMTFAAALYNLSPAFTYIVAL  120

Query  1048  LFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIH-WKYAKNTVDKNS  875
             LFR+E++ L    G A + GT ICIGGAMLLT Y G  + I  + I+  KY  N   +N+
Sbjct  121   LFRMETLSLNNARGIANVAGTAICIGGAMLLTFYKGIEINIWHTNINLLKYHHNH-HQNT  179

Query  874   SSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCV  695
               S    + G  + +++C  Y+ ++I QA+++++Y   YSSTAL   +   + +I ALC 
Sbjct  180   VGSVKQQMFGLAISLIACVFYAFWVILQAKINERYPCFYSSTALMSLMGSIQAIIYALCF  239

Query  694   DHNVSDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILS  518
             +   SDW L + +R +S  Y G + S L I L +WCI ++GPLYVA+FNPL+L++ A+  
Sbjct  240   ERKWSDWKLESNIRLISVIYLGFLASGLNITLMAWCIAKRGPLYVAIFNPLMLLVVALAG  299

Query  517   WAFLREKIYTGTVMGSILIVVGLYIVLWGK----KNELQVINVEDNNKLKEKDAEKTEAG  350
                 +EK++ G+++G +LI+ GLY VLWGK    KN+ Q   + +N+  +  +   T   
Sbjct  300   SLVFQEKLHLGSILGGVLIITGLYTVLWGKSKNAKNKKQPAVLPNNSDQESPEVAVTPQS  359

Query  349   E  347
             E
Sbjct  360   E  360



>ref|XP_006654584.1| PREDICTED: WAT1-related protein At5g07050-like [Oryza brachyantha]
Length=407

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/363 (37%), Positives = 209/363 (58%), Gaps = 21/363 (6%)
 Frame = -1

Query  1393  CSDLL----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFL  1226
             CS  +    P F M+ +Q GYAG+N++    +  GM+ ++ + Y+  FATI++AP A  L
Sbjct  5     CSGFMDRAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALIL  64

Query  1225  ERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVL  1046
             ERK RPKMT +IFFQIF+ A  G   DQ  Y+ GL  + PT A A++N++PA+TFV AV+
Sbjct  65    ERKVRPKMTWSIFFQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAVI  124

Query  1045  FRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSS-  869
             FR+E + L+    QAKI GTL+ + GAML+TLY GP++     + W           ++ 
Sbjct  125   FRMEKLDLKKVRCQAKIAGTLVTVAGAMLMTLYKGPLM----EMAWSRHAAGAVHGGAAE  180

Query  868   ---------SHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFEC  716
                      S  +  LG + VI++  ++++  I Q    KQY A  S T L CF+   + 
Sbjct  181   APAAAAADLSGRDWFLGSMFVIVATLAWASLFILQTHTIKQYSAQLSLTTLICFVGTLQA  240

Query  715   LIIALCVDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLL  539
             +++   ++   S WT+   M  ++  Y G+V S++A  +    I+R GP++ + F+PL++
Sbjct  241   VVVTFVMERRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQRTGPVFASAFSPLMM  300

Query  538   VLTAILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKT  359
             ++ A++    L E+IY G V+G++LIVVGLY VLWGK  E Q    E + KL    ++  
Sbjct  301   IIVAVMGSFILSEQIYLGGVVGAVLIVVGLYSVLWGKHKETQ--EKEADAKLSLPTSKGD  358

Query  358   EAG  350
               G
Sbjct  359   NVG  361



>ref|XP_006851387.1| hypothetical protein AMTR_s00040p00029850 [Amborella trichopoda]
 gb|ERN12968.1| hypothetical protein AMTR_s00040p00029850 [Amborella trichopoda]
Length=413

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 215/349 (62%), Gaps = 6/349 (2%)
 Frame = -1

Query  1390  SDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSR  1211
               L P+ +MV VQ+G+AG+NI     + AGM+  + +AY+       L P+A+FLERK R
Sbjct  8     KSLKPIALMVAVQVGFAGMNIFYKLAINAGMDLRVLVAYRFAIGAAFLGPIAFFLERKIR  67

Query  1210  PKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLES  1031
             PK+T  + FQ FL   FG T +Q  Y  G+  ++ T   A+ N+IPA+TF+ A+ FRLE 
Sbjct  68    PKLTWTVLFQTFLCGLFGGTMNQNLYAAGMKLTSATFVCAMTNVIPAVTFILALFFRLEE  127

Query  1030  VGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             V + T   QAK++GTL+ +GGAML+T Y G  +  QS+       ++        +G+VI
Sbjct  128   VAIGTISSQAKVVGTLVGVGGAMLMTFYKGLAIHMQSSSVQLMNASSPLSPHKPGNGHVI  187

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
              G ++V+ SC S++ +LI QA+LS+++ A YSSTAL CF+A  +    A  ++ + S W 
Sbjct  188   -GSLLVVASCFSFAIWLIIQAKLSEKFPAYYSSTALMCFMAAVQSFCYAKIMNRSWSAWK  246

Query  670   LT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L   ++ ++  Y G+V SAL + + SWCI R+GPL+V++FNPL+L+L AI    FL E +
Sbjct  247   LGWDVKLLTVVYAGVVVSALLVSMMSWCIRRRGPLFVSMFNPLMLILVAIAGSFFLGETL  306

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTEAGE  347
             + G ++GSILI+ GLY+VLWGK  E+++    D  +L   +       E
Sbjct  307   HLGNILGSILIIAGLYMVLWGKNKEMKM----DEAQLPVTEPSHDSVKE  351



>ref|XP_004151540.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=391

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/338 (36%), Positives = 207/338 (61%), Gaps = 7/338 (2%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P F M+ +Q GYAG+NI++   +  GM+ ++ + Y+ +FAT ++AP   F ER+ +P++T
Sbjct  19    PYFAMISLQFGYAGMNIISKVSLSRGMSHYVLVVYRHVFATASIAPFVLFFERRGQPRIT  78

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               IF QIF+ A  G   DQ  Y+ GL  ++PT + A++N++PA+TFV AV+FR+E + ++
Sbjct  79    FKIFIQIFMLALLGPVVDQNFYYAGLKYTSPTFSCAMSNILPAMTFVMAVIFRMEKLDMK  138

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPI  839
                 QAK+LGTL+ +GGAML+TLY GP +    T H  +  N+   N SS+  +   G I
Sbjct  139   KLRCQAKVLGTLVTVGGAMLMTLYKGPPLQMPWTKHNSHLTNS---NESSNDKDWFKGSI  195

Query  838   MVILSCCSYSAFLITQARLSKQY-GAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-  665
              +I++  ++S+  + Q +  K Y    ++ T L CF+   + + + L  +H  S W +  
Sbjct  196   FLIIATLAWSSLFVLQNQALKTYENHQFTLTTLMCFVGTLQAIAVTLVAEHKASVWRIGW  255

Query  664   PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTG  485
              M  ++  Y G+V S+++  +    +++KGP++   F+PL++++ AI+    L EKI+ G
Sbjct  256   DMNLLAAAYAGIVTSSISYYVQGLVMKKKGPVFATAFSPLMMIIVAIMGSFILAEKIFLG  315

Query  484   TVMGSILIVVGLYIVLWGKKNE--LQVINVEDNNKLKE  377
              ++GSILIV GLY VLWGK  E     ++  D+N++ E
Sbjct  316   GIIGSILIVFGLYSVLWGKHKESLENKLSGSDDNEIPE  353



>gb|AFK34273.1| unknown [Lotus japonicus]
Length=392

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/366 (36%), Positives = 216/366 (59%), Gaps = 22/366 (6%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q G+AG+NI+    +  GM+ ++ + Y+  FAT A+AP A  LERK RP++T
Sbjct  16    PYIAMISLQFGFAGMNIITKVSLNRGMSHYVLVVYRHAFATAAIAPFALVLERKVRPRIT  75

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +F Q+F+    G   DQ  Y+ GL  ++PT + AL+N++PA+TF+ AV+FR+E V +R
Sbjct  76    FVMFMQMFVLGLLGPVIDQNLYYAGLKFTSPTYSCALSNVLPAMTFLMAVIFRMEKVDIR  135

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
                 QAK+LGT + + GAML+TLY G V+  +G    H       V+ N+S+   + + G
Sbjct  136   KVRCQAKVLGTGVTVAGAMLMTLYKGKVINFLGSQYTHHPRNYEPVNTNASAEQ-DWVKG  194

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
              I++I++  ++++F I QA   ++Y A  S TA+ CFL   + + +   ++H+ S W++ 
Sbjct  195   SILLIIATLAWASFFILQAVTLRKYSAQLSLTAIVCFLGTLQSIAVTFVMEHSPSVWSIG  254

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               M  ++  Y G+V S +   +    +++KGP++V  F+PL++V+ AI+    L EKIY 
Sbjct  255   WDMNLLAAAYAGIVSSGITYYVQGIVMQKKGPVFVTAFSPLMMVIVAIMGTFILAEKIYL  314

Query  487   GTVMGSILIVVGLYIVLWGKKNELQVINV----------EDNNKL--------KEKDAEK  362
             G ++G+ILIV+GLY VLWGK+ E +   V          E+N ++        +  D EK
Sbjct  315   GGILGAILIVIGLYQVLWGKQKEQEEETVEVVTEVMKCCEENGRMETVMEESVETNDIEK  374

Query  361   TEAGEC  344
              +  +C
Sbjct  375   QKGEDC  380



>ref|XP_011045738.1| PREDICTED: WAT1-related protein At1g25270-like [Populus euphratica]
Length=366

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 136/360 (38%), Positives = 211/360 (59%), Gaps = 10/360 (3%)
 Frame = -1

Query  1399  MGCS---DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYF  1229
             M C+    + P   M+ VQ+ + G+NI    V+  GM+  + +AY+ +F    L P+A  
Sbjct  1     MACTCFGSVHPGIAMIFVQIVFGGINIFYKLVINDGMSIRVAVAYRLLFGAAFLCPIALI  60

Query  1228  LERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAV  1049
             +ER  RPK+T  +FFQIF  A FG +     Y   LN ++ T A+AL NL PA T++ A+
Sbjct  61    VERNKRPKLTWVVFFQIFFLALFGGSIYHNLYLASLNLTSMTFAAALYNLSPAFTYIVAL  120

Query  1048  LFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMG-PVVIGQSTIH-WKYAKNTVDKNS  875
             LFR+E++ L    G A + GT ICIGGAMLLT Y G  + I  + I+  KY +N   +N+
Sbjct  121   LFRMETLSLNNARGIANVAGTAICIGGAMLLTFYQGIEINIWHTNINLLKYHQNH-HQNT  179

Query  874   SSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCV  695
               S    + G  + +++C  Y+ ++I QA+++++Y   YSSTAL   +   + +I ALC 
Sbjct  180   VGSTKQQMFGLAIALIACVFYAFWVIIQAKINERYPCFYSSTALMSLMGSIQAIIYALCF  239

Query  694   DHNVSDWTL-TPMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILS  518
             +   SDW L + +R +S  Y G + S L I L +WCI ++GPLYVA FNPL+L++ A+  
Sbjct  240   ERKWSDWKLESNIRLISVIYLGFLASGLNITLMAWCIAKRGPLYVATFNPLMLLVVAVAG  299

Query  517   WAFLREKIYTGTVMGSILIVVGLYIVLWGKK---NELQVINVEDNNKLKEKDAEKTEAGE  347
                 +EK++ G+++G +LI+ GLY VLWGK    N+ Q   + +N+  +  +   T   E
Sbjct  300   SLVFQEKLHLGSILGGVLIITGLYTVLWGKSKNANKNQPAVLPNNSDQESPEVAVTPQSE  359



>gb|EMS59079.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=381

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 146/359 (41%), Positives = 214/359 (60%), Gaps = 17/359 (5%)
 Frame = -1

Query  1399  MGCSD-LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLE  1223
             MG  D + P+  MV+VQ  +AGVNI     +  GM+  + +AY+ +FA+  L+P+AYF+E
Sbjct  1     MGVMDGMKPVAAMVVVQFVFAGVNIFYKLAVSDGMDMRVLVAYRFLFASAVLSPIAYFVE  60

Query  1222  RKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLF  1043
             RK R K+T  +    F+    G +  Q  Y  G+  ++ T ASA+ NLIPAITFV AVLF
Sbjct  61    RKKRTKVTWRVLLLSFVCGLCGGSLAQNLYISGMKLTSATFASAMTNLIPAITFVLAVLF  120

Query  1042  RLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYA------KNTVDK  881
             R E + +RT  GQAK+ GT++ +GGAMLLT Y G  V      H   A          D+
Sbjct  121   RYERLAIRTLAGQAKVTGTMLGVGGAMLLTFYKGAQVTPWPPTHINLAAQLAARHQHEDQ  180

Query  880   NSSSSH---GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLI  710
               SS H   GN  +G ++   SC  Y+ +LI QARLS++Y   YS+TAL C ++  +   
Sbjct  181   PPSSLHPDSGNRAMGCLLCTGSCFFYALWLILQARLSREYPFHYSTTALMCAMSALQSAA  240

Query  709   IALCVDHNVSDWTLTP-MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVL  533
              ALC D ++  W L+  +R ++  Y G+V S + + + SWC++R+GPL+ +VFNP++LV+
Sbjct  241   FALCFDRDLIQWRLSSGVRLLAVLYTGVVASGVMLVVLSWCVKRRGPLFASVFNPMMLVV  300

Query  532   TAILSWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAEKTE  356
              A+LS   L E+++ G+V+G++LIV GLY VLWGK  E         N+  +  A  TE
Sbjct  301   VAVLSSLLLGEELHLGSVLGAVLIVTGLYSVLWGKGRE------AAENEPAKAHASGTE  353



>ref|XP_006359736.1| PREDICTED: WAT1-related protein At1g25270-like [Solanum tuberosum]
Length=408

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/343 (40%), Positives = 206/343 (60%), Gaps = 3/343 (1%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P+ +MV +Q+GYAG+ ++       GM+  I IAY+ +FA   + PLA + +RKSRPK
Sbjct  26    LKPIIMMVFIQIGYAGMTLLYKLASNDGMSLRILIAYRFLFAAATVLPLALYFDRKSRPK  85

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             MT  +    FL+A FG +  Q  +   L  ++ T A+A  NLIP ITF+ A+ FRLE + 
Sbjct  86    MTWMVMLLAFLSALFGGSMPQNLFAASLVLTSTTFATATLNLIPGITFIIAIFFRLEQLN  145

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
             L+T+GGQAK+LGTLI IGGAMLLT Y G + I   +I   + ++      +      ILG
Sbjct  146   LKTRGGQAKMLGTLIGIGGAMLLTFYKG-LEIKTWSIKLDFKEHMATSQQNQKPYAHILG  204

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
             PI+ I SC S +  LI QA++S+ Y   +SSTAL   +   +  + A+  + + + W L 
Sbjct  205   PILAICSCFSSALSLIFQAKMSELYPCHFSSTALMSIMGALQAGVYAISTERDWTQWKLG  264

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               +R  +  Y G+V S LAI    +C+  +GPL+V++F+PL+LV  AI    FL EK++ 
Sbjct  265   WNLRLFAVLYAGVVASGLAIIFLMFCVRMRGPLFVSIFSPLMLVCVAIAGSLFLNEKLHL  324

Query  487   GTVMGSILIVVGLYIVLWGKKNEL-QVINVEDNNKLKEKDAEK  362
             G+V+G  +I+ GLY+VLWGKK E+ +   +  +   +E D E 
Sbjct  325   GSVLGGAIIICGLYMVLWGKKQEITRTSKLTPSINCEEYDQED  367



>emb|CBI19781.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 196/328 (60%), Gaps = 8/328 (2%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             M+ +Q GYAG ++V+ A +  G++  +   Y+ + A + LAP AYFLE+K RP +T +  
Sbjct  1     MLALQFGYAGFHVVSRAALNMGISKLVFPVYRNIIALLLLAPFAYFLEKKERPALTLSFV  60

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
              Q FL A  G+T +Q  Y +GL+N++PT ASA+ N +PAITF+ A + R+E V L  K G
Sbjct  61    VQFFLLALVGITANQGFYLLGLDNTSPTFASAIQNSVPAITFLMAAVLRIEQVRLNRKDG  120

Query  1006  QAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVD---KNSSSSHGNVILGPIM  836
              AK+LGT++C+ GA ++TLY GP +   ST       NT         +   N  LG + 
Sbjct  121   LAKVLGTILCVAGASVITLYKGPTIYSPST----RPDNTPPLFLSLGDAKGKNWTLGCVY  176

Query  835   VILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-TPM  659
             +I  C S+SA+L+ QA + K+Y A  S T+  CF  + + LIIAL ++ N   W + +  
Sbjct  177   LIGHCLSWSAWLVLQAPVLKKYPARLSVTSYTCFFGLIQFLIIALVIERNSQAWLIHSGA  236

Query  658   RAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTV  479
                S  Y G+V S +A  +  WCI+R GP++VAV+ P+  ++ AI++   L E+ Y G +
Sbjct  237   ELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIMASVALGEEFYLGGI  296

Query  478   MGSILIVVGLYIVLWGKKNELQVINVED  395
             +G++LI+ GLY VLWGK  E +    E 
Sbjct  297   IGAVLIISGLYFVLWGKSEEKKFAAKEK  324



>ref|XP_009387815.1| PREDICTED: protein WALLS ARE THIN 1-like [Musa acuminata subsp. 
malaccensis]
Length=387

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 193/317 (61%), Gaps = 1/317 (0%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             M+ +Q GYAG ++V+ A +  G++  +   Y+ + A I L P AYFLE+K RP +T +  
Sbjct  22    MLALQFGYAGFHVVSRAALNMGISKVVFPVYRNIIALILLVPFAYFLEKKDRPALTLSFV  81

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
              Q FL A  G+T +Q  Y +GL+N++PT ASA+ N +PAITF+ A + R+E V +  + G
Sbjct  82    VQFFLLALCGITANQGFYLLGLDNTSPTFASAIQNSVPAITFLMAAILRIEKVRIDRRDG  141

Query  1006  QAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPIMVIL  827
              AK++GTL C+GGA ++TLY GP + G S      +++T+     +   N  LG + +I 
Sbjct  142   IAKLMGTLACVGGATIITLYKGPTIFGPSRALNDASQSTMLWLGDAKGKNWTLGCLYLIG  201

Query  826   SCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLTPMRAVS  647
              C S+S +L+ QA + K+Y A  S T+  CF  + + L+IA  ++ +   W       + 
Sbjct  202   HCLSWSGWLVLQAPVLKKYPARLSVTSYTCFFGVIQFLVIAAFIERDAEAWKFHSGSELF  261

Query  646   TT-YNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTVMGS  470
             T  Y G V S +A  +  WCI+R GP++VAV+ P+  ++ AI++   LRE+ Y G ++G+
Sbjct  262   TILYAGFVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIMASIALREEFYLGGIIGA  321

Query  469   ILIVVGLYIVLWGKKNE  419
             + I+ GLY+VLWGK  E
Sbjct  322   VFIIAGLYLVLWGKSEE  338



>ref|XP_009759485.1| PREDICTED: WAT1-related protein At1g68170-like [Nicotiana sylvestris]
Length=391

 Score =   239 bits (610),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 138/342 (40%), Positives = 211/342 (62%), Gaps = 12/342 (4%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             ++ PL +M+  Q+  AG+NIV       GMN  I I Y+ +FA++ + PLA+F+ER  R 
Sbjct  13    EMRPLLLMIFGQIILAGMNIVFKLATSDGMNFSILIFYRCLFASVFMVPLAFFIERGKRA  72

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             K+T  + FQ FL    G +  Q  Y   L  ++ T  SA+ NLIPAITFV A++ RLE +
Sbjct  73    KLTKMVIFQGFLCGLLGGSLGQNMYLQSLVYTSATFVSAMFNLIPAITFVVAIILRLEKL  132

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIHWKYAKNTVDKNSSSSHGNVI  851
             GL+T  G+AK+LGT++CI GAMLLTLY GP + +G++ I      N +           +
Sbjct  133   GLKTPAGKAKVLGTIVCISGAMLLTLYKGPEINMGKTNI------NLLHSTHHKGESKPL  186

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
              G I+ +  C  Y+  LI QA+ +++Y  PYS TAL   +A  +C ++A+ V+ +  +W 
Sbjct  187   AGAILALAGCTCYALLLIVQAKAAQRYPCPYSFTALLNVMAAVQCFVVAVVVERDWKEWK  246

Query  670   LT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L   +R +++ Y G+  S +   + +W +  KGP+YV+VFNPL+LV+ AI  + FL EK+
Sbjct  247   LGWNVRLLASAYTGIFCSGVLFTIIAWVVRMKGPVYVSVFNPLMLVMVAISGYLFLDEKL  306

Query  493   YTGTVMGSILIVVGLYIVLWGKKNEL----QVINVEDNNKLK  380
             Y G+V+GSI+IV GLY+VLWGK  E+    Q++  ++ N +K
Sbjct  307   YLGSVLGSIVIVCGLYVVLWGKDKEIKKLSQLVPDKEENDIK  348



>ref|XP_003581230.2| PREDICTED: WAT1-related protein At1g68170 [Brachypodium distachyon]
Length=389

 Score =   239 bits (609),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 204/344 (59%), Gaps = 5/344 (1%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             MV +Q+ +A + I     +  GM+  + +AY+ MFA   L P+A+ +ERK RP +T  + 
Sbjct  27    MVGLQVLFAVLQIFFKLALNDGMDARVLVAYRFMFAAAVLCPVAFLVERKKRPPLTMKVV  86

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
               +FL   FG+  +Q  Y + +  ++ T  +A+ANL PA TF+ A+L RLE++ LR   G
Sbjct  87    QYLFLCGLFGIAINQNLYVLAIKLTSATFVTAIANLAPATTFLLAILTRLETLKLRNPAG  146

Query  1006  QAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSS---SHGNVILGPIM  836
             QAK++GTL+ +GGAMLLT Y G  +     +      +  + +  S   S GN ILG  +
Sbjct  147   QAKLVGTLVGMGGAMLLTFYKGTELTLLRRLPRPRLVHITEAHHHSHPPSTGNQILGSFL  206

Query  835   VILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-TPM  659
              I+SC SY+A+++ QA++ + Y   YS  A+ C     +  ++A+CV  +++ W L   +
Sbjct  207   GIMSCFSYAAWVVIQAKVGEDYPCHYSIAAMVCLFGALQSTVVAVCVHRDMAHWRLGLNI  266

Query  658   RAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTV  479
             R  S+ Y GL+ S  A  L SWC+ +KGPL++AVF+PL+L+  A++S   L E +Y G+ 
Sbjct  267   RLYSSAYAGLIASGSAFPLLSWCLRKKGPLFIAVFSPLMLIFVAVMSSIVLDEPLYLGSG  326

Query  478   MGSILIVVGLYIVLWGK-KNELQVINVEDNNKLKEKDAEKTEAG  350
             +GSILIV GLY+VLWGK K +  V   ED  K        +E+G
Sbjct  327   LGSILIVCGLYLVLWGKAKEQTDVSKDEDLGKESIPVTATSESG  370



>ref|XP_010030083.1| PREDICTED: WAT1-related protein At1g68170-like [Eucalyptus grandis]
Length=418

 Score =   239 bits (611),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 135/335 (40%), Positives = 200/335 (60%), Gaps = 10/335 (3%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P  +MV VQ  +AGVN+V       GMN  + +AY+ +FAT  ++P+A FLERK RPK+T
Sbjct  15    PAILMVTVQASFAGVNVVYKLAANDGMNLRLVVAYRLLFATAFISPIALFLERKKRPKLT  74

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               + FQ F    FG +     Y   L  ++ T A+A+ NL PAIT++ AV F LE V + 
Sbjct  75    GMVLFQAFCCGFFGGSLTHNLYLESLALTSATYAAAMLNLAPAITYIMAVSFGLERVVIG  134

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQST-----IHWKYAKNTVDKN----SSSS  866
                G+AK+LGTLI IGGAM+LT Y G  +   ST      H  +     D +    + + 
Sbjct  135   RIEGKAKVLGTLIGIGGAMVLTFYKGFEIRMWSTHVDLLHHHSHQPLPADHHPAFSNRTE  194

Query  865   HGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN  686
             HG  +LG ++ + SC SYS +LI Q +++++Y   YSSTAL       + +  AL  + +
Sbjct  195   HGAHVLGSMLAVGSCASYSLWLIIQTKMAERYPCHYSSTALTSLFGSIQAVGFALFTERD  254

Query  685   VSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAF  509
              S+W L   +R ++  Y GLV S + + L  WC+ ++GPL+ +VFNPL+LVL A+     
Sbjct  255   WSEWKLGWNIRLLTVAYTGLVASGICVSLIGWCVHKRGPLFASVFNPLMLVLVALAGSFL  314

Query  508   LREKIYTGTVMGSILIVVGLYIVLWGKKNELQVIN  404
             L EK++ G+V+G+ LIV GLY+VLWGK  E++ ++
Sbjct  315   LDEKLHLGSVLGAGLIVCGLYVVLWGKHREMKRMD  349



>ref|XP_002280062.1| PREDICTED: protein WALLS ARE THIN 1 [Vitis vinifera]
Length=383

 Score =   239 bits (609),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 196/328 (60%), Gaps = 8/328 (2%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             M+ +Q GYAG ++V+ A +  G++  +   Y+ + A + LAP AYFLE+K RP +T +  
Sbjct  26    MLALQFGYAGFHVVSRAALNMGISKLVFPVYRNIIALLLLAPFAYFLEKKERPALTLSFV  85

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
              Q FL A  G+T +Q  Y +GL+N++PT ASA+ N +PAITF+ A + R+E V L  K G
Sbjct  86    VQFFLLALVGITANQGFYLLGLDNTSPTFASAIQNSVPAITFLMAAVLRIEQVRLNRKDG  145

Query  1006  QAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVD---KNSSSSHGNVILGPIM  836
              AK+LGT++C+ GA ++TLY GP +   ST       NT         +   N  LG + 
Sbjct  146   LAKVLGTILCVAGASVITLYKGPTIYSPST----RPDNTPPLFLSLGDAKGKNWTLGCVY  201

Query  835   VILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTL-TPM  659
             +I  C S+SA+L+ QA + K+Y A  S T+  CF  + + LIIAL ++ N   W + +  
Sbjct  202   LIGHCLSWSAWLVLQAPVLKKYPARLSVTSYTCFFGLIQFLIIALVIERNSQAWLIHSGA  261

Query  658   RAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTV  479
                S  Y G+V S +A  +  WCI+R GP++VAV+ P+  ++ AI++   L E+ Y G +
Sbjct  262   ELFSVFYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIMASVALGEEFYLGGI  321

Query  478   MGSILIVVGLYIVLWGKKNELQVINVED  395
             +G++LI+ GLY VLWGK  E +    E 
Sbjct  322   IGAVLIISGLYFVLWGKSEEKKFAAKEK  349



>ref|XP_010423261.1| PREDICTED: WAT1-related protein At5g07050 [Camelina sativa]
Length=399

 Score =   239 bits (609),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 127/345 (37%), Positives = 212/345 (61%), Gaps = 3/345 (1%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P F M+ +Q GYAG+NI+    +  GM+ ++ + Y+   AT  +AP A+F ERK++PK+T
Sbjct  18    PYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFFERKAQPKIT  77

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               IF Q+F+    G   DQ  Y++GL  ++PT + A++N++PA+TF+ AVLFR+E + ++
Sbjct  78    FTIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLPAMTFILAVLFRMEMLDVK  137

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPI  839
                 QAKI GT++ +GGAM++TLY GP+V    T +     N    + SSS  + + G I
Sbjct  138   KLWCQAKIGGTVVTVGGAMVMTLYKGPIVELFWTKYMHLQDNETASSKSSSDKDFLKGSI  197

Query  838   MVILSCCSYSAFLITQARLSKQYGA-PYSSTALACFLAIFECLIIALCVDHNVSDWTLT-  665
             ++IL+  ++++  + QAR+ K Y     S T L CF+   + + +   ++HN S W +  
Sbjct  198   LLILATLAWASLFVLQARILKTYAKHQLSLTTLICFIGTIQAVAVTFVMEHNPSAWRIGW  257

Query  664   PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTG  485
              M  ++  Y+G+V S+++  +    ++++GP++   F+PL++V+ A++    L EKI+ G
Sbjct  258   DMNLLAAAYSGIVASSISYYVQGIVMKKRGPVFATAFSPLMMVIVAVMGSFVLAEKIFLG  317

Query  484   TVMGSILIVVGLYIVLWGKKNELQVINVE-DNNKLKEKDAEKTEA  353
              V+G++LIV+GLY VLWGK+ E QV   E    +L  K  E  EA
Sbjct  318   GVIGAVLIVIGLYAVLWGKQKENQVTICEPTKTELNSKITEDVEA  362



>gb|EEC70465.1| hypothetical protein OsI_01511 [Oryza sativa Indica Group]
Length=344

 Score =   237 bits (605),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 128/322 (40%), Positives = 198/322 (61%), Gaps = 27/322 (8%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             MV+VQLG AG+N+++   M +GM+P++ +AY+   A   LAP+A+ +ER           
Sbjct  1     MVLVQLGLAGLNVMSKLTMASGMSPYVLLAYRNFIAAAFLAPIAFLVERA----------  50

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
                        T +Q+ YFVGL  S+PTVASAL N +PA+TF+ A L ++E V  R   G
Sbjct  51    -----------TLNQVLYFVGLKYSSPTVASALNNTLPAVTFLLAALLKMEPVAGRA--G  97

Query  1006  QAKILGTLICIGGAMLLTLYMGPVVIG-QSTIHWKYAKNTVDKNSSSSHGN--VILGPIM  836
             +AK+ GT +C+ G+ML+T Y GP+V    S +HW Y + T+   +++  G   V+LG ++
Sbjct  98    RAKVAGTALCVAGSMLMTFYRGPLVRTLASPVHWPYVQGTMAAEAAAHAGGHAVVLGAVL  157

Query  835   VILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-PM  659
             VI S  +++ + I Q  LSK +  PY+STAL   +A  +C  IA   +   S W L   +
Sbjct  158   VIGSNVAWAIWFIIQKNLSKSFACPYTSTALMALIASVQCAAIAGAAERRFSAWELGLDI  217

Query  658   RAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGTV  479
             R V   Y G+V S +   + SWCI+ +GP++V++F+PL+L++ A++ W  L EKI+ G+V
Sbjct  218   RLVGALYAGIVASGMVCTVMSWCIQERGPVFVSMFSPLMLIVVAVVGWGILGEKIHVGSV  277

Query  478   MGSILIVVGLYIVLWGKKNELQ  413
             +G+++IVVGLY VLWG   +L 
Sbjct  278   IGAVIIVVGLYTVLWGNGRDLD  299



>ref|XP_006473582.1| PREDICTED: protein WALLS ARE THIN 1-like [Citrus sinensis]
Length=390

 Score =   239 bits (609),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 130/330 (39%), Positives = 194/330 (59%), Gaps = 6/330 (2%)
 Frame = -1

Query  1366  MVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTPNIF  1187
             MV +Q GYAG ++V+ A +  G++  +   Y+ + A + L P AYFLE+K RP MT N  
Sbjct  26    MVALQFGYAGFHVVSRAALNMGISKLVFPVYRNIIAFLLLLPFAYFLEKKERPAMTLNFA  85

Query  1186  FQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRTKGG  1007
              Q  L A  G+T +Q  Y +GL N+TPT ASA+ N +PAITF+ A +FR+E V L  K G
Sbjct  86    LQFILLALVGITANQGFYLLGLENTTPTFASAIQNSVPAITFLMAAIFRIEKVRLDRKDG  145

Query  1006  QAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKN-----SSSSHGNVILGP  842
              AK++GTL C+ GA ++TLY GP +   +    +   N++          +   N  LG 
Sbjct  146   IAKVVGTLFCVAGATVITLYKGPTIYSPAPPLNQIQPNSLTSTIFLSLGDAKGKNWTLGC  205

Query  841   IMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLTP  662
             + +I  C S+S +L+ QA + K+Y A  S TA  CF  + + +IIA   + N+  W    
Sbjct  206   VYLIGHCLSWSGWLVMQAPVLKKYPARLSVTAYTCFFGLIQFMIIAAIFERNLDAWIFHN  265

Query  661   MRAV-STTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTG  485
                V S  Y G+V S +A  +  WCI+R GP++VAV+ P+  ++ AI++   L E+ Y G
Sbjct  266   GGEVFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIMASFALGEEFYLG  325

Query  484   TVMGSILIVVGLYIVLWGKKNELQVINVED  395
              ++G++LIVVGLY+VLWGK  E +  + E 
Sbjct  326   GIIGAVLIVVGLYLVLWGKSEEKKFASKEK  355



>ref|XP_002517269.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF45062.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=372

 Score =   238 bits (607),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 205/343 (60%), Gaps = 2/343 (1%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+NI+    +  GM+ ++ + Y+  FAT+A+AP A  LERK RPK+T
Sbjct  16    PYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATLAIAPFALVLERKVRPKIT  75

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               +F QIF+    G   DQ  Y+ GL  ++PT + A++N++PA+TFV AVL R+E V ++
Sbjct  76    FPMFMQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVDIK  135

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILGPI  839
                 QAK++GT++ + GAML+TLY G V+    + H     +     + SS  + + G I
Sbjct  136   KVRCQAKVIGTIVTVAGAMLMTLYKGHVINFIWSEHVHSQTSAPAATTGSSDKDWLKGSI  195

Query  838   MVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT-P  662
             ++I++  ++++F I QA   ++Y A  S T+L CF+   + + +   ++H  S WT+   
Sbjct  196   LLIIATLAWASFFILQAVTLRRYAAQLSLTSLVCFMGTLQSIAVTFVMEHKPSAWTIGWD  255

Query  661   MRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYTGT  482
             M  ++  Y G+V S +A  +    ++++GP++V  F+PL++++ AI+    L EKI+ G 
Sbjct  256   MNLLAAAYAGIVSSGIAYYVQGLVMQKRGPVFVTAFSPLMMIIVAIMGSFILTEKIFLGG  315

Query  481   VMGSILIVVGLYIVLWGKKNELQVINVEDNNK-LKEKDAEKTE  356
             V+G++LIV GLY VLWGK  E    + E     +KE +    E
Sbjct  316   VLGAVLIVAGLYAVLWGKYREYIEKDCETTQGVIKENETNDIE  358



>ref|XP_009354063.1| PREDICTED: WAT1-related protein At1g25270-like [Pyrus x bretschneideri]
Length=398

 Score =   239 bits (609),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 137/330 (42%), Positives = 204/330 (62%), Gaps = 6/330 (2%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P+ +MV++Q   AGVNI+       GMN  I +AY+ +F T  L P+A F+ERKSRPK
Sbjct  13    LKPVLLMVVIQFALAGVNILYKLAAHDGMNLRILVAYRFIFGTAFLLPIALFIERKSRPK  72

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  +  Q FL+  FG +  Q  Y   L  ++    SA+A LIPAITF+ AV+FRLE + 
Sbjct  73    LTWMVLLQGFLSGLFGGSLAQNLYIESLALTSAIFGSAIAQLIPAITFILAVIFRLEKLN  132

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQST----IHWKYAKNT-VDKNSSSSHG  860
             L+   G+AK++GTL+ IGGAML+T Y G  +   ST    IH    +++ +     +  G
Sbjct  133   LKNLAGKAKVMGTLMGIGGAMLMTFYKGMEINIWSTHVDLIHTNRQQHSQLASTPHTDTG  192

Query  859   NVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVS  680
             N +LG ++   SC  Y+ +LI QA++   Y   YSSTAL   +   + +  ALC +   S
Sbjct  193   NQLLGCLLAFASCLCYAIWLIIQAKMGVTYPCYYSSTALMSAMGSIQAVGYALCKEREWS  252

Query  679   DWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLR  503
              W L   +R ++  Y+G++ + L++ + + CI  +GPL+V+VFNPL+LVL AIL+   L 
Sbjct  253   QWKLGWNIRLLTVAYSGIMATGLSVTIIALCIRMRGPLFVSVFNPLMLVLVAILASLVLE  312

Query  502   EKIYTGTVMGSILIVVGLYIVLWGKKNELQ  413
             EK++ G+V+G++LIV GLY VLWGK  E++
Sbjct  313   EKLHLGSVLGAVLIVCGLYGVLWGKGKEIE  342



>ref|XP_009405190.1| PREDICTED: WAT1-related protein At1g68170-like [Musa acuminata 
subsp. malaccensis]
Length=396

 Score =   238 bits (608),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 139/335 (41%), Positives = 211/335 (63%), Gaps = 5/335 (1%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P   MV++Q  +AGVNI+    +  GM+  + +AY+ +FA   ++P+A+F+ERK RPK
Sbjct  13    LKPAAAMVLIQTSFAGVNILYKLALNDGMDVKVLVAYRYIFAAAFISPVAFFIERKRRPK  72

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  I    FL   FG T  Q  Y   +  ++ T  SA+ANL+PA+TF+ AV FRLE +G
Sbjct  73    ITWKILGLTFLCGLFGATFAQNLYVSSMKLTSATFTSAMANLVPAVTFILAVSFRLERLG  132

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGP-VVIGQSTIHWKYAKNTVDKNSSSSH---GN  857
             +RT  G+AK+LGTL+ +GGAMLLT Y G  + +  + I+    ++    + ++ H   GN
Sbjct  133   IRTNYGRAKVLGTLLGLGGAMLLTFYKGAGIELWSTNINLSEQQDHGGHHLAAPHSESGN  192

Query  856   VILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSD  677
              ++G  + + SC  Y+ +LI QA+L++ Y   YS+ AL C +   +  I+ALCV+ +   
Sbjct  193   RVMGSFLAVASCLCYALWLIIQAKLAEAYPCHYSNAALMCLMGSIQASILALCVERHRIQ  252

Query  676   WTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLRE  500
             W L   +R ++  Y+G+  S ++  L  WCI++KGP+Y +VFNPL+L+L AILS   L E
Sbjct  253   WRLGFDIRLLTAAYSGIFASGMSFTLLGWCIKKKGPVYASVFNPLMLLLVAILSSLLLNE  312

Query  499   KIYTGTVMGSILIVVGLYIVLWGKKNELQVINVED  395
             K+Y G ++G+ LIV+GLYIVLWGK  E   I+ E 
Sbjct  313   KLYLGCLLGAALIVIGLYIVLWGKGREASKIDEES  347



>ref|XP_002530977.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF31412.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=385

 Score =   238 bits (607),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 128/330 (39%), Positives = 203/330 (62%), Gaps = 6/330 (2%)
 Frame = -1

Query  1375  LFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMTP  1196
             + VMV +Q+ Y  VN++       GM+  I  AY+ +FAT  + PLA   ERK+RPK+T 
Sbjct  17    VLVMVTIQVAYTAVNVLYKLAASDGMSVRIITAYRFIFATAFMVPLALIFERKNRPKLTW  76

Query  1195  NIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLRT  1016
              I FQ F    FG +  Q  Y   L  ++ T A+A+ NL+PA+TF+ A  F LE V +RT
Sbjct  77    TILFQAFFCGLFGGSLSQNMYLESLVLTSATFATAIFNLVPAVTFILAFSFGLEKVEIRT  136

Query  1015  KGGQAKILGTLICIGGAMLLTLYMGPVV-IGQSTIH----WKYAKNTVDKNSSSSHGNVI  851
               G+AK++GTL+ I GAMLLT Y G  + I ++ I+    ++  +  +  +    HG++ 
Sbjct  137   PPGKAKVIGTLLGISGAMLLTFYKGTEINIWRTHINLIKDYQSHEGGLASSDHHHHGSLA  196

Query  850   LGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWT  671
             LG ++ + +C SY+ +LI QA++S++Y  PYSSTAL  F+A  + ++ ALCV+ +   W 
Sbjct  197   LGSLLAVANCFSYAFWLIIQAKMSERYPCPYSSTALMSFMASIQAVVYALCVEKDFEQWK  256

Query  670   LT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKI  494
             L   +R ++  Y G+  + + + L  WC+  KGPL+V++F+PLLL+ TAI     L E +
Sbjct  257   LGWNIRLLTAAYAGIAVAGIMVTLVIWCVRLKGPLFVSIFSPLLLICTAIAGSILLNETL  316

Query  493   YTGTVMGSILIVVGLYIVLWGKKNELQVIN  404
             + G+++G  LI+ GLY VLW K  E+++++
Sbjct  317   HLGSILGGTLIICGLYGVLWAKSLEMKIVS  346



>emb|CAH58631.1| nodulin-like protein [Plantago major]
Length=364

 Score =   237 bits (605),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 127/349 (36%), Positives = 203/349 (58%), Gaps = 13/349 (4%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P   M+ +Q GYAG+NI+    +  GM+ ++ + Y+  FAT  +AP A  LERK RPK+T
Sbjct  16    PYIAMICLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAIILERKVRPKIT  75

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               IF Q+F+    G   DQ  Y+ GL  ++PT + A++N++PA+TFV AV+ R+E + L+
Sbjct  76    FTIFMQLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVICRMEILDLK  135

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVV--IGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
                 QAK+ GT++ + GAML+TLY G V+       IH   + N  D+ +  S  + + G
Sbjct  136   KVRCQAKLFGTIVTVAGAMLMTLYKGRVINFFWSQFIHPGVSSNAPDQTTQHSDSDWLKG  195

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
              I++I +  +++AF I QA   ++Y A  S TAL CFL   + + + L ++H    W + 
Sbjct  196   SILLITATLAWAAFFILQAITMRKYTAHLSLTALVCFLGTLQSIAVTLVMEHRPHAWVVG  255

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               M  ++  Y G+V S +A  +    ++++GP++V  F+PL++++ AI+    L E IY 
Sbjct  256   WDMNLLAAAYAGIVSSGIAYYVQGLIMQKRGPVFVTAFSPLMMIIVAIMGSFILAENIYL  315

Query  487   GTVMGSILIVVGLYIVLWGKKNELQVINVED----------NNKLKEKD  371
             G V+G++LIV+GLY VLWGK  E +    E+          NNK+   D
Sbjct  316   GGVLGAVLIVIGLYSVLWGKYREYKDKEAEEIPEPMKGINGNNKMGAID  364



>ref|XP_007148456.1| hypothetical protein PHAVU_006G210300g [Phaseolus vulgaris]
 gb|ESW20450.1| hypothetical protein PHAVU_006G210300g [Phaseolus vulgaris]
Length=398

 Score =   238 bits (608),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 137/348 (39%), Positives = 203/348 (58%), Gaps = 10/348 (3%)
 Frame = -1

Query  1387  DLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRP  1208
             +L P+ +MV+VQ+ Y+ VN++    +  GM+  +  AY+  F +    PLA   ER  RP
Sbjct  13    ELKPVLLMVLVQIAYSAVNVLFKLAINDGMSVKVATAYRLAFGSAFTVPLALISERNKRP  72

Query  1207  KMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESV  1028
             KMT  + F   L   FG +  Q  ++  L  ++ T ASAL NLIPAITFV A+    E +
Sbjct  73    KMTWRVLFMACLCGLFGGSLFQNLFYESLAITSATFASALYNLIPAITFVLAISCGFERL  132

Query  1027  GLRTKGGQAKILGTLICIGGAMLLTLYMG------PVVIGQSTIHWKYAKNTVDKNSSSS  866
              LR   G+AK+LGT+I IGGAMLLT   G      P  I     H     +    +S SS
Sbjct  133   NLRAAAGRAKVLGTIIGIGGAMLLTFIKGAEINIWPFHINLMHPHQHQDSHVAQFHSDSS  192

Query  865   HGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN  686
               N +LG +  I SC S+S +L  QA++SK+Y   YSSTAL       +      CV+ +
Sbjct  193   --NKLLGALCSIASCFSFSLWLTIQAKMSKEYPCHYSSTALMSTAGAIQATAFGFCVERD  250

Query  685   VSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAF  509
             +S W L   +R ++  Y+G+V S + + +T+WCI+++GPL+ +VFNPL+LVL AI     
Sbjct  251   LSQWKLGWNIRLLAVAYSGIVASGIVVIITAWCIQKRGPLFASVFNPLMLVLVAIAGSLM  310

Query  508   LREKIYTGTVMGSILIVVGLYIVLWGKKNELQ-VINVEDNNKLKEKDA  368
             L E +Y G+V+G++LIV GLY+VLWGK  E++ +  +  +  ++E +A
Sbjct  311   LNENLYVGSVVGAVLIVFGLYMVLWGKSKEMKNITQLVPSETIREAEA  358



>ref|XP_008239274.1| PREDICTED: WAT1-related protein At3g30340-like [Prunus mume]
Length=367

 Score =   237 bits (605),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 122/351 (35%), Positives = 202/351 (58%), Gaps = 11/351 (3%)
 Frame = -1

Query  1393  CSDLLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKS  1214
             C +  P   MV +   +A VNI+   V+  GMN  + I Y+   +TI LAP++YF ER S
Sbjct  7     CDEWKPFIAMVAIDFCFAIVNILLKKVLDEGMNHLVLITYRLTISTIFLAPISYFRERTS  66

Query  1213  RPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLE  1034
             RPK+T  I F +FL+A  G +  Q  + +G+  ++ T A A  N++P ITF+ A+ F LE
Sbjct  67    RPKLTLRILFFLFLSAIVGTSITQYFFLLGIQYTSATFACAFINMVPMITFIMALPFGLE  126

Query  1033  SVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSH---  863
              V L+   G+AK++GTL+CIGGA +LTLY G  +   S          +D  +  SH   
Sbjct  127   RVNLKCNSGRAKVIGTLVCIGGAFMLTLYKGAPLFDHSK---TTTTQAMDHGTKLSHIRN  183

Query  862   -GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHN  686
                  +G I +++    +S++ + Q+ +SK Y   YSST +  F    +  I+  C   N
Sbjct  184   KERWTIGSIALVVGTLLWSSWFLVQSNISKMYPCQYSSTTIMTFFGAIQSAILGFCTGRN  243

Query  685   VSDWTLTPMRAVSTT-YNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAF  509
             +S W L     V T  ++G++ S L     SWC++++GP++ A F+PL+ +L A++    
Sbjct  244   LSMWVLRGRTQVITVLFSGMIASGLGFVGMSWCVKKRGPVFTAAFSPLVQILAALIGIPI  303

Query  508   LREKIYTGTVMGSILIVVGLYIVLWGKKNELQ---VINVEDNNKLKEKDAE  365
               E+++ G+++GS+++++GLYI+LWGKK E+Q      V++ + +KE++  
Sbjct  304   FHEQLHLGSLLGSVIVIIGLYILLWGKKKEMQKCVTKLVQETDAIKEQEPH  354



>ref|XP_002458648.1| hypothetical protein SORBIDRAFT_03g037390 [Sorghum bicolor]
 gb|EES03768.1| hypothetical protein SORBIDRAFT_03g037390 [Sorghum bicolor]
Length=408

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/336 (38%), Positives = 200/336 (60%), Gaps = 13/336 (4%)
 Frame = -1

Query  1399  MGC-SDLL----PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLA  1235
             MGC  D      P   M  +Q GYAG+N++    +  GM+ ++ + Y+  FATI++AP A
Sbjct  1     MGCYGDFFEKAKPYIAMTSLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFA  60

Query  1234  YFLERKSRPKMTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVA  1055
               LERK RPKMT ++F QIF+ A  G   DQ  Y+ GL  + PT A A++N++PA+TFV 
Sbjct  61    LILERKVRPKMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVM  120

Query  1054  AVLFRLESVGLRTKGGQAKILGTLICIGGAMLLTLYMGPVVI-------GQSTIHWKYAK  896
             AV+FR+E V L+    QAK+ GTL+ + GAM++TLY GP++        G +  H   A 
Sbjct  121   AVIFRMEKVDLKKVRCQAKVAGTLVTVAGAMMMTLYKGPLMKMAWTSGHGHAQGHGAEAP  180

Query  895   NTVDKNSSSSHGNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFEC  716
               V      S     LG + VI++  ++++  I QA   KQY AP S T L CF+   + 
Sbjct  181   AAVAAAIDPSGREWFLGSLFVIIATLAWASLFILQAHTLKQYAAPLSLTTLICFVGTLQA  240

Query  715   LIIALCVDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLL  539
             +++   ++H  S WT+   M  ++  Y G+V S++A  +    I++ GP++ + F+PL++
Sbjct  241   IVVTFAMEHRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMM  300

Query  538   VLTAILSWAFLREKIYTGTVMGSILIVVGLYIVLWG  431
             ++ A++    L EKI+ G V+G++LIV+GLY VLWG
Sbjct  301   IIVAVMGSFILAEKIFLGGVLGAVLIVIGLYSVLWG  336



>ref|XP_003594304.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|ABD28596.1| Protein of unknown function DUF6, transmembrane [Medicago truncatula]
 gb|AES64555.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=366

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/325 (40%), Positives = 191/325 (59%), Gaps = 2/325 (1%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P  +M++VQ+ YA +N+        GM+  +  AY+ +FAT    P+A   ERK+RPK
Sbjct  11    LKPALLMLMVQISYASLNVFYKLATNNGMSVKVLTAYRLIFATATTIPIAIIFERKNRPK  70

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  + F  F    FG T  Q  +F  L   + T  SA+ NL PA+TF+ AV F  E + 
Sbjct  71    LTWRVVFMSFFCGLFGATLFQNLFFESLALISATFVSAVFNLTPAVTFILAVCFGFERLN  130

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNVILG  845
             L T  G+ K+LGT+ICIGGAM+LT   G V I   T H                G+ ILG
Sbjct  131   LETAAGKTKVLGTIICIGGAMILTFLKG-VEINIWTFHINLLHEGKSGTMHVHSGSKILG  189

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
               + + S  S++ +LI QA++SK+Y   YSST+L   +   +    ALC + + S W L 
Sbjct  190   IFLGLASSFSFALWLIIQAKMSKEYQGHYSSTSLMSLMGAIQSTGFALCAEKDWSQWRLG  249

Query  664   -PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
               +R ++  Y+G+V S + +   +WC+ER+GPLY +VFNPL+LVL AI     L EK+Y 
Sbjct  250   WNIRLLTALYSGIVASGIMVIAIAWCVERRGPLYCSVFNPLMLVLVAIAGSMMLNEKLYL  309

Query  487   GTVMGSILIVVGLYIVLWGKKNELQ  413
             G+V+G++L++VGLY+VLWGK  E++
Sbjct  310   GSVIGAVLVIVGLYLVLWGKSKEMK  334



>ref|XP_009780606.1| PREDICTED: WAT1-related protein At3g30340-like [Nicotiana sylvestris]
Length=359

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/341 (36%), Positives = 206/341 (60%), Gaps = 8/341 (2%)
 Frame = -1

Query  1378  PLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPKMT  1199
             P+FVM+ +   +A  NI+   ++  GMN  + I Y+Q  +TI LAP+A+FLER +RPK+T
Sbjct  9     PIFVMLSIDFAFAISNILLKKIIMDGMNHLVFITYRQSVSTIFLAPIAFFLERNTRPKLT  68

Query  1198  PNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVGLR  1019
               I   +FL+A  G +  Q  + +G+  ++ T A A  N++P ITF+ A+ F LE++  +
Sbjct  69    SRILCYLFLSAIVGASLTQYLFLLGIQYTSATFACAFVNMVPVITFLMALPFGLETINTK  128

Query  1018  TKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSHGNV--ILG  845
              + G+AK++GTLIC+GGA+LLT Y G  +I  S    + A  ++++++SSS      I G
Sbjct  129   DRSGRAKVIGTLICLGGALLLTFYKGIPLIHFS--DQQTASQSMEEHNSSSKRKERWIFG  186

Query  844   PIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALCVDHNVSDWTLT  665
              +++      +S++ + Q+ + K+Y   YSST +  F +  +  I+   ++  +S W   
Sbjct  187   SLILFAGTLLWSSWFLLQSNIGKKYPCQYSSTVIMTFFSAIQSAILTFSINRRLSIWIPK  246

Query  664   PM-RAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAILSWAFLREKIYT  488
              M   +S  Y GL+ S L     SWC++++GP++ A F+PL+ V+ A+L   FL E++  
Sbjct  247   EMIDMLSVIYTGLIGSGLCYVGMSWCVKKRGPVFTAAFSPLVQVMAAMLDVPFLHEQLNL  306

Query  487   GTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKLKEKDAE  365
             G+VMGS++++VGLY +LWGK  E+Q +  E   K   KD E
Sbjct  307   GSVMGSVIVIVGLYFLLWGKTKEIQKVPQETAEK---KDKE  344



>ref|XP_004288674.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=395

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 141/356 (40%), Positives = 208/356 (58%), Gaps = 18/356 (5%)
 Frame = -1

Query  1384  LLPLFVMVIVQLGYAGVNIVATAVMGAGMNPFIHIAYQQMFATIALAPLAYFLERKSRPK  1205
             L P+ +MV+ Q  +AGVNI        GMN  + +AY+ +FAT  + PLA +LER SRPK
Sbjct  14    LKPVLLMVVAQAAFAGVNIFYKLAANDGMNTSVVVAYRFLFATAFITPLALYLERNSRPK  73

Query  1204  MTPNIFFQIFLTATFGLTGDQIAYFVGLNNSTPTVASALANLIPAITFVAAVLFRLESVG  1025
             +T  +  Q  L   FG +  Q   F  +  ++ T  +A+  LIPAITFV AV FRLE + 
Sbjct  74    LTWMVVLQASLCGFFGGSMTQNMQFESIALTSATFTAAITQLIPAITFVMAVFFRLERLD  133

Query  1024  LRTKGGQAKILGTLICIGGAMLLTLYMGPVVIGQSTIHWKYAKNTVDKNSSSSH------  863
             LR+ GG+AK+LGTL+ IGGAML+T Y G V I      W    N + K+   SH      
Sbjct  134   LRSGGGRAKVLGTLMGIGGAMLMTFYKG-VEINI----WSTHVNLLHKSEQPSHYLAAPT  188

Query  862   -----GNVILGPIMVILSCCSYSAFLITQARLSKQYGAPYSSTALACFLAIFECLIIALC  698
                   + +LG ++ I S   Y+ F I QA++ ++Y   YSSTAL   +   + +  ALC
Sbjct  189   SKSEYTDHVLGSLLAIGSSFGYAFFFIFQAKMVEKYPCYYSSTALMSLMGSIQSVGFALC  248

Query  697   VDHNVSDWTLT-PMRAVSTTYNGLVYSALAICLTSWCIERKGPLYVAVFNPLLLVLTAIL  521
             ++ + + W L   +R ++  Y G+V + +++ + + C+  KGPL+VAVFNPLLLV+ A +
Sbjct  249   MERDWNQWKLGWNIRLLTVAYTGIVATGISLTILALCVRMKGPLFVAVFNPLLLVIVAFV  308

Query  520   SWAFLREKIYTGTVMGSILIVVGLYIVLWGKKNELQVINVEDNNKL-KEKDAEKTE  356
                 L EK++ G+V+GSI+IV GLY VLWGK  +++++         +EK AE  E
Sbjct  309   GSLLLDEKLHLGSVLGSIIIVGGLYAVLWGKSKDIKMMTQSVPTSFEEEKYAESLE  364



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4602237909976