BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16966_g3_i1 len=2116 path=[1103:0-1536 2640:1537-1565 25:1566-2115]

Length=2116
                                                                      Score     E

ref|XP_009783401.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    902   0.0      
ref|NP_001274963.1|  9-cis-epoxy-carotenoid dioxygenase 2               900   0.0      
ref|XP_004244807.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    899   0.0      
ref|XP_009603531.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    897   0.0      
gb|AFP57678.1|  9-cis-epoxycarotenoid dioxygenase 3 protein famil...    897   0.0      
ref|XP_009804376.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    892   0.0      
ref|XP_011096581.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    877   0.0      
emb|CAN74478.1|  hypothetical protein VITISV_002243                     874   0.0      Vitis vinifera
ref|NP_001268200.1|  9-cis-epoxycarotenoid dioxygenase 2                868   0.0      
ref|XP_006449708.1|  hypothetical protein CICLE_v10014639mg             864   0.0      
gb|KDO78199.1|  hypothetical protein CISIN_1g007291mg                   861   0.0      
ref|NP_001275868.1|  9-cis-epoxycarotenoid dioxygenase 2                860   0.0      
gb|KDP37985.1|  hypothetical protein JCGZ_04628                         854   0.0      
ref|XP_007213614.1|  hypothetical protein PRUPE_ppa002314mg             852   0.0      
ref|XP_008225495.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    850   0.0      
ref|XP_007025058.1|  Nine-cis-epoxycarotenoid dioxygenase 5             848   0.0      
dbj|BAE92960.1|  9-cis-epoxycarotenoid-dioxygenase                      848   0.0      Citrus unshiu [satsuma mandarin]
dbj|BAE92961.1|  9-cis-epoxycarotenoid dioxygenase                      848   0.0      Citrus sinensis [apfelsine]
dbj|BAE92962.1|  9-cis-epoxycarotenoid dioxygenase                      847   0.0      Citrus limon [lemon]
ref|XP_010247741.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    845   0.0      
ref|XP_010110953.1|  hypothetical protein L484_021647                   840   0.0      
ref|XP_010247635.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    841   0.0      
ref|XP_007022180.1|  Nine-cis-epoxycarotenoid dioxygenase 3             840   0.0      
gb|AAR11193.1|  9-cis-epoxycarotenoid dioxygenase 1                     838   0.0      Vitis vinifera
emb|CAN81383.1|  hypothetical protein VITISV_018449                     837   0.0      Vitis vinifera
ref|NP_001268199.1|  9-cis-epoxycarotenoid dioxygenase 1                835   0.0      
gb|EYU33373.1|  hypothetical protein MIMGU_mgv1a003582mg                831   0.0      
dbj|BAE72090.1|  Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 1     830   0.0      Lactuca sativa [cultivated lettuce]
ref|XP_009360900.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    829   0.0      
ref|NP_001234455.1|  nine-cis-epoxycarotenoid dioxygenase               828   0.0      
ref|XP_011082846.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    828   0.0      
gb|AGQ03804.1|  9-cis-epoxycarotenoid dioxygenase                       828   0.0      
gb|ADG03462.1|  9-cis-epoxycarotenoid dioxygenase                       826   0.0      
ref|XP_009797946.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    826   0.0      
ref|NP_001275103.1|  9-cis-epoxy-carotenoid dioxygenase 1               825   0.0      
ref|XP_009615476.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    825   0.0      
gb|AIX87507.1|  9-cis-epoxycarotenoid dioxygenase 1                     823   0.0      
gb|AIG92851.1|  9-cis-epoxycarotenoid dioxygenase                       822   0.0      
ref|XP_004134911.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    822   0.0      
ref|XP_002519665.1|  9-cis-epoxycarotenoid dioxygenase, putative        822   0.0      Ricinus communis
ref|XP_011029543.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    820   0.0      
ref|XP_002316871.1|  hypothetical protein POPTR_0011s11370g             819   0.0      Populus trichocarpa [western balsam poplar]
emb|CAB76920.1|  putative 9-cis-epoxycarotenoid dioxygenase             819   0.0      Solanum tuberosum [potatoes]
ref|XP_008371764.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    819   0.0      
gb|AAS47837.1|  9-cis-epoxycarotenoid dioxygenase                       818   0.0      Gentiana lutea
gb|AFP57677.1|  9-cis-epoxycarotenoid dioxygenase 3 protein famil...    819   0.0      
ref|XP_011098124.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    818   0.0      
gb|ACH85193.1|  9-cis-epoxycarotenoid dioxygenase                       817   0.0      Malus hupehensis var. mengshanensis
ref|XP_006377601.1|  hypothetical protein POPTR_0011s08240g             816   0.0      
ref|XP_008439625.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    816   0.0      
gb|AFO85470.1|  9-cis-epoxy-carotenoid dioxygenase                      816   0.0      
gb|AIY62759.1|  9-cis epoxycarotenoid dioxygenase                       816   0.0      
gb|ADQ74055.1|  9-cis-epoxycarotenoid dioxygenase                       815   0.0      
gb|ADQ74072.1|  9-cis-epoxycarotenoid dioxygenase                       815   0.0      
ref|XP_002316710.2|  hypothetical protein POPTR_0011s02230g             815   0.0      Populus trichocarpa [western balsam poplar]
gb|ADQ74061.1|  9-cis-epoxycarotenoid dioxygenase                       815   0.0      
gb|ADQ74047.1|  9-cis-epoxycarotenoid dioxygenase                       815   0.0      
gb|ADQ74050.1|  9-cis-epoxycarotenoid dioxygenase                       815   0.0      
gb|ADQ74054.1|  9-cis-epoxycarotenoid dioxygenase                       815   0.0      
gb|ADQ74028.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|ADQ74025.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|ADQ74065.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|ADQ74059.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|ADQ74069.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|ADQ74048.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|ADQ74056.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|ADQ74032.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|ADQ74036.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|ADQ74052.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|AIX87531.1|  9-cis-epoxycarotenoid dioxygenase 1                     814   0.0      
gb|ADQ74020.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|ADQ74018.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|ADQ74016.1|  9-cis-epoxycarotenoid dioxygenase                       814   0.0      
gb|ADQ74038.1|  9-cis-epoxycarotenoid dioxygenase                       813   0.0      
gb|ADQ74012.1|  9-cis-epoxycarotenoid dioxygenase                       813   0.0      
gb|ADQ74013.1|  9-cis-epoxycarotenoid dioxygenase                       813   0.0      
gb|ADQ74022.1|  9-cis-epoxycarotenoid dioxygenase                       813   0.0      
ref|XP_008465499.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    813   0.0      
gb|ADQ74030.1|  9-cis-epoxycarotenoid dioxygenase                       813   0.0      
gb|ADQ74053.1|  9-cis-epoxycarotenoid dioxygenase                       813   0.0      
gb|ADQ74044.1|  9-cis-epoxycarotenoid dioxygenase                       813   0.0      
gb|ADQ74021.1|  9-cis-epoxycarotenoid dioxygenase                       813   0.0      
gb|ADQ74042.1|  9-cis-epoxycarotenoid dioxygenase                       813   0.0      
gb|ADQ74019.1|  9-cis-epoxycarotenoid dioxygenase                       813   0.0      
gb|AGN03861.1|  9-cis epoxycarotenoid dioxygenase                       813   0.0      
gb|ADQ74029.1|  9-cis-epoxycarotenoid dioxygenase                       812   0.0      
gb|ADQ74027.1|  9-cis-epoxycarotenoid dioxygenase                       812   0.0      
gb|KDO50508.1|  hypothetical protein CISIN_1g007379mg                   812   0.0      
emb|CDP06103.1|  unnamed protein product                                813   0.0      
gb|ABA43901.1|  9-cis-epoxycarotenoid dioxygenase 3                     813   0.0      Coffea canephora [robusta coffee]
ref|XP_008371610.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    811   0.0      
gb|ADQ74046.1|  9-cis-epoxycarotenoid dioxygenase                       811   0.0      
ref|NP_001275864.1|  putative 9-cis-epoxycarotenoid dioxygenase 3       811   0.0      
gb|ADQ74039.1|  9-cis-epoxycarotenoid dioxygenase                       811   0.0      
gb|AAY98512.2|  9-cis-epoxycarotenoid dioxygenase                       811   0.0      Stylosanthes guianensis [stylo]
gb|AFU91491.1|  9-cis-epoxycarotenoid dioxygenase                       810   0.0      
gb|ADQ74040.1|  9-cis-epoxycarotenoid dioxygenase                       810   0.0      
ref|XP_006370181.1|  nine-cis-epoxycarotenoid dioxygenase3 family...    810   0.0      
gb|ABB52078.1|  putative 9-cis epoxycarotenoid dioxygenase              809   0.0      Daucus carota subsp. sativus
gb|ADQ74024.1|  9-cis-epoxycarotenoid dioxygenase                       810   0.0      
gb|ADQ74017.1|  9-cis-epoxycarotenoid dioxygenase                       810   0.0      
ref|XP_006442236.1|  hypothetical protein CICLE_v10019364mg             810   0.0      
ref|XP_004293530.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    810   0.0      
ref|XP_010062726.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    810   0.0      
gb|ADU85829.1|  9-cis-epoxycarotenoid dioxygenase                       808   0.0      
gb|AEH41591.1|  9-cis-epoxycarotenoid dioxygenase 1                     807   0.0      
gb|ABB52079.1|  putative 9-cis epoxycarotenoid dioxygenase              804   0.0      Daucus carota subsp. sativus
gb|ACU86971.1|  9-cis-epoxycarotenoid dioxygenase                       804   0.0      Caragana korshinskii
ref|XP_011012661.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    803   0.0      
ref|XP_006415513.1|  hypothetical protein EUTSA_v10007160mg             803   0.0      
gb|AAS47838.1|  9-cis-epoxycarotenoid dioxygenase                       803   0.0      Gentiana lutea
ref|XP_004147768.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    802   0.0      
ref|XP_004167844.1|  PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxyc...    802   0.0      
emb|CAE00459.2|  9-cis-epoxycarotenoid dioxygenase                      801   0.0      Arachis hypogaea [goober]
gb|AHJ80777.1|  9-cis-epoxicarotenoid dioxygenase 1 protein             801   0.0      
ref|XP_010552176.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    798   0.0      
gb|EYU26242.1|  hypothetical protein MIMGU_mgv1a025212mg                797   0.0      
ref|XP_004300667.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    798   0.0      
ref|XP_010549494.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    797   0.0      
dbj|BAF42336.1|  9-cis-epoxycarotenoid dioxygenase                      797   0.0      Raphanus sativus
gb|AAY89370.1|  9-cis-epoxycarotenoid dioxygenase 1                     797   0.0      Citrus sinensis [apfelsine]
ref|XP_008226239.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    797   0.0      
ref|XP_009115186.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    795   0.0      
gb|KDP27683.1|  hypothetical protein JCGZ_19722                         794   0.0      
emb|CDY26294.1|  BnaA09g26450D                                          794   0.0      
ref|NP_174302.1|  9-cis-epoxycarotenoid dioxygenase                     794   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY61838.1|  BnaCnng38510D                                          793   0.0      
gb|ABB52080.1|  putative 9-cis epoxycarotenoid dioxygenase              793   0.0      Daucus carota subsp. sativus
ref|XP_007214657.1|  hypothetical protein PRUPE_ppa002804mg             794   0.0      
gb|AIU94747.1|  9-cis-epoxycarotenoid dioxygenase                       793   0.0      
ref|XP_008382970.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    793   0.0      
ref|XP_010478382.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    792   0.0      
ref|XP_002529528.1|  9-cis-epoxycarotenoid dioxygenase, putative        792   0.0      Ricinus communis
ref|XP_006307061.1|  hypothetical protein CARUB_v10008647mg             791   0.0      
dbj|BAE72091.1|  Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 2     790   0.0      Lactuca sativa [cultivated lettuce]
ref|XP_010092722.1|  hypothetical protein L484_024617                   790   0.0      
ref|XP_002890850.1|  nine-cis-epoxycarotenoid dioxygenase 5             788   0.0      
ref|XP_009367762.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    790   0.0      
ref|XP_008378396.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    789   0.0      
ref|XP_011010890.1|  PREDICTED: LOW QUALITY PROTEIN: probable 9-c...    788   0.0      
ref|XP_010694572.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    787   0.0      
ref|XP_010460787.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    786   0.0      
ref|XP_010540581.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    786   0.0      
dbj|BAE72092.1|  Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 3     785   0.0      Lactuca sativa [cultivated lettuce]
ref|XP_009354854.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    785   0.0      
ref|XP_010060796.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    784   0.0      
gb|KFK38809.1|  hypothetical protein AALP_AA3G162900                    784   0.0      
ref|XP_010499525.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    783   0.0      
ref|XP_009399013.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    784   0.0      
gb|AIG92852.1|  9-cis-epoxycarotenoid dioxygenase                       784   0.0      
gb|EYU38203.1|  hypothetical protein MIMGU_mgv1a003133mg                783   0.0      
ref|XP_007149219.1|  hypothetical protein PHAVU_005G051600g             782   0.0      
dbj|BAF36655.1|  putative 9-cis-epoxycarotenoid dioxygenase             781   0.0      Chrysanthemum x morifolium [florist's chrysanthemum]
sp|Q9M6E8.1|NCED1_PHAVU  RecName: Full=9-cis-epoxycarotenoid diox...    781   0.0      Phaseolus vulgaris [French bean]
ref|XP_004504912.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    779   0.0      
dbj|BAF36657.2|  putative 9-cis-epoxycarotenoid dioxygenase             778   0.0      Chrysanthemum x morifolium [florist's chrysanthemum]
dbj|BAE92965.1|  9-cis-epoxycarotenoid dioxygenase                      777   0.0      Citrus limon [lemon]
dbj|BAC10551.1|  nine-cis-epoxycarotenoid dioxygenase3                  778   0.0      Pisum sativum [garden pea]
gb|AEN94304.1|  9-cis-epoxycarotenoid dioxygenase                       778   0.0      
ref|XP_006407071.1|  hypothetical protein EUTSA_v10020337mg             777   0.0      
emb|CDX88443.1|  BnaC06g38870D                                          777   0.0      
ref|XP_006302015.1|  hypothetical protein CARUB_v10019990mg             777   0.0      
gb|KEH38404.1|  9-cis-epoxycarotenoid dioxygenase                       777   0.0      
gb|AAS68632.2|  putative 9-cis-epoxycarotenoid dioxygenase              774   0.0      Chorispora bungeana
emb|CDX97576.1|  BnaA05g25030D                                          774   0.0      
ref|XP_006389988.1|  hypothetical protein EUTSA_v10019707mg             774   0.0      
ref|XP_010666721.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    773   0.0      
ref|XP_009146365.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    772   0.0      
ref|XP_008787808.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    773   0.0      
dbj|BAE92963.1|  9-cis-epoxycarotenoid dioxygenase                      771   0.0      Citrus unshiu [satsuma mandarin]
ref|XP_009398335.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    772   0.0      
dbj|BAC10550.1|  nine-cis-epoxycarotenoid dioxygenase2                  770   0.0      Pisum sativum [garden pea]
ref|NP_188062.1|  9-cis-epoxycarotenoid dioxygenase NCED3               770   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAM72560.1|  9-cis-epoxycarotenoid dioxygenase                      771   0.0      
gb|AAY82458.1|  9-cis-epoxycarotenoid dioxygenase 1                     769   0.0      Cuscuta reflexa [giant dodder]
ref|XP_010472055.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    769   0.0      
ref|XP_002862994.1|  nine-cis-epoxycarotenoid dioxygenase 9             769   0.0      
dbj|BAB11932.1|  neoxanthin cleavage enzyme                             769   0.0      Vigna unguiculata
emb|CDX98455.1|  BnaC05g39200D                                          768   0.0      
ref|XP_010941288.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    768   0.0      
ref|XP_004488719.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    768   0.0      
ref|NP_177960.1|  9-cis-epoxycarotenoid dioxygenase                     769   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAL07104.1|  putative 9-cis-epoxycarotenoid dioxygenase              767   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010537673.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    767   0.0      
dbj|BAE92964.1|  9-cis-epoxycarotenoid dioxygenase                      765   0.0      Citrus sinensis [apfelsine]
ref|XP_008809583.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    766   0.0      
gb|AGI98130.1|  9-cis-epoxycarotenoid dioxygenase                       765   0.0      
emb|CDY52448.1|  BnaA07g39250D                                          765   0.0      
gb|AEG78287.1|  9-cis-epoxycarotenoid dioxygenase                       765   0.0      
gb|AGT28471.1|  9-cis-epoxycarotenoid dioxygenase                       764   0.0      
ref|XP_009106546.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    766   0.0      
gb|EPS69338.1|  9-cis-epoxycarotenoid dioxygenase 3                     757   0.0      
dbj|BAN15737.1|  9-cis-epoxy-carotenoid dioxygenase                     759   0.0      
ref|XP_010428966.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    759   0.0      
ref|XP_010416821.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    759   0.0      
ref|XP_010054257.1|  PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxyc...    759   0.0      
dbj|BAN15738.1|  9-cis-epoxy-carotenoid dioxygenase                     758   0.0      
ref|XP_010487252.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    758   0.0      
gb|AAK00623.1|  9-cis-epoxycarotenoid dioxygenase                       759   0.0      Persea americana
gb|ACL00683.2|  9-cis-epoxycarotenoid dioxygenase 2                     751   0.0      Solanum lycopersicum
ref|XP_010923828.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    759   0.0      
gb|AAY82459.1|  putative 9-cis-epoxycarotenoid dioxygenase 2            759   0.0      Cuscuta reflexa [giant dodder]
ref|XP_010487250.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    758   0.0      
gb|EPS60683.1|  9-cis-epoxycarotenoid dioxygenase                       756   0.0      
ref|XP_010465340.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    755   0.0      
ref|XP_010501914.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    754   0.0      
ref|XP_009406704.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    753   0.0      
ref|XP_006297265.1|  hypothetical protein CARUB_v10013279mg             753   0.0      
ref|XP_009128294.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    753   0.0      
ref|XP_002885045.1|  nine-cis-epoxycarotenoid dioxygenase3              753   0.0      
ref|XP_010529159.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    751   0.0      
gb|EPS70455.1|  hypothetical protein M569_04294                         751   0.0      
ref|XP_009388971.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    751   0.0      
emb|CDY39117.1|  BnaA01g29390D                                          745   0.0      
ref|NP_001241616.1|  probable 9-cis-epoxycarotenoid dioxygenase N...    745   0.0      
ref|XP_009397411.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    747   0.0      
emb|CDY33218.1|  BnaC01g36910D                                          744   0.0      
ref|XP_009116867.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    743   0.0      
gb|AAV35466.1|  9-cis-epoxycarotenoid dioxygenase                       741   0.0      Brassica rapa subsp. pekinensis [bai cai]
gb|ACX33872.1|  NCED3                                                   743   0.0      Lilium formosanum
ref|XP_009408528.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    742   0.0      
ref|NP_001241251.1|  probable 9-cis-epoxycarotenoid dioxygenase N...    741   0.0      
gb|ADP20466.1|  9-cis-epoxycarotenoid dioxygenase                       734   0.0      
gb|AGI97131.1|  9-cis-epoxy carotenoid dioxygenase                      739   0.0      
gb|ACD44928.1|  plastid 9-cis-epoxycarotenoid dioxygenase               739   0.0      Crocus sativus [saffron crocus]
dbj|BAN15739.1|  9-cis-epoxy-carotenoid dioxygenase                     736   0.0      
ref|XP_010439868.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    735   0.0      
ref|NP_193569.1|  9-cis-epoxycarotenoid dioxygenase NCED2               734   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517551.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    734   0.0      
ref|XP_010535003.1|  PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxyc...    733   0.0      
ref|XP_002870052.1|  nine-cis-epoxycarotenoid dioxygenase 2             733   0.0      
ref|XP_010434549.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    731   0.0      
gb|ACX33873.1|  NCED3                                                   731   0.0      Lilium speciosum
ref|XP_008446856.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    730   0.0      
gb|ACX46382.1|  plastid NCED3                                           730   0.0      Lilium hybrid cultivar
emb|CDY55629.1|  BnaA03g58230D                                          725   0.0      
ref|XP_007144972.1|  hypothetical protein PHAVU_007G198800g             724   0.0      
gb|AAY82457.1|  9-cis-epoxycarotenoid dioxygenase 2                     724   0.0      Phaseolus vulgaris [French bean]
emb|CDY01534.1|  BnaC07g35240D                                          724   0.0      
ref|XP_009136923.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    723   0.0      
ref|XP_006282855.1|  hypothetical protein CARUB_v10006815mg             723   0.0      
sp|C3VEQ3.1|NCED_ONCHC  RecName: Full=9-cis-epoxycarotenoid dioxy...    723   0.0      
ref|NP_001050765.1|  Os03g0645900                                       720   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AEK07906.1|  9-cis-epoxycarotenoid dioxygenase                       711   0.0      
gb|AEK99289.1|  9-cis-epoxycarotenoid dioxygenase                       710   0.0      
dbj|BAN15740.1|  9-cis-epoxy-carotenoid dioxygenase                     716   0.0      
gb|AAK00632.1|  9-cis-epoxycarotenoid dioxygenase                       715   0.0      Persea americana
ref|XP_003561898.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    715   0.0      
ref|XP_004986352.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    716   0.0      
gb|EAY91193.1|  hypothetical protein OsI_12802                          715   0.0      Oryza sativa Indica Group [Indian rice]
emb|CDX99475.1|  BnaC01g10770D                                          714   0.0      
gb|AGO64765.1|  9-cis-epoxycarotenoid dioxygenase                       715   0.0      
ref|XP_002466753.1|  hypothetical protein SORBIDRAFT_01g013520          715   0.0      Sorghum bicolor [broomcorn]
ref|XP_009131600.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    713   0.0      
gb|AHA94921.1|  viviparous 14                                           714   0.0      
ref|XP_006650343.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    714   0.0      
gb|AFN11666.1|  putative 9-cis-epoxycarotenoid dioxygenase              714   0.0      
emb|CAD71149.1|  nine-cis-epoxycarotenoid dioxygenase                   714   0.0      Bixa orellana [achiote]
gb|AGA83648.1|  9-cis-epoxycarotenoid dioxygenase                       714   0.0      
gb|AHJ80847.1|  9-cis-epoxycarotenoid dioxygenase 1                     714   0.0      
gb|KCW69861.1|  hypothetical protein EUGRSUZ_F03199                     711   0.0      
emb|CDX78842.1|  BnaA01g09090D                                          711   0.0      
tpg|DAA50307.1|  TPA: viviparous14                                      711   0.0      
ref|NP_001105902.2|  9-cis-epoxycarotenoid dioxygenase 1, chlorop...    711   0.0      Zea mays [maize]
ref|XP_004149672.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    709   0.0      
gb|ABB71583.1|  9-cis-epoxycarotenoid dioxygenase 1                     706   0.0      Hordeum vulgare subsp. vulgare [barley]
pdb|3NPE|A  Chain A, Structure Of Vp14 In Complex With Oxygen           706   0.0      
dbj|BAF02837.1|  putative 9-cis-epoxycarotenoid dioxygenase             708   0.0      Hordeum vulgare [barley]
ref|NP_001177063.1|  Os12g0617400                                       708   0.0      
gb|KFK42225.1|  hypothetical protein AALP_AA2G227500                    706   0.0      
gb|AEK99067.1|  9-cis-epoxycarotenoid dioxygenase                       701   0.0      
gb|EAY83911.1|  hypothetical protein OsI_39134                          707   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAJ93203.1|  predicted protein                                      706   0.0      
ref|XP_006414120.1|  hypothetical protein EUTSA_v10027182mg             708   0.0      
dbj|BAF02838.1|  putative 9-cis-epoxycarotenoid dioxygenase             704   0.0      Hordeum vulgare [barley]
gb|AHJ80848.1|  9-cis-epoxycarotenoid dioxygenase 2                     704   0.0      
dbj|BAJ84863.1|  predicted protein                                      704   0.0      
gb|ADR78340.1|  9-cis-epoxycarotenoid dioxygenase                       696   0.0      
ref|XP_004963201.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    702   0.0      
gb|AGA84060.1|  9-cis-epoxycarotenoid dioxygenase                       701   0.0      
gb|KGN53537.1|  hypothetical protein Csa_4G064690                       694   0.0      
ref|XP_008644645.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    701   0.0      
gb|ABB71584.1|  9-cis-epoxycarotenoid dioxygenase 2                     701   0.0      
gb|AEK99069.1|  9-cis-epoxycarotenoid dioxygenase                       694   0.0      
gb|ADP20465.1|  9-cis-epoxycarotenoid dioxygenase                       694   0.0      
gb|AFM77567.1|  9-cis-epoxycarotenoid dioxygenase                       691   0.0      
gb|AGA84061.1|  9-cis-epoxycarotenoid dioxygenase                       697   0.0      
gb|ADN65136.1|  9-cis-epoxycarotenoid dioxygenase                       689   0.0      
ref|XP_004162808.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    694   0.0      
ref|XP_003579121.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    694   0.0      
gb|AEK99290.1|  9-cis-epoxycarotenoid dioxygenase                       687   0.0      
ref|XP_008670979.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    692   0.0      
gb|AEK99070.1|  9-cis-epoxycarotenoid dioxygenase                       685   0.0      
gb|AFO59594.1|  9-cis-epoxycarotenoid dioxygenase                       684   0.0      
ref|XP_004955480.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    690   0.0      
ref|NP_001147781.1|  viviparous-14                                      689   0.0      
dbj|BAD31592.1|  putative viviparous-14 protein                         686   0.0      
ref|NP_001058913.1|  Os07g0154100                                       687   0.0      
gb|KFK44832.1|  hypothetical protein AALP_AA1G308500                    683   0.0      
ref|NP_001147527.1|  viviparous-14                                      686   0.0      
ref|XP_002459356.1|  hypothetical protein SORBIDRAFT_02g003230          680   0.0      
dbj|BAF32138.1|  putative 9-cis-epoxycarotenoid dioxygenase             680   0.0      
ref|XP_006836449.1|  hypothetical protein AMTR_s00092p00172590          674   0.0      
ref|XP_010264135.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    671   0.0      
dbj|BAF31906.1|  putative 9-cis-epoxycarotenoid dioxygenase             672   0.0      
dbj|BAF31905.1|  putative 9-cis-epoxycarotenoid dioxygenase             672   0.0      
dbj|BAF31929.1|  putative 9-cis-epoxycarotenoid dioxygenase             672   0.0      
dbj|BAF31900.1|  putative 9-cis-epoxycarotenoid dioxygenase             672   0.0      
dbj|BAF31903.1|  putative 9-cis-epoxycarotenoid dioxygenase             671   0.0      
dbj|BAF31922.1|  putative 9-cis-epoxycarotenoid dioxygenase             671   0.0      
dbj|BAF31898.1|  putative 9-cis-epoxycarotenoid dioxygenase             670   0.0      
dbj|BAF31899.1|  putative 9-cis-epoxycarotenoid dioxygenase             669   0.0      
gb|AEW91475.1|  9-cis-epoxycarotenoid dioxygenase                       656   0.0      
ref|XP_006607053.1|  PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxyc...    649   0.0      
ref|XP_010243984.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    652   0.0      
ref|XP_006420602.1|  hypothetical protein CICLE_v10006710mg             651   0.0      
gb|KDO43597.1|  hypothetical protein CISIN_1g044684mg                   646   0.0      
ref|XP_006489810.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    645   0.0      
ref|XP_003561467.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    645   0.0      
gb|ADC53069.1|  9-cis-epoxycarotenoid dioxygenase                       633   0.0      
ref|XP_007034452.1|  Nine-cis-epoxycarotenoid dioxygenase 6             639   0.0      
ref|XP_009804458.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    639   0.0      
ref|XP_010026759.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    638   0.0      
ref|XP_011020689.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    636   0.0      
ref|XP_002304701.2|  hypothetical protein POPTR_0003s17490g             635   0.0      
ref|XP_002518139.1|  9-cis-epoxycarotenoid dioxygenase, putative        635   0.0      
ref|XP_006854405.1|  hypothetical protein AMTR_s00039p00194530          634   0.0      
ref|XP_008223978.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    634   0.0      
ref|XP_010911051.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    632   0.0      
ref|XP_006664750.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    625   0.0      
ref|XP_004150345.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    630   0.0      
ref|XP_009365475.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    629   0.0      
ref|XP_007223976.1|  hypothetical protein PRUPE_ppa014647mg             626   0.0      
ref|XP_008460725.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    625   0.0      
ref|XP_009365476.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    623   0.0      
gb|AFY10513.1|  9-cis-epoxycarotenoid-dioxygenase                       613   0.0      
emb|CBI32922.3|  unnamed protein product                                613   0.0      
ref|XP_008356480.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    617   0.0      
gb|KCW60088.1|  hypothetical protein EUGRSUZ_H02823                     613   0.0      
ref|XP_004289731.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    613   0.0      
ref|NP_189064.1|  9-cis-epoxycarotenoid dioxygenase NCED6               611   0.0      
gb|AIX87508.1|  9-cis-epoxycarotenoid dioxygenase 6                     611   0.0      
emb|CDY57471.1|  BnaCnng32080D                                          603   0.0      
gb|KDP20332.1|  hypothetical protein JCGZ_06418                         611   0.0      
ref|XP_006349526.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    610   0.0      
ref|XP_010532802.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    610   0.0      
ref|XP_009608069.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    609   0.0      
ref|XP_006300091.1|  hypothetical protein CARUB_v10016319mg             608   0.0      
tpg|DAA47540.1|  TPA: hypothetical protein ZEAMMB73_071878              601   0.0      
gb|EAZ21238.1|  hypothetical protein OsJ_36889                          606   0.0      
ref|XP_006418817.1|  hypothetical protein EUTSA_v10002459mg             605   0.0      
gb|AIX87532.1|  9-cis-epoxycarotenoid dioxygenase 6                     605   0.0      
emb|CDO99408.1|  unnamed protein product                                602   0.0      
ref|XP_002981140.1|  hypothetical protein SELMODRAFT_113788             606   0.0      
ref|XP_002885610.1|  nine-cis-epoxycarotenoid dioxygenase 6             603   0.0      
ref|XP_002982621.1|  hypothetical protein SELMODRAFT_116420             605   0.0      
ref|XP_002283185.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    602   0.0      
ref|XP_010466768.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    602   0.0      
ref|XP_010488479.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    600   0.0      
gb|ADE80897.1|  9-cis-epoxycarotenoid dioxygenase                       599   0.0      
tpg|DAA54707.1|  TPA: viviparous-14                                     593   0.0      
emb|CDX77467.1|  BnaA07g06050D                                          597   0.0      
ref|XP_009102557.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    597   0.0      
emb|CDX82482.1|  BnaA03g33390D                                          589   0.0      
emb|CDX85148.1|  BnaC07g07580D                                          593   0.0      
gb|AFA36209.1|  9-cis-epoxycarotenoid dioxygenase 4                     592   0.0      
gb|AFA36207.1|  9-cis-epoxycarotenoid dioxygenase 4                     592   0.0      
gb|AFA36208.1|  9-cis-epoxycarotenoid dioxygenase 4                     590   0.0      
gb|AFA36205.1|  9-cis-epoxycarotenoid dioxygenase 4                     589   0.0      
dbj|BAE72093.1|  Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 4     589   0.0      
gb|AGM34083.1|  nine-cis-epoxycarotenoid dioxygenase 4                  588   0.0      
ref|XP_010099124.1|  hypothetical protein L484_017919                   586   0.0      
ref|XP_009611958.1|  PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxyc...    575   0.0      
ref|XP_008804455.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    568   0.0      
ref|XP_010688979.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    571   0.0      
ref|XP_009400988.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    559   0.0      
ref|XP_001784596.1|  predicted protein                                  558   0.0      
ref|XP_010321597.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    559   0.0      
ref|XP_009412831.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    554   0.0      
gb|EAZ02812.1|  hypothetical protein OsI_24937                          555   0.0      
gb|EMT26898.1|  hypothetical protein F775_52691                         556   0.0      
emb|CBI33352.3|  unnamed protein product                                555   0.0      
gb|AFO59595.1|  9-cis-epoxycarotenoid dioxygenase                       546   0.0      
gb|EYU43820.1|  hypothetical protein MIMGU_mgv1a026010mg                549   0.0      
gb|ADC95722.1|  9-cis epoxycarotenoid dioxygenase                       539   0.0      
ref|XP_001765996.1|  predicted protein                                  541   0.0      
gb|KCW75913.1|  hypothetical protein EUGRSUZ_D002912                    537   0.0      
ref|NP_001183085.1|  uncharacterized protein LOC100501444               514   1e-173   
gb|EMT29848.1|  hypothetical protein F775_05318                         487   1e-163   
gb|KHN46077.1|  Putative 9-cis-epoxycarotenoid dioxygenase NCED5,...    487   3e-161   
gb|ACN26876.1|  unknown                                                 473   3e-158   
gb|ABD78412.1|  neoxanthin epoxy-carotenoid cleavage dioxygenase 3      472   9e-157   
gb|KHN26771.1|  9-cis-epoxycarotenoid dioxygenase NCED1, chloropl...    464   3e-155   
gb|AEQ20876.1|  9-cis-epoxycarotenoid dioxygenase                       447   2e-149   
gb|ACT98685.1|  9-cis-epoxycarotenoid dioxygenase 1t                    433   4e-144   
gb|ACT98688.1|  9-cis-epoxycarotenoid dioxygenase 2t                    431   3e-143   
gb|ADE33060.1|  9-cis-epoxycarotenoid dioxygenase 3t                    429   1e-142   
gb|AFY10514.1|  9-cis-epoxycarotenoid-dioxygenase                       431   7e-142   
ref|XP_002967439.1|  hypothetical protein SELMODRAFT_31991              435   6e-141   
ref|XP_002960273.1|  hypothetical protein SELMODRAFT_75383              438   6e-141   
gb|ACL00682.1|  9-cis-epoxycarotenoid dioxygenase 2                     425   7e-141   
gb|ABW80854.1|  fruit-specific 9-cis-epoxycarotenoid dioxygenase        423   4e-140   
gb|ACM69016.1|  9-cis-epoxycarotenoid dioxygenase 3                     419   2e-138   
gb|AEK99071.1|  9-cis-epoxycarotenoid dioxygenase                       417   8e-138   
ref|XP_002969641.1|  hypothetical protein SELMODRAFT_11287              427   9e-138   
gb|ADM18297.1|  nine-cis-epoxycarotenoid dioxygenase-like protein       418   2e-137   
ref|XP_002970910.1|  hypothetical protein SELMODRAFT_11292              425   4e-137   
gb|ADE33059.1|  9-cis-epoxycarotenoid dioxygenase 2t                    413   1e-136   
gb|AHG94967.1|  9-cis-epoxycarotenoid dioxygenase                       412   1e-135   
gb|AEK99065.1|  9-cis-epoxycarotenoid dioxygenase                       408   2e-134   
ref|XP_002963374.1|  hypothetical protein SELMODRAFT_79628              418   2e-134   
ref|XP_002970755.1|  hypothetical protein SELMODRAFT_11304              417   5e-134   
ref|XP_002970754.1|  hypothetical protein SELMODRAFT_11293              417   5e-134   
gb|ACD39738.1|  9-cis-epoxycarotenoid dioxygenase NCED2t                407   5e-134   
gb|ACL00684.1|  9-cis-epoxycarotenoid dioxygenase 1                     406   1e-133   
ref|XP_002963376.1|  hypothetical protein SELMODRAFT_80651              418   2e-133   
ref|XP_002969646.1|  hypothetical protein SELMODRAFT_91815              417   5e-133   
gb|AEK99064.1|  9-cis-epoxycarotenoid dioxygenase                       404   8e-133   
ref|XP_002970756.1|  hypothetical protein SELMODRAFT_94523              416   1e-132   
gb|AEO86812.1|  9-cis-epoxycarotenoiddioxygenase                        403   1e-132   
gb|AFN22051.1|  9-cis-epoxycarotenoid dioxygenase                       405   2e-132   
ref|XP_002969420.1|  hypothetical protein SELMODRAFT_11289              412   3e-132   
gb|ADC53071.1|  9-cis-epoxycarotenoid dioxygenase                       402   4e-132   
gb|AAX85470.1|  9-cis epoxycarotenoid dioxygenase                       402   4e-132   
ref|XP_002970906.1|  hypothetical protein SELMODRAFT_411585             414   2e-131   
dbj|BAF81959.1|  9-cis-epoxycarotenoid dioxygenase                      400   3e-131   
gb|ABV01922.1|  NCED1 protein                                           399   5e-131   
gb|ACL00681.1|  9-cis-epoxycarotenoid dioxygenase 1                     395   2e-129   
gb|ABV01923.1|  NCED1 protein                                           394   7e-129   
gb|AAZ99434.1|  9-cis-epoxycarotenoid dioxygenase 7                     391   6e-128   
gb|ABK24456.1|  unknown                                                 398   2e-125   
gb|AEK99287.1|  9-cis-epoxycarotenoid dioxygenase                       386   2e-125   
gb|KHN12459.1|  Putative 9-cis-epoxycarotenoid dioxygenase NCED5,...    385   3e-124   
gb|AAX85469.1|  9-cis epoxycarotenoid dioxygenase                       381   5e-124   
emb|CDX98456.1|  BnaC05g39190D                                          379   6e-123   
gb|AFJ94676.1|  carotenoid cleavage dioxygenase 4b                      390   1e-122   
gb|AAX85471.1|  9-cis epoxycarotenoid dioxygenase                       375   1e-121   
gb|AGT63322.1|  carotenoid cleavage dioxygenase 4b                      386   4e-121   
ref|XP_002270161.1|  PREDICTED: probable carotenoid cleavage diox...    386   5e-121   
gb|ADP06891.1|  9-cis-epoxycarotenoid dioxygenase 1                     368   3e-119   
gb|ACM69015.1|  9-cis-epoxycarotenoid dioxygenase 2                     368   6e-119   
gb|EMT30112.1|  hypothetical protein F775_13945                         375   9e-119   
emb|CBI30914.3|  unnamed protein product                                375   1e-118   
ref|XP_007040858.1|  Nine-cis-epoxycarotenoid dioxygenase 4             379   2e-118   
gb|AFN22050.1|  9-cis-epoxycarotenoid dioxygenase                       367   2e-118   
ref|XP_008653974.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    367   1e-117   
gb|AEO14930.1|  9-cis-epoxycarotenoid dioxygenase                       363   3e-117   
gb|AEO14920.1|  9-cis-epoxycarotenoid dioxygenase                       362   8e-117   
gb|AEO14922.1|  9-cis-epoxycarotenoid dioxygenase                       361   1e-116   
ref|XP_006359966.1|  PREDICTED: probable carotenoid cleavage diox...    373   6e-116   
gb|EMS54693.1|  hypothetical protein TRIUR3_20365                       361   1e-115   
ref|XP_008654195.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    367   2e-115   
tpg|DAA64342.1|  TPA: hypothetical protein ZEAMMB73_260873              365   5e-115   
ref|XP_009778728.1|  PREDICTED: probable carotenoid cleavage diox...    370   9e-115   
ref|XP_010275132.1|  PREDICTED: probable carotenoid cleavage diox...    371   1e-114   
gb|AEO14931.1|  9-cis-epoxycarotenoid dioxygenase                       355   2e-114   
ref|XP_008340019.1|  PREDICTED: probable carotenoid cleavage diox...    367   7e-114   
gb|AEO14934.1|  9-cis-epoxycarotenoid dioxygenase                       354   7e-114   
ref|XP_010054003.1|  PREDICTED: probable carotenoid cleavage diox...    366   1e-113   
ref|XP_009611128.1|  PREDICTED: probable carotenoid cleavage diox...    366   2e-113   
ref|XP_009623499.1|  PREDICTED: probable carotenoid cleavage diox...    366   2e-113   
gb|ABY60886.1|  carotenoid cleavage dioxygenase 4                       366   3e-113   
gb|AIX87534.1|  carotenoid cleavage dioxygenase 4                       366   3e-113   
gb|AEO14921.1|  9-cis-epoxycarotenoid dioxygenase                       351   6e-113   
gb|AEI61930.1|  carotenoid cleavage dioxygenase 4                       365   1e-112   
gb|AGT63321.1|  carotenoid cleavage dioxygenase 4a                      364   1e-112   
ref|XP_002268404.1|  PREDICTED: probable carotenoid cleavage diox...    364   2e-112   
gb|AEO14932.1|  9-cis-epoxycarotenoid dioxygenase                       350   2e-112   
gb|AIX87510.1|  carotenoid cleavage dioxygenase 4                       363   2e-112   
gb|AFJ94675.1|  carotenoid cleavage dioxygenase 4a                      363   4e-112   
gb|EYU37493.1|  hypothetical protein MIMGU_mgv1a023345mg                359   2e-111   
ref|XP_009363530.1|  PREDICTED: probable carotenoid cleavage diox...    361   3e-111   
gb|ADC53070.1|  9-cis-epoxycarotenoid dioxygenase                       348   5e-111   
gb|ABK24523.1|  unknown                                                 358   6e-111   
ref|XP_010677394.1|  PREDICTED: probable carotenoid cleavage diox...    360   7e-111   
gb|KDP37806.1|  hypothetical protein JCGZ_06708                         359   1e-110   
dbj|BAF36656.2|  putative carotenoid cleavage dioxygenase               359   1e-110   
gb|ABR17001.1|  unknown                                                 357   2e-110   
gb|ABK96278.1|  unknown                                                 355   2e-110   
ref|XP_010275133.1|  PREDICTED: probable carotenoid cleavage diox...    358   2e-110   
ref|XP_006437482.1|  hypothetical protein CICLE_v10031003mg             358   3e-110   
ref|XP_010241260.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    356   3e-110   
ref|XP_004246004.1|  PREDICTED: probable carotenoid cleavage diox...    358   3e-110   
gb|KHN19457.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase 1          356   3e-110   
ref|XP_003542847.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    356   4e-110   
ref|XP_002326037.2|  hypothetical protein POPTR_0019s12320g             358   5e-110   
ref|XP_006379330.1|  hypothetical protein POPTR_0009s15400g             357   6e-110   
ref|XP_007133813.1|  hypothetical protein PHAVU_011G211200g             355   8e-110   
gb|AGN03860.1|  carotenoid cleavage dioxygenase 4                       357   1e-109   
ref|XP_002269538.2|  PREDICTED: probable carotenoid cleavage diox...    356   1e-109   
gb|ABB52081.1|  putative carotenoid cleavage dioxygenase                354   2e-109   
ref|XP_006484631.1|  PREDICTED: probable carotenoid cleavage diox...    358   2e-109   
sp|Q94IR2.1|CCD1_PHAVU  RecName: Full=Carotenoid 9,10(9',10')-cle...    353   4e-109   
gb|AFW63527.1|  hypothetical protein ZEAMMB73_955136                    357   4e-109   
ref|XP_011002658.1|  PREDICTED: probable carotenoid cleavage diox...    355   4e-109   
ref|XP_011044128.1|  PREDICTED: zeaxanthin 7,8(7',8')-cleavage di...    355   4e-109   
ref|XP_004297644.1|  PREDICTED: probable carotenoid cleavage diox...    355   4e-109   
ref|XP_002312877.2|  hypothetical protein POPTR_0009s15430g             354   6e-109   
ref|XP_004512437.1|  PREDICTED: probable carotenoid cleavage diox...    354   6e-109   
gb|AGN03859.1|  carotenoid cleavage dioxygenase 1                       352   2e-108   



>ref|XP_009783401.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Nicotiana sylvestris]
Length=599

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/572 (78%), Positives = 500/572 (87%), Gaps = 8/572 (1%)
 Frame = -2

Query  2091  VDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQ--QLP---DGESPAPSQPKWNl  1927
             VDLG PSKSISM+KPT RAKI C  A+HS +V+T P+Q  Q P     ++P+P QP WNL
Sbjct  31    VDLGFPSKSISMRKPTPRAKIQC--ALHSPAVLTFPKQPYQYPTITKRDTPSPPQPAWNL  88

Query  1926  lqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDC  1747
              Q+A A ALD+ E AL+SR+ Q+PLPKT DPGVQIAGNF PVPE  VR+NLP+ G VPDC
Sbjct  89    FQKAAAKALDIMESALISRDKQKPLPKTSDPGVQIAGNFFPVPEMPVRHNLPITGTVPDC  148

Query  1746  INGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRP  1567
             INGVYVRNGANP F P AGHHLFDGDGM+HAVTI GGSV+YSCRFTETERLVQERGLG+ 
Sbjct  149   INGVYVRNGANPHFEPVAGHHLFDGDGMLHAVTINGGSVNYSCRFTETERLVQERGLGKS  208

Query  1566  VFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPY  1387
             VFPKAIGELHGHSG+ARLLLFYARGL GLVDH  GTG+ANAGLVYFNGRLLAMSEDDLPY
Sbjct  209   VFPKAIGELHGHSGIARLLLFYARGLCGLVDHSHGTGVANAGLVYFNGRLLAMSEDDLPY  268

Query  1386  HVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSS  1207
             HV +KP GDL+T GRYDF++QLKSTMIAHPK+DP SGE FALSYDV+QKPYLKYF    +
Sbjct  269   HVAIKPCGDLQTKGRYDFDEQLKSTMIAHPKIDPVSGELFALSYDVVQKPYLKYFKFSKN  328

Query  1206  GEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGI  1027
             G+KS DVEIPLDVPTM+HDFAITENYV+IPDQQVVFKLQ MI+GGS VIY++KKKSRFGI
Sbjct  329   GKKSYDVEIPLDVPTMMHDFAITENYVVIPDQQVVFKLQNMIKGGSPVIYDEKKKSRFGI  388

Query  1026  LKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSI  847
             L K  K++  IIWVESP+TFCFHLWNAWEE E DE+VVIGSCMTPPDSIFNEC+ENLKS+
Sbjct  389   LPKNVKDSNRIIWVESPDTFCFHLWNAWEEPENDEVVVIGSCMTPPDSIFNECDENLKSV  448

Query  846   LSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFA  667
             LSEIRLNLKT ES KR II +T +QVNLEAGMVN+N LGRKTQYAYLAIAEPWP+VSG A
Sbjct  449   LSEIRLNLKTAESRKRAIISST-EQVNLEAGMVNKNKLGRKTQYAYLAIAEPWPRVSGLA  507

Query  666   KVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAI  487
             KVDLSTGE+QK+MYGD +YGGEP F+PRN  +EKEDDG+IL+FVHDEK WKSELQIVNA+
Sbjct  508   KVDLSTGEVQKYMYGDTRYGGEPLFLPRNQCTEKEDDGYILAFVHDEKIWKSELQIVNAM  567

Query  486   NLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
              LEL AT+KLPSRVPYGFHGTF++  DL+NQV
Sbjct  568   TLELEATVKLPSRVPYGFHGTFVSKKDLENQV  599



>ref|NP_001274963.1| 9-cis-epoxy-carotenoid dioxygenase 2 [Solanum tuberosum]
 gb|AAT75152.1| 9-cis-epoxy-carotenoid dioxygenase 2 [Solanum tuberosum]
Length=580

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/568 (78%), Positives = 493/568 (87%), Gaps = 8/568 (1%)
 Frame = -2

Query  2094  TVDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqra  1915
             ++D  LPSKSISMK  T + KIH       S+++T P+Q     + P    P WN  Q+A
Sbjct  21    SLDFTLPSKSISMKNHTTKTKIH-------SALLTFPKQNNTPKKQPQFQTPDWNFFQKA  73

Query  1914  vaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGV  1735
              A ALD+ E ALVSRELQ PLPKT DP VQIAGNFAPVPEQ+VR+NLPV G +P+CINGV
Sbjct  74    AAKALDIVESALVSRELQNPLPKTADPRVQIAGNFAPVPEQSVRHNLPVIGTIPNCINGV  133

Query  1734  YVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPK  1555
             YVRNGANPLF P AGHHLFDGDGMVHAVT+  GSVSYSCRFTETERLVQER LGRPVFPK
Sbjct  134   YVRNGANPLFEPVAGHHLFDGDGMVHAVTVENGSVSYSCRFTETERLVQERELGRPVFPK  193

Query  1554  AIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRV  1375
             AIGELHGHSG+ARLLLFYARG+FGLVDH  GTG+ANAGLVYFN RLLAMSEDD+PY+V+V
Sbjct  194   AIGELHGHSGIARLLLFYARGVFGLVDHSHGTGVANAGLVYFNNRLLAMSEDDVPYNVQV  253

Query  1374  KPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKS  1195
              PSGDL+TVGRY+F+DQLKSTMIAHPK+DP SGE FALSYDV+QKPYLK F     GEKS
Sbjct  254   LPSGDLQTVGRYNFDDQLKSTMIAHPKIDPVSGELFALSYDVVQKPYLKSFKFSPDGEKS  313

Query  1194  PDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKT  1015
             PDVEIPLDVPTM+HDFAITENYV+IPDQQVVFKLQEMI+GGS VIY+K KKSRFGIL K 
Sbjct  314   PDVEIPLDVPTMMHDFAITENYVVIPDQQVVFKLQEMIKGGSPVIYDKNKKSRFGILPKN  373

Query  1014  AKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEI  835
             AK+++ IIWVESPETFCFHLWNAWEE ETDE+VVIGSCMTPPDSIF EC ENLKS+LSEI
Sbjct  374   AKDSDNIIWVESPETFCFHLWNAWEEPETDEVVVIGSCMTPPDSIFKECSENLKSVLSEI  433

Query  834   RLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDL  655
             RLNLKTGEST+R ++  +D QVNLEAGMVNRN LGRKTQ+ YLAIAEPWPKVSGFAKVDL
Sbjct  434   RLNLKTGESTRRQLLSPSD-QVNLEAGMVNRNKLGRKTQFTYLAIAEPWPKVSGFAKVDL  492

Query  654   STGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLEL  475
             STGE++K +YGD +YGGEP F+PRN NSEKEDDG+IL+F HDEKTWKSELQIVNA+ LEL
Sbjct  493   STGEIKKHIYGDKRYGGEPLFLPRNVNSEKEDDGYILAFCHDEKTWKSELQIVNAMTLEL  552

Query  474   LATIKLPSRVPYGFHGTFITSYDLQNQV  391
              AT+KLPSRVPYGFHGTFI+S DLQNQV
Sbjct  553   EATVKLPSRVPYGFHGTFISSKDLQNQV  580



>ref|XP_004244807.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Solanum lycopersicum]
Length=581

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/569 (78%), Positives = 492/569 (86%), Gaps = 9/569 (2%)
 Frame = -2

Query  2094  TVDLGLPSKSISMKK-PTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqr  1918
             ++D  LPSKSISMK   T + KIH       S+++TLP+Q       P      WN  Q+
Sbjct  21    SLDFTLPSKSISMKNHTTTKTKIH-------SALLTLPKQNNTPKNQPQFQTSHWNFFQK  73

Query  1917  avaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCING  1738
             A A ALD+ E ALVSRELQ PLPKT DP VQIAGNFAPVPEQ+VR+NLPV G +PDCING
Sbjct  74    AAAKALDIVESALVSRELQNPLPKTADPRVQIAGNFAPVPEQSVRHNLPVTGTIPDCING  133

Query  1737  VYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFP  1558
             VYVRNGANPLF P AGHHLFDGDGMVHAVT+  GSVSYSCRFTETERLVQER LG PVFP
Sbjct  134   VYVRNGANPLFEPVAGHHLFDGDGMVHAVTVENGSVSYSCRFTETERLVQERELGHPVFP  193

Query  1557  KAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVR  1378
             KAIGELHGHSG+ARLLLFYARG+FGLVDH  GTG+ANAGLV+FN RLLAMSEDD+PYHV+
Sbjct  194   KAIGELHGHSGIARLLLFYARGVFGLVDHSHGTGVANAGLVFFNNRLLAMSEDDVPYHVQ  253

Query  1377  VKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEK  1198
             V PSGDL+TVGRY+F+DQLKSTMIAHPK+DP SGE FALSYDV+QKPYLK F     GEK
Sbjct  254   VLPSGDLQTVGRYNFDDQLKSTMIAHPKIDPVSGELFALSYDVVQKPYLKSFKFSPDGEK  313

Query  1197  SPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKK  1018
             SPDVEIPLDVPTM+HDFAITENYV+IPDQQVVFKLQEMI+GGS VIY+K KKSRFGIL K
Sbjct  314   SPDVEIPLDVPTMMHDFAITENYVVIPDQQVVFKLQEMIKGGSPVIYDKNKKSRFGILPK  373

Query  1017  TAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSE  838
              A+N+E IIWVES ETFCFHLWNAWEE ETDE++VIGSCMTPPDSIFNEC ENLKS+LSE
Sbjct  374   NAENSENIIWVESAETFCFHLWNAWEEPETDEVIVIGSCMTPPDSIFNECNENLKSVLSE  433

Query  837   IRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVD  658
             IRLNLKTGEST+R ++  +D QVNLEAGMVNRN LGRKTQ+AYLAIAEPWPKVSGFAKVD
Sbjct  434   IRLNLKTGESTRRQLLSPSD-QVNLEAGMVNRNKLGRKTQFAYLAIAEPWPKVSGFAKVD  492

Query  657   LSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLE  478
             LSTGE++K +YGD +YGGEP F+PRN NSEKEDDG+IL+F HDEKTWKSELQIVNA+ LE
Sbjct  493   LSTGEIKKHIYGDKRYGGEPLFLPRNVNSEKEDDGYILAFCHDEKTWKSELQIVNAMTLE  552

Query  477   LLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             L AT+KLPSRVPYGFHGTFI+S DLQNQV
Sbjct  553   LEATVKLPSRVPYGFHGTFISSKDLQNQV  581



>ref|XP_009603531.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Nicotiana tomentosiformis]
Length=601

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/574 (78%), Positives = 495/574 (86%), Gaps = 10/574 (2%)
 Frame = -2

Query  2091  VDLGLPSKSISMKKPT-RRAKIHCEAAVHSSSVVTLPEQQLPDGESP------APSQPKW  1933
             VD  LP+KSIS K  T R+  IH  +A+ S +V+T P+Q+  +   P       P  P W
Sbjct  31    VDFSLPTKSISKKNLTIRKTNIH--SALQSPAVLTFPKQKKQNPTIPNKHLQSQPQTPDW  88

Query  1932  NllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVP  1753
             NL QRA A ALD+ E ALVS ELQ PLPKT DP VQIAGNFAPVPEQ VR++LPV G +P
Sbjct  89    NLFQRAAAKALDIVESALVSHELQNPLPKTADPRVQIAGNFAPVPEQPVRHSLPVTGTIP  148

Query  1752  DCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLG  1573
             DCINGVYVRNGANPLF P AGHHLFDGDGM+HAVTI   SVSYSCRFTET+RLVQER LG
Sbjct  149   DCINGVYVRNGANPLFEPVAGHHLFDGDGMIHAVTIDNSSVSYSCRFTETQRLVQERELG  208

Query  1572  RPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDL  1393
             RPVFPKAIGELHGHSG+ARLLLFYARGLFGLVDH  G G+ANAGLVYFN RLLAMSEDD+
Sbjct  209   RPVFPKAIGELHGHSGIARLLLFYARGLFGLVDHSHGMGVANAGLVYFNNRLLAMSEDDV  268

Query  1392  PYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVK  1213
             PY V++  SGDL+TVGRY+F++QLKSTMIAHPK+DP SGE FALSYDV+QKPYLKYF   
Sbjct  269   PYQVQISSSGDLQTVGRYNFDEQLKSTMIAHPKIDPVSGELFALSYDVVQKPYLKYFKFS  328

Query  1212  SSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRF  1033
             + G+KSPDVEIPLDVPTM+HDFAITENYV+IPDQQVVFKLQEMI+GGS VIY+K KKSRF
Sbjct  329   TYGKKSPDVEIPLDVPTMMHDFAITENYVVIPDQQVVFKLQEMIKGGSPVIYDKDKKSRF  388

Query  1032  GILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLK  853
             GIL K AK+++ IIWVESPETFCFHLWNAWEE ETDE+VVIGSCMTPPDSIFNEC ENL+
Sbjct  389   GILPKNAKDSKNIIWVESPETFCFHLWNAWEEPETDEVVVIGSCMTPPDSIFNECNENLQ  448

Query  852   SILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSG  673
             S+LSEIRLNLKTGESTKR II ++ +QVNLEAGMVNRN LGRKTQYAYLAIAEPWPKVSG
Sbjct  449   SVLSEIRLNLKTGESTKRAII-SSSEQVNLEAGMVNRNKLGRKTQYAYLAIAEPWPKVSG  507

Query  672   FAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVN  493
             FAKVDLSTGE+QK+MYGD +YGGEP F+PRN NSE EDDG IL+F HDEKTWKSELQIVN
Sbjct  508   FAKVDLSTGEVQKYMYGDKRYGGEPLFLPRNVNSENEDDGFILAFCHDEKTWKSELQIVN  567

Query  492   AINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             A+ LEL AT+KLPSRVPYGFHGTFI+S DLQNQV
Sbjct  568   AMTLELEATVKLPSRVPYGFHGTFISSKDLQNQV  601



>gb|AFP57678.1| 9-cis-epoxycarotenoid dioxygenase 3 protein family isoform 2 
[Nicotiana tabacum]
Length=601

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/574 (78%), Positives = 495/574 (86%), Gaps = 10/574 (2%)
 Frame = -2

Query  2091  VDLGLPSKSISMKKPT-RRAKIHCEAAVHSSSVVTLPEQQLPDGESP------APSQPKW  1933
             VD  LP+KSIS K  T R+  IH  +A+ S +V+T P+Q+  +   P       P  P W
Sbjct  31    VDFSLPTKSISKKNLTIRKTNIH--SALQSPAVLTFPKQKKQNPTIPNKHLQSQPQTPDW  88

Query  1932  NllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVP  1753
             NL QRA A ALD+ E ALVS ELQ PLPKT DP VQIAGNFAPVPEQ VR++LPV G +P
Sbjct  89    NLFQRAAAKALDIVESALVSHELQNPLPKTADPRVQIAGNFAPVPEQPVRHSLPVTGTIP  148

Query  1752  DCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLG  1573
             DCINGVYVRNGANPLF P AGHHLFDGDGM+HAVTI   SVSYSCRFTET+RLVQER LG
Sbjct  149   DCINGVYVRNGANPLFEPVAGHHLFDGDGMIHAVTIDNSSVSYSCRFTETQRLVQERELG  208

Query  1572  RPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDL  1393
             RPVFPKAIGELHGHSG+ARLLLFYARGLFGLVDH  G G+ANAGLVYFN RLLAMSEDD+
Sbjct  209   RPVFPKAIGELHGHSGIARLLLFYARGLFGLVDHSHGMGVANAGLVYFNNRLLAMSEDDV  268

Query  1392  PYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVK  1213
             PY V++  SGDL+TVGRY+F++QLKSTMIAHPK+DP SGE FALSYDV+QKPYLKYF   
Sbjct  269   PYQVQISSSGDLQTVGRYNFDEQLKSTMIAHPKIDPVSGELFALSYDVVQKPYLKYFKFS  328

Query  1212  SSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRF  1033
             + G+KSPDVEIPLDVPTM+HDFAITENYV+IPDQQVVFKLQEMI+GGS VIY+K KKSRF
Sbjct  329   TYGKKSPDVEIPLDVPTMMHDFAITENYVVIPDQQVVFKLQEMIKGGSPVIYDKDKKSRF  388

Query  1032  GILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLK  853
             GIL K AK+++ IIWVESPETFCFHLWNAWEE ETDE+VVIGSCMTPPDSIFNEC ENL+
Sbjct  389   GILPKNAKDSKNIIWVESPETFCFHLWNAWEEPETDEVVVIGSCMTPPDSIFNECNENLQ  448

Query  852   SILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSG  673
             S+LSEIRLNLKTGESTKR II ++ +QVNLEAGMVNRN LGRKTQYAYLAIAEPWPKVSG
Sbjct  449   SVLSEIRLNLKTGESTKRAII-SSSEQVNLEAGMVNRNKLGRKTQYAYLAIAEPWPKVSG  507

Query  672   FAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVN  493
             FAKVDLSTGE+QK+MYGD +YGGEP F+PRN NSE EDDG IL+F HDEKTWKSELQIVN
Sbjct  508   FAKVDLSTGEVQKYMYGDKRYGGEPLFLPRNVNSENEDDGFILAFCHDEKTWKSELQIVN  567

Query  492   AINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             A+ LEL AT+KLPSRVPYGFHGTFI+S DLQNQV
Sbjct  568   AMTLELEATVKLPSRVPYGFHGTFISSKDLQNQV  601



>ref|XP_009804376.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Nicotiana sylvestris]
Length=601

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/574 (78%), Positives = 493/574 (86%), Gaps = 10/574 (2%)
 Frame = -2

Query  2091  VDLGLPSKSISMKKPT-RRAKIHCEAAVHSSSVVTLPEQQLPDGESP------APSQPKW  1933
             VD  LPSKS SMK  T R+  IH  +A+ S +V+  P+++  +   P       P  P  
Sbjct  31    VDFSLPSKSSSMKNLTIRKTNIH--SALQSPAVLIFPKRKKQNPTIPNKQLHSQPQTPDL  88

Query  1932  NllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVP  1753
             NL QRA A ALD+ E ALVSRELQ PLPKT DP VQIAGNFAPVPEQ VR+NLPV G +P
Sbjct  89    NLFQRAAAKALDIVESALVSRELQNPLPKTADPRVQIAGNFAPVPEQPVRHNLPVTGTIP  148

Query  1752  DCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLG  1573
             DCINGVYVRNGANPLF P AGHHLFDGDGM+HAVTI   SVSYSCRFTET+RLVQER LG
Sbjct  149   DCINGVYVRNGANPLFEPVAGHHLFDGDGMIHAVTIDDSSVSYSCRFTETQRLVQERELG  208

Query  1572  RPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDL  1393
             RPVFPKAIGELHGHSG+ARLLLFYARGLFGLV+H  G G+ANAGLVYFN +LLAMSEDD+
Sbjct  209   RPVFPKAIGELHGHSGIARLLLFYARGLFGLVNHSHGMGVANAGLVYFNNKLLAMSEDDV  268

Query  1392  PYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVK  1213
             PY V++  SGDL+TVGRYDF +QLKSTMIAHPK+DP SGE FALSYDV+QKPYLKYF   
Sbjct  269   PYQVQISSSGDLQTVGRYDFEEQLKSTMIAHPKIDPVSGELFALSYDVVQKPYLKYFMFS  328

Query  1212  SSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRF  1033
             + G+KSPDVEIPLDVPTM+HDFAITENYV+IPDQQVVFKLQEMI+GGS VIY+K KKSRF
Sbjct  329   TDGKKSPDVEIPLDVPTMMHDFAITENYVVIPDQQVVFKLQEMIKGGSPVIYDKDKKSRF  388

Query  1032  GILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLK  853
             GIL K AK+++ IIWVESPETFCFHLWNAWEE ETDE+VVIGSCMTPPDSIFNEC ENL+
Sbjct  389   GILPKNAKDSKNIIWVESPETFCFHLWNAWEEPETDEVVVIGSCMTPPDSIFNECNENLQ  448

Query  852   SILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSG  673
             S+LSEIRLNLKTGESTKR II ++ +QVNLEAGMVNRN LGRKTQYAYLAIAEPWPKVSG
Sbjct  449   SVLSEIRLNLKTGESTKRAII-SSSEQVNLEAGMVNRNKLGRKTQYAYLAIAEPWPKVSG  507

Query  672   FAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVN  493
             FAKVDLSTGE+QK+MYGD +YGGEP F+PRN NSE EDDG IL+F HDEKTWKSELQIVN
Sbjct  508   FAKVDLSTGEVQKYMYGDKRYGGEPLFLPRNVNSENEDDGFILAFCHDEKTWKSELQIVN  567

Query  492   AINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             A+ LEL AT+KLPSRVPYGFHGTFI+S DLQNQV
Sbjct  568   AMTLELEATVKLPSRVPYGFHGTFISSKDLQNQV  601



>ref|XP_011096581.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Sesamum indicum]
Length=603

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/578 (75%), Positives = 495/578 (86%), Gaps = 14/578 (2%)
 Frame = -2

Query  2091  VDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQ-----QLPDGESPAPSQPK---  1936
             V+L  PSKS S++KPTR AKIHC  A+HS SV+TLP++      LP  +SPA        
Sbjct  29    VELSSPSKSFSVRKPTRGAKIHC--ALHSPSVLTLPKRPFQTPTLPKTDSPAHPPAPPLP  86

Query  1935  --WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDG  1762
               WNLLQ+A A ALD  E ALVSRE Q PLPKT DP VQIAGNFAPVPEQ VR+NLPV G
Sbjct  87    PHWNLLQKAAAQALDAMESALVSRERQHPLPKTADPRVQIAGNFAPVPEQPVRHNLPVTG  146

Query  1761  AVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGG-SVSYSCRFTETERLVQE  1585
              +P+CINGVYVRNGANPL  P  GHHLFDGDGM+HAV + GG S SY+CRFTET+RLVQE
Sbjct  147   TIPECINGVYVRNGANPLHEPLGGHHLFDGDGMIHAVALNGGNSASYACRFTETQRLVQE  206

Query  1584  RGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMS  1405
             R LGRPVFPKAIGELHGH G+ARL+LFYARGLFGLVDH  GTG+ANAGLVYFN RLLAMS
Sbjct  207   RDLGRPVFPKAIGELHGHLGIARLMLFYARGLFGLVDHSHGTGVANAGLVYFNQRLLAMS  266

Query  1404  EDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKY  1225
             EDDLPY VR+ PSGDLET+GRYDF DQL+STMIAHPK+DP S E FALSYDV+QKPYLKY
Sbjct  267   EDDLPYQVRITPSGDLETIGRYDFGDQLRSTMIAHPKIDPVSKELFALSYDVVQKPYLKY  326

Query  1224  FNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKK  1045
             F   + G+KSPDVEIPLDVPTM+HDFAITEN V+IPDQQVVFKLQEM++GGS VIY+K K
Sbjct  327   FKFSTDGKKSPDVEIPLDVPTMMHDFAITENLVVIPDQQVVFKLQEMVKGGSPVIYDKNK  386

Query  1044  KSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECE  865
             KSRFGIL K A+N+E I W+E  +TFCFHLWNAWEE ETDE+VVIGSCMTP DSIFNEC+
Sbjct  387   KSRFGILSKNAQNSEDIKWIECADTFCFHLWNAWEEPETDEVVVIGSCMTPADSIFNECD  446

Query  864   ENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWP  685
             E  KS+LSEIRLNLKTGES +RPII ++ +Q+NLEAGMVNRN LGRKT+YAYLAIAEPWP
Sbjct  447   EKFKSVLSEIRLNLKTGESKRRPIIQSS-EQINLEAGMVNRNRLGRKTRYAYLAIAEPWP  505

Query  684   KVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSEL  505
             KVSGFAKVDLSTG+++KF+YGD +YGGEPFFVPR+PNSE+EDDG+ILSFVHDEK WKSEL
Sbjct  506   KVSGFAKVDLSTGKVEKFIYGDRRYGGEPFFVPRDPNSEREDDGYILSFVHDEKAWKSEL  565

Query  504   QIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             QIVN++ L+L A+++LPSRVPYGFHGTFI+S DL+NQ 
Sbjct  566   QIVNSMTLKLEASVRLPSRVPYGFHGTFISSRDLENQA  603



>emb|CAN74478.1| hypothetical protein VITISV_002243 [Vitis vinifera]
Length=605

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/576 (76%), Positives = 486/576 (84%), Gaps = 16/576 (3%)
 Frame = -2

Query  2082  GLPSKSISMKKPTRRA--KIHCEAAVHSSSVVTLPEQ----------QLPDGESPAPSQP  1939
             G PSKSI  +KP  R    IHC AA+ S SV+  P Q            P+ +   P  P
Sbjct  34    GFPSKSIPFRKPNSRRGNAIHC-AALQSHSVLHYPRQPFHPKEFSKDDFPENQITQP--P  90

Query  1938  KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGA  1759
             +WN LQRA A ALD AE ALVS E Q PLPKT DP VQIAGNFAPVPEQ V ++LPV G 
Sbjct  91    QWNFLQRAAALALDRAESALVSHERQHPLPKTADPRVQIAGNFAPVPEQPVCHSLPVSGT  150

Query  1758  VPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERG  1579
             +PDCINGVY+RNGANPLF P AGHH FDGDGMVHAVT+ GGS SY+CRFTET+RLVQER 
Sbjct  151   IPDCINGVYLRNGANPLFEPVAGHHFFDGDGMVHAVTLNGGSASYACRFTETQRLVQERK  210

Query  1578  LGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSED  1399
             LGRPVFPKAIGELHGHSG+ARLLLFYARGLFGLVDH  GTG+ANAGLVYFN RLLAMSED
Sbjct  211   LGRPVFPKAIGELHGHSGIARLLLFYARGLFGLVDHNHGTGVANAGLVYFNQRLLAMSED  270

Query  1398  DLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFN  1219
             DLPY VR+KPSGDLETVGRYDF+ QL+STMIAHPKVDP SGE FALSYDV+QKPYLKYF+
Sbjct  271   DLPYQVRIKPSGDLETVGRYDFDKQLRSTMIAHPKVDPVSGELFALSYDVVQKPYLKYFH  330

Query  1218  VKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKS  1039
                 G KSPDVEIP+  PTM+HDFAITENYV+IPDQQVVFKLQEMI GGS VIY+K KKS
Sbjct  331   FSPGGHKSPDVEIPIAGPTMMHDFAITENYVVIPDQQVVFKLQEMITGGSPVIYDKTKKS  390

Query  1038  RFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEEN  859
             RFGIL K A+ A  IIWVESP+TFCFHLWNAWEE ET+E+VVIGSCMTP DSIFNECEEN
Sbjct  391   RFGILAKNAQTASDIIWVESPDTFCFHLWNAWEEPETNEVVVIGSCMTPADSIFNECEEN  450

Query  858   LKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKV  679
             L+S+LSEIRLNLKTGEST+RPI+PA+ +QVNLEAGMVNR  LGRKTQYAYLAIAEPWPKV
Sbjct  451   LQSVLSEIRLNLKTGESTRRPIVPAS-EQVNLEAGMVNRTRLGRKTQYAYLAIAEPWPKV  509

Query  678   SGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQI  499
             SGFAKVDLSTG++QK+ YGD +YGGEP+FV ++P SE+EDDG+IL+FVHDEKTWKSEL I
Sbjct  510   SGFAKVDLSTGDVQKYQYGDQRYGGEPYFVHKDPTSEREDDGYILAFVHDEKTWKSELHI  569

Query  498   VNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             VNA+NL+L AT+KLPSRVPYGFHGTF+ S DL NQ 
Sbjct  570   VNAMNLQLEATVKLPSRVPYGFHGTFVNSEDLANQA  605



>ref|NP_001268200.1| 9-cis-epoxycarotenoid dioxygenase 2 [Vitis vinifera]
 gb|AAR11194.1| 9-cis-epoxycarotenoid dioxygenase 2 [Vitis vinifera]
Length=605

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/576 (75%), Positives = 484/576 (84%), Gaps = 16/576 (3%)
 Frame = -2

Query  2082  GLPSKSISMKKPTRRA--KIHCEAAVHSSSVVTLPEQ----------QLPDGESPAPSQP  1939
             G PSKSI  +KP  R    IHC AA+ S SV+  P Q            P+ +   P  P
Sbjct  34    GFPSKSIPFRKPNSRRGNAIHC-AALQSHSVLHYPRQPFHPKEFSKDDFPENQITQP--P  90

Query  1938  KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGA  1759
             +WN LQRA A ALD AE ALVS E Q PLPK+ DP VQIAGNFAPVPEQ V ++LPV G 
Sbjct  91    QWNFLQRAAALALDRAESALVSHERQHPLPKSADPRVQIAGNFAPVPEQPVHHSLPVSGT  150

Query  1758  VPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERG  1579
             +PDC+NGVY+RNGANPLF P AGHH FDGDGMVHAVT+ GGS SY+CRFTET+RLVQER 
Sbjct  151   IPDCMNGVYLRNGANPLFEPVAGHHFFDGDGMVHAVTLNGGSASYACRFTETQRLVQERK  210

Query  1578  LGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSED  1399
             LGRPVFPKAIGELHGHSG+ARLLLFYARGLFGLVDH  GTG+ANAGLVYFN RLLAMSED
Sbjct  211   LGRPVFPKAIGELHGHSGIARLLLFYARGLFGLVDHNHGTGVANAGLVYFNQRLLAMSED  270

Query  1398  DLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFN  1219
             DLPY VR+KPSGDLETVGRYDF+ QL+STMIAHPKVDP SGE FALSYDV+QKPYLKYF+
Sbjct  271   DLPYQVRIKPSGDLETVGRYDFDKQLRSTMIAHPKVDPVSGELFALSYDVVQKPYLKYFH  330

Query  1218  VKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKS  1039
                 G KSPDVEIP+  PTM+HDFAITENYV+IPDQQVV KLQEMI GGS VIY K KKS
Sbjct  331   FSPEGHKSPDVEIPIAGPTMMHDFAITENYVVIPDQQVVLKLQEMITGGSPVIYHKNKKS  390

Query  1038  RFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEEN  859
             RFGIL K A+ A  IIWVESP+TFCFHLWNAWEE ET+E+VVIGSCMTP DSIFNECEEN
Sbjct  391   RFGILAKNAQTASDIIWVESPDTFCFHLWNAWEEPETNEVVVIGSCMTPADSIFNECEEN  450

Query  858   LKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKV  679
             L+S+LSEIRLNLKTGEST+RPI+PA+ +QVNLEAGMV+R  LGRKTQYAYLAIAEPWPKV
Sbjct  451   LQSVLSEIRLNLKTGESTRRPIVPAS-EQVNLEAGMVDRTRLGRKTQYAYLAIAEPWPKV  509

Query  678   SGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQI  499
             SGFAKVDLSTG++QK+ YGD +YGGEP+FV ++P SE+EDDG+IL+FVHDEKTWKSEL I
Sbjct  510   SGFAKVDLSTGDVQKYQYGDQRYGGEPYFVHKDPTSEREDDGYILAFVHDEKTWKSELHI  569

Query  498   VNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             VNA+NL+L AT+KLPSRVPYGFHGTF+ S DL NQ 
Sbjct  570   VNAMNLQLEATVKLPSRVPYGFHGTFVNSEDLANQA  605



>ref|XP_006449708.1| hypothetical protein CICLE_v10014639mg [Citrus clementina]
 gb|ABC26010.1| 9-cis-epoxycarotenoid dioxygenase 5 [Citrus clementina]
 gb|ESR62948.1| hypothetical protein CICLE_v10014639mg [Citrus clementina]
Length=609

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/586 (74%), Positives = 495/586 (84%), Gaps = 22/586 (4%)
 Frame = -2

Query  2091  VDLGLPSKSISMKK-PTRRAKIHCEAAVHSSSVVTLPEQQL-------------PDGESP  1954
             VD+G P+KSI++KK P +  K+  E+A+HS SV+  P+Q               P+ +S 
Sbjct  27    VDMGFPTKSIALKKKPNKSLKV--ESALHSPSVLHFPKQPYQNPVITRQDSTAKPENKSN  84

Query  1953  APS----QPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAV  1786
                    Q +WN LQRA A ALD+AE ALVSRE Q PLPKT DP VQI+GNFAPVPE  V
Sbjct  85    KSQGQTQQSQWNPLQRAAAMALDMAENALVSRERQHPLPKTADPRVQISGNFAPVPEWPV  144

Query  1785  RNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTE  1606
             R+ LPV G++P+CINGVY+RNGANPLF P AGHH FDGDGMVHAVTI  GS SY+CRFTE
Sbjct  145   RHGLPVTGSIPECINGVYLRNGANPLFEPVAGHHFFDGDGMVHAVTIGNGSASYACRFTE  204

Query  1605  TERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFN  1426
             T+RL+QER LGRPVFPKAIGELHGH+G+ RLLLFYARGLFGLVDH++GTG+ANAGLVYFN
Sbjct  205   TQRLMQERELGRPVFPKAIGELHGHNGIGRLLLFYARGLFGLVDHKQGTGVANAGLVYFN  264

Query  1425  GRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVI  1246
              RLLAMSEDDLPY VR+ PSGDLETVGRY+FN QLKSTMIAHPKVDP S E FALSYDV+
Sbjct  265   NRLLAMSEDDLPYQVRITPSGDLETVGRYNFNHQLKSTMIAHPKVDPVSKELFALSYDVV  324

Query  1245  QKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSC  1066
             QKPYLKYF   + G+KSPDVEI L VPTM+HDFAITEN+V+IPDQQVVFKLQEMI GGS 
Sbjct  325   QKPYLKYFRFSADGDKSPDVEIHLPVPTMMHDFAITENFVVIPDQQVVFKLQEMITGGSP  384

Query  1065  VIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPD  886
             VIY+K KKSRFGIL K AK++  IIW+ESP+TFCFHLWNAWEE ETDE+VVIGSCMTP D
Sbjct  385   VIYDKNKKSRFGILAKNAKDSNDIIWIESPDTFCFHLWNAWEEPETDEVVVIGSCMTPAD  444

Query  885   SIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYL  706
             SIFNEC+E+LKS+LSEIRLNLKTGEST+RPI+  +D QVNLEAGMVNRN LGRKTQ+AYL
Sbjct  445   SIFNECDESLKSVLSEIRLNLKTGESTRRPILSESD-QVNLEAGMVNRNSLGRKTQFAYL  503

Query  705   AIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNP-NSEKEDDGHILSFVHD  529
             AIAEPWPKVSGFAKVDLS+GE++K+ YGD KYGGEPFF+PR+  NSE EDDG+IL+FVHD
Sbjct  504   AIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPFFLPRDANNSENEDDGYILAFVHD  563

Query  528   EKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             EKTWKSELQIVNA+NL+L A+IKLPSRVPYGFHGTF+ S DL NQ 
Sbjct  564   EKTWKSELQIVNAMNLQLEASIKLPSRVPYGFHGTFVDSKDLVNQA  609



>gb|KDO78199.1| hypothetical protein CISIN_1g007291mg [Citrus sinensis]
Length=609

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/586 (74%), Positives = 492/586 (84%), Gaps = 22/586 (4%)
 Frame = -2

Query  2091  VDLGLPSKSISMKK-PTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAP-----------  1948
             VD G P+KSI++KK P +  K+  E+A+HS SV+  P+Q  P+     P           
Sbjct  27    VDKGFPTKSIALKKKPNKSLKV--ESALHSPSVLHFPKQPYPNPVITRPDSTAKPDNKSN  84

Query  1947  ------SQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAV  1786
                    Q +WN LQRA A ALD+AE ALVSRE Q PLPKT DP VQI GNFAPVPE+ V
Sbjct  85    KSQGQTQQSQWNPLQRAAAMALDMAENALVSRERQHPLPKTADPRVQIGGNFAPVPERPV  144

Query  1785  RNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTE  1606
             R+ LPV G++P+CINGVY+RNGANPLF P AGHH FDGDGMVHAVTI  GS SY+CRFTE
Sbjct  145   RHGLPVTGSIPECINGVYLRNGANPLFEPVAGHHFFDGDGMVHAVTIGNGSASYACRFTE  204

Query  1605  TERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFN  1426
             T+RL+QER LGRPVFPKAIGELHGH+G+ RLLLFYARGLFGLVDH++GTG+ANAGLVYFN
Sbjct  205   TQRLMQERELGRPVFPKAIGELHGHNGIGRLLLFYARGLFGLVDHKQGTGVANAGLVYFN  264

Query  1425  GRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVI  1246
              R+LAMSEDDLPY VR+ PSGDLETVGRY+FN QLKSTMIAHPKVDP S E FALSYDV+
Sbjct  265   NRILAMSEDDLPYQVRITPSGDLETVGRYNFNHQLKSTMIAHPKVDPVSKELFALSYDVV  324

Query  1245  QKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSC  1066
             QKPYLKYF   + G+KSPDVEI L VPTM+HDFAITEN+V+IPDQQVVFKLQEMI GGS 
Sbjct  325   QKPYLKYFRFSADGDKSPDVEIHLPVPTMMHDFAITENFVVIPDQQVVFKLQEMITGGSP  384

Query  1065  VIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPD  886
             VIY+K KKSRFGIL K AK++  IIW+ESP+TFCFHLWNAWEE ETDEIVVIGSCMTP D
Sbjct  385   VIYDKNKKSRFGILAKNAKDSNDIIWIESPDTFCFHLWNAWEEPETDEIVVIGSCMTPAD  444

Query  885   SIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYL  706
             SIFNEC+E+LKS+LSEIRLNLKTGEST+R I+  +D QVNLEAGMVNRN LGRKTQ+AYL
Sbjct  445   SIFNECDESLKSVLSEIRLNLKTGESTRRQILSESD-QVNLEAGMVNRNSLGRKTQFAYL  503

Query  705   AIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNP-NSEKEDDGHILSFVHD  529
             AIAEPWPKVSGFAKVDLS+GE++K+ YGD KYGGEPFF+PR+  NSE EDDG+IL+FVHD
Sbjct  504   AIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPFFLPRDANNSENEDDGYILAFVHD  563

Query  528   EKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             EKTWKSELQIVNA+NL+L A+IKLPSRVPYGFHGTF+ S DL NQ 
Sbjct  564   EKTWKSELQIVNAMNLQLEASIKLPSRVPYGFHGTFVDSKDLVNQA  609



>ref|NP_001275868.1| 9-cis-epoxycarotenoid dioxygenase 2 [Citrus sinensis]
 gb|AAY89371.1| 9-cis-epoxycarotenoid dioxygenase 2 [Citrus sinensis]
Length=609

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/586 (74%), Positives = 490/586 (84%), Gaps = 22/586 (4%)
 Frame = -2

Query  2091  VDLGLPSKSISMKK-PTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAP-----------  1948
             VD G P+KSI++KK P +  K+  E+A+HS SV+  P+Q  P+     P           
Sbjct  27    VDKGFPTKSIALKKKPNKSLKV--ESALHSPSVLHFPKQPYPNPVITRPDSTAKPDNKSN  84

Query  1947  ------SQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAV  1786
                    Q +WN LQRA A ALD+AE ALVSRE Q PLPKT DP VQI GNFAPVPE+ V
Sbjct  85    KSQGQTQQSQWNPLQRAAAMALDMAENALVSRERQHPLPKTADPRVQIGGNFAPVPERPV  144

Query  1785  RNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTE  1606
             R+ LPV G++P+CINGVY+RNGANPLF P AGHH FDGDGM HAVTI  GS SY+CRFTE
Sbjct  145   RHGLPVTGSIPECINGVYLRNGANPLFEPVAGHHFFDGDGMAHAVTIGNGSASYACRFTE  204

Query  1605  TERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFN  1426
             T+RL+QER LGRPVFPKAIGELHGH+G+ RLLLFYARGLFGLVDH +GTG+ANAGLVYFN
Sbjct  205   TQRLMQERELGRPVFPKAIGELHGHNGIGRLLLFYARGLFGLVDHEQGTGVANAGLVYFN  264

Query  1425  GRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVI  1246
              RLLAMSEDDLPY VR+ PSGDLETVGRY+FN QLKSTMIAHPKVDP+S E FALSYDV+
Sbjct  265   NRLLAMSEDDLPYQVRITPSGDLETVGRYNFNHQLKSTMIAHPKVDPDSKELFALSYDVV  324

Query  1245  QKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSC  1066
             QKPYLKYF   + G+KSPDVEI L VPTM+HDFAITEN+V+IPDQQVVFKLQEMI GGS 
Sbjct  325   QKPYLKYFRFSADGDKSPDVEIHLPVPTMMHDFAITENFVVIPDQQVVFKLQEMITGGSP  384

Query  1065  VIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPD  886
             VIY+K KKSRFGIL K AK++  IIW+ESP+TFCFHLWNAWEE ETDEIVVIGSCMTP D
Sbjct  385   VIYDKNKKSRFGILAKNAKDSNDIIWIESPDTFCFHLWNAWEEPETDEIVVIGSCMTPAD  444

Query  885   SIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYL  706
             SIFNEC+E+LKS+LSEIRLNLKTGEST+R I+  +D QVNLEAGMVNRN LGRKTQ+AYL
Sbjct  445   SIFNECDESLKSVLSEIRLNLKTGESTRRQILSESD-QVNLEAGMVNRNSLGRKTQFAYL  503

Query  705   AIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNP-NSEKEDDGHILSFVHD  529
             AIAEPWPKVSGFAKVDLS+GE++K+ YGD KYGGEPFF PR+  NSE EDDG+IL+FVHD
Sbjct  504   AIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPFFFPRDANNSENEDDGYILAFVHD  563

Query  528   EKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             EKTWKSELQIVNA+NL+L A+IKLPSRVPYGFHGTF+ S DL NQ 
Sbjct  564   EKTWKSELQIVNAMNLQLEASIKLPSRVPYGFHGTFVDSKDLVNQA  609



>gb|KDP37985.1| hypothetical protein JCGZ_04628 [Jatropha curcas]
Length=598

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/575 (75%), Positives = 487/575 (85%), Gaps = 11/575 (2%)
 Frame = -2

Query  2091  VDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQ--------PK  1936
             VDLG  S + S  K ++  KIHC  A++S SV+ LPE  +P  +S    +        P 
Sbjct  27    VDLGSISFTKSKPKSSKTNKIHC--ALNSPSVLHLPEHVIPKDDSFITVKRKTHHRQPPH  84

Query  1935  WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAV  1756
             WNLLQ+A A ALDVAEGALVS+E Q  LPKT DP VQI+GN+APVPEQ VR +LPV G +
Sbjct  85    WNLLQKAAAIALDVAEGALVSKERQHQLPKTADPRVQISGNYAPVPEQPVRQSLPVAGTI  144

Query  1755  PDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGL  1576
             PDCINGVYVRNGANPLF P AGHHLFDGDGMVHAV+I  G+ SY+CRFTETERL QER L
Sbjct  145   PDCINGVYVRNGANPLFEPIAGHHLFDGDGMVHAVSIKNGNASYACRFTETERLKQEREL  204

Query  1575  GRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDD  1396
             GRPVFPKAIGELHGHSG+ARLLLFYARGL GLVDH +GTG+ANAGLVYFN RLLAMSEDD
Sbjct  205   GRPVFPKAIGELHGHSGIARLLLFYARGLCGLVDHTKGTGVANAGLVYFNARLLAMSEDD  264

Query  1395  LPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNV  1216
             +PY VR+  SGDLETVGR+DFN QLK+ MIAHPK+DP S E FALSYDV+QKPYLKYF  
Sbjct  265   VPYQVRITNSGDLETVGRHDFNGQLKNAMIAHPKIDPVSKELFALSYDVVQKPYLKYFKF  324

Query  1215  KSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSR  1036
                G+KSPDV IPL VPTM+HDFAITEN+V+IPDQQVVFKLQEMIRGGS V+Y+K KKSR
Sbjct  325   SPDGKKSPDVNIPLSVPTMMHDFAITENFVVIPDQQVVFKLQEMIRGGSPVVYDKDKKSR  384

Query  1035  FGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENL  856
             FGIL K A +A+ IIWVESPETFCFHLWNAWEE E+DEIVVIGSCMTPPDSIFNEC+E+L
Sbjct  385   FGILAKNATDADNIIWVESPETFCFHLWNAWEEPESDEIVVIGSCMTPPDSIFNECDESL  444

Query  855   KSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVS  676
             KS+LSEIRLNLKTG+ST+RPII  ++ QVNLEAGMVNRN LGRK+QYAYLAIAEPWPKVS
Sbjct  445   KSVLSEIRLNLKTGKSTRRPIIQESN-QVNLEAGMVNRNRLGRKSQYAYLAIAEPWPKVS  503

Query  675   GFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIV  496
             GFAKVDL TGE++K +YGD KYGGEPFF+PR+PNSE EDDG+IL+FVHDEK  KSELQIV
Sbjct  504   GFAKVDLFTGEVKKHIYGDKKYGGEPFFLPRDPNSENEDDGYILAFVHDEKKCKSELQIV  563

Query  495   NAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             NAINL+L A+IKLPSRVPYGFHGT+I S DL NQ 
Sbjct  564   NAINLQLEASIKLPSRVPYGFHGTYINSSDLVNQA  598



>ref|XP_007213614.1| hypothetical protein PRUPE_ppa002314mg [Prunus persica]
 gb|EMJ14813.1| hypothetical protein PRUPE_ppa002314mg [Prunus persica]
Length=688

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/585 (73%), Positives = 482/585 (82%), Gaps = 23/585 (4%)
 Frame = -2

Query  2085  LGLPSKSISMKK-----PTRRA-KIHCEAAVHSSSVVTLPEQQL------PDGESPAPSQ  1942
             +G P +SIS++K      TRR   IHC  A+ S SV+  P Q         +  SP P+ 
Sbjct  107   MGFPKRSISLRKTHPKAATRRTTSIHC--ALQSPSVLHFPNQPYNRPIITKEATSPKPNN  164

Query  1941  --------PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAV  1786
                     P+WNLLQ+A A A+D+ EGALVSRE Q PLPKT DP VQI GN+APVPEQ V
Sbjct  165   STHHHHQPPQWNLLQKAAAMAIDMVEGALVSRERQNPLPKTSDPRVQITGNYAPVPEQPV  224

Query  1785  RNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTE  1606
             R++LP+ G +P+CINGVYVRNGANPLF P AGHHLFDGDGMVHAVTI  GS SY+CRFTE
Sbjct  225   RHSLPITGTIPECINGVYVRNGANPLFEPVAGHHLFDGDGMVHAVTIDSGSASYACRFTE  284

Query  1605  TERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFN  1426
             T+RLVQER  GRPVFPKAIGELHGHSG+ARLLLFYARG+ GLVD   GTG+ANAGLVY N
Sbjct  285   TQRLVQEREFGRPVFPKAIGELHGHSGIARLLLFYARGVLGLVDKNHGTGVANAGLVYHN  344

Query  1425  GRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVI  1246
              RLLAMSEDDLPY VRV  SGDLETVGRYDFN QL STMIAHPKVDPESG  FALSYDV+
Sbjct  345   DRLLAMSEDDLPYQVRVTKSGDLETVGRYDFNSQLGSTMIAHPKVDPESGSLFALSYDVV  404

Query  1245  QKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSC  1066
             QKPYLKYF V   G KSPDVEIPL  PTM+HDFAITENYV+IPDQQVVFKLQEMI GGS 
Sbjct  405   QKPYLKYFQVSPDGTKSPDVEIPLAGPTMMHDFAITENYVVIPDQQVVFKLQEMITGGSP  464

Query  1065  VIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPD  886
             VIY+K K SRFGILKK AKNA+ ++WV+SP+TFCFHLWNAWEE E+DE+VVIGSCMTPPD
Sbjct  465   VIYDKDKMSRFGILKKNAKNADDLVWVDSPDTFCFHLWNAWEEPESDEVVVIGSCMTPPD  524

Query  885   SIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYL  706
             SIFNEC+E+LKS+LSEIRLNLKTGEST+R I+ +  + VNLEAGMVNRN LGRKT++AYL
Sbjct  525   SIFNECDESLKSVLSEIRLNLKTGESTRRAIL-SESEHVNLEAGMVNRNRLGRKTRFAYL  583

Query  705   AIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDE  526
             AIAEPWPKVSGFAKVD+STGE++KF+YGD KYGGEPFFVP       EDDG+I++FVHDE
Sbjct  584   AIAEPWPKVSGFAKVDVSTGEVKKFIYGDKKYGGEPFFVPNAELGSSEDDGYIMTFVHDE  643

Query  525   KTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             KTWKSELQIVNA+NL+L AT+KLPSRVPYGFHGTFI S DL NQ 
Sbjct  644   KTWKSELQIVNAVNLKLEATVKLPSRVPYGFHGTFIESKDLANQA  688



>ref|XP_008225495.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Prunus mume]
Length=617

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/585 (74%), Positives = 481/585 (82%), Gaps = 23/585 (4%)
 Frame = -2

Query  2085  LGLPSKSISMKK-----PTRRA-KIHCEAAVHSSSVVTLPEQQL-------------PDG  1963
             +G P +SI ++K      TRR   IHC  A+ S SV+  P Q               P+ 
Sbjct  36    MGFPKRSIFLRKTHPKTATRRTTSIHC--ALQSPSVLHFPNQPYNQPIITKEATSLKPNN  93

Query  1962  ESPAPSQP-KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAV  1786
              +    QP +WNLLQ+A A A+D  EGALVSRE Q PLPKT DP VQIAGN+APVPEQ V
Sbjct  94    STHHHHQPPQWNLLQKAAAMAIDTVEGALVSRERQNPLPKTSDPRVQIAGNYAPVPEQPV  153

Query  1785  RNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTE  1606
             R++LP+ G +P+CINGVYVRNGANPLF P AGHHLFDGDGMVHAVTI  GS SYSCRFTE
Sbjct  154   RHSLPITGTIPECINGVYVRNGANPLFEPVAGHHLFDGDGMVHAVTIDSGSASYSCRFTE  213

Query  1605  TERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFN  1426
             T+RLVQER  GRPVFPKAIGELHGHSG+ARLLLFYARG+ GLVD   GTG+ANAGLVY N
Sbjct  214   TQRLVQEREFGRPVFPKAIGELHGHSGIARLLLFYARGVLGLVDKNHGTGVANAGLVYHN  273

Query  1425  GRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVI  1246
             GRLLAMSEDDLPY VRV  SGDLETVGRYDFN QL STMIAHPKVDPESG  FALSYDV+
Sbjct  274   GRLLAMSEDDLPYQVRVTKSGDLETVGRYDFNSQLGSTMIAHPKVDPESGSLFALSYDVV  333

Query  1245  QKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSC  1066
             QKPYLKYF V   G KSPDVEIPL  PTM+HDFAITENYV+IPDQQVVFKLQEMI GGS 
Sbjct  334   QKPYLKYFQVSPDGAKSPDVEIPLAGPTMMHDFAITENYVVIPDQQVVFKLQEMITGGSP  393

Query  1065  VIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPD  886
             VIY+K K SRFGILKK AKNA+ ++WV+SP+TFCFHLWNAWEE E+DE+VVIGSCMTPPD
Sbjct  394   VIYDKDKMSRFGILKKNAKNADDLVWVDSPDTFCFHLWNAWEEPESDEVVVIGSCMTPPD  453

Query  885   SIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYL  706
             SIFNEC+E+LKS+LSEIRLNLKTGEST+R I+ +  + VNLEAGMVNRN LGRKT++AYL
Sbjct  454   SIFNECDESLKSVLSEIRLNLKTGESTRRAIL-SESEHVNLEAGMVNRNRLGRKTRFAYL  512

Query  705   AIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDE  526
             AIAEPWPKVSGFAKVD+STGE++KF+YGD KYGGEPFFVP       EDDG+I++FVHDE
Sbjct  513   AIAEPWPKVSGFAKVDVSTGEVKKFIYGDKKYGGEPFFVPNTELGSSEDDGYIMTFVHDE  572

Query  525   KTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             KTWKSELQIVNA+NL+L AT+KLPSRVPYGFHGTFI S DL NQ 
Sbjct  573   KTWKSELQIVNAVNLKLEATVKLPSRVPYGFHGTFIESKDLANQA  617



>ref|XP_007025058.1| Nine-cis-epoxycarotenoid dioxygenase 5 [Theobroma cacao]
 gb|EOY27680.1| Nine-cis-epoxycarotenoid dioxygenase 5 [Theobroma cacao]
Length=613

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/594 (73%), Positives = 494/594 (83%), Gaps = 29/594 (5%)
 Frame = -2

Query  2094  TVDLGLPSKSISMKK------PTRRAK----IHCEAAVHSSSVVTLPEQQ-----LPDGE  1960
             TVDLG+   SIS KK        RR      IH  +A+HS SV+  P+Q      +P  E
Sbjct  23    TVDLGISPTSISWKKRQPNKTTLRRTNNINIIH--SALHSPSVLHFPKQPYQNPVIPREE  80

Query  1959  SPAPSQPK----------WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNF  1810
             +P  ++PK          WNLLQ+A A ALD+AE ALVSRELQ PLPKT DP VQI+GNF
Sbjct  81    TPVNAKPKTHQPQQQQPQWNLLQKAAAMALDMAESALVSRELQHPLPKTADPRVQISGNF  140

Query  1809  APVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSV  1630
             APVPEQ V+ +LP++G +P CINGVY+RNGANPLF P AGHH FDGDGMVHAVTI  G+ 
Sbjct  141   APVPEQPVKQSLPINGTIPSCINGVYLRNGANPLFEPVAGHHFFDGDGMVHAVTIDNGNA  200

Query  1629  SYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLA  1450
             SY+CRFTET+RL+QE+ LGRPVFPKAIGELHGHSG+ARLLLFYARGLFGLVDH++GTG+A
Sbjct  201   SYACRFTETQRLLQEKELGRPVFPKAIGELHGHSGIARLLLFYARGLFGLVDHKQGTGVA  260

Query  1449  NAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEF  1270
             NAGLVYFN RLLAMSEDDLPYHVR+  SGDLETVGRY+F+DQLKSTMIAHPK+DP S E 
Sbjct  261   NAGLVYFNNRLLAMSEDDLPYHVRITSSGDLETVGRYNFDDQLKSTMIAHPKIDPFSKEL  320

Query  1269  FALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQ  1090
             FALSYDVI KPYLKYF     G+KSP+VEIPL VPTM+HDFAITEN+V+IPDQQVVFKLQ
Sbjct  321   FALSYDVIHKPYLKYFRFLPDGKKSPNVEIPLPVPTMMHDFAITENFVVIPDQQVVFKLQ  380

Query  1089  EMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVI  910
             EMI GGS VIY+K KKSRFGIL K A +A+ IIWVESP+TFCFHLWNAWEE E+DE+VVI
Sbjct  381   EMIIGGSPVIYDKNKKSRFGILSKNASDAKDIIWVESPDTFCFHLWNAWEEPESDEVVVI  440

Query  909   GSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLG  730
             GSCMTPPDSIFNEC+E+LKS+LSEIRLNLKTGES +RPII +  +QVNLEAGMVNRN LG
Sbjct  441   GSCMTPPDSIFNECDESLKSVLSEIRLNLKTGESIRRPII-SESEQVNLEAGMVNRNRLG  499

Query  729   RKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEK-EDDG  553
             RKT+YAYLAIAEPWPKVSGFAKVDL TGE++K +YGD +YGGEPFF+PR+ N E  EDDG
Sbjct  500   RKTRYAYLAIAEPWPKVSGFAKVDLFTGEVKKHIYGDRRYGGEPFFLPRDDNCESAEDDG  559

Query  552   HILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +ILSFVHDEKTWKSELQIVNA+NL+L A+IKL SRVPYGFHGTFI +  L NQ 
Sbjct  560   YILSFVHDEKTWKSELQIVNAMNLQLEASIKLQSRVPYGFHGTFIDAKALVNQA  613



>dbj|BAE92960.1| 9-cis-epoxycarotenoid-dioxygenase [Citrus unshiu]
Length=587

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/575 (74%), Positives = 487/575 (85%), Gaps = 22/575 (4%)
 Frame = -2

Query  2091  VDLGLPSKSISMKK-PTRRAKIHCEAAVHSSSVVTLPEQQL-------------PDGESP  1954
             VD+G P+KSI++KK P +  K+  E+A+HS SV+  P+Q               P+ +S 
Sbjct  16    VDMGFPTKSIALKKKPNKSLKV--ESALHSPSVLHFPKQPYQNPVITRQDSTAKPENKSN  73

Query  1953  APS----QPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAV  1786
                    Q +WN LQRA A ALD+AE ALVSRE Q PLPKT DP VQI+GNFAPVPE  V
Sbjct  74    KSQGQTQQSQWNPLQRAAAMALDMAENALVSRERQHPLPKTADPRVQISGNFAPVPEWPV  133

Query  1785  RNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTE  1606
             R+ LPV G++P+CINGVY+RNGANPLF P AGHH FDGDGMVHAVTI  GS SY+CRFTE
Sbjct  134   RHGLPVTGSIPECINGVYLRNGANPLFEPVAGHHFFDGDGMVHAVTIGNGSASYACRFTE  193

Query  1605  TERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFN  1426
             T+RL+QER LGRPVFPKAIGELHGH+G+ RLLLFYARGLFGLVDH++GTG+ANAGLVYFN
Sbjct  194   TQRLMQERELGRPVFPKAIGELHGHNGIGRLLLFYARGLFGLVDHKQGTGVANAGLVYFN  253

Query  1425  GRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVI  1246
              RLLAMSEDDLPY VR+ PSGDLETVGRY+FN QLKSTMIAHPKVDP S E FALSYDV+
Sbjct  254   NRLLAMSEDDLPYQVRITPSGDLETVGRYNFNHQLKSTMIAHPKVDPVSKELFALSYDVV  313

Query  1245  QKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSC  1066
             QKPYLKYF   + G+KSPDVEI L VPTM+HDFAITEN+V+IPDQQVVFKLQEMI GGS 
Sbjct  314   QKPYLKYFRFSADGDKSPDVEIHLPVPTMMHDFAITENFVVIPDQQVVFKLQEMITGGSP  373

Query  1065  VIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPD  886
             VIY+K KKSRFGIL K AK++  IIW+ESP+TFCFHLWNAWEE ETDE+VVIGSCMTP D
Sbjct  374   VIYDKNKKSRFGILAKNAKDSNDIIWIESPDTFCFHLWNAWEEPETDEVVVIGSCMTPAD  433

Query  885   SIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYL  706
             SIFNEC+E+LKS+LSEIRLNLKTGEST+RPI+  +D QVNLEAGMVNRN LGRKTQ+AYL
Sbjct  434   SIFNECDESLKSVLSEIRLNLKTGESTRRPILSESD-QVNLEAGMVNRNSLGRKTQFAYL  492

Query  705   AIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNP-NSEKEDDGHILSFVHD  529
             AIAEPWPKVSGFAKVDLS+GE++K+ YGD KYGGEPFF+PR+  NSE EDDG+IL+FVHD
Sbjct  493   AIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPFFLPRDANNSENEDDGYILAFVHD  552

Query  528   EKTWKSELQIVNAINLELLATIKLPSRVPYGFHGT  424
             EKTWKSELQI NA+NL+L A+IKLPSRVPYGFHGT
Sbjct  553   EKTWKSELQIANAMNLQLEASIKLPSRVPYGFHGT  587



>dbj|BAE92961.1| 9-cis-epoxycarotenoid dioxygenase [Citrus sinensis]
Length=587

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/575 (74%), Positives = 484/575 (84%), Gaps = 22/575 (4%)
 Frame = -2

Query  2091  VDLGLPSKSISMKK-PTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAP-----------  1948
             VD G P+KSI++KK P +  K+  E+A+HS SV+  P+Q  P+     P           
Sbjct  16    VDKGFPTKSIALKKKPNKSLKV--ESALHSPSVLHFPKQPYPNPVITRPDSTAKPDNKSN  73

Query  1947  ------SQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAV  1786
                    Q +WN LQRA A ALD+AE ALVSRE Q PLPKT DP VQI GNFAPVPE+ V
Sbjct  74    KSQGQTQQSQWNPLQRAAAMALDMAENALVSRERQHPLPKTADPRVQIGGNFAPVPERPV  133

Query  1785  RNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTE  1606
             R+ LPV G++P+CINGVY+RNGANPLF P AGHH FDGDGMVHAVTI  GS SY+CRFTE
Sbjct  134   RHGLPVTGSIPECINGVYLRNGANPLFEPVAGHHFFDGDGMVHAVTIGNGSASYACRFTE  193

Query  1605  TERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFN  1426
             T+RL+QER LGRPVFPKAIGELHGH+G+ RLLLFYARGLFGLVDH++GTG+ANAGLVYFN
Sbjct  194   TQRLMQERELGRPVFPKAIGELHGHNGIGRLLLFYARGLFGLVDHKQGTGVANAGLVYFN  253

Query  1425  GRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVI  1246
              RLLAMSEDDLPY VR+ PSGDLETVGRY+FN QLKSTMIAHPKVDP S E FALSYDV+
Sbjct  254   NRLLAMSEDDLPYQVRITPSGDLETVGRYNFNHQLKSTMIAHPKVDPVSKELFALSYDVV  313

Query  1245  QKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSC  1066
             QKPYLKYF   + G+KSPDVEI L VPTM+HDFAITEN+V+IPDQQVVFKLQEMI GGS 
Sbjct  314   QKPYLKYFRFSADGDKSPDVEIHLPVPTMMHDFAITENFVVIPDQQVVFKLQEMITGGSP  373

Query  1065  VIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPD  886
             VIY+K KKSRFGIL K AK++  IIW+ESP+TFCFHLWNAWEE ETDEIVVIGSCMTP D
Sbjct  374   VIYDKNKKSRFGILAKNAKDSNDIIWIESPDTFCFHLWNAWEEPETDEIVVIGSCMTPAD  433

Query  885   SIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYL  706
             SIFNEC+E+LKS+LSEIRLNLKTGEST+R I+  +D QVNLEAGMVNRN LGRKTQ+AYL
Sbjct  434   SIFNECDESLKSVLSEIRLNLKTGESTRRQILSESD-QVNLEAGMVNRNSLGRKTQFAYL  492

Query  705   AIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNP-NSEKEDDGHILSFVHD  529
             AIAEPWPKVSGFAKVDLS+GE++K+ YGD KYGGEPFF PR+  NSE EDDG+IL+FVHD
Sbjct  493   AIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPFFFPRDANNSENEDDGYILAFVHD  552

Query  528   EKTWKSELQIVNAINLELLATIKLPSRVPYGFHGT  424
             EKTWKSELQIVNA+NL+L A+IKLPSRVPYGFHGT
Sbjct  553   EKTWKSELQIVNAMNLQLEASIKLPSRVPYGFHGT  587



>dbj|BAE92962.1| 9-cis-epoxycarotenoid dioxygenase [Citrus limon]
Length=587

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/575 (74%), Positives = 487/575 (85%), Gaps = 22/575 (4%)
 Frame = -2

Query  2091  VDLGLPSKSISMKK-PTRRAKIHCEAAVHSSSVVTLPEQQLPD-----GESPA-------  1951
             VD+G P+KSI++KK P +  K+  E+A+HS SV+  P+Q  P+      +S A       
Sbjct  16    VDMGFPTKSIALKKKPNKSLKV--ESALHSPSVLHFPKQPYPNPVITRQDSTAKPDNKSN  73

Query  1950  -----PSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAV  1786
                    Q +WN LQRA A ALD+AE ALVSRE Q PLPKT DP VQI GNFAPVPE  V
Sbjct  74    KSQGQTQQSQWNPLQRAAAMALDIAENALVSRERQHPLPKTADPSVQIGGNFAPVPELPV  133

Query  1785  RNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTE  1606
             R+ LPV G++P+CINGVY+RNGANPLF P AGHH FDGDGMVHAV I  GS SY+CRFTE
Sbjct  134   RHGLPVTGSIPECINGVYLRNGANPLFEPVAGHHFFDGDGMVHAVAIGNGSASYACRFTE  193

Query  1605  TERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFN  1426
             T+RL+QER LGRPVFPKAIGELHGH+G+ RLLLFYARGLFGLVDH++GTG+ANAGLVYFN
Sbjct  194   TQRLMQERELGRPVFPKAIGELHGHNGIGRLLLFYARGLFGLVDHKQGTGVANAGLVYFN  253

Query  1425  GRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVI  1246
              RLLAMSEDDLPY VR+ PSGDLETVGRY+FN QLKSTMIAHPKVDP S E FALSYDV+
Sbjct  254   NRLLAMSEDDLPYQVRITPSGDLETVGRYNFNHQLKSTMIAHPKVDPVSKELFALSYDVV  313

Query  1245  QKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSC  1066
             QKPYLKYF   + G+KSPDVEI L VPTM+HDFAITEN+V+IPDQQVVFKLQEMI GGS 
Sbjct  314   QKPYLKYFRFSADGDKSPDVEIHLPVPTMMHDFAITENFVVIPDQQVVFKLQEMITGGSP  373

Query  1065  VIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPD  886
             VIY++ KKSRFGIL K AK++  +IW+ESP+TFCFHLWNAWEE ETDE+VVIGSCMTP D
Sbjct  374   VIYDQNKKSRFGILAKNAKDSNDVIWIESPDTFCFHLWNAWEEPETDEVVVIGSCMTPAD  433

Query  885   SIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYL  706
             SIFNEC+E+LKS+LSEIRLNLKTGEST+RPI+  +D QVNLEAGMVNRN LGRKTQ+AYL
Sbjct  434   SIFNECDESLKSVLSEIRLNLKTGESTRRPILSESD-QVNLEAGMVNRNRLGRKTQFAYL  492

Query  705   AIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNP-NSEKEDDGHILSFVHD  529
             AIAEPWPKVSGFAKVDLS+GE++K+ YGD KYGGEPFF+PR+  NSE EDDG+IL+FVHD
Sbjct  493   AIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPFFLPRDANNSENEDDGYILAFVHD  552

Query  528   EKTWKSELQIVNAINLELLATIKLPSRVPYGFHGT  424
             EKTWKSELQIVNA+NL+L A+I+LPSRVPYGFHGT
Sbjct  553   EKTWKSELQIVNAMNLQLEASIQLPSRVPYGFHGT  587



>ref|XP_010247741.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Nelumbo nucifera]
Length=622

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/597 (72%), Positives = 478/597 (80%), Gaps = 33/597 (6%)
 Frame = -2

Query  2091  VDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQ----------------------  1978
             +DLG  SKSI +KKP RRA++HC     + SV   P+Q                      
Sbjct  27    MDLGYSSKSIILKKPNRRAQLHCSLQT-TPSVFHFPKQTSTFQPTTTSAATTITTLPKLK  85

Query  1977  ---------QLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQ  1825
                       +    +  PS P+WNLLQR+ A ALD  E ALVS E   PLPKT DP VQ
Sbjct  86    TKPKTKEDDSVSTPTTNNPSSPQWNLLQRSAAIALDAVEAALVSSERHHPLPKTADPAVQ  145

Query  1824  IAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTI  1645
             IAGNFAPV EQ VR++LPV G +PDCI GVYVRNGANPLF P AGHH FDGDGMVHAV I
Sbjct  146   IAGNFAPVLEQPVRHSLPVSGRIPDCIQGVYVRNGANPLFEPVAGHHFFDGDGMVHAVRI  205

Query  1644  TGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRR  1465
               GS SY+CRFTET+RLVQER LGRPVFPKAIGELHGH G+ARLLLFYARGLFGLVDH  
Sbjct  206   EDGSASYACRFTETQRLVQERALGRPVFPKAIGELHGHFGIARLLLFYARGLFGLVDHTH  265

Query  1464  GTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDP  1285
             GTG+ANAGLVYFNG LLAMSEDDLPYHVRV  SGDLETVGRYDFN QL S MIAHPK+DP
Sbjct  266   GTGVANAGLVYFNGHLLAMSEDDLPYHVRVTASGDLETVGRYDFNGQLCSAMIAHPKLDP  325

Query  1284  ESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQV  1105
              SG+ FALSYDVIQKPYLKYF+    G+KSPDVEIP+  PTM+HDFAITE +V+IPDQQV
Sbjct  326   VSGKLFALSYDVIQKPYLKYFSFSPDGQKSPDVEIPVTEPTMMHDFAITERFVVIPDQQV  385

Query  1104  VFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETD  925
             VFKLQEMIRGGS V+Y+K K SRFGIL K A +A GI WVE P+ FCFHLWNAWEE ETD
Sbjct  386   VFKLQEMIRGGSPVVYDKNKISRFGILDKNAVDASGIRWVEVPDCFCFHLWNAWEEPETD  445

Query  924   EIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVN  745
             E+VVIGSCMTPPDSIFNECEE LKS+LSEIRLNLKTG+ST+RPII  ++ Q+NLEAGMVN
Sbjct  446   EVVVIGSCMTPPDSIFNECEEGLKSVLSEIRLNLKTGKSTRRPIISVSN-QLNLEAGMVN  504

Query  744   RNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEK  565
             RN LGRK+Q+AYLAIAEPWP+VSGFAKVDL+TGE+ KFMYGD  YGGEPFFVPR+PNSE+
Sbjct  505   RNRLGRKSQFAYLAIAEPWPRVSGFAKVDLTTGEVSKFMYGDRCYGGEPFFVPRHPNSER  564

Query  564   EDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             EDDG+IL+F+HDEKT KSEL IVNA+NL+L A++KLPSRVPYGFHGTFI S DL+ Q
Sbjct  565   EDDGYILAFMHDEKTSKSELVIVNAMNLQLEASVKLPSRVPYGFHGTFINSNDLEKQ  621



>ref|XP_010110953.1| hypothetical protein L484_021647 [Morus notabilis]
 gb|EXC29339.1| hypothetical protein L484_021647 [Morus notabilis]
Length=605

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/575 (74%), Positives = 486/575 (85%), Gaps = 8/575 (1%)
 Frame = -2

Query  2091  VDLGLPSKS-ISMKKPTRRAKIHCEAAVHSSSVVTLPEQ---QLPDGESPAPSQ----PK  1936
              DLG  SKS IS+K            A+HS SV+  P+Q   Q    + P  +     P+
Sbjct  31    TDLGFSSKSTISVKNKPNSTSSTTRCALHSPSVLHFPKQPYNQPVITKEPKKTHHHQPPQ  90

Query  1935  WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAV  1756
             WN LQRA A ALD AE AL+SRE   PLPKT DP VQI+GNFAPVPEQ V +NLPV G +
Sbjct  91    WNFLQRAAAMALDAAETALISRERLHPLPKTADPRVQISGNFAPVPEQPVHHNLPVTGTI  150

Query  1755  PDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGL  1576
             PDCINGVY+RNGANPLF P AGHH FDGDGMVHAV I  GS SY+CRFTET+RLVQER L
Sbjct  151   PDCINGVYLRNGANPLFEPVAGHHFFDGDGMVHAVKINAGSASYACRFTETQRLVQEREL  210

Query  1575  GRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDD  1396
             GRPVFPKAIGELHGHSG+ARLLLFYARGLFGL+DH +GTG+ANAGLVYFNGRLLAMSEDD
Sbjct  211   GRPVFPKAIGELHGHSGIARLLLFYARGLFGLLDHSQGTGVANAGLVYFNGRLLAMSEDD  270

Query  1395  LPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNV  1216
             +PY VR+  SGDLETVGRYDFNDQLKSTMIAHPKVDP SGE F+LSYDV+ KPYLKYF  
Sbjct  271   IPYQVRITDSGDLETVGRYDFNDQLKSTMIAHPKVDPVSGELFSLSYDVVLKPYLKYFKF  330

Query  1215  KSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSR  1036
               +G+KSPDVEIPLDVPTM+HDFAITEN+V+IPDQQVVFKL+EM+RGGS VIY+ KKKSR
Sbjct  331   SPNGDKSPDVEIPLDVPTMMHDFAITENFVVIPDQQVVFKLEEMVRGGSPVIYDSKKKSR  390

Query  1035  FGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENL  856
             FGIL K ++NA  I+WVESP+TFCFHLWNAWEE ET+E+VVIGSCMTP DSIFNEC+E+L
Sbjct  391   FGILPKNSQNASDILWVESPDTFCFHLWNAWEEPETEEVVVIGSCMTPADSIFNECDESL  450

Query  855   KSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVS  676
             KS+LSEIRLNL+TGEST+RPII    +QVNLEAGMVNRN LGRKT++AYLAIAEPWPKVS
Sbjct  451   KSVLSEIRLNLRTGESTRRPIISEESEQVNLEAGMVNRNRLGRKTRFAYLAIAEPWPKVS  510

Query  675   GFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIV  496
             GFAKVDL TGE++K+ YG+ +YGGEPFF+PR+PNSEKEDDGH+++FVHDE+T KSE+QIV
Sbjct  511   GFAKVDLRTGEVRKYFYGNRRYGGEPFFLPRDPNSEKEDDGHVMAFVHDERTGKSEMQIV  570

Query  495   NAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             NA++LEL A++KLPSRVPYGFHGTF+ S DL +Q 
Sbjct  571   NAVDLELEASVKLPSRVPYGFHGTFVDSKDLVHQA  605



>ref|XP_010247635.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Nelumbo nucifera]
Length=631

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/606 (70%), Positives = 486/606 (80%), Gaps = 42/606 (7%)
 Frame = -2

Query  2091  VDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQ----------------------  1978
             +DLG  SKSIS+K+P+RRA +HC  ++ + S++  P+Q                      
Sbjct  29    MDLGCSSKSISLKRPSRRAHLHC--SLQTPSLLRFPKQSSSSTTPSPAITTSTTTLPKPK  86

Query  1977  -----------QLP-----DGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPK  1846
                         LP     +  SPAP  P+WNLLQRA A ALD  E AL+S E Q PLPK
Sbjct  87    PKPRNKEDSSSSLPANYNTNKASPAPPPPQWNLLQRAAAMALDAVEAALISSERQHPLPK  146

Query  1845  TWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDG  1666
             T DP VQIAGNFAPVPEQ V ++L V G +PDCI GVYVRNGANPLF P AGHH FDGDG
Sbjct  147   TADPTVQIAGNFAPVPEQPVSHSLSVSGRIPDCIQGVYVRNGANPLFEPVAGHHFFDGDG  206

Query  1665  MVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLF  1486
             MVHAV+I  GS SY+CRFTET+R VQER LGRPVFPKAIGELHGHSG+ARLLLFYARGLF
Sbjct  207   MVHAVSIHDGSASYACRFTETQRFVQERALGRPVFPKAIGELHGHSGIARLLLFYARGLF  266

Query  1485  GLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMI  1306
             G+VDH +GTG+ANAGLVYFN RLLAMSEDDLPY VR+ PSGDLETVGRYDF  QL+S MI
Sbjct  267   GIVDHTQGTGVANAGLVYFNRRLLAMSEDDLPYQVRITPSGDLETVGRYDFQGQLRSAMI  326

Query  1305  AHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYV  1126
             AHPK+DP SG+ FALSYDV+QKPYLKYF+    G+KSPDVEIP+  PTM+HDFAIT+ +V
Sbjct  327   AHPKLDPVSGKLFALSYDVVQKPYLKYFSFSPDGQKSPDVEIPVAEPTMMHDFAITDRFV  386

Query  1125  IIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNA  946
             +IPDQQVVFKLQEMI+GGS V+Y+K K SRFGIL K A NA GI WVE+P+ FCFHLWNA
Sbjct  387   VIPDQQVVFKLQEMIQGGSPVVYDKNKISRFGILDKNAVNASGIRWVEAPDCFCFHLWNA  446

Query  945   WEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVN  766
             WEE ETDE+VVIGSCMTPPDSIFNECEE LKS+LSEIRLNL+TG+ST+R II +  QQ+N
Sbjct  447   WEEPETDEVVVIGSCMTPPDSIFNECEEGLKSVLSEIRLNLRTGKSTRRSII-SDSQQLN  505

Query  765   LEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVP  586
             LEAGMVNRN LGRKTQ+ YLAIAEPWP+VSG AKVDL+TGE+ KF+YGD  YGGEPFF+P
Sbjct  506   LEAGMVNRNRLGRKTQFTYLAIAEPWPRVSGIAKVDLTTGEVNKFIYGDRCYGGEPFFLP  565

Query  585   RNP-NSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSY  409
             R+P NSE+EDDG+IL+F+HDEKT KSEL IVNAINL+L A++KLPSRVPYGFHGTFI S 
Sbjct  566   RDPNNSEREDDGYILAFMHDEKTSKSELLIVNAINLQLEASVKLPSRVPYGFHGTFINSK  625

Query  408   DLQNQV  391
             DL+ QV
Sbjct  626   DLEKQV  631



>ref|XP_007022180.1| Nine-cis-epoxycarotenoid dioxygenase 3 [Theobroma cacao]
 gb|EOY13705.1| Nine-cis-epoxycarotenoid dioxygenase 3 [Theobroma cacao]
Length=613

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/584 (72%), Positives = 478/584 (82%), Gaps = 21/584 (4%)
 Frame = -2

Query  2088  DLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQ----------------QLPDGES  1957
             DLG  S SI  K+PT +  I C  ++ + S++  P+Q                + P   S
Sbjct  33    DLGSISSSIPFKRPTIKPNISC--SLQTPSILHFPKQSPTYPPSPTPASSPTTKHPKNTS  90

Query  1956  PA--PSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVR  1783
              A  P   +WN  QRA A ALDV E ALVS E   PLPKT DP VQI+GNFAPVPEQ ++
Sbjct  91    SAEKPQSQQWNPFQRAAAMALDVVENALVSHERNHPLPKTADPRVQISGNFAPVPEQPIK  150

Query  1782  NNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTET  1603
             + LPV G +P+CI GVYVRNGANPL  P AGHH FDGDGMVHAV    GS SY CRFTET
Sbjct  151   HRLPVTGTIPECIQGVYVRNGANPLHEPVAGHHFFDGDGMVHAVQFKNGSASYGCRFTET  210

Query  1602  ERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNG  1423
              RLVQER  GRPVFPKAIGELHGHSG+ARLLLFYARGLFGLVD   GTG+ANAGLVYFNG
Sbjct  211   SRLVQERAFGRPVFPKAIGELHGHSGIARLLLFYARGLFGLVDPSHGTGVANAGLVYFNG  270

Query  1422  RLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQ  1243
              LLAMSEDDLPYHVR+ PSGDL+TVGRYDF+ QLKSTMIAHPKVDP +GEFFALSYDVIQ
Sbjct  271   HLLAMSEDDLPYHVRITPSGDLKTVGRYDFDGQLKSTMIAHPKVDPVTGEFFALSYDVIQ  330

Query  1242  KPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCV  1063
             KPYLKYF+  + G+KSPDVEIP++ PTM+HDFAITEN+V+IPDQQVVFKL EMI GGS V
Sbjct  331   KPYLKYFHFSADGKKSPDVEIPVESPTMMHDFAITENFVVIPDQQVVFKLPEMIHGGSPV  390

Query  1062  IYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDS  883
             +Y+K K SRFGIL K A +  GI WVE+P+ FCFHLWNAWEE +TDE+VVIGSCMTPPDS
Sbjct  391   VYDKNKMSRFGILDKNATDDSGISWVEAPDCFCFHLWNAWEEPQTDEVVVIGSCMTPPDS  450

Query  882   IFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLA  703
             IFNEC+E+LKS+LSEIRLNLKTG+ST+RPII +  +QVNLEAGMVNRNLLGRKT++AYLA
Sbjct  451   IFNECDESLKSVLSEIRLNLKTGKSTRRPII-SESEQVNLEAGMVNRNLLGRKTRFAYLA  509

Query  702   IAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEK  523
             +AEPWPKVSGFAKVDLSTGE++K++YGD +YGGEP F PRNPNSE EDDG+IL+FVHDEK
Sbjct  510   LAEPWPKVSGFAKVDLSTGEVKKYIYGDQRYGGEPLFFPRNPNSENEDDGYILAFVHDEK  569

Query  522   TWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             TW+SELQIVNA+NL+L AT+KLPSRVPYGFHGTFI+S DL+ Q 
Sbjct  570   TWQSELQIVNAMNLQLEATVKLPSRVPYGFHGTFISSKDLEKQA  613



>gb|AAR11193.1| 9-cis-epoxycarotenoid dioxygenase 1 [Vitis vinifera]
Length=610

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/583 (71%), Positives = 480/583 (82%), Gaps = 23/583 (4%)
 Frame = -2

Query  2094  TVDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQ------------LP---DGE  1960
              +DLG    S S  +PT R  I+C  ++HS SV+  P+              LP   D  
Sbjct  36    ALDLG----SFSFHRPTIRPNINC--SLHSPSVLHFPKHTSSSTGVATVKTTLPKEKDDF  89

Query  1959  SPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRN  1780
             S + SQ +WN LQ A A ALD  E ALV+RE Q PLPKT DP VQIAGNFAPVPEQ V++
Sbjct  90    SSSVSQ-QWNFLQSAAAMALDAVETALVARETQHPLPKTADPRVQIAGNFAPVPEQPVQH  148

Query  1779  NLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETE  1600
             +LPVDG +PDCI GVY RNGANPL +P AGHHLFDGDGMVHAV    G  SY+CRFTET+
Sbjct  149   SLPVDGRIPDCIQGVYTRNGANPLHKPVAGHHLFDGDGMVHAVQFKDGDASYACRFTETQ  208

Query  1599  RLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGR  1420
             RL+QER  GRPVFPKAIGELHGHSG+ARLLLFYARGLFGLVDH  GTG+ANAGLVYFN R
Sbjct  209   RLIQERDFGRPVFPKAIGELHGHSGIARLLLFYARGLFGLVDHSHGTGVANAGLVYFNRR  268

Query  1419  LLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQK  1240
             LLAMSEDDLPY +RV PSGDLETVGRYDF  QL+STMIAHPKVDP SGE FALSYDV+QK
Sbjct  269   LLAMSEDDLPYQIRVTPSGDLETVGRYDFEGQLRSTMIAHPKVDPVSGEMFALSYDVVQK  328

Query  1239  PYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVI  1060
             PYLKYF     G+KSPDVEIPL  PTM+HDFAITE +V++P+QQVVFKLQEMI GGS V+
Sbjct  329   PYLKYFRFSPKGDKSPDVEIPLAEPTMMHDFAITERFVVVPNQQVVFKLQEMISGGSPVV  388

Query  1059  YEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSI  880
             Y+K K SRFG+L K A +A G++W+E+P+ FCFHLWNAWEE ETDE+VVIGSCMTPPDSI
Sbjct  389   YDKNKMSRFGVLDKNATDASGMLWIEAPDCFCFHLWNAWEEPETDEVVVIGSCMTPPDSI  448

Query  879   FNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAI  700
             FNEC+E LKS+LSEIRLNLKTG+ST+RPI+P + +QVNLEAGMVNRN LGRKTQ+AYLA+
Sbjct  449   FNECDEGLKSVLSEIRLNLKTGKSTRRPILPES-EQVNLEAGMVNRNRLGRKTQFAYLAV  507

Query  699   AEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKT  520
             AEPWPKVSGFAKVDLSTG++ K++YG+ +YGGEP F+PR+PNS +EDDG+IL+FVHDEKT
Sbjct  508   AEPWPKVSGFAKVDLSTGQVSKYIYGEQRYGGEPLFLPRDPNSGREDDGYILAFVHDEKT  567

Query  519   WKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             WKSELQIVNA NL+L A++KLPSRVPYGFHGTFI+S +L+ Q 
Sbjct  568   WKSELQIVNATNLQLEASVKLPSRVPYGFHGTFISSKELEKQA  610



>emb|CAN81383.1| hypothetical protein VITISV_018449 [Vitis vinifera]
Length=610

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/583 (71%), Positives = 479/583 (82%), Gaps = 23/583 (4%)
 Frame = -2

Query  2094  TVDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQ------------LP---DGE  1960
              +DLG    S S  +PT R  I+C  ++HS SV+  P+              LP   D  
Sbjct  36    ALDLG----SFSFHRPTIRPNINC--SLHSPSVLHFPKHTSSSTGVATVKTTLPKEKDDF  89

Query  1959  SPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRN  1780
             S + SQ +WN LQ A A ALD  E ALV+RE Q PLPKT DP VQIAGNFAPVPEQ V++
Sbjct  90    SSSVSQ-QWNFLQSAAAMALDAVETALVARETQHPLPKTADPRVQIAGNFAPVPEQPVQH  148

Query  1779  NLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETE  1600
             +LPVDG +PDCI GVY RNGANPL +P AGHHLFDGDGMVHAV    G  SY+CRFTET+
Sbjct  149   SLPVDGRIPDCIQGVYTRNGANPLHKPVAGHHLFDGDGMVHAVQFKDGDASYACRFTETQ  208

Query  1599  RLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGR  1420
             RL+QER  GRPVFPKAIGELHGHSG+ARLLLFYARGLFGLVDH  GTG+ANAGLVYFN R
Sbjct  209   RLIQERDFGRPVFPKAIGELHGHSGIARLLLFYARGLFGLVDHSHGTGVANAGLVYFNRR  268

Query  1419  LLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQK  1240
             LLAMSEDDLPY +RV PSGDLETVGRYDF  QL+STMIAHPKVDP SGE FALSYDV+QK
Sbjct  269   LLAMSEDDLPYQIRVTPSGDLETVGRYDFEGQLRSTMIAHPKVDPVSGEMFALSYDVVQK  328

Query  1239  PYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVI  1060
             PYLKYF     G+KSPDVEIPL  PTM+HDFAITE +V++P+QQVVFKLQEMI GGS V+
Sbjct  329   PYLKYFRFSPKGDKSPDVEIPLAEPTMMHDFAITERFVVVPNQQVVFKLQEMISGGSPVV  388

Query  1059  YEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSI  880
             Y+K K SRFG+L K A +A G+ W+E+P+ FCFHLWNAWEE ETDE+VVIGSCMTPPDSI
Sbjct  389   YDKNKMSRFGVLDKNATDASGMXWIEAPDCFCFHLWNAWEEPETDEVVVIGSCMTPPDSI  448

Query  879   FNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAI  700
             FNEC+E LKS+LSEIRLNLKTG+ST+RPI+P + +QVNLEAGMVNRN LGRKTQ+AYLA+
Sbjct  449   FNECDEGLKSVLSEIRLNLKTGKSTRRPILPES-EQVNLEAGMVNRNRLGRKTQFAYLAV  507

Query  699   AEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKT  520
             AEPWPKVSGFAKVDLSTG++ K++YG+ +YGGEP F+PR+PNS +EDDG+IL+FVHDEKT
Sbjct  508   AEPWPKVSGFAKVDLSTGQVSKYIYGEQRYGGEPLFLPRDPNSGREDDGYILAFVHDEKT  567

Query  519   WKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             WKSELQIVNA NL+L A++KLPSRVPYGFHGTFI+S +L+ Q 
Sbjct  568   WKSELQIVNATNLQLEASVKLPSRVPYGFHGTFISSKELEKQA  610



>ref|NP_001268199.1| 9-cis-epoxycarotenoid dioxygenase 1 [Vitis vinifera]
 gb|AFP28804.1| 9-cis epoxy carotenoid dioxygenase 3 [Vitis vinifera]
Length=610

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/583 (71%), Positives = 478/583 (82%), Gaps = 23/583 (4%)
 Frame = -2

Query  2094  TVDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQ------------LP---DGE  1960
              +DLG    S S  +PT R  I+C  ++HS SV+  P+              LP   D  
Sbjct  36    ALDLG----SFSFHRPTIRPNINC--SLHSPSVLHFPKHTSSSTGVATVKTTLPKEKDDF  89

Query  1959  SPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRN  1780
             S + SQ +WN LQ A A ALD  E ALV+RE Q PLPKT DP VQIAGNFAPVPEQ V++
Sbjct  90    SSSVSQ-QWNFLQSAAAMALDAVETALVARETQHPLPKTADPRVQIAGNFAPVPEQPVQH  148

Query  1779  NLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETE  1600
             +LPVDG +PDCI GVY RNGANPL +P AGHHLFDGDGMVHAV    G  SY+CRFTET+
Sbjct  149   SLPVDGRIPDCIQGVYTRNGANPLHKPVAGHHLFDGDGMVHAVQFKDGDASYACRFTETQ  208

Query  1599  RLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGR  1420
             RL+QER  GRPVFPKAIGELHGHSG+ARLLLFYARGLFGLVDH  GTG+ANAGLVYFN R
Sbjct  209   RLIQERDFGRPVFPKAIGELHGHSGIARLLLFYARGLFGLVDHSHGTGVANAGLVYFNRR  268

Query  1419  LLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQK  1240
             LLAMSEDDLPY +RV PSGDLETVGRYDF  QL+STMIAHPKVDP SGE FALSYDV+QK
Sbjct  269   LLAMSEDDLPYQIRVTPSGDLETVGRYDFEGQLRSTMIAHPKVDPVSGEMFALSYDVVQK  328

Query  1239  PYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVI  1060
             PYLKYF     G+KSPDVEIPL  PTM+HDFAITE +V++PDQQVVFKLQEMI  GS V+
Sbjct  329   PYLKYFRFSPKGDKSPDVEIPLAEPTMMHDFAITERFVVVPDQQVVFKLQEMISRGSPVV  388

Query  1059  YEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSI  880
             Y+K K SRFG+L K A +A G+ W+E+P+ FCFHLWNAWEE ETDE+VVIGSCMTPPDSI
Sbjct  389   YDKNKMSRFGVLDKNATDASGMRWIEAPDCFCFHLWNAWEEPETDEVVVIGSCMTPPDSI  448

Query  879   FNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAI  700
             FNEC+E LKS+LSEIRLNLKTG+ST+RPI+P + +QVNLEAGMVNRN LGRKTQ+AYLA+
Sbjct  449   FNECDEGLKSVLSEIRLNLKTGKSTRRPILPES-EQVNLEAGMVNRNRLGRKTQFAYLAV  507

Query  699   AEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKT  520
             AEPWPKVSGFAKVDLSTG++ K++YG+ +YGGEP F+PR+PNS +EDDG+IL+FVHDEKT
Sbjct  508   AEPWPKVSGFAKVDLSTGQVSKYIYGEQRYGGEPLFLPRDPNSGREDDGYILAFVHDEKT  567

Query  519   WKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             WKSELQIVNA NL+L A++KLPSRVPYGFHGTFI+S +L+ Q 
Sbjct  568   WKSELQIVNATNLQLEASVKLPSRVPYGFHGTFISSKELEKQA  610



>gb|EYU33373.1| hypothetical protein MIMGU_mgv1a003582mg [Erythranthe guttata]
Length=576

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/564 (73%), Positives = 473/564 (84%), Gaps = 14/564 (2%)
 Frame = -2

Query  2055  KKPTRRAKIHCEAAVHSSSVVTLPEQQ-----LPDGESPAPSQPKWNllqravaaaldva  1891
             +KP+RRAKI C     S SV+T P+       LP  ++  P+ P+WN LQRA A  LD  
Sbjct  18    RKPSRRAKIRC-----SPSVLTFPKHNFQTPTLPKHDTCPPAAPQWNFLQRAAAKTLDFF  72

Query  1890  egalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANP  1711
             E ALVSREL   LPKT DP +QIAGNFAPVPEQ V +NL V G +PDC+NGVYVRNGANP
Sbjct  73    ESALVSRELHHTLPKTADPRIQIAGNFAPVPEQPVCHNLHVTGTIPDCLNGVYVRNGANP  132

Query  1710  LFRPKAGHHLFDGDGMVHAVTITG-GSVSYSCRFTETERLVQERGLGRPVFPKAIGELHG  1534
             L  P AGHHLFDGDGM+HAVT +G  S SY+CRFTET+RL+QER LGRPVFPKAIGELHG
Sbjct  133   LHEPVAGHHLFDGDGMIHAVTFSGDNSASYACRFTETQRLIQERDLGRPVFPKAIGELHG  192

Query  1533  HSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLE  1354
             HSG+ARLLLFY RGL GLVDH +GTG+ANAGLVYFN RLLAMSEDDLPY VR+ PSGDLE
Sbjct  193   HSGIARLLLFYTRGLCGLVDHSKGTGVANAGLVYFNQRLLAMSEDDLPYQVRLTPSGDLE  252

Query  1353  TVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPL  1174
             TVGRYDF +QL STMIAHPK+DP S E FALSYDV+QKPYLKYF     G+KSPDVEIPL
Sbjct  253   TVGRYDFEEQLSSTMIAHPKIDPVSKELFALSYDVVQKPYLKYFKFSGDGKKSPDVEIPL  312

Query  1173  DVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGI  994
             D PTM+HDFAITEN+V+IPDQQVVFKLQEM++GGS ++Y+K KKSRFGIL K A+NAE I
Sbjct  313   DSPTMMHDFAITENFVVIPDQQVVFKLQEMVKGGSPMVYDKNKKSRFGILSKNAENAEDI  372

Query  993   IWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTG  814
             IWV+ P+TFCFHLWNAWEE ETDE+VVIGSCMTPPDSIFNE  ENLKS+LSEIRLNLKTG
Sbjct  373   IWVDCPDTFCFHLWNAWEEPETDEVVVIGSCMTPPDSIFNESNENLKSVLSEIRLNLKTG  432

Query  813   ESTKRPII-PATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQ  637
              S KR II  ++++++NLEAGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDLSTGE++
Sbjct  433   RSKKRSIIQSSSEEEINLEAGMVNRNRLGRKTRYAYLAIAEPWPKVSGFAKVDLSTGEVE  492

Query  636   KFMYGDGKYGGEPFFVPRNPNS--EKEDDGHILSFVHDEKTWKSELQIVNAINLELLATI  463
             +F+YGD +YGGEPFFVP +  S  E ED G+ILS+VHDE TWKSEL +VNA +L+L A++
Sbjct  493   EFIYGDRRYGGEPFFVPSDSTSDGEGEDAGYILSYVHDENTWKSELLVVNATSLKLEASV  552

Query  462   KLPSRVPYGFHGTFITSYDLQNQV  391
             +LPSRVPYGFHGTFI++ DL+NQ 
Sbjct  553   ELPSRVPYGFHGTFISATDLENQA  576



>dbj|BAE72090.1| Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 1
Length=585

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/564 (73%), Positives = 478/564 (85%), Gaps = 13/564 (2%)
 Frame = -2

Query  2067  SISMKKPTRRAKIHCEAAVHSSSVVTLP-----EQQLPDGESPAPSQPKWNllqravaaa  1903
             +I   KP+R+A I+C AA+ SS ++  P     EQQ    ES  P Q  WNLLQRA A A
Sbjct  28    AIKPTKPSRKASINC-AALQSSPLLHFPHTINREQQ----ESHHPLQ--WNLLQRAAATA  80

Query  1902  ldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRN  1723
             LD+ EGALVSRE + P PKT DP VQI+GNFAPVPEQAV++NLPV G++PDCINGVYVRN
Sbjct  81    LDMFEGALVSRETENPFPKTSDPRVQISGNFAPVPEQAVKHNLPVSGSIPDCINGVYVRN  140

Query  1722  GANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGE  1543
             GANPLF P AGHHLFDGDGMVHAV I G SVSYSC+ TET RL+QER +GRPVFPKAIGE
Sbjct  141   GANPLFEPVAGHHLFDGDGMVHAVNIDGNSVSYSCKLTETNRLIQEREMGRPVFPKAIGE  200

Query  1542  LHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSG  1363
             LHGHSG+ARL LFYAR L GLVDH +G G+ANAGLVYFN RLLAMSEDDLPY +R+ PS 
Sbjct  201   LHGHSGVARLALFYARSLLGLVDHSKGMGVANAGLVYFNNRLLAMSEDDLPYQIRITPSS  260

Query  1362  DLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVE  1183
             D+ETVGRYDF+++  STMIAHPK+DP +GE FALSYDV++KPYLKYF     G KSPDVE
Sbjct  261   DIETVGRYDFSEKHMSTMIAHPKLDPVTGEMFALSYDVVKKPYLKYFKFSKDGGKSPDVE  320

Query  1182  IPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNA  1003
             IPLDVPTM+HDFAITEN+V++PDQQVVFKLQEMI+GGS VIY+K KKSRFGIL K A+ +
Sbjct  321   IPLDVPTMMHDFAITENFVVVPDQQVVFKLQEMIKGGSPVIYDKDKKSRFGILPKNAETS  380

Query  1002  EGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNL  823
             + +IWVESPETFCFHLWNAWEE E++E+VVIGSCMTPPDSIFNEC+ENLKS+LSEIR+NL
Sbjct  381   DDMIWVESPETFCFHLWNAWEEPESNEVVVIGSCMTPPDSIFNECDENLKSVLSEIRINL  440

Query  822   KTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGE  643
             KT  STKR I+  + +QVNLEAGMVNR+ LGRKTQ+AYLAIAEPWPKVSGFAKVDL+TGE
Sbjct  441   KTRRSTKRSILQES-EQVNLEAGMVNRDKLGRKTQFAYLAIAEPWPKVSGFAKVDLTTGE  499

Query  642   MQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATI  463
             ++KF YGD +YGGEPFF+P   NS++EDDG+ILSFVHDE TWKSELQI+NA+ + + A++
Sbjct  500   IKKFFYGDERYGGEPFFLPSGRNSQREDDGYILSFVHDENTWKSELQIINAMTMLMEASV  559

Query  462   KLPSRVPYGFHGTFITSYDLQNQV  391
             KLPSRVPYGFHGTFI+S DL  Q 
Sbjct  560   KLPSRVPYGFHGTFISSKDLAEQA  583



>ref|XP_009360900.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Pyrus x bretschneideri]
Length=603

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/577 (73%), Positives = 475/577 (82%), Gaps = 15/577 (3%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRR---AKIHCEAAVHSSSVVTLPEQ--------QLPDGESPAPSQ-  1942
             L  P +SIS+     R   + IHC  A+ S SV+  P+Q        +      P   Q 
Sbjct  30    LCFPKRSISLTNSKNRRNSSIIHC--ALQSPSVLHFPKQPYNTPVITKEATRAKPKTHQI  87

Query  1941  PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDG  1762
             P+WNLLQ+A A A+DV EGALVSRE Q PLPKT DP VQIAGN+APVPEQAVR++LPV G
Sbjct  88    PQWNLLQKAAAMAIDVVEGALVSRERQNPLPKTSDPRVQIAGNYAPVPEQAVRHSLPVTG  147

Query  1761  AVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQER  1582
              +PDCINGVY+RNGANPL  P AGHHLFDGDGMVHA++I  GS SY+CRFTET+RL QER
Sbjct  148   TIPDCINGVYLRNGANPLHEPVAGHHLFDGDGMVHAISIDSGSASYACRFTETQRLPQER  207

Query  1581  GLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSE  1402
              +GRPVFPKAIGELHGHSG+ARLLLF+ARG  GL+D  +GTG+ANAGLVY NGRLLAMSE
Sbjct  208   EMGRPVFPKAIGELHGHSGIARLLLFFARGALGLLDKNQGTGVANAGLVYHNGRLLAMSE  267

Query  1401  DDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYF  1222
             DDLPY VRV  SGDLETVGRYDFN QL STMIAHPKVDPESG   ALSYDV+QKPYLKYF
Sbjct  268   DDLPYQVRVTKSGDLETVGRYDFNSQLGSTMIAHPKVDPESGSLHALSYDVVQKPYLKYF  327

Query  1221  NVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKK  1042
             +   +G KSPDVEIPL  PTM+HDFAITENYV+IPDQQVVFKL EMI GGS VIY+K K 
Sbjct  328   HFSPNGAKSPDVEIPLAGPTMMHDFAITENYVVIPDQQVVFKLGEMITGGSPVIYDKTKM  387

Query  1041  SRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEE  862
             SRFGILKK A+NA+ IIWV+SP+TFCFHLWNAWEE E+DE+VVIGSCMTPPDSIFNEC+E
Sbjct  388   SRFGILKKNAENADDIIWVDSPDTFCFHLWNAWEEPESDEVVVIGSCMTPPDSIFNECDE  447

Query  861   NLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPK  682
             NLKS+LSEIRLNLKTGEST+R I+  +D  VNLEAGMVNRN LGRKT++AYLAIAEPWPK
Sbjct  448   NLKSVLSEIRLNLKTGESTRRAILSESD-DVNLEAGMVNRNRLGRKTRFAYLAIAEPWPK  506

Query  681   VSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQ  502
             VSGFAKVDL TGE++KF YG+ KYGGEPFFVP       ED+G+IL+FVHDEK WKSELQ
Sbjct  507   VSGFAKVDLFTGEVKKFFYGEKKYGGEPFFVPSTAEGASEDEGYILTFVHDEKKWKSELQ  566

Query  501   IVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             IVNA+N++L AT+KLPSRVPYGFHGTFI S DL NQ 
Sbjct  567   IVNAVNMKLEATVKLPSRVPYGFHGTFIESKDLVNQA  603



>ref|NP_001234455.1| nine-cis-epoxycarotenoid dioxygenase [Solanum lycopersicum]
 emb|CAB10168.1| nine-cis-epoxycarotenoid dioxygenase [Solanum lycopersicum]
 emb|CAD30202.1| 9-cis-epoxycarotenoid dioxygenase [Solanum lycopersicum]
Length=605

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/582 (70%), Positives = 474/582 (81%), Gaps = 16/582 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEEAETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTFI + DL NQ 
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTFINANDLANQA  605



>ref|XP_011082846.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic 
[Sesamum indicum]
Length=606

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/538 (74%), Positives = 460/538 (86%), Gaps = 1/538 (0%)
 Frame = -2

Query  2004  SSVVTLPEQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQ  1825
             + +V  P+  +  G++ +PS+PKWN++Q+A A ALD  E AL   EL+ PLPKT DP VQ
Sbjct  70    TKIVVNPQPTVRKGDAASPSKPKWNMIQKAAAMALDAVENALTDHELRHPLPKTADPEVQ  129

Query  1824  IAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTI  1645
             IAGNF+PVPEQ VR+ LPV G +P+ I GVYVRNGANPLF P+AGHH FDGDGM+HAV  
Sbjct  130   IAGNFSPVPEQPVRHRLPVVGKIPESIQGVYVRNGANPLFEPQAGHHFFDGDGMIHAVKF  189

Query  1644  TGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRR  1465
               GS SY+CRFTET+RLVQER LGRP+FPKAIGELHGHSG+ARLLLFYARGLF LVDH +
Sbjct  190   ENGSASYACRFTETQRLVQERALGRPIFPKAIGELHGHSGIARLLLFYARGLFNLVDHGQ  249

Query  1464  GTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDP  1285
             GTG+ANAGLVYFN RLLAMSEDDLPYHVR+ P+GDL+TV RY+FN QL STMIAHPKVDP
Sbjct  250   GTGVANAGLVYFNNRLLAMSEDDLPYHVRLTPNGDLKTVERYNFNGQLNSTMIAHPKVDP  309

Query  1284  ESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQV  1105
              SGE FALSYDVI+KPYLKYF    +GEKS DVEIP+  PTM+HDFAITE +VI+PDQQV
Sbjct  310   VSGELFALSYDVIRKPYLKYFRFSRNGEKSEDVEIPVSEPTMMHDFAITEKFVIVPDQQV  369

Query  1104  VFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETD  925
             VFK+ EMIRGGS V+YEK K SRFG+L K AK++ GI WV+ P+ FCFHLWNAWEE ETD
Sbjct  370   VFKMSEMIRGGSPVVYEKDKVSRFGVLDKYAKDSSGIKWVQVPDCFCFHLWNAWEEPETD  429

Query  924   EIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVN  745
             EIVVIGSCMTPPDSIFNEC+E LKS+LSEIRLNLKTG+ST+RPI+   D QVNLEAGMVN
Sbjct  430   EIVVIGSCMTPPDSIFNECDEGLKSVLSEIRLNLKTGKSTRRPIMSEED-QVNLEAGMVN  488

Query  744   RNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEK  565
             RN LGRKT+YAYLAIAEPWPKVSGFAKVDL TGE++KF+YGD KYGGEP F+PR+PNSE 
Sbjct  489   RNRLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRDPNSEA  548

Query  564   EDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             EDDG+IL+FVHDEK WKSELQIVNA  ++L A++KLPSRVPYGFHGTFI++ DL NQ 
Sbjct  549   EDDGYILAFVHDEKAWKSELQIVNAKTMKLEASVKLPSRVPYGFHGTFISAKDLANQA  606



>gb|AGQ03804.1| 9-cis-epoxycarotenoid dioxygenase [Malus domestica x Malus honanensis]
Length=606

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/580 (73%), Positives = 478/580 (82%), Gaps = 21/580 (4%)
 Frame = -2

Query  2085  LGLPSKSISMKKP-TRR--AKIHCEAAVHSSSVVTLPEQQLPDGESP------APSQPK-  1936
             +G   +SIS+K   TRR  + IHC  A+   SV+  P+   P   +P       P++PK 
Sbjct  33    MGFSKRSISLKSSKTRRNSSIIHC--ALRFPSVLHFPK---PPYNTPVITKEATPAKPKT  87

Query  1935  -----WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLP  1771
                  WNLLQ+A A A+DV EGALVSRE Q PLPKT DP VQIAGN+APVPEQAVR++LP
Sbjct  88    RQLPQWNLLQKAAAMAIDVVEGALVSRERQNPLPKTSDPRVQIAGNYAPVPEQAVRHSLP  147

Query  1770  VDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLV  1591
             V G +PDCINGVYVRNGANPL  P AGHHLFDGDGMVHAV+I  GS SY+CRFTET+RLV
Sbjct  148   VTGTIPDCINGVYVRNGANPLHEPVAGHHLFDGDGMVHAVSIDSGSASYACRFTETQRLV  207

Query  1590  QERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLA  1411
             QER +GRPVFPKAIGELHGHSG+ARLLLF+ARG  GL+D  +GTG+ANAGLVY NGRLLA
Sbjct  208   QEREMGRPVFPKAIGELHGHSGIARLLLFFARGALGLLDKNQGTGVANAGLVYHNGRLLA  267

Query  1410  MSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYL  1231
             MSEDDLPY VRV  SGDLETVGRYDF+ QL STMIAHPKVDPESG   +LSYDV+QKPYL
Sbjct  268   MSEDDLPYQVRVTKSGDLETVGRYDFDSQLGSTMIAHPKVDPESGSLHSLSYDVVQKPYL  327

Query  1230  KYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEK  1051
             KYF+   +G KSPDVEIPL  PTMIHDFAITENYV+IPDQQVVFKL EMI GGS VIY+K
Sbjct  328   KYFHFSPNGAKSPDVEIPLAGPTMIHDFAITENYVVIPDQQVVFKLGEMITGGSPVIYDK  387

Query  1050  KKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNE  871
              K SRFGILKK A+NA+ IIWV+SP+TFCFHLWNAWEE E+DE+VVIGSCMTPPDSIFNE
Sbjct  388   TKMSRFGILKKNAENADDIIWVDSPDTFCFHLWNAWEEPESDEVVVIGSCMTPPDSIFNE  447

Query  870   CEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEP  691
             C+ENLKS+LSEIRLNLKTGEST+R I+  +D  VNLEAGMVNRN LGRKT++AYLAIAEP
Sbjct  448   CDENLKSVLSEIRLNLKTGESTRRAILSESD-DVNLEAGMVNRNRLGRKTRFAYLAIAEP  506

Query  690   WPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKS  511
             WPKVSGFAKVDL TGE++KF YG+ KYGGEPFFVP       ED+G+IL+FVHDEK WKS
Sbjct  507   WPKVSGFAKVDLFTGEVKKFFYGEKKYGGEPFFVPGTAEGASEDEGYILTFVHDEKKWKS  566

Query  510   ELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             ELQIVNA N+ L AT+KLPSRVPYGFHGTFI S DL NQ 
Sbjct  567   ELQIVNAANMRLEATVKLPSRVPYGFHGTFIESKDLVNQA  606



>gb|ADG03462.1| 9-cis-epoxycarotenoid dioxygenase [Gossypium hirsutum]
Length=608

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/576 (72%), Positives = 478/576 (83%), Gaps = 16/576 (3%)
 Frame = -2

Query  2073  SKSISMKKPTRRAKIHC-EAAVHSSSVVTLPEQQLPDGESPAPS-------------QPK  1936
             S S + ++P R   I    +A+HS SV+  P+Q   +   P                 P+
Sbjct  34    SISWNSRQPNRTHNISIIHSALHSPSVLHFPKQPFQNPLIPIEDDSVNVQVQPKTHRHPQ  93

Query  1935  WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAV  1756
             WNLLQRA A ALD AE ALVS ELQ PLPKT DP VQI+GNFAPVPEQ V+  LPV G +
Sbjct  94    WNLLQRAAAMALDKAESALVSLELQHPLPKTADPHVQISGNFAPVPEQPVKQALPVTGTI  153

Query  1755  PDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGL  1576
             P CINGVY+RNGANPLF P AGHH FDGDGMVHAVTI  G+ SY+CRFTET+R +QE+ L
Sbjct  154   PSCINGVYLRNGANPLFEPVAGHHFFDGDGMVHAVTIDNGNASYACRFTETQRFLQEKEL  213

Query  1575  GRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDD  1396
             GRPVFPKAIGELHGHSG+ARLLLFYARGLFGLVDH++GTG+ANAGLVYFN RLLAMSEDD
Sbjct  214   GRPVFPKAIGELHGHSGIARLLLFYARGLFGLVDHKQGTGVANAGLVYFNNRLLAMSEDD  273

Query  1395  LPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNV  1216
             LPYH+R+ PSGDLETVGRY+F+DQLKSTMIAHPK+DP S E FALSYDVIQKPYLKYF  
Sbjct  274   LPYHLRITPSGDLETVGRYNFDDQLKSTMIAHPKIDPFSKELFALSYDVIQKPYLKYFKF  333

Query  1215  KSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSR  1036
             +  G KSPDVEIPL +PTM+HDFAITEN+V+IP+QQV+FKLQEMI GGS VIY+K KKS 
Sbjct  334   QPDGTKSPDVEIPLSMPTMMHDFAITENFVVIPNQQVLFKLQEMIFGGSPVIYDKNKKSS  393

Query  1035  FGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENL  856
             FGIL K A +++ IIWVESP+TFCFHLWNAWEE E+DE+VVIGSCMTPPDSIFNEC+E+L
Sbjct  394   FGILSKNASDSKDIIWVESPDTFCFHLWNAWEEPESDEVVVIGSCMTPPDSIFNECDESL  453

Query  855   KSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVS  676
              S+LSEIRLNLKTG+ST+RPII +  +QVNLEAGMVNRN LGR+T+YAYLAIAEPWPKVS
Sbjct  454   TSVLSEIRLNLKTGKSTRRPII-SESEQVNLEAGMVNRNRLGRRTRYAYLAIAEPWPKVS  512

Query  675   GFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEK-EDDGHILSFVHDEKTWKSELQI  499
             GFAK+DL TGE++K +YGD K+GGEPFF+PR+ N E  EDDG+I+SFVHDE +WKSELQ+
Sbjct  513   GFAKIDLFTGEVKKHIYGDKKFGGEPFFLPRDDNCESAEDDGYIISFVHDENSWKSELQV  572

Query  498   VNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             V+AINL+L ++IKLPSRVPYGFHGTFI +  L NQ 
Sbjct  573   VDAINLQLESSIKLPSRVPYGFHGTFIDAKSLINQA  608



>ref|XP_009797946.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Nicotiana sylvestris]
Length=609

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/537 (74%), Positives = 457/537 (85%), Gaps = 3/537 (1%)
 Frame = -2

Query  2001  SVVTLPEQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQI  1822
             + ++ P+Q+     S + + P+WNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI
Sbjct  76    TTISYPKQE---NNSSSTTHPQWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQI  132

Query  1821  AGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTIT  1642
             +GNFAPVPE  V ++LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV   
Sbjct  133   SGNFAPVPENPVSHSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFK  192

Query  1641  GGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRG  1462
              GS SY+CRFTETERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +G
Sbjct  193   NGSASYACRFTETERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKG  252

Query  1461  TGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPE  1282
             TG+ANAGLVYFN RLLAMSEDDLPYHVRV P+GDL+TVGR+DF+ QLKSTMIAHPK+DP 
Sbjct  253   TGVANAGLVYFNNRLLAMSEDDLPYHVRVTPTGDLKTVGRFDFDGQLKSTMIAHPKLDPV  312

Query  1281  SGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVV  1102
             SGE FALSYDVIQKPYLKYF    +GEKS DVEIP++ PTM+HDFAIT+ YVIIPDQQVV
Sbjct  313   SGELFALSYDVIQKPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITDKYVIIPDQQVV  372

Query  1101  FKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDE  922
             FK+ EMIRGGS V+Y+K K SRFG+L K AK+ EG+ WVE P+ FCFHLWNAWEE ETDE
Sbjct  373   FKMSEMIRGGSPVVYDKNKVSRFGVLDKYAKDGEGLKWVEVPDCFCFHLWNAWEEPETDE  432

Query  921   IVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNR  742
             IVVIGSCMTPPDSIFNEC+E LKS+LSEIRLNLKTG+ST+R II   + QVNLEAGMVNR
Sbjct  433   IVVIGSCMTPPDSIFNECDEGLKSVLSEIRLNLKTGKSTRRAIIQKEEDQVNLEAGMVNR  492

Query  741   NLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKE  562
             N LGRKT++AYLAIAEPWPKVSGFAKVDL TGE++KF+YGD K+GGEP F+PR+PNS+ E
Sbjct  493   NKLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGEVEKFIYGDNKFGGEPLFLPRDPNSKAE  552

Query  561   DDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             DDG+IL+F H+EK WKSELQIVNA+ ++L AT+KLP+RVPYGFHGTFI + DL NQ 
Sbjct  553   DDGYILAFAHNEKEWKSELQIVNAMTMKLEATVKLPTRVPYGFHGTFINAKDLANQA  609



>ref|NP_001275103.1| 9-cis-epoxy-carotenoid dioxygenase 1 [Solanum tuberosum]
 gb|AAT75151.1| 9-cis-epoxy-carotenoid dioxygenase 1 [Solanum tuberosum]
Length=603

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/580 (70%), Positives = 470/580 (81%), Gaps = 14/580 (2%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGES---------PA  1951
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   +          +
Sbjct  24    EFGFASNSISLLKNQHNRKSLNINSSLQAPPILHFPKQSSNYQTPKTSTISHPIQENNNS  83

Query  1950  PSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLP  1771
              S  KWNL+Q+A A ALD  EGAL   EL+ PLPKT DP VQI+GNFAPVPE  V  +LP
Sbjct  84    SSISKWNLVQKAAAMALDAVEGALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQSLP  143

Query  1770  VDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLV  1591
             V G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETERLV
Sbjct  144   VTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETERLV  203

Query  1590  QERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLA  1411
             QE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGL+DH RGTG+ANAGLVYFN RLLA
Sbjct  204   QEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLIDHSRGTGVANAGLVYFNNRLLA  263

Query  1410  MSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYL  1231
             MSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKPYL
Sbjct  264   MSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKPYL  323

Query  1230  KYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEK  1051
             KYF    +GEKS DVEIP++ PTM+HDFAITE +VIIPDQQVVFK+ EMIRGGS V+Y+K
Sbjct  324   KYFRFSKNGEKSNDVEIPVEDPTMMHDFAITEKFVIIPDQQVVFKMSEMIRGGSPVVYDK  383

Query  1050  KKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNE  871
              K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIFNE
Sbjct  384   NKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIFNE  443

Query  870   CEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEP  691
             C+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKTQYAYLAIAEP
Sbjct  444   CDEGLKSVLSEIRLNLKTGKSTRKAIIENPDEQVNLEAGMVNRNKLGRKTQYAYLAIAEP  503

Query  690   WPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKS  511
             WPKVSGFAKVDL TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W S
Sbjct  504   WPKVSGFAKVDLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEWNS  563

Query  510   ELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             ELQIVNA+ L+L AT+KLPSRVPYGFHGTFI + DL NQ 
Sbjct  564   ELQIVNAMTLKLEATVKLPSRVPYGFHGTFINANDLANQA  603



>ref|XP_009615476.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=613

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/592 (69%), Positives = 473/592 (80%), Gaps = 27/592 (5%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPA-------------  1951
             DL   S SIS+ KK   R      +++ +  ++  P+Q  P+ ++P              
Sbjct  23    DLAYSSNSISLVKKQPNRQLPSINSSLQAPPILHFPKQS-PNYQTPKTTTIPTSKPTTIS  81

Query  1950  -PSQ-----------PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFA  1807
              P Q           P+WNL+Q+A A ALD  E  L   EL+ PLPKT DP VQI+GNFA
Sbjct  82    YPKQESTNSSSSTTSPQWNLVQKAAAMALDAVESVLTKHELEHPLPKTADPRVQISGNFA  141

Query  1806  PVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVS  1627
             PVPE  V ++LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS S
Sbjct  142   PVPENPVSHSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSAS  201

Query  1626  YSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLAN  1447
             Y+CRFTETERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH RGTG+AN
Sbjct  202   YACRFTETERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSRGTGVAN  261

Query  1446  AGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFF  1267
             AGLVYFN RLLAMSEDDLPYHVRV P+GDL+TVGR+DF+ QLKSTMIAHPK+DP SGE F
Sbjct  262   AGLVYFNNRLLAMSEDDLPYHVRVTPTGDLKTVGRFDFDGQLKSTMIAHPKLDPVSGELF  321

Query  1266  ALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQE  1087
             ALSYDVIQKPYLKYF    +GEKS DVEIP++ PTM+HDFAITE +VIIPDQQVVFK+ E
Sbjct  322   ALSYDVIQKPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITEKFVIIPDQQVVFKMSE  381

Query  1086  MIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIG  907
             MIRGGS V+Y+K K SRFG+L K AK+ EG+ WVE P+ FCFHLWNAWEE ETDEIVVIG
Sbjct  382   MIRGGSPVVYDKNKVSRFGVLDKYAKDGEGLKWVEVPDCFCFHLWNAWEEPETDEIVVIG  441

Query  906   SCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGR  727
             SCMTPPDSIFNEC+E LKS+LSEIRLNLKTG+ST+R II   + QVNLEAGMVNRN LGR
Sbjct  442   SCMTPPDSIFNECDEGLKSVLSEIRLNLKTGKSTRRAIIQKEEDQVNLEAGMVNRNKLGR  501

Query  726   KTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHI  547
             KT++AYLAIAEPWPKVSGFAKVDL TGE++KF+YGD K+GGEP F+PR+PNS+ EDDG+I
Sbjct  502   KTRFAYLAIAEPWPKVSGFAKVDLFTGEVEKFIYGDNKFGGEPLFLPRDPNSKAEDDGYI  561

Query  546   LSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             L+FVH+EK WKSELQIVNA+ ++L AT+KLP+RVPYGFHGTFI + D+ NQ 
Sbjct  562   LAFVHNEKEWKSELQIVNAMTMKLEATVKLPTRVPYGFHGTFINAKDMANQA  613



>gb|AIX87507.1| 9-cis-epoxycarotenoid dioxygenase 1 [Lycium barbarum]
Length=607

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/588 (70%), Positives = 468/588 (80%), Gaps = 25/588 (4%)
 Frame = -2

Query  2088  DLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAP------------S  1945
             + G  S SIS+ K  +  KI C  ++ +  ++  P+QQ  + ++P              S
Sbjct  23    EFGHSSNSISLLK-NKPNKITC--SLQAPPILHFPKQQSSNYQTPKTNTIPTSKPTTKIS  79

Query  1944  QPK----------WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPE  1795
              PK          WNL+Q+A A ALD  E  L   EL+ PLPKT DP VQI+GNFAPVPE
Sbjct  80    HPKQENKSSSSSPWNLVQKAAAMALDAVESVLTKHELEHPLPKTADPRVQISGNFAPVPE  139

Query  1794  QAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCR  1615
               V  +LPV G +P C+NGVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CR
Sbjct  140   NPVTQSLPVTGKIPKCVNGVYVRNGANPLFEPTAGHHFFDGDGMVHAVEFKNGSASYACR  199

Query  1614  FTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLV  1435
             FTETERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARG+FGLVDH  GTG+ANAGLV
Sbjct  200   FTETERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGVFGLVDHSNGTGVANAGLV  259

Query  1434  YFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSY  1255
             YFN RLLAMSEDDLPYHVRV  +GDLET GR+DF+ QLKSTMIAHPK+DP SGE FALSY
Sbjct  260   YFNNRLLAMSEDDLPYHVRVTANGDLETDGRFDFDGQLKSTMIAHPKLDPVSGELFALSY  319

Query  1254  DVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRG  1075
             DVIQKPYLKYF    +GEKS DVEIP++ PTM+HDFAITE +V+IPDQQVVFK+ EMIRG
Sbjct  320   DVIQKPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITEKFVVIPDQQVVFKMSEMIRG  379

Query  1074  GSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMT  895
             GS V+Y+K K SRFGIL K AK+  G+ WVE P+ FCFHLWNAWEE ETDEIVVIGSCMT
Sbjct  380   GSPVVYDKNKVSRFGILDKYAKDGSGLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMT  439

Query  894   PPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQY  715
             PPDSIFNEC+E L+S+LSEIRLNLKTG+ST++ II   ++QVNLEAGMVNRN LGRKTQY
Sbjct  440   PPDSIFNECDEGLESVLSEIRLNLKTGKSTRKAIIQNEEEQVNLEAGMVNRNKLGRKTQY  499

Query  714   AYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFV  535
             AYLAIAEPWPKVSGFAKVDL TGE+ KF YGD KYGGEP F+PR+PNS+ EDDG+IL+FV
Sbjct  500   AYLAIAEPWPKVSGFAKVDLFTGEINKFFYGDNKYGGEPLFLPRDPNSKDEDDGYILAFV  559

Query  534   HDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             HDEK WKSELQIVNA+ L+L AT+KLPSRVPYGFHGTFI + DL NQ 
Sbjct  560   HDEKEWKSELQIVNAMTLKLEATVKLPSRVPYGFHGTFINAKDLANQA  607



>gb|AIG92851.1| 9-cis-epoxycarotenoid dioxygenase [Malus prunifolia]
Length=607

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/576 (73%), Positives = 474/576 (82%), Gaps = 15/576 (3%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRRAK---IHCEAAVHSSSVVTLPEQQ-----LPDGESPAPSQ----  1942
             +G P +SI +K    R     IHC  A+ S SV+  P+Q      +    +PA  +    
Sbjct  34    MGFPKRSIFLKSSKNRRSSSSIHC--ALQSPSVLHFPKQPCNTPVVTKEATPAKPKTHQL  91

Query  1941  PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDG  1762
             P+WNLLQ+A A A+D+ EGALVSRE Q PLPKT DP VQIAGN+APVPEQAVR+ LP+ G
Sbjct  92    PQWNLLQKAAAMAIDMVEGALVSRERQNPLPKTSDPRVQIAGNYAPVPEQAVRHCLPITG  151

Query  1761  AVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQER  1582
              +PDCINGVY+RNGANPL  P AGHHLFDGDGMVHAV+I  GS SY+CRFTET+RLVQER
Sbjct  152   TIPDCINGVYLRNGANPLHEPVAGHHLFDGDGMVHAVSIDSGSASYACRFTETQRLVQER  211

Query  1581  GLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSE  1402
              +GRPVFPKAIGELHGHSG+ARLLLF+ARG  GL+D   GTG+ANAGLVY NGRLLAMSE
Sbjct  212   EMGRPVFPKAIGELHGHSGIARLLLFFARGALGLLDKNHGTGVANAGLVYHNGRLLAMSE  271

Query  1401  DDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYF  1222
             DDLPYHVRV  SGDLETVGRYDF+ QL STMIAHPKVDPESG   ALSYDV+QKPYLKYF
Sbjct  272   DDLPYHVRVTKSGDLETVGRYDFDSQLGSTMIAHPKVDPESGSLHALSYDVVQKPYLKYF  331

Query  1221  NVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKK  1042
             +   +G KSPDVEIPL  PTM+HDFAITENYV+IPDQQVVFKL EMI GGS VIY+K K 
Sbjct  332   HFSPNGSKSPDVEIPLAGPTMMHDFAITENYVVIPDQQVVFKLGEMITGGSPVIYDKSKM  391

Query  1041  SRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEE  862
             SRFGILKK   NA+ IIWV+SP+TFCFHLWNAWEE E+ E+VVIGSCMTPPDSIFNEC+E
Sbjct  392   SRFGILKKNGVNADDIIWVDSPDTFCFHLWNAWEEPESAEVVVIGSCMTPPDSIFNECDE  451

Query  861   NLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPK  682
             NLKS+LSEIRLNLKTGES++R I+  +D  VNLEAGMVNRNLLGRKT++AYLAIAEPWPK
Sbjct  452   NLKSVLSEIRLNLKTGESSRRAILSESD-DVNLEAGMVNRNLLGRKTRFAYLAIAEPWPK  510

Query  681   VSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQ  502
             VSGFAKVDL TGE++KF YG+  YGGEPFFVP       EDDG+IL+FVHDEK WKSELQ
Sbjct  511   VSGFAKVDLFTGEVKKFFYGEKMYGGEPFFVPSTEEGASEDDGYILTFVHDEKNWKSELQ  570

Query  501   IVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             IVNA+N++L AT+KLPSRVPYGFHGTFI S DL NQ
Sbjct  571   IVNAVNMKLEATVKLPSRVPYGFHGTFIESKDLVNQ  606



>ref|XP_004134911.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004166758.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49403.1| hypothetical protein Csa_6G523440 [Cucumis sativus]
Length=600

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/579 (71%), Positives = 482/579 (83%), Gaps = 16/579 (3%)
 Frame = -2

Query  2079  LPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQ----------------QLPDGESPAP  1948
              P+ +I+  KP         +A+HS SV+  P Q                 L      +P
Sbjct  22    FPNFNINNLKPITSQNSIIHSALHSPSVLHFPNQTTTSTTTTSTTPNFHKSLSLKHQKSP  81

Query  1947  SQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPV  1768
             + P WNLLQ+  + ALD+ E ALVS ELQ PLPKT DP VQI+GNFAPVPEQAV++ LPV
Sbjct  82    TAPNWNLLQKTASMALDMVESALVSHELQHPLPKTADPRVQISGNFAPVPEQAVKHYLPV  141

Query  1767  DGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQ  1588
              G +PDCINGVY+RNGANPLF+P AGHHLFDGDGMVHAV+I  GS SY+CRFT+T+RLVQ
Sbjct  142   AGTIPDCINGVYLRNGANPLFQPTAGHHLFDGDGMVHAVSINHGSASYACRFTQTQRLVQ  201

Query  1587  ERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAM  1408
             ER LGRPVFPKAIGELHGHSG+ARLLLFYARG+FGLVDH++GTG+ANAGLVYFN RLLAM
Sbjct  202   ERRLGRPVFPKAIGELHGHSGIARLLLFYARGVFGLVDHKKGTGVANAGLVYFNDRLLAM  261

Query  1407  SEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLK  1228
             SEDDLPYHVR+ PSGDL+TVGRYDF+ QL STMIAHPKVDP S E +ALSYDV++KPYLK
Sbjct  262   SEDDLPYHVRITPSGDLQTVGRYDFDKQLHSTMIAHPKVDPISKELYALSYDVVRKPYLK  321

Query  1227  YFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKK  1048
             YF    +G KS DVEIPL+ PTM+HDFAITEN+V+IPDQQVVFKLQEM++GGS VIY+K 
Sbjct  322   YFRFSPNGIKSKDVEIPLETPTMMHDFAITENFVVIPDQQVVFKLQEMVKGGSPVIYDKN  381

Query  1047  KKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNEC  868
             KKSRFGIL K A +++ +IWVESP+TFCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNEC
Sbjct  382   KKSRFGILPKNATDSKDLIWVESPDTFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNEC  441

Query  867   EENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPW  688
             EENLKS+LSEIRLNL+TG+ST+R II    +QVNLEAGMVN+N +GRK++YAYLAIAEPW
Sbjct  442   EENLKSVLSEIRLNLRTGKSTRRAIIKEEKEQVNLEAGMVNKNRVGRKSRYAYLAIAEPW  501

Query  687   PKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSE  508
             PKVSGFAKVDL TGE++K +YG  K+GGEPFF+P+  NS++ED+G+IL+FVHDE+TWKSE
Sbjct  502   PKVSGFAKVDLVTGEVKKHIYGGRKFGGEPFFLPKEENSKEEDEGYILAFVHDERTWKSE  561

Query  507   LQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +QIVNA +L++ ATIKLPSRVPYGFHGTF+ S DLQNQ 
Sbjct  562   VQIVNAKDLKVEATIKLPSRVPYGFHGTFVQSNDLQNQA  600



>ref|XP_002519665.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
 gb|EEF42638.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
Length=607

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/575 (72%), Positives = 477/575 (83%), Gaps = 20/575 (3%)
 Frame = -2

Query  2067  SISMKKPTRRAKI-HCEAAVHSSSVVTLPEQQ------LPDGESPAPSQ----------P  1939
             S +  KPT +  I HC  A+HS SV+  P +Q      +P  +S    +          P
Sbjct  35    SFTKNKPTSKRNISHC--ALHSPSVLHFPPEQPYKPTVIPTDDSFTTVKRKTSHHRHQPP  92

Query  1938  KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGA  1759
              WNLLQRA A ALD+AE A++SRE Q  LPKT DP VQI+GN+APVPEQ VR +LPV G 
Sbjct  93    HWNLLQRAAAIALDMAESAVISRERQHQLPKTADPRVQISGNYAPVPEQPVRQSLPVTGT  152

Query  1758  VPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERG  1579
             +PDCINGVYVRNGANPLF P AGHHLFDGDGMVHAV+I  G+ SY+CRFTETERL QER 
Sbjct  153   IPDCINGVYVRNGANPLFEPIAGHHLFDGDGMVHAVSIKNGNASYACRFTETERLKQERV  212

Query  1578  LGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSED  1399
             LGRPVFPKAIGELHGHSG+ARLLLFYARGL GL+DH +GTG+ANAGLVYFN RLLAMSED
Sbjct  213   LGRPVFPKAIGELHGHSGIARLLLFYARGLCGLIDHTKGTGVANAGLVYFNDRLLAMSED  272

Query  1398  DLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFN  1219
             D+PY VRV  SGDLETVGRY+F  QL+ TMIAHPK+DP S E FALSYDVIQKPYLKYF 
Sbjct  273   DVPYQVRVTFSGDLETVGRYNFEGQLEHTMIAHPKIDPVSKEMFALSYDVIQKPYLKYFR  332

Query  1218  VKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKS  1039
                 G KSPDV+IPL VPTM+HDFAITEN+V+IPDQQVVFKLQEMI GGS VIY+K KKS
Sbjct  333   FFPDGTKSPDVDIPLPVPTMMHDFAITENFVVIPDQQVVFKLQEMISGGSPVIYDKDKKS  392

Query  1038  RFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEEN  859
             RFGIL K A++A  IIW+ESP+TFCFHLWNAWEE E+DE+VVIGSCMTPPDSIFNEC+E+
Sbjct  393   RFGILAKNARDANDIIWIESPDTFCFHLWNAWEEPESDEVVVIGSCMTPPDSIFNECDES  452

Query  858   LKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKV  679
             LKS+LSEIRLNL+TG+ST+R II  ++ QVNLEAGMVNRN +GRKT+Y YLAI EPWPKV
Sbjct  453   LKSVLSEIRLNLRTGKSTRREIIQESN-QVNLEAGMVNRNRIGRKTRYVYLAIVEPWPKV  511

Query  678   SGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQI  499
             SGFAKVDL TGE++K++YGD K+GGEPFF+PR+PNSE+EDDG++L+FVHDEK  KSELQI
Sbjct  512   SGFAKVDLFTGEVKKYIYGDKKFGGEPFFLPRDPNSEEEDDGYVLAFVHDEKKCKSELQI  571

Query  498   VNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             VNA NL+L A++KLPSRVPYGFHGTFI S DL +Q
Sbjct  572   VNATNLQLEASVKLPSRVPYGFHGTFIDSEDLVSQ  606



>ref|XP_011029543.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Populus euphratica]
Length=592

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/588 (69%), Positives = 469/588 (80%), Gaps = 28/588 (5%)
 Frame = -2

Query  2079  LPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQL------------------------  1972
             L S S+S+K+P ++  I+C  ++ + S +  P+Q                          
Sbjct  8     LGSSSLSLKRPGKKPNINC--SLQTPSTLHFPKQSTTCTPASTTISTPTPTTKHPKLDTP  65

Query  1971  -PDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPE  1795
              P   SP   Q +WN LQ A A ALD  E ALVS E Q PLPKT DP VQI+GNFAPVPE
Sbjct  66    SPVAPSPKQQQKQWNFLQSAAAMALDAVETALVSHERQHPLPKTADPRVQISGNFAPVPE  125

Query  1794  QAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCR  1615
             Q V  +LPV G +PDCI G Y+RNGANP   P AGHH FDGDGMVHAV    GSVSYS R
Sbjct  126   QPVVLDLPVTGKIPDCIQGAYLRNGANPFHEPVAGHHFFDGDGMVHAVQFKKGSVSYSSR  185

Query  1614  FTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLV  1435
             FTET RLVQERGLGR +FPKAIGELHGHSG+ARLLLFYARG FG+VD   GTG+ANAGLV
Sbjct  186   FTETNRLVQERGLGRSLFPKAIGELHGHSGIARLLLFYARGAFGIVDPSHGTGVANAGLV  245

Query  1434  YFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSY  1255
             YF+G LLAMSEDDLPYHVRV PSGDL+TVGRYDF+ QLK+TMIAHPKVDP SGE FALSY
Sbjct  246   YFDGHLLAMSEDDLPYHVRVLPSGDLQTVGRYDFDGQLKTTMIAHPKVDPVSGELFALSY  305

Query  1254  DVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRG  1075
             DV+QKPYLKYF     G+KSPDVEIPLD PTM+HDFAITE +V++PDQQVVFKL EMIRG
Sbjct  306   DVVQKPYLKYFRFSLDGKKSPDVEIPLDQPTMMHDFAITERFVVVPDQQVVFKLSEMIRG  365

Query  1074  GSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMT  895
             GS VIY+K K +RFGIL K A +A  I W+E+P+ FCFHLWNAWEE ETDE+VVIGSCMT
Sbjct  366   GSPVIYDKNKMARFGILDKNATDASNIRWIETPDCFCFHLWNAWEEPETDEVVVIGSCMT  425

Query  894   PPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQY  715
             PPDSIFNEC+E+LKS+LSEIRLNLKTG+ST+R I+   D QVNLEAGMVNRNLLGRK+++
Sbjct  426   PPDSIFNECDESLKSVLSEIRLNLKTGKSTRRQILSEAD-QVNLEAGMVNRNLLGRKSRF  484

Query  714   AYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFV  535
             AYLA+AEPWPKVSGFAKVDLSTGE+ K++YGD K+GGEP F+PR+PNSE+EDDG+IL+FV
Sbjct  485   AYLALAEPWPKVSGFAKVDLSTGEVHKYIYGDQKFGGEPLFLPRDPNSEREDDGYILAFV  544

Query  534   HDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             HDEK WKSELQIVNA+NL+L AT+KLPSRVPYGFHGTFI + DL+ Q 
Sbjct  545   HDEKEWKSELQIVNAMNLKLEATVKLPSRVPYGFHGTFIGAKDLEKQA  592



>ref|XP_002316871.1| hypothetical protein POPTR_0011s11370g [Populus trichocarpa]
 gb|EEE97483.1| hypothetical protein POPTR_0011s11370g [Populus trichocarpa]
Length=592

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/579 (70%), Positives = 469/579 (81%), Gaps = 26/579 (4%)
 Frame = -2

Query  2058  MKKPTRRAKIHCEAAVHSSSVVTLPEQ----------------QLPDGESPAPSQP----  1939
             +K+P ++   HC  ++ + S +  P+Q                + P  ++P+P  P    
Sbjct  17    LKRPGKKPNTHC--SLQTPSTLHFPKQSTTYTPSSTTISTPTTKHPKRDTPSPVAPSPKQ  74

Query  1938  ---KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPV  1768
                +WN LQ A A ALD  E ALVS E Q PLPKT DPGVQI+GNFAPVPEQ V  +LPV
Sbjct  75    QQKQWNFLQSAAAMALDAVETALVSHERQHPLPKTADPGVQISGNFAPVPEQPVVQDLPV  134

Query  1767  DGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQ  1588
              G +PDCI G Y+RNGANP   P AGHH FDGDGMVHAV    GSVSYS RFTET RLVQ
Sbjct  135   TGKIPDCIQGAYLRNGANPFHEPVAGHHFFDGDGMVHAVQFKKGSVSYSSRFTETNRLVQ  194

Query  1587  ERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAM  1408
             ERGLGRP+FPKAIGELHGHSG+ARLLLFYARG FG+VD   GTG+ANAGLVYF+G LLAM
Sbjct  195   ERGLGRPLFPKAIGELHGHSGIARLLLFYARGAFGIVDPSHGTGVANAGLVYFDGHLLAM  254

Query  1407  SEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLK  1228
             SEDDLPYHVRV PSGDL+TVGRYDF+ QLK+TMIAHPKVDP SGE FALSYDV+QKPYLK
Sbjct  255   SEDDLPYHVRVLPSGDLQTVGRYDFDGQLKTTMIAHPKVDPVSGELFALSYDVVQKPYLK  314

Query  1227  YFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKK  1048
             YF     G+KSP+VEIPLD PTM+HDFAITE +V++PDQQVVFKL EMIRGGS VIY+K 
Sbjct  315   YFRFSPDGKKSPNVEIPLDQPTMMHDFAITERFVVVPDQQVVFKLPEMIRGGSPVIYDKN  374

Query  1047  KKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNEC  868
             K +RFGIL K A +A  I W+E+P+ FCFHLWNAWEE ETDE+VVIGSCMTPPDSIFNEC
Sbjct  375   KMARFGILDKNATDASNIRWIETPDCFCFHLWNAWEEPETDEVVVIGSCMTPPDSIFNEC  434

Query  867   EENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPW  688
             +E+LKS+LSEIRLNLKTG+ST+R I+   D QVNLEAGMVNRNLLGRK+++AYLA+AEPW
Sbjct  435   DESLKSVLSEIRLNLKTGKSTRRQILSEAD-QVNLEAGMVNRNLLGRKSRFAYLALAEPW  493

Query  687   PKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSE  508
             PKVSGFAKVDLSTGE+ K++YGD K+GGEP F+PR+PNSE+EDDG+IL+FVHDEK WKSE
Sbjct  494   PKVSGFAKVDLSTGEVHKYIYGDQKFGGEPLFLPRDPNSEREDDGYILAFVHDEKEWKSE  553

Query  507   LQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             LQIVNA+NL+L AT+KLPSRVPYGFHGTFI + DL+ Q 
Sbjct  554   LQIVNAMNLKLEATVKLPSRVPYGFHGTFIGAKDLEKQA  592



>emb|CAB76920.1| putative 9-cis-epoxycarotenoid dioxygenase [Solanum tuberosum]
Length=604

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/581 (70%), Positives = 469/581 (81%), Gaps = 15/581 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKTSTISHPKQENNNS  83

Query  1938  -----KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNL  1774
                  KWNL+Q+A A ALD  EGAL   EL+ PLPKT DP VQI+GNFAPVPE  V  +L
Sbjct  84    SSSISKWNLVQKAAAMALDAVEGALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQSL  143

Query  1773  PVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERL  1594
             PV G +P C+ GVYVRNGANPLF P AG H FDGDGMVHAV    GS SY+CRFTETER 
Sbjct  144   PVTGKIPKCVQGVYVRNGANPLFEPTAGRHFFDGDGMVHAVQFKNGSASYACRFTETERF  203

Query  1593  VQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLL  1414
             VQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGL+DH RGTG+ANAGLVYFN RLL
Sbjct  204   VQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLIDHSRGTGVANAGLVYFNNRLL  263

Query  1413  AMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPY  1234
             AMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKPY
Sbjct  264   AMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKPY  323

Query  1233  LKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYE  1054
             LKYF    +GEKS DVEIP++ PTM+HDFAITE +VIIPDQQVVFK+ EMIRGGS V+Y+
Sbjct  324   LKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITEKFVIIPDQQVVFKMSEMIRGGSPVVYD  383

Query  1053  KKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFN  874
             K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIFN
Sbjct  384   KNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIFN  443

Query  873   ECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAE  694
             EC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKTQYAYLAIAE
Sbjct  444   ECDEGLKSVLSEIRLNLKTGKSTRKAIIENPDEQVNLEAGMVNRNKLGRKTQYAYLAIAE  503

Query  693   PWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWK  514
             PWPKVSGFAKVDL TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W 
Sbjct  504   PWPKVSGFAKVDLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEWT  563

Query  513   SELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             SELQIVNA+ L+L AT+KLPSRVPYGFHGTFI + DL NQ 
Sbjct  564   SELQIVNAMTLKLEATVKLPSRVPYGFHGTFINANDLANQA  604



>ref|XP_008371764.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Malus domestica]
Length=607

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/576 (73%), Positives = 473/576 (82%), Gaps = 15/576 (3%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRRAK---IHCEAAVHSSSVVTLPEQQ-----LPDGESPAPSQ----  1942
             +G P +SI +K    R     IHC  A+ S SV+  P+Q      +    +PA  +    
Sbjct  34    MGFPKRSIFLKSSKNRRSSSSIHC--ALQSPSVLHFPKQPCNTPVVTKEATPAKPKTHQL  91

Query  1941  PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDG  1762
             P+WNLLQ+A A A+D+ EGALVSRE Q PLPKT DP VQIAGN+APVPEQAVR+ LP+ G
Sbjct  92    PQWNLLQKAAAMAIDMVEGALVSRERQNPLPKTSDPRVQIAGNYAPVPEQAVRHCLPITG  151

Query  1761  AVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQER  1582
              +PDCINGVY+RNGANPL  P AGHHLFDGDGMVHAV+I  GS SY+CRFTET+RLVQER
Sbjct  152   TIPDCINGVYLRNGANPLHEPVAGHHLFDGDGMVHAVSIDSGSASYACRFTETQRLVQER  211

Query  1581  GLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSE  1402
              +GRPVFPKAIGELHGHSG+ARLLLF+ARG  GL+D   GTG+ANAGLVY NGRLLAMSE
Sbjct  212   EMGRPVFPKAIGELHGHSGIARLLLFFARGALGLLDKNHGTGVANAGLVYHNGRLLAMSE  271

Query  1401  DDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYF  1222
             DDLPYHVRV  SGDLETVGRYDF+ QL STMIAHPKVDPESG   ALSYDV+QKPYLKYF
Sbjct  272   DDLPYHVRVTKSGDLETVGRYDFDSQLGSTMIAHPKVDPESGSLHALSYDVVQKPYLKYF  331

Query  1221  NVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKK  1042
             +   +G KSPDVEIPL  PTM+HDFAITENYV+IPDQQVVFKL EMI GGS VIY+K K 
Sbjct  332   HFSPNGSKSPDVEIPLAGPTMMHDFAITENYVVIPDQQVVFKLGEMITGGSPVIYDKSKM  391

Query  1041  SRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEE  862
             SRFGILKK    A+ IIWV+SP+TFCFHLWNAWEE E+ E+VVIGSCMTPPDSIFNEC+E
Sbjct  392   SRFGILKKNDVXADDIIWVDSPDTFCFHLWNAWEEPESAEVVVIGSCMTPPDSIFNECDE  451

Query  861   NLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPK  682
             NLKS+LSEIRLNLKTGES++R I+  +D  VNLEAGMVNRNLLGRKT++AYLAIAEPWPK
Sbjct  452   NLKSVLSEIRLNLKTGESSRRAILSESD-DVNLEAGMVNRNLLGRKTRFAYLAIAEPWPK  510

Query  681   VSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQ  502
             VSGFAKVDL TGE++KF YG+  YGGEPFFVP       EDDG+IL+FVHDEK WKSELQ
Sbjct  511   VSGFAKVDLFTGEVKKFFYGEKMYGGEPFFVPSTEEGASEDDGYILTFVHDEKNWKSELQ  570

Query  501   IVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             IVNA+N++L AT+KLPSRVPYGFHGTFI S DL NQ
Sbjct  571   IVNAVNMKLEATVKLPSRVPYGFHGTFIESKDLVNQ  606



>gb|AAS47837.1| 9-cis-epoxycarotenoid dioxygenase [Gentiana lutea]
Length=600

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/575 (69%), Positives = 473/575 (82%), Gaps = 12/575 (2%)
 Frame = -2

Query  2094  TVDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQP--KWNllq  1921
             ++D       IS+KKPT+   I C      + ++T+P+QQLP   +P P  P  KWN LQ
Sbjct  29    SIDFNGSVNLISIKKPTKNNGIKC---AFQTPLITMPKQQLPPLTAPQPPSPPSKWNFLQ  85

Query  1920  ravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCIN  1741
             RA +  L+  E A++++E Q+ LPKT DP VQI+GNFAPVPE  ++ NLPV G +PDCI 
Sbjct  86    RAASIMLEKVESAILTKETQQKLPKTVDPNVQISGNFAPVPEMPIQYNLPVTGVIPDCIK  145

Query  1740  GVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGG--SVSYSCRFTETERLVQERGLGRP  1567
             GVY+RNGANP  +P +GHH FDGDGMVHAV I G   + SY+CRFTETERL+QER LGR 
Sbjct  146   GVYLRNGANPFHKPVSGHHFFDGDGMVHAVNINGNENTASYACRFTETERLIQERELGRS  205

Query  1566  VFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPY  1387
             VFPKAIGELHGHSG+ARL+LFY+R L GLVD  +G G+ANAGLVYFN RLLAMSEDDLPY
Sbjct  206   VFPKAIGELHGHSGIARLMLFYSRCLCGLVDQSKGIGVANAGLVYFNNRLLAMSEDDLPY  265

Query  1386  HVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSS  1207
             HVR+KPSGDLET+GRY+F+ QLK TMIAHPKVDP++G  FALSYDVI KPYLKYFNV   
Sbjct  266   HVRIKPSGDLETIGRYNFDGQLKGTMIAHPKVDPDTGSLFALSYDVISKPYLKYFNVTGD  325

Query  1206  GEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGI  1027
             G KS DVEIPL+ PTM+HDFAITEN+VIIPDQQVVFKLQEM++GGS ++Y+K KKSRFG+
Sbjct  326   GTKSGDVEIPLEEPTMMHDFAITENHVIIPDQQVVFKLQEMLKGGSPLMYDKNKKSRFGV  385

Query  1026  LKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSI  847
             L K AK+AE IIWVESPETFCFHLWNAWEE E DEIVVIGSCMTPPDS+FNEC+ENLKS+
Sbjct  386   LSKNAKHAEDIIWVESPETFCFHLWNAWEELENDEIVVIGSCMTPPDSVFNECDENLKSV  445

Query  846   LSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFA  667
             LSEIRLNLKTG+S KR I+ +  ++VNLEAGMVN++ LGRKTQ+ YLAIAEPWPKVSGFA
Sbjct  446   LSEIRLNLKTGKSRKRAIVQS--EEVNLEAGMVNKSRLGRKTQFGYLAIAEPWPKVSGFA  503

Query  666   KVDLSTGEMQKFMYGDGKYGGEPFFVP---RNPNSEKEDDGHILSFVHDEKTWKSELQIV  496
             KVDL +G++QK+MYGDG+YGGEPFFV     N   + EDDG+++ FVHDEKTWKSELQIV
Sbjct  504   KVDLLSGDIQKYMYGDGRYGGEPFFVSSSDSNSEDQDEDDGYVIVFVHDEKTWKSELQIV  563

Query  495   NAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
              A +L+L A+I+LPSRVPYGFHGTFI S DL++Q+
Sbjct  564   KAKSLKLQASIRLPSRVPYGFHGTFINSKDLESQL  598



>gb|AFP57677.1| 9-cis-epoxycarotenoid dioxygenase 3 protein family isoform 1 
[Nicotiana tabacum]
Length=613

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/592 (68%), Positives = 471/592 (80%), Gaps = 27/592 (5%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPA-------------  1951
             DL   S SIS+ KK   R      +++ +  ++  P+Q  P+ ++P              
Sbjct  23    DLAYSSNSISLVKKQPNRQLPSINSSLQAPPILHFPKQS-PNYQTPKTTTIPTSKPATIS  81

Query  1950  -PSQ-----------PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFA  1807
              P Q           P+WNL+Q+A A ALD  E  L   EL+ PLPKT DP VQI+GNFA
Sbjct  82    YPKQESTNSSSSTTSPQWNLVQKAAAMALDAVESVLTKHELEHPLPKTADPRVQISGNFA  141

Query  1806  PVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVS  1627
             PVPE  V ++ PV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS S
Sbjct  142   PVPENPVSHSPPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSAS  201

Query  1626  YSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLAN  1447
             Y+CRFTETERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH RGTG+AN
Sbjct  202   YACRFTETERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSRGTGVAN  261

Query  1446  AGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFF  1267
             AGLVYFN RLLAMSEDDLPYHVRV P+GDL+TVGR+DF+ QLKSTMIAHPK+DP SGE F
Sbjct  262   AGLVYFNNRLLAMSEDDLPYHVRVTPTGDLKTVGRFDFDGQLKSTMIAHPKLDPVSGELF  321

Query  1266  ALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQE  1087
             ALSYDVIQKPYLKYF    +GEKS DVEIP++ PTM+HDFAITE +VIIPDQQVVFK+ E
Sbjct  322   ALSYDVIQKPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITEKFVIIPDQQVVFKMSE  381

Query  1086  MIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIG  907
             MIRGGS V+Y+K K SRFG+L K AK+ EG+ WVE P+ FCFHLWNAWEE ETDEIVVIG
Sbjct  382   MIRGGSPVVYDKNKVSRFGVLDKYAKDGEGLKWVEVPDCFCFHLWNAWEEPETDEIVVIG  441

Query  906   SCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGR  727
             SCMTPPDSIFNEC+  LKS+LSEIRLNLKTG+ST+R II   + QVNLEAGMVNRN LGR
Sbjct  442   SCMTPPDSIFNECDGGLKSVLSEIRLNLKTGKSTRRAIIQKEEDQVNLEAGMVNRNKLGR  501

Query  726   KTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHI  547
             KT++AYLAIAEPWPKVSGFAKVDL TGE++KF+YGD K+GGEP F+PR+PNS+ EDDG+I
Sbjct  502   KTRFAYLAIAEPWPKVSGFAKVDLFTGEVEKFIYGDNKFGGEPLFLPRDPNSKAEDDGYI  561

Query  546   LSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             L+FVH+EK WKSELQIVNA+ ++L AT+KLP+RVPYGFHGTFI + D+ NQ 
Sbjct  562   LAFVHNEKEWKSELQIVNAMTMKLEATVKLPTRVPYGFHGTFINAKDMANQA  613



>ref|XP_011098124.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Sesamum indicum]
Length=605

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/566 (70%), Positives = 462/566 (82%), Gaps = 5/566 (1%)
 Frame = -2

Query  2076  PSKSISMKKPTRRAKIHCEAAVH---SSSVVTLPEQQLPDGESPA-PSQPKWNllqrava  1909
             P+   S++ PT           +   SS+ +  P+  +    SPA PS+P+WN++Q+A A
Sbjct  41    PTIKCSLQAPTLHFPKQSTTTTYQTPSSTTIAAPQTSITKSNSPASPSKPQWNIIQKAAA  100

Query  1908  aaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYV  1729
              AL+  E AL + EL  PLPKT DP VQIAGNF+PVPEQ V++ LPV G +PD I GVYV
Sbjct  101   MALEAIETALTAHELDHPLPKTADPRVQIAGNFSPVPEQPVKHKLPVTGKIPDSIQGVYV  160

Query  1728  RNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAI  1549
             RNGANPLF P AGHH FDGDGM+HAV    GS SY+CRFTET+RL+QER LGRP+FPKAI
Sbjct  161   RNGANPLFEPVAGHHFFDGDGMIHAVQFKDGSASYACRFTETQRLIQERALGRPIFPKAI  220

Query  1548  GELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKP  1369
             GELHGHSG+ARLLLFYARGLF LVDH +GTG+ANAGLVYFN RLLAMSEDDLPYHVRV P
Sbjct  221   GELHGHSGIARLLLFYARGLFKLVDHGQGTGVANAGLVYFNNRLLAMSEDDLPYHVRVTP  280

Query  1368  SGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPD  1189
             +GDL+TV RY+FN QLKSTMIAHPK+DP SGE FALSYDVIQKPYLKYF    +GEKS D
Sbjct  281   NGDLKTVERYNFNGQLKSTMIAHPKLDPVSGELFALSYDVIQKPYLKYFRFSRNGEKSAD  340

Query  1188  VEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAK  1009
             +EIP+  PTM+HDFAIT+ +VI+PDQQVVFK+ EMIRGGS V+Y+K K SRFG+L K A+
Sbjct  341   IEIPVSGPTMMHDFAITKKFVIVPDQQVVFKMSEMIRGGSPVVYDKNKLSRFGVLDKYAE  400

Query  1008  NAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRL  829
             +A  + WVE P+ FCFHLWNAWEE ETDEIVV+GSCMTPPDSIFNEC+E LKSILSEIRL
Sbjct  401   DATKMKWVEVPDCFCFHLWNAWEEPETDEIVVVGSCMTPPDSIFNECDEGLKSILSEIRL  460

Query  828   NLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLST  649
             NLKTG+ST+RPI+   D QVNLEAGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL T
Sbjct  461   NLKTGKSTRRPIMSDED-QVNLEAGMVNRNWLGRKTRYAYLAIAEPWPKVSGFAKVDLFT  519

Query  648   GEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLA  469
             GE+ KF YG+ KYGGEP F+P +PNS  EDDG+IL+FVHDEK WKSELQIVNA  + L A
Sbjct  520   GEVNKFFYGEEKYGGEPLFLPTDPNSGAEDDGYILAFVHDEKAWKSELQIVNAKTMSLEA  579

Query  468   TIKLPSRVPYGFHGTFITSYDLQNQV  391
             ++KLPSRVPYGFHGTFI++ DL NQ 
Sbjct  580   SVKLPSRVPYGFHGTFISAKDLANQA  605



>gb|ACH85193.1| 9-cis-epoxycarotenoid dioxygenase [Malus hupehensis var. mengshanensis]
Length=606

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/576 (72%), Positives = 472/576 (82%), Gaps = 15/576 (3%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRRAK---IHCEAAVHSSSVVTLPEQQ-----LPDGESPAPSQ----  1942
             +G P +SI +K    R     IHC  A+ S SV+  P+Q      +    +PA  +    
Sbjct  33    MGFPKRSIFLKSSKNRRSSSSIHC--ALQSPSVLHFPKQPCNTPVVTKEATPAKPKTHQF  90

Query  1941  PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDG  1762
             P+WNLLQ+A A A+D+ EGALVSRE Q PLPKT DP VQIAGN+APVPEQAVR+ LP+ G
Sbjct  91    PQWNLLQKAAAMAIDMVEGALVSRERQNPLPKTSDPRVQIAGNYAPVPEQAVRHCLPITG  150

Query  1761  AVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQER  1582
              +PDCINGVY+RNGANPL  P AGHHLFDGDGMVHAV+I  GS SY+CRFTET+RLVQER
Sbjct  151   TIPDCINGVYLRNGANPLHEPVAGHHLFDGDGMVHAVSIDSGSASYACRFTETQRLVQER  210

Query  1581  GLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSE  1402
              +GRPVFPKAIGELHGHSG+ARLLLF+ARG  GL+D   GTG+ANAGLVY NGRLLAMSE
Sbjct  211   EMGRPVFPKAIGELHGHSGIARLLLFFARGALGLLDKNHGTGVANAGLVYHNGRLLAMSE  270

Query  1401  DDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYF  1222
             DDLPYHVRV  SGDLETVGRYDF+ QL STMIAHPKVDPESG   ALSYDV+QKPYLKYF
Sbjct  271   DDLPYHVRVTKSGDLETVGRYDFDSQLGSTMIAHPKVDPESGTLHALSYDVVQKPYLKYF  330

Query  1221  NVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKK  1042
             +   +G KSPDVEIPL  PTM+HDFAITENYV+IPDQQVVFKL EMI GGS VIY+K K 
Sbjct  331   HFSPNGSKSPDVEIPLAGPTMMHDFAITENYVVIPDQQVVFKLGEMITGGSPVIYDKNKM  390

Query  1041  SRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEE  862
             SRFGILKK   NA+ IIWV+SP+TFCFHLWNAWEE E+ E+VVIGSCM PPDSIFNEC+E
Sbjct  391   SRFGILKKNDVNADDIIWVDSPDTFCFHLWNAWEEPESAEVVVIGSCMAPPDSIFNECDE  450

Query  861   NLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPK  682
             NLKS+LSEIRLNLKTGE ++R I+  +D  VNLEAGMVNRNLLGRKT++AYLAIAEPWPK
Sbjct  451   NLKSVLSEIRLNLKTGEPSRRAILSESD-DVNLEAGMVNRNLLGRKTRFAYLAIAEPWPK  509

Query  681   VSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQ  502
             VSGFAKVDL TGE++KF YG+  YGGEPFFVP       EDDG+IL+FVHDEK WKSELQ
Sbjct  510   VSGFAKVDLFTGEVKKFFYGEKMYGGEPFFVPSTEEGASEDDGYILTFVHDEKNWKSELQ  569

Query  501   IVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             IVNA+N++L AT+KLPSRVPYGFHGTFI S DL NQ
Sbjct  570   IVNAVNMKLEATVKLPSRVPYGFHGTFIESKDLVNQ  605



>ref|XP_006377601.1| hypothetical protein POPTR_0011s08240g [Populus trichocarpa]
 gb|ERP55398.1| hypothetical protein POPTR_0011s08240g [Populus trichocarpa]
Length=597

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/557 (73%), Positives = 461/557 (83%), Gaps = 10/557 (2%)
 Frame = -2

Query  2037  AKIHCEAAVHSSSVVTLPEQQLPDGESPAPS--------QPKWNllqravaaaldvaega  1882
              KIH  + +HS SV+  P Q     E  + +        QP WN LQRA A ALD+AE A
Sbjct  43    TKIH--STLHSPSVLHFPTQPGTSEEDSSVTVNPKTNRYQPLWNFLQRAAATALDMAEAA  100

Query  1881  lVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFR  1702
             LVS E QRPLPKT DP VQIAGNF+PV EQ VR +LPV G +P+CI+G+YVRNGANPL  
Sbjct  101   LVSHERQRPLPKTVDPRVQIAGNFSPVQEQKVRRSLPVTGTIPECIDGIYVRNGANPLLE  160

Query  1701  PKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGL  1522
             P AGHH FDGDGMVHA+ I  GS SYSCRFTETERL QERG GRPVFPKAIGELHGHSG+
Sbjct  161   PVAGHHFFDGDGMVHAMKIEKGSASYSCRFTETERLKQERGRGRPVFPKAIGELHGHSGI  220

Query  1521  ARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGR  1342
             ARLLLFYARGL GL+DH +GTG+ANAGLVYFN RLLAMSEDDLPY VR+ P GDLETVGR
Sbjct  221   ARLLLFYARGLCGLLDHTKGTGVANAGLVYFNDRLLAMSEDDLPYQVRITPCGDLETVGR  280

Query  1341  YDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPT  1162
             Y+FN QLK +MIAHPK+DP S E FALSY+V+QKPYLKYF     G+KSPD++IPL VPT
Sbjct  281   YNFNSQLKHSMIAHPKIDPVSKELFALSYNVVQKPYLKYFRFFPDGKKSPDIDIPLPVPT  340

Query  1161  MIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVE  982
             M+HDFAITEN+V+IPDQQVVFKLQEM+RGGS VIY+K KKSRFGIL K A +A+ IIWVE
Sbjct  341   MMHDFAITENFVVIPDQQVVFKLQEMLRGGSPVIYDKNKKSRFGILNKNATDAKDIIWVE  400

Query  981   SPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTK  802
             SP TFCFHLWNAWEE E++E+VVIGSCMTPPDSIFN+ +E+LKS+LSEIRLNLKTG+ST+
Sbjct  401   SPGTFCFHLWNAWEEPESNEVVVIGSCMTPPDSIFNDYDESLKSVLSEIRLNLKTGKSTR  460

Query  801   RPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYG  622
             RPII  +   VNLEAGMVNRN LGR+T YAYLAIAEPWPKVSGFAKVDL TGE++K+MYG
Sbjct  461   RPIIQESSNHVNLEAGMVNRNRLGRQTNYAYLAIAEPWPKVSGFAKVDLFTGEVKKYMYG  520

Query  621   DGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVP  442
             +  YGGEPFF+P N N E EDDG+IL+FVHDEKTWKSELQIVNA NL+L A+++LPSRVP
Sbjct  521   NKSYGGEPFFLPTNQNCETEDDGYILAFVHDEKTWKSELQIVNAKNLQLEASVRLPSRVP  580

Query  441   YGFHGTFITSYDLQNQV  391
             YGFHGTFI    L NQ 
Sbjct  581   YGFHGTFIDRRGLVNQA  597



>ref|XP_008439625.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Cucumis melo]
Length=599

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/566 (72%), Positives = 480/566 (85%), Gaps = 17/566 (3%)
 Frame = -2

Query  2046  TRRAKIHCEAAVHSSSVVTLPEQ------------QLPDGESPAPSQPKWNllqravaaa  1903
             T+ + IH  +A+HS SV+  P Q             L      +P+ P WNLLQ+  + A
Sbjct  35    TQNSIIH--SALHSPSVLRFPNQTTTTPPPPNFHKSLSLKHQKSPTAPNWNLLQKTASIA  92

Query  1902  ldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRN  1723
             LD+ E ALVS ELQ PLPKT DP VQI+GNFAPVPEQ V++NLPV G +PDCINGVY+RN
Sbjct  93    LDMVESALVSHELQHPLPKTADPRVQISGNFAPVPEQPVKHNLPVTGTIPDCINGVYLRN  152

Query  1722  GANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGE  1543
             GANPLF+P AGHHLFDGDGMVHAVTI  GS SY+CRFT+T+RLVQER LGRP+FPKAIGE
Sbjct  153   GANPLFQPTAGHHLFDGDGMVHAVTINHGSASYACRFTQTQRLVQERRLGRPIFPKAIGE  212

Query  1542  LHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSG  1363
             LHGHSG+ARLLLFYARG+FGLVDH++GTG+ANAGLVYFN RLLAMSEDDLPYHVR+ PSG
Sbjct  213   LHGHSGIARLLLFYARGVFGLVDHKKGTGVANAGLVYFNDRLLAMSEDDLPYHVRITPSG  272

Query  1362  DLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVE  1183
             DL+TVGRYDF+ QL STMIAHPKVDP S E +ALSYDV++KPYLKYF    +G KS DVE
Sbjct  273   DLQTVGRYDFDKQLHSTMIAHPKVDPISKELYALSYDVVRKPYLKYFRFSPNGIKSKDVE  332

Query  1182  IPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNA  1003
             IP++ PTM+HDFAITEN+V+IPDQQVVFKLQEM++GGS VIY+K KKSRFGIL K A ++
Sbjct  333   IPVETPTMMHDFAITENFVVIPDQQVVFKLQEMVKGGSPVIYDKNKKSRFGILPKNATDS  392

Query  1002  EGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNL  823
             + +IWVESP+TFCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNECEENLKS+LSEIRLNL
Sbjct  393   KDLIWVESPDTFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNECEENLKSVLSEIRLNL  452

Query  822   KTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGE  643
             +TG+ST+R II    +QVNLEAGMVN+  +GRK++YAYLAIAEPWPKVSGFAKVDL TGE
Sbjct  453   RTGKSTRRAIIKEEKEQVNLEAGMVNKTRVGRKSRYAYLAIAEPWPKVSGFAKVDLVTGE  512

Query  642   MQKFMYGDGKYGGEPFFVPRNPNS---EKEDDGHILSFVHDEKTWKSELQIVNAINLELL  472
             ++K +YG  K+GGEPFF+P++ NS   E+ED+G+IL+FVHDE+TWKSE+QIVNA +L++ 
Sbjct  513   VKKHIYGGRKFGGEPFFLPKDENSKAEEEEDEGYILAFVHDERTWKSEVQIVNAKDLKVE  572

Query  471   ATIKLPSRVPYGFHGTFITSYDLQNQ  394
             ATIKLPSRVPYGFHGTF+ S +LQNQ
Sbjct  573   ATIKLPSRVPYGFHGTFVQSNNLQNQ  598



>gb|AFO85470.1| 9-cis-epoxy-carotenoid dioxygenase [Lycium barbarum]
Length=607

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/588 (69%), Positives = 467/588 (79%), Gaps = 25/588 (4%)
 Frame = -2

Query  2088  DLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAP------------S  1945
             + G  S SIS+ K  +  KI C  ++ +  ++  P+QQ  + ++P              S
Sbjct  23    EFGHSSNSISLLK-NKPNKITC--SLQAPPILHFPKQQSSNYQTPKTNTIPTSKPTTKIS  79

Query  1944  QPK----------WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPE  1795
              PK           NL+Q+A A ALD  E  L   EL+ PLPKT DP VQI+GNFAPVPE
Sbjct  80    HPKQENKSSSSSPLNLVQKAAAMALDAVESVLTKHELEHPLPKTADPRVQISGNFAPVPE  139

Query  1794  QAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCR  1615
               V  +LPV G +P C+NGVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CR
Sbjct  140   NPVTQSLPVTGKIPKCVNGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACR  199

Query  1614  FTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLV  1435
             FTETERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARG+FGLVDH  GTG+ANAGLV
Sbjct  200   FTETERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGVFGLVDHSNGTGVANAGLV  259

Query  1434  YFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSY  1255
             YFN RLLAMSEDDLPYHVRV  +GDLET GR+DF+ QLKSTMIAHPK+DP SGE FALSY
Sbjct  260   YFNNRLLAMSEDDLPYHVRVTANGDLETDGRFDFDGQLKSTMIAHPKLDPVSGELFALSY  319

Query  1254  DVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRG  1075
             DVIQKPYLKYF    +GEKS DVEIP++ PTM+HDFAITE +V+IPDQQVVFK+ EMIRG
Sbjct  320   DVIQKPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITEKFVVIPDQQVVFKMSEMIRG  379

Query  1074  GSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMT  895
             GS V+Y+K K SRFGIL K AK+  G+ WVE P+ FCFHLWNAWEE ETDE+VVIGSCMT
Sbjct  380   GSPVVYDKNKVSRFGILDKYAKDGSGLKWVEVPDCFCFHLWNAWEEPETDELVVIGSCMT  439

Query  894   PPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQY  715
             PPDSIFNEC+E L+S+LSEIRLNLKTG+ST++ +I   ++QVNLEAGMVNRN LGRKTQY
Sbjct  440   PPDSIFNECDEGLESVLSEIRLNLKTGKSTRKALIQNEEEQVNLEAGMVNRNKLGRKTQY  499

Query  714   AYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFV  535
             AYLAIAEPWPKVSGFAKVDL TGE+ KF YGD KYGGEP F+PR+PNS+ EDDG+IL+FV
Sbjct  500   AYLAIAEPWPKVSGFAKVDLFTGEINKFFYGDNKYGGEPLFLPRDPNSKDEDDGYILAFV  559

Query  534   HDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             HDEK WKSELQIVNA+ L+L AT+KLPSRVPYGFHGTFI + DL NQ 
Sbjct  560   HDEKEWKSELQIVNAMTLKLEATVKLPSRVPYGFHGTFINAKDLANQA  607



>gb|AIY62759.1| 9-cis epoxycarotenoid dioxygenase [Lycium chinense]
Length=608

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/588 (69%), Positives = 467/588 (79%), Gaps = 25/588 (4%)
 Frame = -2

Query  2088  DLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAP------------S  1945
             + G  S SIS+ K  +  KI C  ++ +  ++  P+QQ  + ++P              S
Sbjct  24    EFGHSSNSISLLK-NKPNKITC--SLQAPPILHFPKQQSSNYQTPKTNTIPTSKPTTKIS  80

Query  1944  QPK----------WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPE  1795
              PK           NL+Q+A A ALD  E  L   EL+ PLPKT DP VQI+GNFAPVPE
Sbjct  81    HPKQENKSSSSSPLNLVQKAAAMALDAVESVLTKHELEHPLPKTADPRVQISGNFAPVPE  140

Query  1794  QAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCR  1615
               V  +LPV G +P C+NGVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CR
Sbjct  141   NPVTQSLPVTGKIPKCVNGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACR  200

Query  1614  FTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLV  1435
             FTETERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARG+FGLVDH  GTG+ANAGLV
Sbjct  201   FTETERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGVFGLVDHSNGTGVANAGLV  260

Query  1434  YFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSY  1255
             YFN RLLAMSEDDLPYHVRV  +GDLET GR+DF+ QLKSTMIAHPK+DP SGE FALSY
Sbjct  261   YFNNRLLAMSEDDLPYHVRVTANGDLETDGRFDFDGQLKSTMIAHPKLDPVSGELFALSY  320

Query  1254  DVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRG  1075
             DVIQKPYLKYF    +GEKS DVEIP++ PTM+HDFAITE +V+IPDQQVVFK+ EMIRG
Sbjct  321   DVIQKPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITEKFVVIPDQQVVFKMSEMIRG  380

Query  1074  GSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMT  895
             GS V+Y+K K SRFGIL K AK+  G+ WVE P+ FCFHLWNAWEE ETDE+VVIGSCMT
Sbjct  381   GSPVVYDKNKVSRFGILDKYAKDGSGLKWVEVPDCFCFHLWNAWEEPETDELVVIGSCMT  440

Query  894   PPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQY  715
             PPDSIFNEC+E L+S+LSEIRLNLKTG+ST++ +I   ++QVNLEAGMVNRN LGRKTQY
Sbjct  441   PPDSIFNECDEGLESVLSEIRLNLKTGKSTRKALIQNEEEQVNLEAGMVNRNKLGRKTQY  500

Query  714   AYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFV  535
             AYLAIAEPWPKVSGFAKVDL TGE+ KF YGD KYGGEP F+PR+PNS+ EDDG+IL+FV
Sbjct  501   AYLAIAEPWPKVSGFAKVDLFTGEINKFFYGDNKYGGEPLFLPRDPNSKDEDDGYILAFV  560

Query  534   HDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             HDEK WKSELQIVNA+ L+L AT+KLPSRVPYGFHGTFI + DL NQ 
Sbjct  561   HDEKEWKSELQIVNAMTLKLEATVKLPSRVPYGFHGTFINAKDLANQA  608



>gb|ADQ74055.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=593

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/572 (70%), Positives = 468/572 (82%), Gaps = 18/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPAPSQPK----  1936
             + G+ S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   +   SQPK    
Sbjct  24    EFGVASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTI--SQPKQENN  81

Query  1935  -------WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                    WNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  82    NSSSSSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  141

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  142   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  201

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  202   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  261

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  262   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  321

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  322   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  381

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  382   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  441

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  442   NECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  501

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  502   EPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  561

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  562   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  593



>gb|ADQ74072.1| 9-cis-epoxycarotenoid dioxygenase [Solanum ochranthum]
 gb|ADQ74073.1| 9-cis-epoxycarotenoid dioxygenase [Solanum ochranthum]
Length=592

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/569 (71%), Positives = 464/569 (82%), Gaps = 13/569 (2%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQQL------------PDGESPAP  1948
             + G  S SI++ K    R  ++  +++ +  ++  P+Q              P  E+   
Sbjct  24    EFGFASNSIALLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1947  SQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPV  1768
             S  KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +LPV
Sbjct  84    SSSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQSLPV  143

Query  1767  DGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQ  1588
              G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETERLVQ
Sbjct  144   TGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETERLVQ  203

Query  1587  ERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAM  1408
             E+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RLLAM
Sbjct  204   EKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRLLAM  263

Query  1407  SEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLK  1228
             SEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKPYLK
Sbjct  264   SEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKPYLK  323

Query  1227  YFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKK  1048
             YF    +GEKS DVEIP++ PTM+HDFAITE +VIIPDQQVVFK+ EMIRGGS V+Y+K 
Sbjct  324   YFRFSKNGEKSNDVEIPVEDPTMMHDFAITEKFVIIPDQQVVFKMSEMIRGGSPVVYDKN  383

Query  1047  KKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNEC  868
             K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIFNEC
Sbjct  384   KVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIFNEC  443

Query  867   EENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPW  688
             +E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKTQYAYLAIAEPW
Sbjct  444   DEGLKSVLSEIRLNLKTGKSTRKVIIENPDEQVNLEAGMVNRNKLGRKTQYAYLAIAEPW  503

Query  687   PKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSE  508
             PKVSGFAKVDL TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK WKSE
Sbjct  504   PKVSGFAKVDLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEWKSE  563

Query  507   LQIVNAINLELLATIKLPSRVPYGFHGTF  421
             LQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   LQIVNAMSLKLEATVKLPSRVPYGFHGTF  592



>ref|XP_002316710.2| hypothetical protein POPTR_0011s02230g [Populus trichocarpa]
 gb|EEE97322.2| hypothetical protein POPTR_0011s02230g [Populus trichocarpa]
Length=597

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/557 (73%), Positives = 461/557 (83%), Gaps = 10/557 (2%)
 Frame = -2

Query  2037  AKIHCEAAVHSSSVVTLPEQQLPDGESPAPS--------QPKWNllqravaaaldvaega  1882
              KIH  + +HS SV+  P Q     E  + +        QP WN LQRA A ALD+AE A
Sbjct  43    TKIH--STLHSPSVLHFPTQPGTSEEDSSVTVNPKTNRYQPLWNFLQRAAATALDMAEAA  100

Query  1881  lVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFR  1702
             LVS E QRPLPKT DP VQIAGNF+PV EQ VR +LPV G +P+CI+G+YVRNGANPL  
Sbjct  101   LVSHERQRPLPKTVDPRVQIAGNFSPVQEQKVRRSLPVTGTIPECIDGIYVRNGANPLLE  160

Query  1701  PKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGL  1522
             P AGHH FDGDGMVHA+ I  GS SYSCRFTETERL QERG GRPVFPKAIGELHGHSG+
Sbjct  161   PVAGHHFFDGDGMVHAMKIEKGSASYSCRFTETERLKQERGRGRPVFPKAIGELHGHSGI  220

Query  1521  ARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGR  1342
             ARLLLFYARGL GL+DH +GTG+ANAGLVYFN RLLAMSEDDLPY VR+ P GDLETVGR
Sbjct  221   ARLLLFYARGLCGLLDHTKGTGVANAGLVYFNDRLLAMSEDDLPYQVRITPCGDLETVGR  280

Query  1341  YDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPT  1162
             Y+FN QLK +MIAHPK+DP S E FALSY+V+QKPYLKYF     G+KSPD++IPL VPT
Sbjct  281   YNFNSQLKHSMIAHPKIDPVSKELFALSYNVVQKPYLKYFRFFPDGKKSPDIDIPLPVPT  340

Query  1161  MIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVE  982
             M+HDFAITEN+V+IPDQQVVFKLQEM+RGGS VIY+K KKSRFG+L K A +A+ IIWVE
Sbjct  341   MMHDFAITENFVVIPDQQVVFKLQEMLRGGSPVIYDKNKKSRFGVLNKNATDAKDIIWVE  400

Query  981   SPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTK  802
             SP TFCFHLWNAWEE E++E+VVIGSCMTPPDSIFN+ +E+LKS+LSEIRLNLKTG+ST+
Sbjct  401   SPGTFCFHLWNAWEEPESNEVVVIGSCMTPPDSIFNDYDESLKSVLSEIRLNLKTGKSTR  460

Query  801   RPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYG  622
             RPII  +   VNLEAGMVNRN LGR+T YAYLAIAEPWPKVSGFAKVDL TGE++K+MYG
Sbjct  461   RPIIQESSNHVNLEAGMVNRNRLGRQTNYAYLAIAEPWPKVSGFAKVDLFTGEVKKYMYG  520

Query  621   DGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVP  442
             +  YGGEPFF+P N N E EDDG+IL+FVHDEKTWKSELQIVNA NL+L A+++LPSRVP
Sbjct  521   NKSYGGEPFFLPTNQNCETEDDGYILAFVHDEKTWKSELQIVNAKNLQLEASVRLPSRVP  580

Query  441   YGFHGTFITSYDLQNQV  391
             YGFHGTFI    L NQ 
Sbjct  581   YGFHGTFIDRRGLVNQA  597



>gb|ADQ74061.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/572 (70%), Positives = 467/572 (82%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74047.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74049.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74051.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74067.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/572 (70%), Positives = 467/572 (82%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74050.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/572 (70%), Positives = 468/572 (82%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G+ S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGVASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74054.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/574 (70%), Positives = 467/574 (81%), Gaps = 20/574 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPAPSQPK----  1936
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   +   SQPK    
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTI--SQPKQENN  81

Query  1935  ---------WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVR  1783
                      WNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V 
Sbjct  82    NSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVC  141

Query  1782  NNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTET  1603
              +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTET
Sbjct  142   QSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTET  201

Query  1602  ERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNG  1423
             ERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN 
Sbjct  202   ERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNN  261

Query  1422  RLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQ  1243
             RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQ
Sbjct  262   RLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQ  321

Query  1242  KPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCV  1063
             KPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V
Sbjct  322   KPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPV  381

Query  1062  IYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDS  883
             +Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDS
Sbjct  382   VYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDS  441

Query  882   IFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLA  703
             IFNEC+E LKS+LSEIRLN+KTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLA
Sbjct  442   IFNECDEGLKSVLSEIRLNMKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLA  501

Query  702   IAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEK  523
             IAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK
Sbjct  502   IAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEK  561

Query  522   TWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
              WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  562   EWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74028.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=595

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/572 (70%), Positives = 467/572 (82%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74025.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=595

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/572 (70%), Positives = 467/572 (82%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74065.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/572 (70%), Positives = 468/572 (82%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G+ S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGVASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLN+KTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNMKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74059.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74063.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74064.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74066.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74068.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/572 (70%), Positives = 467/572 (82%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLN+KTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNMKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74069.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/572 (70%), Positives = 467/572 (82%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLN+KTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNMKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74048.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=596

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/573 (70%), Positives = 467/573 (82%), Gaps = 17/573 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  -------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRN  1780
                    KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  
Sbjct  84    SSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQ  143

Query  1779  NLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETE  1600
             +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETE
Sbjct  144   SLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETE  203

Query  1599  RLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGR  1420
             RLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN R
Sbjct  204   RLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNR  263

Query  1419  LLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQK  1240
             LLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQK
Sbjct  264   LLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQK  323

Query  1239  PYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVI  1060
             PYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+
Sbjct  324   PYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVV  383

Query  1059  YEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSI  880
             Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSI
Sbjct  384   YDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSI  443

Query  879   FNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAI  700
             FNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAI
Sbjct  444   FNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAI  503

Query  699   AEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKT  520
             AEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK 
Sbjct  504   AEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKE  563

Query  519   WKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   WKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  596



>gb|ADQ74056.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74057.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74070.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74071.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/572 (70%), Positives = 468/572 (82%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G+ S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGVASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74032.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74033.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74034.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74035.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74037.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74041.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/574 (70%), Positives = 469/574 (82%), Gaps = 18/574 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G+ S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P+Q     
Sbjct  24    EFGVASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPNQENNNS  83

Query  1938  --------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVR  1783
                     KWNL+Q+A A ALD  E AL   EL+ PLPKT DP +QI+GNFAPVPE  V 
Sbjct  84    SSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRIQISGNFAPVPENPVC  143

Query  1782  NNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTET  1603
              +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTET
Sbjct  144   QSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTET  203

Query  1602  ERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNG  1423
             ERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN 
Sbjct  204   ERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNN  263

Query  1422  RLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQ  1243
             RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQ
Sbjct  264   RLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQ  323

Query  1242  KPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCV  1063
             KPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V
Sbjct  324   KPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPV  383

Query  1062  IYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDS  883
             +Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDS
Sbjct  384   VYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDS  443

Query  882   IFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLA  703
             IFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLA
Sbjct  444   IFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLA  503

Query  702   IAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEK  523
             IAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK
Sbjct  504   IAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEK  563

Query  522   TWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
              WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   EWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74036.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=593

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/572 (70%), Positives = 466/572 (81%), Gaps = 18/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPAPSQPK----  1936
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   +   S PK    
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTI--SHPKQENK  81

Query  1935  -------WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                    WNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  82    NSSSSSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  141

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  142   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  201

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  202   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  261

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  262   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  321

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  322   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  381

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  382   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  441

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  442   NECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  501

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  502   EPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  561

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  562   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  593



>gb|ADQ74052.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74058.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74062.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/572 (70%), Positives = 468/572 (82%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G+ S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGVASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLN+KTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNMKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|AIX87531.1| 9-cis-epoxycarotenoid dioxygenase 1 [Lycium ruthenicum]
Length=607

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/588 (69%), Positives = 463/588 (79%), Gaps = 25/588 (4%)
 Frame = -2

Query  2088  DLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAP------------S  1945
             + G  S SIS+ K  +  KI C  ++ +  ++  P+QQ  + ++P              S
Sbjct  23    EFGHSSNSISLLK-NKPNKITC--SLQAPPILHFPKQQSSNYQTPKTNTIPTSKPTTKIS  79

Query  1944  QPK----------WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPE  1795
              PK          WNL+Q+A A ALD  E  L   EL+ PLPKT DP VQI+GNFAPVPE
Sbjct  80    HPKQENKSSSSSPWNLVQKAAAMALDAVESVLTKHELEHPLPKTADPRVQISGNFAPVPE  139

Query  1794  QAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCR  1615
               V  +LPV G +P C+NGVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CR
Sbjct  140   NPVTQSLPVTGKIPKCVNGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACR  199

Query  1614  FTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLV  1435
             FTETERL QE+ LGRPVFPKAIGELHGHSG+ARL+LFYARG+FGLVDH  GTG+ANAGLV
Sbjct  200   FTETERLTQEKALGRPVFPKAIGELHGHSGIARLMLFYARGVFGLVDHSNGTGVANAGLV  259

Query  1434  YFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSY  1255
             YFN RLLAMSEDDLPYHVRV  +GDLET GR DF+ QLKSTMI HPK+DP SGE FALSY
Sbjct  260   YFNNRLLAMSEDDLPYHVRVTANGDLETDGRVDFDGQLKSTMIVHPKLDPVSGELFALSY  319

Query  1254  DVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRG  1075
             DVIQKPYLKYF    +GEKS DVEIP++ PTM+HDFAITE +V+IPDQQVVFK+ EMI G
Sbjct  320   DVIQKPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITEKFVVIPDQQVVFKMSEMILG  379

Query  1074  GSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMT  895
             GS V+Y+K K SRFGIL K AK+  G+ WVE P+ FCFHLWNAWEE ETDEIVVIGSCMT
Sbjct  380   GSPVVYDKNKVSRFGILDKYAKDGSGLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMT  439

Query  894   PPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQY  715
             PPDSIFNEC+E L+S+LSEIRLNLKTG+ST++ II   ++QVNLEAGMVNRN LGRKTQY
Sbjct  440   PPDSIFNECDEGLESVLSEIRLNLKTGKSTRKAIIQNEEEQVNLEAGMVNRNKLGRKTQY  499

Query  714   AYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFV  535
             AYLAIAEPWPKVSGFAKVDL TGE+ KF YGD KYGGEP F+PR+PNS+ EDDG+IL+FV
Sbjct  500   AYLAIAEPWPKVSGFAKVDLFTGEINKFFYGDNKYGGEPLFLPRDPNSKDEDDGYILAFV  559

Query  534   HDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             HDEK WKSELQIVNA+ L L AT+KLPSRVPYGFHGTFI + DL NQ 
Sbjct  560   HDEKEWKSELQIVNAMTLRLEATVKLPSRVPYGFHGTFINAKDLANQA  607



>gb|ADQ74020.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/574 (70%), Positives = 467/574 (81%), Gaps = 18/574 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  --------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVR  1783
                     KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V 
Sbjct  84    SSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVC  143

Query  1782  NNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTET  1603
              +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTET
Sbjct  144   QSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTET  203

Query  1602  ERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNG  1423
             ERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN 
Sbjct  204   ERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNN  263

Query  1422  RLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQ  1243
             RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQ
Sbjct  264   RLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQ  323

Query  1242  KPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCV  1063
             KPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V
Sbjct  324   KPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPV  383

Query  1062  IYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDS  883
             +Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDS
Sbjct  384   VYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDS  443

Query  882   IFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLA  703
             IFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLA
Sbjct  444   IFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLA  503

Query  702   IAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEK  523
             IAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK
Sbjct  504   IAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEK  563

Query  522   TWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
              WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   EWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74018.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/574 (70%), Positives = 467/574 (81%), Gaps = 18/574 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  --------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVR  1783
                     KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V 
Sbjct  84    SSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVC  143

Query  1782  NNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTET  1603
              +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTET
Sbjct  144   QSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTET  203

Query  1602  ERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNG  1423
             ERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN 
Sbjct  204   ERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNN  263

Query  1422  RLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQ  1243
             RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQ
Sbjct  264   RLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQ  323

Query  1242  KPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCV  1063
             KPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V
Sbjct  324   KPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPV  383

Query  1062  IYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDS  883
             +Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDS
Sbjct  384   VYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDS  443

Query  882   IFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLA  703
             IFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLA
Sbjct  444   IFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLA  503

Query  702   IAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEK  523
             IAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK
Sbjct  504   IAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEK  563

Query  522   TWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
              WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   EWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74016.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/574 (70%), Positives = 467/574 (81%), Gaps = 18/574 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNSTISHPKQENNNS  83

Query  1938  --------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVR  1783
                     KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V 
Sbjct  84    SSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVC  143

Query  1782  NNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTET  1603
              +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTET
Sbjct  144   QSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTET  203

Query  1602  ERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNG  1423
             ERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN 
Sbjct  204   ERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNN  263

Query  1422  RLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQ  1243
             RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQ
Sbjct  264   RLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQ  323

Query  1242  KPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCV  1063
             KPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V
Sbjct  324   KPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPV  383

Query  1062  IYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDS  883
             +Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDS
Sbjct  384   VYDKNKVSRFGILDKYAKDGSDLRWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDS  443

Query  882   IFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLA  703
             IFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLA
Sbjct  444   IFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLA  503

Query  702   IAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEK  523
             IAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK
Sbjct  504   IAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEK  563

Query  522   TWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
              WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   EWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74038.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/574 (70%), Positives = 468/574 (82%), Gaps = 18/574 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G+ S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGVASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  --------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVR  1783
                     KWNL+Q+A A ALD  E AL   EL+ PLPKT DP +QI+GNFAPVPE  V 
Sbjct  84    SSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRIQISGNFAPVPENPVC  143

Query  1782  NNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTET  1603
              +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTET
Sbjct  144   QSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTET  203

Query  1602  ERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNG  1423
             ERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN 
Sbjct  204   ERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNN  263

Query  1422  RLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQ  1243
             RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQ
Sbjct  264   RLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQ  323

Query  1242  KPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCV  1063
             KPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V
Sbjct  324   KPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPV  383

Query  1062  IYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDS  883
             +Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDS
Sbjct  384   VYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDS  443

Query  882   IFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLA  703
             IFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLA
Sbjct  444   IFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLA  503

Query  702   IAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEK  523
             IAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK
Sbjct  504   IAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEK  563

Query  522   TWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
              WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   EWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74012.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/574 (70%), Positives = 467/574 (81%), Gaps = 18/574 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  --------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVR  1783
                     KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V 
Sbjct  84    SSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVC  143

Query  1782  NNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTET  1603
              +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTET
Sbjct  144   QSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTET  203

Query  1602  ERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNG  1423
             ERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN 
Sbjct  204   ERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNN  263

Query  1422  RLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQ  1243
             RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQ
Sbjct  264   RLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQ  323

Query  1242  KPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCV  1063
             KPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V
Sbjct  324   KPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPV  383

Query  1062  IYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDS  883
             +Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDS
Sbjct  384   VYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDS  443

Query  882   IFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLA  703
             IFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLA
Sbjct  444   IFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLA  503

Query  702   IAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEK  523
             IAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK
Sbjct  504   IAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEK  563

Query  522   TWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
              WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   EWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74013.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74014.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74015.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/574 (70%), Positives = 467/574 (81%), Gaps = 18/574 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  --------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVR  1783
                     KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V 
Sbjct  84    SSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVC  143

Query  1782  NNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTET  1603
              +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTET
Sbjct  144   QSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTET  203

Query  1602  ERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNG  1423
             ERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN 
Sbjct  204   ERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNN  263

Query  1422  RLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQ  1243
             RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQ
Sbjct  264   RLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQ  323

Query  1242  KPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCV  1063
             KPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V
Sbjct  324   KPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPV  383

Query  1062  IYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDS  883
             +Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDS
Sbjct  384   VYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDS  443

Query  882   IFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLA  703
             IFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLA
Sbjct  444   IFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLA  503

Query  702   IAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEK  523
             IAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK
Sbjct  504   IAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEK  563

Query  522   TWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
              WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   EWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74022.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74023.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=598

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/575 (70%), Positives = 467/575 (81%), Gaps = 19/575 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ---------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAV  1786
                      KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V
Sbjct  84    SSSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPV  143

Query  1785  RNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTE  1606
               +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTE
Sbjct  144   CQSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTE  203

Query  1605  TERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFN  1426
             TERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN
Sbjct  204   TERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFN  263

Query  1425  GRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVI  1246
              RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVI
Sbjct  264   NRLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVI  323

Query  1245  QKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSC  1066
             QKPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS 
Sbjct  324   QKPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSP  383

Query  1065  VIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPD  886
             V+Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPD
Sbjct  384   VVYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPD  443

Query  885   SIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYL  706
             SIFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYL
Sbjct  444   SIFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYL  503

Query  705   AIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDE  526
             AIAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDE
Sbjct  504   AIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDE  563

Query  525   KTWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             K WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  598



>ref|XP_008465499.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Cucumis melo]
Length=591

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/516 (77%), Positives = 446/516 (86%), Gaps = 3/516 (1%)
 Frame = -2

Query  1935  WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAV  1756
             WN LQRA A ALD  E AL+S E +  LPKT DP VQIAGNFAPVPEQ VR  LPV G V
Sbjct  77    WNFLQRAAAMALDAVENALISAERKHSLPKTADPAVQIAGNFAPVPEQPVRKGLPVIGKV  136

Query  1755  PDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTIT-GGSVSYSCRFTETERLVQERG  1579
             P+CI GVYVRNGANPL  P +GHHLFDGDGMVHAV  +  G VSY+CRFTET+RLVQER 
Sbjct  137   PECIRGVYVRNGANPLHEPVSGHHLFDGDGMVHAVEFSEAGGVSYACRFTETQRLVQERA  196

Query  1578  LGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSED  1399
              GRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +G G+ANAGLVYFNGRLLAMSED
Sbjct  197   YGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHNQGIGVANAGLVYFNGRLLAMSED  256

Query  1398  DLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFN  1219
             DLPY +RV P+GDL+TVGR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKPYLKYF 
Sbjct  257   DLPYQIRVTPAGDLKTVGRFDFDGQLKSTMIAHPKLDPVSGEMFALSYDVIQKPYLKYFK  316

Query  1218  VKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKS  1039
                 GEKSPDVEIPL  PTM+HDFAITE YV+IPDQQVVFKL EMIRGGS V+Y+K+K S
Sbjct  317   FSPEGEKSPDVEIPLPQPTMMHDFAITEKYVVIPDQQVVFKLPEMIRGGSPVVYDKEKTS  376

Query  1038  RFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEEN  859
             RFGIL K A +A  I W+E+P+ FCFHLWNAWEE ET+EIVVIGSCMTPPDSIFNECEEN
Sbjct  377   RFGILDKNAADANAIKWIEAPDCFCFHLWNAWEEPETNEIVVIGSCMTPPDSIFNECEEN  436

Query  858   LKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKV  679
             LKS+LSEIRLNL TG+ST+RPII  T +QVNLEAGMVNRNLLGRKTQ++YLA+AEPWPKV
Sbjct  437   LKSVLSEIRLNLSTGKSTRRPIISET-EQVNLEAGMVNRNLLGRKTQFSYLALAEPWPKV  495

Query  678   SGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQI  499
             SGFAKVDL TGE++K++YG+ +YGGEP F+PR   +E EDDGHIL+FVHDEK WKSELQI
Sbjct  496   SGFAKVDLFTGEIKKYLYGEQRYGGEPLFLPRE-GAEAEDDGHILAFVHDEKEWKSELQI  554

Query  498   VNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             VNA+ LEL AT+KLPSRVPYGFHGTFI+S DLQ Q+
Sbjct  555   VNAMTLELEATVKLPSRVPYGFHGTFISSEDLQKQI  590



>gb|ADQ74030.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=598

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/575 (70%), Positives = 467/575 (81%), Gaps = 19/575 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNSTISHPKQENNNS  83

Query  1938  ---------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAV  1786
                      KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V
Sbjct  84    SSSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPV  143

Query  1785  RNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTE  1606
               +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTE
Sbjct  144   CQSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTE  203

Query  1605  TERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFN  1426
             TERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN
Sbjct  204   TERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFN  263

Query  1425  GRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVI  1246
              RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVI
Sbjct  264   NRLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVI  323

Query  1245  QKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSC  1066
             QKPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS 
Sbjct  324   QKPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSP  383

Query  1065  VIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPD  886
             V+Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPD
Sbjct  384   VVYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPD  443

Query  885   SIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYL  706
             SIFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYL
Sbjct  444   SIFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYL  503

Query  705   AIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDE  526
             AIAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDE
Sbjct  504   AIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDE  563

Query  525   KTWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             K WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  598



>gb|ADQ74053.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74060.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/572 (70%), Positives = 466/572 (81%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTAYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74044.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74045.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/572 (70%), Positives = 467/572 (82%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G+ S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGVASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLN KTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNTKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74021.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/528 (75%), Positives = 453/528 (86%), Gaps = 0/528 (0%)
 Frame = -2

Query  2004  SSVVTLPEQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQ  1825
             +S ++ P+Q+  +  S + S  KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQ
Sbjct  70    NSTISHPKQENNNSSSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQ  129

Query  1824  IAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTI  1645
             I+GNFAPVPE  V  +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV  
Sbjct  130   ISGNFAPVPENPVCQSLPVTGKIPKCVKGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQF  189

Query  1644  TGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRR  1465
               GS SY+CRFTETERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +
Sbjct  190   KNGSASYACRFTETERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSK  249

Query  1464  GTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDP  1285
             GTG+ANAGLVYFN RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP
Sbjct  250   GTGVANAGLVYFNNRLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDP  309

Query  1284  ESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQV  1105
              SGE FALSYDVIQKPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQV
Sbjct  310   VSGELFALSYDVIQKPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQV  369

Query  1104  VFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETD  925
             VFK+ EMIRGGS V+Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETD
Sbjct  370   VFKMSEMIRGGSPVVYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETD  429

Query  924   EIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVN  745
             EIVVIGSCMTPPDSIFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVN
Sbjct  430   EIVVIGSCMTPPDSIFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVN  489

Query  744   RNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEK  565
             RN LGRKT+YAYLAIAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++
Sbjct  490   RNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFVYGDNKYGGEPLFLPRDPNSKE  549

Query  564   EDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             EDDG+IL+FVHDEK WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  550   EDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74042.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74043.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/572 (70%), Positives = 466/572 (81%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLN KTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNTKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74019.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/528 (75%), Positives = 453/528 (86%), Gaps = 0/528 (0%)
 Frame = -2

Query  2004  SSVVTLPEQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQ  1825
             +S ++ P+Q+  +  S + S  KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQ
Sbjct  70    NSTISHPKQENNNSSSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQ  129

Query  1824  IAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTI  1645
             I+GNFAPVPE  V  +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV  
Sbjct  130   ISGNFAPVPENPVCQSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQF  189

Query  1644  TGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRR  1465
               GS SY+CRFTETERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +
Sbjct  190   KNGSASYACRFTETERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSK  249

Query  1464  GTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDP  1285
             GTG+ANAGLVYFN RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP
Sbjct  250   GTGVANAGLVYFNNRLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDP  309

Query  1284  ESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQV  1105
              SGE FALSYDVIQKPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQV
Sbjct  310   VSGELFALSYDVIQKPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQV  369

Query  1104  VFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETD  925
             VFK+ EMIRGGS V+Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETD
Sbjct  370   VFKMSEMIRGGSPVVYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETD  429

Query  924   EIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVN  745
             EIVVIGSCMTPPDSIFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVN
Sbjct  430   EIVVIGSCMTPPDSIFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVN  489

Query  744   RNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEK  565
             RN LGRKT+YAYLAIAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++
Sbjct  490   RNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKE  549

Query  564   EDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             EDDG+IL+FVHDEK WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  550   EDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|AGN03861.1| 9-cis epoxycarotenoid dioxygenase [Scutellaria baicalensis]
Length=598

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/523 (74%), Positives = 449/523 (86%), Gaps = 1/523 (0%)
 Frame = -2

Query  1959  SPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRN  1780
             S +PS+P+WN++Q+A A AL+  EGAL + EL++PLPKT DP VQIAGNF+PVPEQ V++
Sbjct  77    SNSPSKPQWNIIQKAAAMALEAVEGALTAHELEQPLPKTADPRVQIAGNFSPVPEQPVKH  136

Query  1779  NLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETE  1600
              LPV G +PD I GVYVRNGANPLF P AGHH FDGDGM+HAV    GS SY+CRFTET+
Sbjct  137   QLPVTGKIPDSIQGVYVRNGANPLFEPVAGHHFFDGDGMIHAVQFKNGSASYACRFTETQ  196

Query  1599  RLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGR  1420
             RL+QER LGRP+FPKAIGELHGHSG+ARLLLFYARGLF LVDH  GTG+ANAGLVYFN R
Sbjct  197   RLIQERALGRPIFPKAIGELHGHSGIARLLLFYARGLFKLVDHGHGTGVANAGLVYFNNR  256

Query  1419  LLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQK  1240
             LLAMSEDDLPYHVRV P+GDL+T  RYDF+ QLKSTMIAHPKVDP +GE FALSYDV+QK
Sbjct  257   LLAMSEDDLPYHVRVTPNGDLKTAERYDFDGQLKSTMIAHPKVDPVTGEMFALSYDVVQK  316

Query  1239  PYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVI  1060
             PYLKYF    +GEKS DV+IP+  PTM+HDFAITE +VI+PDQQVVFK+ EMIRGGS V+
Sbjct  317   PYLKYFKFSKNGEKSEDVDIPVSEPTMMHDFAITEKFVIVPDQQVVFKMSEMIRGGSPVV  376

Query  1059  YEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSI  880
             Y+K K SRFG+L K AK+A  + WVE P+ FCFHLWNAWEE ETDE+VVIGSCMTPPDSI
Sbjct  377   YDKNKMSRFGVLDKYAKDASSMKWVEVPDCFCFHLWNAWEEPETDEVVVIGSCMTPPDSI  436

Query  879   FNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAI  700
             FNECEE LKS+LSEIRLNLKTG+ST++ II   ++QVNLEAGMVNRN LGRKT+YAYLAI
Sbjct  437   FNECEEGLKSVLSEIRLNLKTGKSTRKAII-CEEEQVNLEAGMVNRNKLGRKTRYAYLAI  495

Query  699   AEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKT  520
             AEPWPKVSGFAKVDL TGE+ KF YG+ K+GGEP F+PR+ NSE+EDDG+IL+FVHDEK 
Sbjct  496   AEPWPKVSGFAKVDLFTGEVTKFFYGEEKFGGEPLFLPRDANSEEEDDGYILAFVHDEKA  555

Query  519   WKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             WKSELQIVNA  +++ A++KLPSRVPYGFHGTFI S D+ NQ 
Sbjct  556   WKSELQIVNAKTMKMEASVKLPSRVPYGFHGTFIGSKDMANQA  598



>gb|ADQ74029.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/574 (70%), Positives = 466/574 (81%), Gaps = 18/574 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  --------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVR  1783
                     KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V 
Sbjct  84    SSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVC  143

Query  1782  NNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTET  1603
              +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTET
Sbjct  144   QSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTET  203

Query  1602  ERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNG  1423
             ERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN 
Sbjct  204   ERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNN  263

Query  1422  RLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQ  1243
             RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQ
Sbjct  264   RLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQ  323

Query  1242  KPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCV  1063
             KPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+VIIPDQQVVFK+ EMIRGGS V
Sbjct  324   KPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVIIPDQQVVFKMSEMIRGGSPV  383

Query  1062  IYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDS  883
             +Y+K K SRFGIL K A++   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDS
Sbjct  384   VYDKNKVSRFGILDKYAEDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDS  443

Query  882   IFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLA  703
             IFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLA
Sbjct  444   IFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLA  503

Query  702   IAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEK  523
             IAEPWPKVSGFAKV+L TGE +KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK
Sbjct  504   IAEPWPKVSGFAKVNLFTGETEKFVYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEK  563

Query  522   TWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
              WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   EWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74027.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=595

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/572 (70%), Positives = 466/572 (81%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V  +GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTSTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|KDO50508.1| hypothetical protein CISIN_1g007379mg [Citrus sinensis]
Length=606

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/531 (75%), Positives = 452/531 (85%), Gaps = 3/531 (1%)
 Frame = -2

Query  1983  EQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAP  1804
             +QQ  + ++ APS  KWN LQ+A A ALD  E ALVS+E Q PLPKT DP VQIAGNF+P
Sbjct  79    KQQPKENDNFAPS--KWNFLQKAAALALDAVENALVSQERQHPLPKTADPTVQIAGNFSP  136

Query  1803  VPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSY  1624
             VPE+ V  NLP  G VPDCI GVYVRNGANPL  P AGHH FDGDGMVHAV    GSVSY
Sbjct  137   VPEKPVCQNLPTTGKVPDCIQGVYVRNGANPLHEPVAGHHFFDGDGMVHAVKFNKGSVSY  196

Query  1623  SCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANA  1444
             SCRFTET R VQER LGRPVFPKAIGELHGH+G+ARLLLFY+R LFGLVD   GTG+ANA
Sbjct  197   SCRFTETNRFVQERSLGRPVFPKAIGELHGHTGIARLLLFYSRALFGLVDPSHGTGVANA  256

Query  1443  GLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFA  1264
             GLVYFN RLLAMSEDDLPYHVRV PSG+L+TVGR+DF+ QLKSTMIAHPKVDP +G+ FA
Sbjct  257   GLVYFNNRLLAMSEDDLPYHVRVTPSGELKTVGRFDFSGQLKSTMIAHPKVDPVTGDLFA  316

Query  1263  LSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEM  1084
             LSYDV++KPYLKYF     G KSPDVEIPL+ PTM+HDFAITEN+V++PDQQVVFKL+EM
Sbjct  317   LSYDVVKKPYLKYFRFSPQGIKSPDVEIPLEEPTMMHDFAITENFVVVPDQQVVFKLKEM  376

Query  1083  IRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGS  904
             IRGGS VIY+K K SRFGIL K A +A  + W+++P+ FCFHLWNAWEE E DE+VVIGS
Sbjct  377   IRGGSPVIYDKNKVSRFGILDKNATDASKMKWIDAPDCFCFHLWNAWEEPERDEVVVIGS  436

Query  903   CMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRK  724
             CMTP DSIFNEC+E+LKS+LSEIRLNLKTGEST+RPII + D+QVNLEAGMVNRNLLGRK
Sbjct  437   CMTPADSIFNECDESLKSVLSEIRLNLKTGESTRRPII-SEDEQVNLEAGMVNRNLLGRK  495

Query  723   TQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHIL  544
             T++AYLA+AEPWPKVSGFAKVDL TG++ KF+YGD +YGGEP F PR+PNSE EDDG+IL
Sbjct  496   TRFAYLALAEPWPKVSGFAKVDLLTGQVNKFIYGDQRYGGEPLFFPRDPNSENEDDGYIL  555

Query  543   SFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +FVHDEK WKSELQIVNA+ LEL AT+KLPSRVPYGFHGTFI + DL  Q 
Sbjct  556   AFVHDEKEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFIGAKDLAKQA  606



>emb|CDP06103.1| unnamed protein product [Coffea canephora]
Length=635

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/516 (75%), Positives = 448/516 (87%), Gaps = 0/516 (0%)
 Frame = -2

Query  1938  KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGA  1759
             +WN+LQRA A ALD  E AL +REL++PLPKT DP +QI+GNFAPVPEQ VR+ LPV G 
Sbjct  120   QWNVLQRAAAMALDAVETALTARELEQPLPKTADPRIQISGNFAPVPEQPVRHALPVTGK  179

Query  1758  VPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERG  1579
             +P+ I GVYVRNGANPLF P AGHH FDGDGM+HA+    GS SY+CRFTET+RL QER 
Sbjct  180   IPNSIQGVYVRNGANPLFEPAAGHHFFDGDGMIHALQFQNGSASYACRFTETQRLAQERS  239

Query  1578  LGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSED  1399
             LGRPVFPKAIGELHGHSG+ARL+LFYARG+FGL+DH +GTG+ANAGLVYFN RLLAMSED
Sbjct  240   LGRPVFPKAIGELHGHSGIARLMLFYARGVFGLLDHSQGTGVANAGLVYFNNRLLAMSED  299

Query  1398  DLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFN  1219
             DLPYHVR+ PSGDL+TV RY FN QLKSTMIAHPK+DP +GE FALSYDVIQKPYLKYF 
Sbjct  300   DLPYHVRITPSGDLKTVERYSFNGQLKSTMIAHPKLDPVTGELFALSYDVIQKPYLKYFR  359

Query  1218  VKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKS  1039
                +GEKS D+EIP+  PTM+HDFAIT+N+V+IPDQQVVFK+ EMIRGGS V+Y+K+K S
Sbjct  360   FSKAGEKSKDIEIPVPEPTMMHDFAITDNFVVIPDQQVVFKMSEMIRGGSPVVYDKEKVS  419

Query  1038  RFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEEN  859
             RFG+L K A+++  I WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIFNEC+E 
Sbjct  420   RFGVLDKYAEDSSAIKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIFNECDEG  479

Query  858   LKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKV  679
             LKS+LSEIRLNLKTG+ST+R II   + QVNLEAGMVNRN LGRKT+YAYLAIAEPWPKV
Sbjct  480   LKSVLSEIRLNLKTGKSTRRAIISNPEDQVNLEAGMVNRNKLGRKTRYAYLAIAEPWPKV  539

Query  678   SGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQI  499
             SGFAKVDL TGE++KF+YGD KYGGEP F+PR+PN E EDDG+IL+FVHDEK WKSEL+I
Sbjct  540   SGFAKVDLFTGEVRKFIYGDEKYGGEPLFLPRDPNCEAEDDGYILAFVHDEKEWKSELRI  599

Query  498   VNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             VNA+ LEL A+++LPSRVPYGFHGTFI++ DL +Q 
Sbjct  600   VNAMTLELEASVQLPSRVPYGFHGTFISAKDLASQA  635



>gb|ABA43901.1| 9-cis-epoxycarotenoid dioxygenase 3 [Coffea canephora]
Length=635

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/516 (75%), Positives = 448/516 (87%), Gaps = 0/516 (0%)
 Frame = -2

Query  1938  KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGA  1759
             +WN+LQRA A ALD  E AL +REL++PLPKT DP +QI+GNFAPVPEQ VR+ LPV G 
Sbjct  120   QWNVLQRAAAMALDAVETALTARELEQPLPKTADPRIQISGNFAPVPEQPVRHALPVTGK  179

Query  1758  VPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERG  1579
             +P+ I GVYVRNGANPLF P AGHH FDGDGM+HA+    GS SY+CRFTET+RL QER 
Sbjct  180   IPNSIQGVYVRNGANPLFEPAAGHHFFDGDGMIHALQFQNGSASYACRFTETQRLAQERS  239

Query  1578  LGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSED  1399
             LGRPVFPKAIGELHGHSG+ARL+LFYARG+FGL+DH +GTG+ANAGLVYFN RLLAMSED
Sbjct  240   LGRPVFPKAIGELHGHSGIARLMLFYARGVFGLLDHSQGTGVANAGLVYFNNRLLAMSED  299

Query  1398  DLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFN  1219
             DLPYHVR+ PSGDL+TV RY FN QLKSTMIAHPK+DP +GE FALSYDVIQKPYLKYF 
Sbjct  300   DLPYHVRITPSGDLKTVERYSFNGQLKSTMIAHPKLDPVTGELFALSYDVIQKPYLKYFR  359

Query  1218  VKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKS  1039
                +GEKS D+EIP+  PTM+HDFAIT+N+V+IPDQQVVFK+ EMIRGGS V+Y+K+K S
Sbjct  360   FSKAGEKSKDIEIPVPEPTMMHDFAITDNFVVIPDQQVVFKMSEMIRGGSPVVYDKEKVS  419

Query  1038  RFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEEN  859
             RFG+L K A+++  I WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIFNEC+E 
Sbjct  420   RFGVLDKYAEDSSAIKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIFNECDEG  479

Query  858   LKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKV  679
             LKS+LSEIRLNLKTG+ST+R II   + QVNLEAGMVNRN LGRKT+YAYLAIAEPWPKV
Sbjct  480   LKSVLSEIRLNLKTGKSTRRAIISNPEDQVNLEAGMVNRNKLGRKTRYAYLAIAEPWPKV  539

Query  678   SGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQI  499
             SGFAKVDL TGE++KF+YGD KYGGEP F+PR+PN E EDDG+IL+FVHDEK WKSEL+I
Sbjct  540   SGFAKVDLFTGEVRKFIYGDEKYGGEPLFLPRDPNCEAEDDGYILAFVHDEKEWKSELRI  599

Query  498   VNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             VNA+ LEL A+++LPSRVPYGFHGTFI++ DL +Q 
Sbjct  600   VNAMTLELEASVQLPSRVPYGFHGTFISAKDLASQA  635



>ref|XP_008371610.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Malus domestica]
Length=603

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/580 (72%), Positives = 474/580 (82%), Gaps = 21/580 (4%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRR---AKIHCEAAVHSSSVVTLPEQQLPDGESP------APSQPK-  1936
             +G   +SIS+K    R   + IHC  A+ S SV+  P+   P   +P       P++PK 
Sbjct  30    MGFSKRSISLKSSKNRRNSSIIHC--ALRSPSVLHFPK---PPYNTPVITKEATPAKPKT  84

Query  1935  -----WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLP  1771
                  WNLLQ+A A A+DV EGALVSRE Q PLPKT DP VQ+AGN+APVPEQAVR++LP
Sbjct  85    RQLPQWNLLQKAAAMAIDVVEGALVSRERQNPLPKTSDPRVQMAGNYAPVPEQAVRHSLP  144

Query  1770  VDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLV  1591
             V G +PDCINGVYVRNGANPL  P AGHHLFDGDGMVHAV+I  GS SY+CRFTET+RLV
Sbjct  145   VTGTIPDCINGVYVRNGANPLHEPVAGHHLFDGDGMVHAVSIDSGSASYACRFTETQRLV  204

Query  1590  QERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLA  1411
             QER +GRPVFPKAIGELHGHSG+ARLLLF+ARG  GL+D  +GTG+ANAGLVY NGRLLA
Sbjct  205   QEREMGRPVFPKAIGELHGHSGIARLLLFFARGALGLLDKNQGTGVANAGLVYHNGRLLA  264

Query  1410  MSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYL  1231
             MSEDDLPY VRV  SGDLETVGRYDF+ QL STMIAHPKVDPESG   +LSYDV+QKPYL
Sbjct  265   MSEDDLPYQVRVTKSGDLETVGRYDFDSQLGSTMIAHPKVDPESGSLHSLSYDVVQKPYL  324

Query  1230  KYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEK  1051
             KYF+   +G KSPDVEIPL  PTM+HDFAITENYV+IPDQQVVFKL EMI GGS VIY+K
Sbjct  325   KYFHFSPNGAKSPDVEIPLAGPTMMHDFAITENYVVIPDQQVVFKLGEMITGGSPVIYDK  384

Query  1050  KKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNE  871
              K SRFGILKK  +NA+ IIWV+SP+TFCFHLWNAWEE E+ E VVIGSCMTPPDSIFNE
Sbjct  385   TKMSRFGILKKNEENADDIIWVDSPDTFCFHLWNAWEEPESXEXVVIGSCMTPPDSIFNE  444

Query  870   CEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEP  691
             C ENLKS+LSEIRLNLKTGEST+R I+  +D  VNLEAGMVNRN LGRKT++AYLAIAEP
Sbjct  445   CXENLKSVLSEIRLNLKTGESTRRAILSESD-DVNLEAGMVNRNRLGRKTRFAYLAIAEP  503

Query  690   WPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKS  511
             WPKVSGFAKVDL TGE++KF YG+ KYGGEPFFVP       ED+G+IL+FVHDEK WKS
Sbjct  504   WPKVSGFAKVDLFTGEVKKFFYGEKKYGGEPFFVPSTAERASEDEGYILTFVHDEKKWKS  563

Query  510   ELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             ELQIVNA N++L AT+KLPSRVPYGFHGTFI S DL NQ 
Sbjct  564   ELQIVNAXNMKLEATVKLPSRVPYGFHGTFIESKDLVNQA  603



>gb|ADQ74046.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/572 (70%), Positives = 467/572 (82%), Gaps = 16/572 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G+ S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGVASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNSTISHPKQENNNS  83

Query  1938  ------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                   KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V  +
Sbjct  84    SSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVCQS  143

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETER
Sbjct  144   LPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETER  203

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN RL
Sbjct  204   LVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNRL  263

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQKP
Sbjct  264   LAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKP  323

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+Y
Sbjct  324   YLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVY  383

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIF
Sbjct  384   DKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIF  443

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAIA
Sbjct  444   NECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAIA  503

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKV+L T E++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK W
Sbjct  504   EPWPKVSGFAKVNLFTDEVEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKEW  563

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             KSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   KSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>ref|NP_001275864.1| putative 9-cis-epoxycarotenoid dioxygenase 3 [Citrus sinensis]
 gb|AER70359.1| putative 9-cis-epoxycarotenoid dioxygenase 3 [Citrus sinensis]
Length=606

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/531 (75%), Positives = 451/531 (85%), Gaps = 3/531 (1%)
 Frame = -2

Query  1983  EQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAP  1804
             +QQ  + ++ APS  KWN LQ+A A ALD  E ALVS+E Q PLPKT DP VQIAGNF+P
Sbjct  79    KQQPKENDNFAPS--KWNFLQKAAALALDAVENALVSQERQHPLPKTADPTVQIAGNFSP  136

Query  1803  VPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSY  1624
             VPE+ V  NLP  G VPDCI GVYVRNGANPL  P AGHH FDGDGMVHAV    GSVSY
Sbjct  137   VPEKPVCQNLPTTGKVPDCIQGVYVRNGANPLHEPVAGHHFFDGDGMVHAVQFNKGSVSY  196

Query  1623  SCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANA  1444
             SCRFTET R VQER LGRPVFPKAIGELHGH+G+ARLLLFY+R LFGLVD   GTG+ANA
Sbjct  197   SCRFTETNRFVQERSLGRPVFPKAIGELHGHTGIARLLLFYSRALFGLVDPSHGTGVANA  256

Query  1443  GLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFA  1264
             GLVYFN RLLAMSEDDLPYHVRV PSGDL+TVGR+DF+ QLKSTMIAHPKVDP +G+ FA
Sbjct  257   GLVYFNNRLLAMSEDDLPYHVRVTPSGDLKTVGRFDFSGQLKSTMIAHPKVDPVTGDLFA  316

Query  1263  LSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEM  1084
             LSYDV++KPYLKYF     G KSPDVEIPL+ PTM+HDFAITEN+V++PDQQVVFKL EM
Sbjct  317   LSYDVVKKPYLKYFRFSPQGIKSPDVEIPLEEPTMMHDFAITENFVVVPDQQVVFKLNEM  376

Query  1083  IRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGS  904
             IRGGS VIY+K K SRFGIL K A +A  + W+++P+ FCFHLWNAWEE E DE+VVIGS
Sbjct  377   IRGGSPVIYDKNKVSRFGILDKNATDASKMKWIDAPDCFCFHLWNAWEEPERDEVVVIGS  436

Query  903   CMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRK  724
             CMTP DSIFNEC+E+LKS+LSEIRLNLKTGEST+RP+I + D+QVNLEAGMVNRNLLGRK
Sbjct  437   CMTPADSIFNECDESLKSVLSEIRLNLKTGESTRRPLI-SEDEQVNLEAGMVNRNLLGRK  495

Query  723   TQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHIL  544
             T++AYLA+AEPWPKVSGFAKVDL TG++ KF+YG  +YGGEP F PR+PNSE EDDG+IL
Sbjct  496   TRFAYLALAEPWPKVSGFAKVDLLTGQVNKFIYGGQRYGGEPLFFPRDPNSENEDDGYIL  555

Query  543   SFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +FVHDEK WKSELQIVNA+ LEL AT+KLPS+VPYGFHGTFI++ DL  Q 
Sbjct  556   AFVHDEKEWKSELQIVNAMTLELEATVKLPSQVPYGFHGTFISAKDLAKQA  606



>gb|ADQ74039.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=596

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/573 (70%), Positives = 467/573 (82%), Gaps = 17/573 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G+ S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGVASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPMNSTISHPKQENNNS  83

Query  1938  -------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRN  1780
                    KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  +  
Sbjct  84    SSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPICQ  143

Query  1779  NLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETE  1600
             +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTETE
Sbjct  144   SLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTETE  203

Query  1599  RLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGR  1420
             RLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN R
Sbjct  204   RLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNNR  263

Query  1419  LLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQK  1240
             LLAMSEDDLPYHV+V P+GDL+T GR+DF  QLKSTMIAHPK+DP SGE FALSYDVIQK
Sbjct  264   LLAMSEDDLPYHVKVTPTGDLKTEGRFDFEGQLKSTMIAHPKLDPVSGELFALSYDVIQK  323

Query  1239  PYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVI  1060
             PYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+
Sbjct  324   PYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVV  383

Query  1059  YEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSI  880
             Y+K K SRFGIL K A++   + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSI
Sbjct  384   YDKNKVSRFGILDKYAEDGSDLKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSI  443

Query  879   FNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAI  700
             FNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLAI
Sbjct  444   FNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLAI  503

Query  699   AEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKT  520
             AEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK 
Sbjct  504   AEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEKE  563

Query  519   WKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   WKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  596



>gb|AAY98512.2| 9-cis-epoxycarotenoid dioxygenase [Stylosanthes guianensis]
Length=602

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/515 (75%), Positives = 448/515 (87%), Gaps = 1/515 (0%)
 Frame = -2

Query  1935  WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAV  1756
             WNL+Q+A + A+D AE AL S E + PLPKT DP VQIAGNFAPVPE  V  NLP+ G +
Sbjct  89    WNLIQKAASMAIDFAESALASHERKHPLPKTADPRVQIAGNFAPVPEHPVTQNLPIAGKL  148

Query  1755  PDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGL  1576
             P+CI+GVYVRNGANP++ P AGHHLFDGDGMVHA+    GS SYSCRFTET RLVQE+ L
Sbjct  149   PECIDGVYVRNGANPMYEPLAGHHLFDGDGMVHALKFHNGSASYSCRFTETNRLVQEKSL  208

Query  1575  GRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDD  1396
             G+PVFPKAIGELHGHSG+ARLLLFYARGLFGLVD + G G+ANAGLVYFN  LLAMSEDD
Sbjct  209   GKPVFPKAIGELHGHSGIARLLLFYARGLFGLVDGKNGMGVANAGLVYFNNHLLAMSEDD  268

Query  1395  LPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNV  1216
             LPYHVRV PSGDL+TVGRYDFN QLKSTMIAHPKVDP SGE FALSYDV+ KPYLKYF  
Sbjct  269   LPYHVRVTPSGDLKTVGRYDFNGQLKSTMIAHPKVDPVSGELFALSYDVVSKPYLKYFKF  328

Query  1215  KSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSR  1036
                G KS DVEIPL VPTM+HDFAITEN+V++PDQQVVFKL EM++GGS V+Y+K+K SR
Sbjct  329   NKDGTKSKDVEIPLKVPTMMHDFAITENFVVVPDQQVVFKLGEMMKGGSPVVYDKEKVSR  388

Query  1035  FGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENL  856
             FGIL K A +++GI W+E+PE FCFHLWNAWEE ETDE+VVIGSCMTP DSIFNEC+ENL
Sbjct  389   FGILDKNATDSDGIRWIEAPECFCFHLWNAWEEKETDEVVVIGSCMTPADSIFNECDENL  448

Query  855   KSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVS  676
             KS+LSEIRLNLKTG+ST+R II   ++QVNLEAGMVN+N LGRK+Q+AYLA+AEPWPKVS
Sbjct  449   KSVLSEIRLNLKTGKSTRRAII-REEEQVNLEAGMVNKNKLGRKSQFAYLALAEPWPKVS  507

Query  675   GFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIV  496
             GFAKVDLSTGE++K++YGD K+GGEP F+PR+P+S++EDDG+IL+FVHDEK WKSELQ+V
Sbjct  508   GFAKVDLSTGEVKKYIYGDEKFGGEPMFLPRSPSSDREDDGYILAFVHDEKEWKSELQVV  567

Query  495   NAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             NA+ LEL ATI+LPSRVPYGFHGTFI S DL+ Q 
Sbjct  568   NAMTLELEATIELPSRVPYGFHGTFIQSKDLRKQA  602



>gb|AFU91491.1| 9-cis-epoxycarotenoid dioxygenase [Momordica charantia]
Length=589

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/563 (72%), Positives = 466/563 (83%), Gaps = 17/563 (3%)
 Frame = -2

Query  2040  RAKIHCEAAVHSSSVVTLPEQQ-----------LPDGESPAPSQPK-WNllqravaaald  1897
             + ++ C  ++H+ S+V +P+             +    SP+ S P+ WN LQRA + A+D
Sbjct  30    KNRVSC--SLHTPSIVQIPKHSQTFRPPPLKTPVEKPVSPSTSAPEDWNFLQRAASMAID  87

Query  1896  vaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGA  1717
               E AL+S E +RPLPKT DP VQIAGNFAPVPEQ VR  LPV G +P+CI GVYVRNGA
Sbjct  88    AVENALLSAERKRPLPKTADPEVQIAGNFAPVPEQPVRKALPVTGRIPECIRGVYVRNGA  147

Query  1716  NPLFRPKAGHHLFDGDGMVHAVTIT-GGSVSYSCRFTETERLVQERGLGRPVFPKAIGEL  1540
             NPL  P AGHHLFDGDGMVHAV  + GG VSY+CRFTET+RLVQER  GRPVFPKAIGEL
Sbjct  148   NPLHEPAAGHHLFDGDGMVHAVEFSDGGGVSYACRFTETQRLVQERAHGRPVFPKAIGEL  207

Query  1539  HGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGD  1360
             HGHSG+ARLLLFYARGLFGLVDH  G G+ANAGLVYFNGRLLAMSEDDLPY +RV P+GD
Sbjct  208   HGHSGIARLLLFYARGLFGLVDHSHGIGVANAGLVYFNGRLLAMSEDDLPYQIRVTPAGD  267

Query  1359  LETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEI  1180
             L+T+GR+DF+ QLKSTMIAHPK+DP SGE FA+SYDVIQKP+LKYF     GEKSPDVE+
Sbjct  268   LKTIGRFDFDGQLKSTMIAHPKLDPVSGELFAISYDVIQKPHLKYFKFSPEGEKSPDVEV  327

Query  1179  PLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAE  1000
             PL  PTM+HDFAITE +V+IPDQQVVFKL EMIRGGS VIY+K K SRFGIL K A +A 
Sbjct  328   PLPQPTMMHDFAITEKFVVIPDQQVVFKLPEMIRGGSPVIYDKNKISRFGILPKNATDAG  387

Query  999   GIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLK  820
              I W+E+P+ FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNECEENLKS+LSEIRLNL 
Sbjct  388   DIKWIEAPDCFCFHLWNAWEEPETNEVVVIGSCMTPPDSIFNECEENLKSVLSEIRLNLT  447

Query  819   TGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEM  640
             TG+ST+RPIIP T +QVNLEAGMVNRN LGRKTQ+AYLA+AEPWPKVSGFAKVDLSTGE+
Sbjct  448   TGKSTRRPIIPET-EQVNLEAGMVNRNRLGRKTQFAYLALAEPWPKVSGFAKVDLSTGEI  506

Query  639   QKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIK  460
             +K++YG+ +YGGEP F+PR   +E EDDGHIL+FVHDEK WKSELQIVNAI L+L A++K
Sbjct  507   RKYIYGEQRYGGEPLFLPRE-GAEAEDDGHILAFVHDEKEWKSELQIVNAITLKLEASVK  565

Query  459   LPSRVPYGFHGTFITSYDLQNQV  391
             LPSRVPYGFHGTFI S  LQ Q 
Sbjct  566   LPSRVPYGFHGTFIGSKGLQKQT  588



>gb|ADQ74040.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/528 (74%), Positives = 452/528 (86%), Gaps = 0/528 (0%)
 Frame = -2

Query  2004  SSVVTLPEQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQ  1825
             +S ++ P+Q+  +  S + S  KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQ
Sbjct  70    NSTISHPKQENNNSSSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQ  129

Query  1824  IAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTI  1645
             I+GNFAPVPE  V  +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV  
Sbjct  130   ISGNFAPVPENPVCQSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQF  189

Query  1644  TGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRR  1465
               GS SY+CRFTETERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +
Sbjct  190   KNGSASYACRFTETERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSK  249

Query  1464  GTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDP  1285
             GTG+ANAGLVYFN RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP
Sbjct  250   GTGVANAGLVYFNNRLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDP  309

Query  1284  ESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQV  1105
              SGE FALSYDVIQKPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQV
Sbjct  310   VSGELFALSYDVIQKPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQV  369

Query  1104  VFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETD  925
             VFK+ EMIRGGS V+Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE ETD
Sbjct  370   VFKMSEMIRGGSPVVYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPETD  429

Query  924   EIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVN  745
             EIVVIGSCMTPPDSIFNEC+E LKS+LSEIRLNLKT +ST++ II   D+QVNLEAGMVN
Sbjct  430   EIVVIGSCMTPPDSIFNECDEGLKSVLSEIRLNLKTRKSTRKSIIENPDEQVNLEAGMVN  489

Query  744   RNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEK  565
             RN LGRKT+YAYLAIAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++
Sbjct  490   RNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKE  549

Query  564   EDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             EDDG+IL+FVHDEK WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  550   EDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>ref|XP_006370181.1| nine-cis-epoxycarotenoid dioxygenase3 family protein [Populus 
trichocarpa]
 gb|ERP66750.1| nine-cis-epoxycarotenoid dioxygenase3 family protein [Populus 
trichocarpa]
Length=599

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/589 (69%), Positives = 469/589 (80%), Gaps = 25/589 (4%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQL---PDGESPAPS--QPK-----  1936
             LG  S S S+ +P R+  ++   ++ + S++  P+Q     P    P P+   PK     
Sbjct  12    LGSSSFSSSLNRPGRKPNVNINCSLQTPSILHFPKQSTACTPSTTIPNPTTRHPKQNTPS  71

Query  1935  --------------WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVP  1798
                           WN LQR  A ALD  E ALVS E Q PLPKT DP VQI+GNFAPVP
Sbjct  72    PVVVVPQKQQQQKQWNFLQRTAAMALDAVETALVSHERQHPLPKTADPRVQISGNFAPVP  131

Query  1797  EQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSC  1618
             EQ V +NLPV G +PD I GVY+RNGANPL  P AGHH FDGDGMVHAV    GSVSYS 
Sbjct  132   EQPVVHNLPVTGEIPDSIQGVYLRNGANPLHEPVAGHHFFDGDGMVHAVQFNKGSVSYSS  191

Query  1617  RFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGL  1438
             RFTET RLVQER LGRP+FPKAIGELHGHSG+ARLLLFYARG FG+VD   GTG+ANAGL
Sbjct  192   RFTETNRLVQERDLGRPLFPKAIGELHGHSGIARLLLFYARGAFGIVDPSHGTGVANAGL  251

Query  1437  VYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALS  1258
             VYF+G LLAMSEDDLPYHVRV PSGDL+TVGRYDF+ QLK+TMIAHPKVDP SGE FALS
Sbjct  252   VYFDGHLLAMSEDDLPYHVRVLPSGDLKTVGRYDFDGQLKTTMIAHPKVDPVSGELFALS  311

Query  1257  YDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIR  1078
             YDV+QKPYLKYF     G+KSPDVEI LD PTM+HDFAITE +V++PDQQVVFKL EMIR
Sbjct  312   YDVVQKPYLKYFRFSPDGKKSPDVEISLDQPTMMHDFAITERFVVVPDQQVVFKLPEMIR  371

Query  1077  GGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCM  898
             GGS VIY+K K +RFGIL K A +A  + W+E+P+ FCFHLWNAWEE ETDE+VVIGSCM
Sbjct  372   GGSPVIYDKNKMARFGILDKNATDASNMRWIETPDCFCFHLWNAWEEPETDEVVVIGSCM  431

Query  897   TPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQ  718
             TPPDSIFNEC+E+LKS+LSEIRLNLKTG+ST+RPI+   D QVNLEAGMVNRNLLGRKT+
Sbjct  432   TPPDSIFNECDESLKSVLSEIRLNLKTGKSTRRPIMSEAD-QVNLEAGMVNRNLLGRKTR  490

Query  717   YAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSF  538
             +AYLA+AEPWPKVSGFAKVDLSTGE+ K  YGD K+GGEP F+PR+PNSE+EDDG+IL+F
Sbjct  491   FAYLALAEPWPKVSGFAKVDLSTGEVHKHTYGDQKFGGEPLFLPRDPNSEREDDGYILAF  550

Query  537   VHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             VHDEK WKSELQIVNA+NL+L AT+K+PSRVPYGFHGTFI + DL+ Q 
Sbjct  551   VHDEKEWKSELQIVNAMNLKLEATVKIPSRVPYGFHGTFIGAKDLEKQA  599



>gb|ABB52078.1| putative 9-cis epoxycarotenoid dioxygenase [Daucus carota subsp. 
sativus]
Length=573

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/521 (75%), Positives = 446/521 (86%), Gaps = 2/521 (0%)
 Frame = -2

Query  1953  APSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNL  1774
             +P  PKWN+LQ+A A ALD  E A++SRELQ PLPKT DP +QIAGNFAPVPEQ V+ NL
Sbjct  55    SPPIPKWNILQKAAAMALDAVESAIISRELQLPLPKTTDPEIQIAGNFAPVPEQPVKQNL  114

Query  1773  PVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERL  1594
              V G +P+CINGVYVRNGANP F PKAGHHLFDGDGMVHAV    GS SY+CRFTETERL
Sbjct  115   SVSGKIPECINGVYVRNGANPHFEPKAGHHLFDGDGMVHAVQFKNGSASYACRFTETERL  174

Query  1593  VQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLL  1414
             VQER LGRP FPKAIGELHGHSG+ARL LFYARG+FGL+DH+ G G+ANAGLVYFN RLL
Sbjct  175   VQERSLGRPAFPKAIGELHGHSGIARLALFYARGMFGLLDHKHGMGVANAGLVYFNDRLL  234

Query  1413  AMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPY  1234
             AMSEDDLPYHVRV PSGDLET+GRY+F+ QL STMIAHPK+DPE+ E FALSY+VIQKPY
Sbjct  235   AMSEDDLPYHVRVGPSGDLETIGRYNFDGQLDSTMIAHPKIDPETSELFALSYNVIQKPY  294

Query  1233  LKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYE  1054
             LKYF   S G KS DV+I L  PTM+HDFAITEN+V+IPDQQVVFK+ EMI+GGS V+Y+
Sbjct  295   LKYFRFSSDGSKSEDVDIQLSDPTMMHDFAITENFVVIPDQQVVFKMSEMIQGGSPVVYD  354

Query  1053  KKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFN  874
             K K SRFG+L K A +A GI WV+ P+ FCFHLWNAWEE ETDE+VVIGSCMTP DSIFN
Sbjct  355   KNKVSRFGVLDKYASDASGIRWVDVPDCFCFHLWNAWEEKETDEVVVIGSCMTPADSIFN  414

Query  873   ECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAE  694
             EC+E L+S+LSEIRLNLKTG+S ++PI+   D QVNLEAGMVN+N+LGRKTQ+AYLAIAE
Sbjct  415   ECDEGLQSVLSEIRLNLKTGKSIRKPILSCYD-QVNLEAGMVNKNMLGRKTQFAYLAIAE  473

Query  693   PWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWK  514
             PWPKVSGFAKVDLS+G++ KF YGD K+GGEP F P NP+S+ EDDG+IL+FVHDEK W+
Sbjct  474   PWPKVSGFAKVDLSSGQVNKFFYGDEKFGGEPLFFP-NPDSKNEDDGYILAFVHDEKNWE  532

Query  513   SELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             SELQIVNA  LEL A+IKLPSRVPYGFHGTFI++ DL+ Q 
Sbjct  533   SELQIVNAATLELEASIKLPSRVPYGFHGTFISAKDLETQA  573



>gb|ADQ74024.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74026.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74031.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/574 (70%), Positives = 466/574 (81%), Gaps = 18/574 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             + G  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    EFGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPKNNTISHPKQENNNS  83

Query  1938  --------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVR  1783
                     KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V 
Sbjct  84    SSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVC  143

Query  1782  NNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTET  1603
              +LPV G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTET
Sbjct  144   QSLPVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTET  203

Query  1602  ERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNG  1423
             ERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN 
Sbjct  204   ERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNN  263

Query  1422  RLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQ  1243
             RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE +ALSYDVIQ
Sbjct  264   RLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELYALSYDVIQ  323

Query  1242  KPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCV  1063
             KPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V
Sbjct  324   KPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPV  383

Query  1062  IYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDS  883
             +Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE E DEIVVIGSCMTPPDS
Sbjct  384   VYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPERDEIVVIGSCMTPPDS  443

Query  882   IFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLA  703
             IFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLA
Sbjct  444   IFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLA  503

Query  702   IAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEK  523
             IAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK
Sbjct  504   IAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEK  563

Query  522   TWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
              WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   EWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74017.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/574 (70%), Positives = 466/574 (81%), Gaps = 18/574 (3%)
 Frame = -2

Query  2088  DLGLPSKSISM-KKPTRRAKIHCEAAVHSSSVVTLPEQ----QLPDGESPA-PSQP----  1939
             +LG  S SIS+ K    R  ++  +++ +  ++  P+Q    Q P   + + P Q     
Sbjct  24    ELGFASNSISLLKNQHNRQSLNINSSLQAPPILHFPKQSSNYQTPMNSTISHPKQENNNS  83

Query  1938  --------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVR  1783
                     KWNL+Q+A A ALD  E AL   EL+ PLPKT DP VQI+GNFAPVPE  V 
Sbjct  84    SSSSSSTSKWNLVQKAAAMALDAVESALTKHELEHPLPKTADPRVQISGNFAPVPENPVC  143

Query  1782  NNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTET  1603
              +L V G +P C+ GVYVRNGANPLF P AGHH FDGDGMVHAV    GS SY+CRFTET
Sbjct  144   QSLQVTGKIPKCVQGVYVRNGANPLFEPTAGHHFFDGDGMVHAVQFKNGSASYACRFTET  203

Query  1602  ERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNG  1423
             ERLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH +GTG+ANAGLVYFN 
Sbjct  204   ERLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHSKGTGVANAGLVYFNN  263

Query  1422  RLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQ  1243
             RLLAMSEDDLPYHV+V P+GDL+T GR+DF+ QLKSTMIAHPK+DP SGE FALSYDVIQ
Sbjct  264   RLLAMSEDDLPYHVKVTPTGDLKTEGRFDFDGQLKSTMIAHPKLDPVSGELFALSYDVIQ  323

Query  1242  KPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCV  1063
             KPYLKYF    +GEKS DVEIP++ PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V
Sbjct  324   KPYLKYFRFSKNGEKSNDVEIPVEDPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPV  383

Query  1062  IYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDS  883
             +Y+K K SRFGIL K AK+   + WVE P+ FCFHLWNAWEE E DEIVVIGSCMTPPDS
Sbjct  384   VYDKNKVSRFGILDKYAKDGSDLKWVEVPDCFCFHLWNAWEEPERDEIVVIGSCMTPPDS  443

Query  882   IFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLA  703
             IFNEC+E LKS+LSEIRLNLKTG+ST++ II   D+QVNLEAGMVNRN LGRKT+YAYLA
Sbjct  444   IFNECDEGLKSVLSEIRLNLKTGKSTRKSIIENPDEQVNLEAGMVNRNKLGRKTEYAYLA  503

Query  702   IAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEK  523
             IAEPWPKVSGFAKV+L TGE++KF+YGD KYGGEP F+PR+PNS++EDDG+IL+FVHDEK
Sbjct  504   IAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRDPNSKEEDDGYILAFVHDEK  563

Query  522   TWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
              WKSELQIVNA++L+L AT+KLPSRVPYGFHGTF
Sbjct  564   EWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>ref|XP_006442236.1| hypothetical protein CICLE_v10019364mg [Citrus clementina]
 gb|ABC26013.1| 9-cis-epoxycarotenoid dioxygenase 3 [Citrus clementina]
 gb|ESR55476.1| hypothetical protein CICLE_v10019364mg [Citrus clementina]
Length=606

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/531 (75%), Positives = 450/531 (85%), Gaps = 3/531 (1%)
 Frame = -2

Query  1983  EQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAP  1804
             +QQ  + ++ APS  KWN LQ+A A ALD  E ALVS+E Q PLPKT DP VQIAGNF+P
Sbjct  79    KQQPKENDNFAPS--KWNFLQKAAALALDAVENALVSQERQHPLPKTADPTVQIAGNFSP  136

Query  1803  VPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSY  1624
             VPE+ V  NLP  G VPDCI GVYVRNGANPL  P AGHH FDGDGMVHAV    GSVSY
Sbjct  137   VPEKPVCQNLPTTGKVPDCIQGVYVRNGANPLHEPVAGHHFFDGDGMVHAVKFNKGSVSY  196

Query  1623  SCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANA  1444
             SCRFTET R VQER LG PVFPKAIGELHGH+G+ARLLLFY+R LFGLVD   GTG+ANA
Sbjct  197   SCRFTETNRFVQERSLGHPVFPKAIGELHGHTGIARLLLFYSRALFGLVDPSHGTGVANA  256

Query  1443  GLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFA  1264
             GLVYFN RLLAMSEDDLPYHVRV PSGDL+TVGR+DF+ QLKSTMIAHPKVDP +G+ FA
Sbjct  257   GLVYFNNRLLAMSEDDLPYHVRVTPSGDLKTVGRFDFSGQLKSTMIAHPKVDPVTGDLFA  316

Query  1263  LSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEM  1084
             LSYDV++KPYLKYF     G KSPDVEIPL+ PTM+HDFAITEN+V++PDQQVVFKL EM
Sbjct  317   LSYDVVKKPYLKYFRFSPQGIKSPDVEIPLEEPTMMHDFAITENFVVVPDQQVVFKLNEM  376

Query  1083  IRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGS  904
             IRGGS VIY+K K SRFGIL K A +A  + W+++P+ FCFHLWNAWEE E DE+VVIGS
Sbjct  377   IRGGSPVIYDKNKVSRFGILDKNATDASKMKWIDAPDCFCFHLWNAWEEPERDEVVVIGS  436

Query  903   CMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRK  724
             CMTP DSIFNEC+E+LKS+LSEIRLNLKTGEST+RP+I + D+QVNLEAGMVNRNLLGRK
Sbjct  437   CMTPADSIFNECDESLKSVLSEIRLNLKTGESTRRPLI-SEDEQVNLEAGMVNRNLLGRK  495

Query  723   TQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHIL  544
             T++AYLA+AEPWPKVSGFAKVDL TG++ KF+YG  +YGGEP F PR+PNSE EDDG+IL
Sbjct  496   TRFAYLALAEPWPKVSGFAKVDLLTGQVNKFIYGGQRYGGEPLFFPRDPNSENEDDGYIL  555

Query  543   SFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +FVHDEK WKSELQIVNA+ LEL AT+KLPSRVPYGFHGTFI++ DL  Q 
Sbjct  556   AFVHDEKEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISAKDLAKQA  606



>ref|XP_004293530.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
 gb|AFU61914.1| 9-cis-epoxycarotenoid dioxygenase 1 [Fragaria x ananassa]
Length=609

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/582 (69%), Positives = 463/582 (80%), Gaps = 20/582 (3%)
 Frame = -2

Query  2088  DLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQL----------------PDGES  1957
             ++    +S+++    R   +   +A+ S SV+  P+Q                  P   +
Sbjct  32    NMSFTKRSVALN---RNRTVTAHSALQSPSVLNFPKQPYHQQVITKEATSSPSAKPKTAT  88

Query  1956  PAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                  P WN LQRA + ALD+ EGALVSRE + PLPKT DP VQIAGNFAPVPEQ VR++
Sbjct  89    TTQQPPHWNFLQRAASTALDMLEGALVSRESRSPLPKTADPRVQIAGNFAPVPEQPVRHS  148

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P+CI+GVYVRNGANPL  P AGHH FDGDGMVHAV+I  G+ SY+CRFTET+R
Sbjct  149   LPVSGTIPECISGVYVRNGANPLHEPVAGHHFFDGDGMVHAVSINDGAASYACRFTETQR  208

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQER +GRPVFPKAIGELHGHSG+ARL LFYARG  GLVD   G G+ANAGLVYFN RL
Sbjct  209   LVQEREIGRPVFPKAIGELHGHSGIARLALFYARGALGLVDPSHGIGVANAGLVYFNDRL  268

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDD+PY VR+KPSGDLETVGRYDF  QL STMIAHPKVDP S     LSYDV++KP
Sbjct  269   LAMSEDDMPYQVRIKPSGDLETVGRYDFETQLGSTMIAHPKVDPVSSHLHTLSYDVVKKP  328

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF   + GEKSPDVEIPL  PTM+HDFAITEN+V+IPDQQVVFKLQEMI GGS VIY
Sbjct  329   YLKYFQFSADGEKSPDVEIPLAAPTMMHDFAITENFVVIPDQQVVFKLQEMITGGSPVIY  388

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             ++ KKSRFGIL K A NA  IIWVESP+TFCFHLWNAWEE E+DE+VVIGSCMTP DSIF
Sbjct  389   DQNKKSRFGILAKNATNAADIIWVESPDTFCFHLWNAWEEPESDEVVVIGSCMTPADSIF  448

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E+LKS+LSEIRLNLKTGES +RPII      VNLEAGMVNRNLLGRKT+YAYLAIA
Sbjct  449   NECDESLKSVLSEIRLNLKTGESKRRPIISEEADHVNLEAGMVNRNLLGRKTRYAYLAIA  508

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKVDL TGE++K +YGD K+GGEPFF+P +   E ED+G+ILSFVHDEKTW
Sbjct  509   EPWPKVSGFAKVDLFTGEVKKHIYGDRKFGGEPFFLPSSSTGE-EDEGYILSFVHDEKTW  567

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             KSELQIVNA++L++ AT+ LPSRVPYGFHGTFI S  L+NQ 
Sbjct  568   KSELQIVNAVSLKVEATVTLPSRVPYGFHGTFIDSKALKNQA  609



>ref|XP_010062726.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Eucalyptus grandis]
Length=616

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/514 (77%), Positives = 446/514 (87%), Gaps = 1/514 (0%)
 Frame = -2

Query  1935  WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAV  1756
             WN LQRA + ALDV E ALVS E   PLPKT DPGVQIAGNFAPVPE+ V  +LPV G +
Sbjct  103   WNFLQRAASIALDVVESALVSHERTHPLPKTADPGVQIAGNFAPVPERPVARSLPVIGKI  162

Query  1755  PDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGL  1576
             P+CI GVYVRNGANPL  P AGHHLFDGDGM+HAV  +GGSVSY+CRFTET+RL+QERGL
Sbjct  163   PECIRGVYVRNGANPLHEPVAGHHLFDGDGMIHAVRFSGGSVSYACRFTETQRLIQERGL  222

Query  1575  GRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDD  1396
             GRPVFPKAIGELHGHSG+ARL+LFYAR LFGLVDHR G G+ANAGLVYF+G LLAMSEDD
Sbjct  223   GRPVFPKAIGELHGHSGIARLMLFYARSLFGLVDHRNGMGVANAGLVYFDGHLLAMSEDD  282

Query  1395  LPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNV  1216
             LPYHVRV  SGDLETVGRYDF  QL S MIAHPK+DP SGE FALSYDV++KPYLKYF  
Sbjct  283   LPYHVRVTRSGDLETVGRYDFAGQLDSPMIAHPKIDPASGEMFALSYDVVRKPYLKYFRF  342

Query  1215  KSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSR  1036
                GEKSPDVEIPL  PTM+HDFAITE +V+IPDQQVVFKL EMIRGGS VIY+K K +R
Sbjct  343   SKDGEKSPDVEIPLAEPTMMHDFAITERFVVIPDQQVVFKLPEMIRGGSPVIYDKDKVAR  402

Query  1035  FGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENL  856
             FG+L K A +A GI W+E P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIFNE EE+L
Sbjct  403   FGVLDKNASDASGIKWIEVPDCFCFHLWNAWEETETDEIVVIGSCMTPPDSIFNESEESL  462

Query  855   KSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVS  676
             +S+LSEIRLNLKTG+ST+R II A  +Q+NLEAGMVNRNLLGRKT+YAYLA+AEPWPKVS
Sbjct  463   ESVLSEIRLNLKTGKSTRRRII-AESEQINLEAGMVNRNLLGRKTRYAYLALAEPWPKVS  521

Query  675   GFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIV  496
             GFAKVDLSTGE++K+MYG+ +YGGEP FVPR+ +SE+EDDG++L+FVHDEK   SELQIV
Sbjct  522   GFAKVDLSTGEVRKYMYGEERYGGEPMFVPRSRDSEREDDGYVLAFVHDEKERSSELQIV  581

Query  495   NAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             NA+ LEL AT+KLPSRVPYGFHGTFI+S DL+ Q
Sbjct  582   NAVTLELEATVKLPSRVPYGFHGTFISSKDLERQ  615



>gb|ADU85829.1| 9-cis-epoxycarotenoid dioxygenase [Fragaria x ananassa]
Length=609

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/582 (69%), Positives = 466/582 (80%), Gaps = 20/582 (3%)
 Frame = -2

Query  2088  DLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQL----------------PDGES  1957
             ++  P +S+++    R   +   +A+ S SV+  P+Q                  P   +
Sbjct  32    NMSFPKRSVALN---RNRTVTAHSALQSPSVLNFPKQPYHQQVITKEATSSPSAKPKTAT  88

Query  1956  PAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
                  P WN LQRA + ALD+ EGALVSRE + PLPKT DP VQIAGNFAPVPEQ VR++
Sbjct  89    TTQQPPHWNFLQRAASTALDMLEGALVSRESRSPLPKTADPRVQIAGNFAPVPEQPVRHS  148

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             L + G +P+CI+GVYVRNGANPL  P AGHH FDGDGMVHAV+I  G+ SY+CRFTET+R
Sbjct  149   LSISGTIPECISGVYVRNGANPLHEPVAGHHFFDGDGMVHAVSINDGAASYACRFTETQR  208

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQER +GRPVFPKAIGELHGHSG+ARL LFYARG  GLV+  +G G+ANAGLVYFN RL
Sbjct  209   LVQEREIGRPVFPKAIGELHGHSGIARLALFYARGALGLVNPSQGIGVANAGLVYFNDRL  268

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDD+PY VR+ PSGD+ETVGRYDF  QL STMIAHPKVDP SG    LSYD+++ P
Sbjct  269   LAMSEDDMPYQVRITPSGDIETVGRYDFETQLGSTMIAHPKVDPVSGHLHTLSYDIVKMP  328

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF   ++GEKSPDVEIPL  PTM+HDFAITEN+V+IPDQQVVFKLQEMI GGS VIY
Sbjct  329   YLKYFQFSANGEKSPDVEIPLAAPTMMHDFAITENFVVIPDQQVVFKLQEMITGGSPVIY  388

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             ++ KKSRFGIL K A NA+ IIWVESP+TFCFHLWNAWEE E+DE+VVIGSCMTPPDSIF
Sbjct  389   DQNKKSRFGILAKNATNADDIIWVESPDTFCFHLWNAWEEPESDEVVVIGSCMTPPDSIF  448

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E+LKS+LSEIRLNLKTGES +RPII      VNLEAGMVNRNLLGRKT+YAYLAIA
Sbjct  449   NECDESLKSVLSEIRLNLKTGESKRRPIISEEADHVNLEAGMVNRNLLGRKTRYAYLAIA  508

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKVDL TGE++K +YGD K+GGEPFF+P +   E ED+G+ILSFVHDEKTW
Sbjct  509   EPWPKVSGFAKVDLFTGEVKKHIYGDRKFGGEPFFLPSSSTGE-EDEGYILSFVHDEKTW  567

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             KSELQIVNA++L++ AT+ LPSRVPYGFHGTFI S  L+NQ 
Sbjct  568   KSELQIVNAVSLKVEATVTLPSRVPYGFHGTFIDSKALKNQA  609



>gb|AEH41591.1| 9-cis-epoxycarotenoid dioxygenase 1 [Ipomoea nil]
Length=615

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/585 (70%), Positives = 468/585 (80%), Gaps = 30/585 (5%)
 Frame = -2

Query  2067  SISMKKPTR---RAKIHCEAAVHSSSVVTLPEQQ-----LPDGESPA---------PSQP  1939
             S+S +KP+    R KI+C A     SV+  P+Q      +P   S A          ++P
Sbjct  34    SLSPQKPSSQELRLKINCSA----QSVLHFPKQSSAPPTVPTSNSTAITTISCPKEEAKP  89

Query  1938  K---------WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAV  1786
             K         WNLLQR  AAALD  EG L   EL+ PLP+T DP VQIAGNFAPVPEQ V
Sbjct  90    KADSCFSGGGWNLLQRVAAAALDAVEGKLTEHELEHPLPRTADPRVQIAGNFAPVPEQPV  149

Query  1785  RNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTE  1606
              + LPV G +P+CINGVYVRNGANP F P AGHH FDGDGMVHAV    G+ SY+CRFTE
Sbjct  150   CHALPVAGKIPECINGVYVRNGANPHFEPVAGHHFFDGDGMVHAVQFKNGAASYACRFTE  209

Query  1605  TERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFN  1426
             T+RLVQE+ LGRPVFPKAIGELHGHSG+ARL+LFYARG+FGL+DH  GTG+ANAGLVYFN
Sbjct  210   TQRLVQEKALGRPVFPKAIGELHGHSGIARLMLFYARGIFGLLDHSNGTGVANAGLVYFN  269

Query  1425  GRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVI  1246
              RLLAMSEDD+PYHV V PSGDL+TV RYDF+ QLKSTMIAHPK+DP SGE FALSYDVI
Sbjct  270   NRLLAMSEDDIPYHVSVTPSGDLKTVERYDFDGQLKSTMIAHPKLDPVSGELFALSYDVI  329

Query  1245  QKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSC  1066
             QKPYLKYF    +G+KSPDVEIP+  PTM+HDFAITE + I+PDQQVVFK+ EMIRGGS 
Sbjct  330   QKPYLKYFRFSKTGKKSPDVEIPVPDPTMMHDFAITERFFIVPDQQVVFKISEMIRGGSP  389

Query  1065  VIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPD  886
             V+Y+K K SRFG+L K AK+A  + WVE P+ FCFHLWNAWEE ETDEIVVIGSCMTPPD
Sbjct  390   VVYDKNKVSRFGVLNKYAKDASEMKWVEVPDCFCFHLWNAWEEPETDEIVVIGSCMTPPD  449

Query  885   SIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYL  706
             SIFNEC+E LKS+LSEIRLNLKTG+ST++PII    ++VNLEAGMVNRN LGRKT+YAYL
Sbjct  450   SIFNECDEGLKSVLSEIRLNLKTGKSTRKPIIQNPSEEVNLEAGMVNRNKLGRKTRYAYL  509

Query  705   AIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDE  526
             AIAEPWPKVSGFAKVDL TGE++KF+YGD KYGGEP F+PRN +S+ EDDG+IL+FVHDE
Sbjct  510   AIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRNSDSDAEDDGYILAFVHDE  569

Query  525   KTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             KTWKSELQIVN+  L L AT+KLPSRVPYGFHGTFIT+ DL  Q 
Sbjct  570   KTWKSELQIVNSQTLHLEATVKLPSRVPYGFHGTFITATDLSTQA  614



>gb|ABB52079.1| putative 9-cis epoxycarotenoid dioxygenase [Daucus carota subsp. 
sativus]
Length=588

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/575 (68%), Positives = 466/575 (81%), Gaps = 16/575 (3%)
 Frame = -2

Query  2076  PSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAP----SQPK---------  1936
             P + +  +K  R+  ++C  ++ S S++  P+Q     ++P      +QPK         
Sbjct  17    PQREVKSQKAYRKNNVNC--SLQSPSILHFPKQSPHIYQTPCVPTTIAQPKHQDSSSSNQ  74

Query  1935  WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAV  1756
             WN LQ+A + ALD  E  + +RE + PLPKT DP VQIAGNFAPVPEQ VR+ LPV G +
Sbjct  75    WNFLQKAASMALDAVENVIAAREKEHPLPKTADPQVQIAGNFAPVPEQPVRHRLPVTGKI  134

Query  1755  PDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGL  1576
             P+CI+GVYVRNGANP   P AGHH FDGDGMVHAV    G+ SY+CRFTETERL+QER L
Sbjct  135   PECISGVYVRNGANPHLEPTAGHHFFDGDGMVHAVQFKEGAASYACRFTETERLIQERNL  194

Query  1575  GRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDD  1396
             G+PVFPKAIGELHGHSG+ARL LFYARGLFGLVDH +GTG+ANAGLVYFN RLLAMSEDD
Sbjct  195   GKPVFPKAIGELHGHSGIARLALFYARGLFGLVDHSQGTGVANAGLVYFNNRLLAMSEDD  254

Query  1395  LPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNV  1216
             LPYHV +  SGDL+TVGRY+F+ QL +TMIAHPK+DP++ E  ALSY+VIQKPYLKYF V
Sbjct  255   LPYHVEITSSGDLKTVGRYNFDGQLDTTMIAHPKIDPDTKELIALSYNVIQKPYLKYFRV  314

Query  1215  KSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSR  1036
                G KS DV+I L  PTM+HDFAITEN+V+IPDQQVVFK+ EMI+GGS V+Y+K K SR
Sbjct  315   SPDGVKSDDVDIELADPTMMHDFAITENFVVIPDQQVVFKISEMIQGGSPVVYDKNKVSR  374

Query  1035  FGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENL  856
             FG+L K AK+  GI WVE P+ FCFHLWNAWE+ E+DEIVVIGSCMTP DSIFNEC+E L
Sbjct  375   FGVLDKYAKDGSGIKWVEVPDCFCFHLWNAWEDEESDEIVVIGSCMTPADSIFNECDEGL  434

Query  855   KSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVS  676
             +S+LSEIRLNLKTG+ST++PI+ + D QVNLEAGMVN+N LGRKTQ+AYLAIAEPWPKVS
Sbjct  435   QSVLSEIRLNLKTGKSTRKPIMSSED-QVNLEAGMVNKNKLGRKTQFAYLAIAEPWPKVS  493

Query  675   GFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIV  496
             GFAKVDL TG++QKF YGD KYGGEP F+P+NPNSE EDDG+IL+FVHDEK WKSELQIV
Sbjct  494   GFAKVDLFTGQVQKFFYGDHKYGGEPLFLPKNPNSENEDDGYILAFVHDEKAWKSELQIV  553

Query  495   NAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             NA+ LEL AT++LPSRVPYGFHGTFI++ DL++Q 
Sbjct  554   NAMTLELEATVQLPSRVPYGFHGTFISAKDLESQA  588



>gb|ACU86971.1| 9-cis-epoxycarotenoid dioxygenase [Caragana korshinskii]
Length=605

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/587 (68%), Positives = 464/587 (79%), Gaps = 31/587 (5%)
 Frame = -2

Query  2088  DLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGES----------------  1957
             DLG  S SI++KK  +R  I C     S   +  P+Q  P   +                
Sbjct  29    DLG--SNSITLKK--KRTTISC-----SLQTLPFPKQYQPQSTTTTLIPTKEPKPKPSPP  79

Query  1956  ----PAPSQ-PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQ  1792
                 P P Q  KWNLLQ+A A ALD  E  L+SRE Q PLPKT DP VQIAGNFAPVPE 
Sbjct  80    SETKPLPQQQKKWNLLQKAAANALDFVETTLISRERQHPLPKTADPRVQIAGNFAPVPEH  139

Query  1791  AVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRF  1612
                 +LPV G +P CI+GVYVRNGANPL+ P AGHH FDGDGMVHAV  T GSVSYSCRF
Sbjct  140   PATQSLPVTGKIPKCIDGVYVRNGANPLYEPVAGHHFFDGDGMVHAVKFTNGSVSYSCRF  199

Query  1611  TETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVY  1432
             TET RL QE+ LGRPVFPKAIGELHGHSG+ARLLLFYAR +FG+VD   G G+ANAGLVY
Sbjct  200   TETHRLAQEKALGRPVFPKAIGELHGHSGIARLLLFYARSMFGIVDGTHGMGVANAGLVY  259

Query  1431  FNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYD  1252
             FN RLLAMSEDD+PY VRV P+GDL TV RYDFN QLKSTMIAHPK+DP     +ALSYD
Sbjct  260   FNNRLLAMSEDDIPYQVRVTPNGDLTTVCRYDFNGQLKSTMIAHPKLDPVDNNLYALSYD  319

Query  1251  VIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGG  1072
             V+QKPYLKYF   S+G KSPDVEIPL  PTM+HDFAITEN+V++PDQQVVFKL EMIRGG
Sbjct  320   VVQKPYLKYFRFDSNGVKSPDVEIPLAAPTMMHDFAITENFVVVPDQQVVFKLAEMIRGG  379

Query  1071  SCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTP  892
             S V+Y K+K SRFG+L K A +A GI W+++P+ FCFHLWNAWEE E DE+VVIGSCMTP
Sbjct  380   SPVVYNKEKVSRFGVLSKNASDASGIKWIDAPDCFCFHLWNAWEEPENDEVVVIGSCMTP  439

Query  891   PDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYA  712
              DSIFNEC+E+LKS+LSEIRLNLKTG+ST+R II  + + VNLEAGMVNRN LGRKTQ+A
Sbjct  440   ADSIFNECDESLKSVLSEIRLNLKTGKSTRRAIIKES-EHVNLEAGMVNRNKLGRKTQFA  498

Query  711   YLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVH  532
             YLA+AEPWPKVSGFAKVDL +GE++K++YG+G++GGEP F+PR+PNSE+EDDG+IL+FVH
Sbjct  499   YLALAEPWPKVSGFAKVDLFSGEVKKYLYGEGRFGGEPLFLPRDPNSEREDDGYILTFVH  558

Query  531   DEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             DEK WKSELQIVNA+NL+L A+IKLPSRVPYGFHGTFI S DL+ Q 
Sbjct  559   DEKEWKSELQIVNAMNLKLEASIKLPSRVPYGFHGTFIHSNDLRKQA  605



>ref|XP_011012661.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Populus euphratica]
Length=603

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/592 (68%), Positives = 468/592 (79%), Gaps = 29/592 (5%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQL---------------PDGESPA  1951
             LG  S S S+ +P R+  ++   ++ + S++  P+Q                 P   +P+
Sbjct  12    LGSSSFSSSLNRPGRKPNVNINCSLQTPSILHFPKQSTACTPSTTFPNPTTGHPKQNTPS  71

Query  1950  P-------------SQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNF  1810
             P              + +WN  QR  A ALD  E ALVS E Q PLPKT DP VQI+GNF
Sbjct  72    PVVVVPQKQQQKQQQEKQWNFFQRTAAMALDAVETALVSHERQHPLPKTADPRVQISGNF  131

Query  1809  APVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSV  1630
             APVPEQ V +NLPV G +PD I GVY+RNGANPL  P AGHH FDGDGMVHAV    GSV
Sbjct  132   APVPEQPVVHNLPVTGEIPDSIQGVYLRNGANPLHEPVAGHHFFDGDGMVHAVQFNKGSV  191

Query  1629  SYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLA  1450
             SYS RFTET RLVQER LGRP+FPKAIGELHGHSG+ARLLLFYARG FG+VD   GTG+A
Sbjct  192   SYSSRFTETNRLVQERDLGRPLFPKAIGELHGHSGIARLLLFYARGAFGIVDPSPGTGVA  251

Query  1449  NAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEF  1270
             NAGLVYF+G LLAMSEDDLPYHVRV PSGDL+TVGRYDF+ QLK+TMIAHPKVDP SGE 
Sbjct  252   NAGLVYFDGHLLAMSEDDLPYHVRVLPSGDLKTVGRYDFDGQLKTTMIAHPKVDPVSGEL  311

Query  1269  FALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQ  1090
             FALSYDV+QKPYLKYF      +KSPDVEI LD PTM+HDFAITE +V++PDQQVVFKL 
Sbjct  312   FALSYDVVQKPYLKYFRFSPDEKKSPDVEISLDQPTMMHDFAITERFVVVPDQQVVFKLS  371

Query  1089  EMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVI  910
             EMIRGGS VIY+K K +RFG+L K A +A  + W+E+P+ FCFHLWNAWEE ETDE+VVI
Sbjct  372   EMIRGGSPVIYDKNKMARFGVLDKNATDASNMRWIETPDCFCFHLWNAWEEPETDEVVVI  431

Query  909   GSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLG  730
             GSCMTPPDSIFNEC+E+LKS+LSEIRLNLKTG+ST+RPI+   D QVNLEAGMVNRNLLG
Sbjct  432   GSCMTPPDSIFNECDESLKSVLSEIRLNLKTGKSTRRPIMSEAD-QVNLEAGMVNRNLLG  490

Query  729   RKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGH  550
             RKT++AYLA+AEPWPKVSGFAKVDLSTGE+ K  YGD K+GGEP F+PR+P+SE+EDDG+
Sbjct  491   RKTRFAYLALAEPWPKVSGFAKVDLSTGEVHKHTYGDQKFGGEPLFLPRDPHSEREDDGY  550

Query  549   ILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             IL+FVHDEK WKSELQIVNA+NL+L AT+K+PSRVPYGFHGTFI + DL+ Q
Sbjct  551   ILAFVHDEKEWKSELQIVNAMNLKLEATVKIPSRVPYGFHGTFIGAKDLEKQ  602



>ref|XP_006415513.1| hypothetical protein EUTSA_v10007160mg [Eutrema salsugineum]
 gb|ESQ33866.1| hypothetical protein EUTSA_v10007160mg [Eutrema salsugineum]
Length=589

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/569 (70%), Positives = 465/569 (82%), Gaps = 4/569 (1%)
 Frame = -2

Query  2091  VDLGLPSKSISMK--KPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqr  1918
             +D   PS S+S    KP RR K+   +   S +++  P    P+   P  +   WN LQR
Sbjct  23    LDAPSPSSSVSFTNTKPRRR-KLSANSVTDSPALLNFPNYPSPNPIIPEKNTSHWNPLQR  81

Query  1917  avaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCING  1738
             A +AALD AE AL+SRE  +PLPKT DP  QI+GN+APVPEQ V+++L V G +PDCI+G
Sbjct  82    AASAALDFAEAALLSRERSQPLPKTVDPRHQISGNYAPVPEQPVKSSLSVTGKIPDCIDG  141

Query  1737  VYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFP  1558
             VY+RNGANPLF P +GHHLFDGDGMVHAV IT G  SYSCRFTETERLVQE+ LG P+FP
Sbjct  142   VYLRNGANPLFEPVSGHHLFDGDGMVHAVKITNGDASYSCRFTETERLVQEKRLGSPIFP  201

Query  1557  KAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVR  1378
             KAIGELHGHSG+ARL+LFYARGLFGL++HR GTG+ANAGLVYF+ RLLAMSEDDLPY VR
Sbjct  202   KAIGELHGHSGIARLMLFYARGLFGLLNHRNGTGVANAGLVYFHDRLLAMSEDDLPYQVR  261

Query  1377  VKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEK  1198
             V  +GDLETVGR+DF+ QL S MIAHPK+DPE+ E FALSYDV++KPYLKYF     GEK
Sbjct  262   VTDNGDLETVGRFDFDGQLNSAMIAHPKIDPETKELFALSYDVVKKPYLKYFRFSPGGEK  321

Query  1197  SPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKK  1018
             SPDVEIPL  PTM+HDFAITEN+V+IPDQQVVFKL +M  G S V Y+ +K SRFGIL +
Sbjct  322   SPDVEIPLASPTMMHDFAITENFVVIPDQQVVFKLSDMFLGKSPVKYDGEKVSRFGILPR  381

Query  1017  TAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSE  838
              AK+A  +IWVESPETFCFHLWNAWE  ETDE+VVIGSCMTP DSIFNEC+E L S+LSE
Sbjct  382   NAKDATEMIWVESPETFCFHLWNAWESPETDEVVVIGSCMTPADSIFNECDEQLNSVLSE  441

Query  837   IRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVD  658
             IRLNLKTG+ST+R IIP +  Q+NLEAGMVNRNLLGRKT+YAYLAIAEPWPKVSGFAKVD
Sbjct  442   IRLNLKTGKSTRRTIIPGS-VQMNLEAGMVNRNLLGRKTRYAYLAIAEPWPKVSGFAKVD  500

Query  657   LSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLE  478
             LSTGE++  +YG  KYGGEPFF+PR   S+ EDDG+I+SFVHDE++WKSELQIVNA+ LE
Sbjct  501   LSTGEVKNHIYGGKKYGGEPFFLPRGLESDGEDDGYIMSFVHDEESWKSELQIVNAVTLE  560

Query  477   LLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             L AT+KLPSRVPYGFHGTF+ S D+ NQ 
Sbjct  561   LEATVKLPSRVPYGFHGTFVNSADMLNQA  589



>gb|AAS47838.1| 9-cis-epoxycarotenoid dioxygenase [Gentiana lutea]
Length=604

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/564 (70%), Positives = 461/564 (82%), Gaps = 15/564 (3%)
 Frame = -2

Query  2040  RAKIHCEAAVHSSSVVTLPEQQLPDGESPAP-------------SQPKWNllqravaaal  1900
             RA+ +   ++ + S++  P Q  P   + A              S PK NLLQRA + A+
Sbjct  42    RAQKNINCSLQTPSLLNFPTQTPPSTLTSAANYQTLTPTPTPTPSAPKLNLLQRAASMAM  101

Query  1899  dvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNG  1720
             D  E AL +REL+ PLPKT DP VQIAGNFAPVPEQ VR+ LPV G +PD I G YVRNG
Sbjct  102   DAVESALNARELKHPLPKTADPKVQIAGNFAPVPEQPVRHRLPVTGKIPDSIQGAYVRNG  161

Query  1719  ANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGEL  1540
             ANPLF P AGHH FDGDGM+HAV    GS SYSCRFTET+RLVQER +GRP+FPKAIGEL
Sbjct  162   ANPLFEPAAGHHFFDGDGMIHAVQFENGSASYSCRFTETQRLVQERAVGRPLFPKAIGEL  221

Query  1539  HGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGD  1360
             HGHSG+ARL LFYARGLFGL+DH +G G+ANAGLVYFN RLLAMSEDDLPYHVR+ PSGD
Sbjct  222   HGHSGIARLGLFYARGLFGLLDHTQGLGVANAGLVYFNNRLLAMSEDDLPYHVRITPSGD  281

Query  1359  LETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEI  1180
             L+T GR++F+ QLKSTMIAHPK+DP SGE FALSYDVIQKPYLKYF    +GEKS DV+I
Sbjct  282   LKTEGRFNFDGQLKSTMIAHPKLDPVSGELFALSYDVIQKPYLKYFRFSQNGEKSEDVDI  341

Query  1179  PLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAE  1000
             P+  PTM+HDFAITEN+V+IPDQQVVFK+ EMIRGGS V+++K K SRFG+L K AK+A 
Sbjct  342   PVSEPTMMHDFAITENFVVIPDQQVVFKMSEMIRGGSPVVHDKNKVSRFGVLDKYAKDAS  401

Query  999   GIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEEN-LKSILSEIRLNL  823
             GI W+E P+ FCFHLWN+WEE ETDEIVVIGSCMTPPDSIFNE EE  L+S+LSEIRLN+
Sbjct  402   GIKWIEVPDCFCFHLWNSWEEPETDEIVVIGSCMTPPDSIFNESEEEGLESVLSEIRLNM  461

Query  822   KTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGE  643
             KTGEST+R I+ + D QVNLEAGMVNRN+LGRKT+YAYLAIAEPWPKVSGFAKVDL +GE
Sbjct  462   KTGESTRRAILSSKD-QVNLEAGMVNRNILGRKTRYAYLAIAEPWPKVSGFAKVDLFSGE  520

Query  642   MQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATI  463
             ++KF YGD KYGGEP F+P + NSE EDDGHIL+FVH+EKT KSEL+IVNA+ LE  AT+
Sbjct  521   VKKFFYGDEKYGGEPLFLPNDSNSEVEDDGHILAFVHNEKTSKSELRIVNAMTLEEEATV  580

Query  462   KLPSRVPYGFHGTFITSYDLQNQV  391
             KLPSRVPYGFHGTF+++ DL+NQ 
Sbjct  581   KLPSRVPYGFHGTFMSAKDLENQA  604



>ref|XP_004147768.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Cucumis sativus]
Length=594

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/580 (69%), Positives = 464/580 (80%), Gaps = 21/580 (4%)
 Frame = -2

Query  2079  LPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQ--------------  1942
             +P K +S     R   +   +++H+ S++ +P+       SP  +               
Sbjct  18    MPDKKLSNYTTNRLLSV--SSSLHTPSIIQIPKHSHTTFPSPLQTSIPKPPPLTTTPPVS  75

Query  1941  --PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPV  1768
                 WN LQRA A ALD  E AL+S E +  LPKT DP VQIAGNFAPVPEQ VR  LPV
Sbjct  76    GSQDWNFLQRAAAMALDAVENALISAERKHSLPKTADPAVQIAGNFAPVPEQPVRKGLPV  135

Query  1767  DGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTIT-GGSVSYSCRFTETERLV  1591
              G VPD I GVYVRNGANPL  P +GHHLFDGDGMVHAV  +  G VSY+CRFTET+RLV
Sbjct  136   IGKVPDHIRGVYVRNGANPLHEPLSGHHLFDGDGMVHAVEFSEAGGVSYACRFTETQRLV  195

Query  1590  QERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLA  1411
             QER  GRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH  G G+ANAGLVYFNGRLLA
Sbjct  196   QERAYGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHNHGIGVANAGLVYFNGRLLA  255

Query  1410  MSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYL  1231
             MSEDDLPY +RV P+GDL+TVGR++F+ QL+STMIAHPK+DP SGE FALSYDVIQKPYL
Sbjct  256   MSEDDLPYQIRVTPAGDLKTVGRFNFDGQLESTMIAHPKLDPVSGEMFALSYDVIQKPYL  315

Query  1230  KYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEK  1051
             KYF     GEKSPDVEIPL  PTM+HDFAITE YV+IPDQQVVFKL EMIRGGS V+Y+K
Sbjct  316   KYFKFSPEGEKSPDVEIPLPQPTMMHDFAITEKYVVIPDQQVVFKLPEMIRGGSPVVYDK  375

Query  1050  KKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNE  871
             +K SRFGIL K A +A  I W+E+P+ FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE
Sbjct  376   EKTSRFGILDKNATDANAIKWIEAPDCFCFHLWNAWEEPETNEVVVIGSCMTPPDSIFNE  435

Query  870   CEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEP  691
             CEENLKS+LSEIRLNL TG+ST+RPII  T +QVNLEAGMVNRNLLGRKTQ++YLA+AEP
Sbjct  436   CEENLKSVLSEIRLNLSTGKSTRRPIITET-EQVNLEAGMVNRNLLGRKTQFSYLALAEP  494

Query  690   WPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKS  511
             WPKVSGFAKVD+ +GE++K++YG+ +YGGEP F+PR   +E EDDGHIL+FVHDEK WKS
Sbjct  495   WPKVSGFAKVDVLSGEVKKYLYGEQRYGGEPLFLPRE-GAEAEDDGHILAFVHDEKEWKS  553

Query  510   ELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             ELQIVNA+ LEL AT+KLPSRVPYGFHGTFI+  DLQ Q+
Sbjct  554   ELQIVNAMTLELEATVKLPSRVPYGFHGTFISCKDLQKQI  593



>ref|XP_004167844.1| PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxycarotenoid dioxygenase 
NCED1, chloroplastic-like [Cucumis sativus]
Length=594

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/580 (69%), Positives = 464/580 (80%), Gaps = 21/580 (4%)
 Frame = -2

Query  2079  LPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQ--------------  1942
             +P K +S     R   +   +++H+ S++ +P+       SP  +               
Sbjct  18    MPDKKLSNYTTNRLLSV--SSSLHTPSIIQIPKHSHTTFPSPLQTSIPKPPPLTTTPPVS  75

Query  1941  --PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPV  1768
                 WN LQRA A ALD  E AL+S E +  LPKT DP VQIAGNFAPVPEQ VR  LPV
Sbjct  76    GSQDWNFLQRAAAMALDAVENALISAERKHSLPKTADPAVQIAGNFAPVPEQPVRKGLPV  135

Query  1767  DGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTIT-GGSVSYSCRFTETERLV  1591
              G VPD I GVYVRNGANPL  P +GHHLFDGDGMVHAV  +  G VSY+CRFTET+RLV
Sbjct  136   IGKVPDHIRGVYVRNGANPLHEPLSGHHLFDGDGMVHAVEFSEAGGVSYACRFTETQRLV  195

Query  1590  QERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLA  1411
             QER  GRPVFPKAIGELHGHSG+ARL+LFYARGLFGLVDH  G G+ANAGLVYFNGRLLA
Sbjct  196   QERAYGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHNHGIGVANAGLVYFNGRLLA  255

Query  1410  MSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYL  1231
             MSEDDLPY +RV P+GDL+TVGR++F+ QL+STMIAHPK+DP SGE FALSYDVIQKPYL
Sbjct  256   MSEDDLPYQIRVTPAGDLKTVGRFNFDGQLESTMIAHPKLDPVSGEMFALSYDVIQKPYL  315

Query  1230  KYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEK  1051
             KYF     GEKSPDVEIPL  PTM+HDFAITE YV+IPDQQVVFKL EMIRGGS V+Y+K
Sbjct  316   KYFKFSPEGEKSPDVEIPLPQPTMMHDFAITEKYVVIPDQQVVFKLPEMIRGGSPVVYDK  375

Query  1050  KKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNE  871
             +K SRFGIL K A +A  I W+E+P+ FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE
Sbjct  376   EKXSRFGILDKNATDANAIKWIEAPDCFCFHLWNAWEEPETNEVVVIGSCMTPPDSIFNE  435

Query  870   CEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEP  691
             CEENLKS+LSEIRLNL TG+ST+RPII  T +QVNLEAGMVNRNLLGRKTQ++YLA+AEP
Sbjct  436   CEENLKSVLSEIRLNLSTGKSTRRPIITET-EQVNLEAGMVNRNLLGRKTQFSYLALAEP  494

Query  690   WPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKS  511
             WPKVSGFAKVD+ +GE++K++YG+ +YGGEP F+PR   +E EDDGHIL+FVHDEK WKS
Sbjct  495   WPKVSGFAKVDVLSGEVKKYLYGEQRYGGEPLFLPRE-GAEAEDDGHILAFVHDEKEWKS  553

Query  510   ELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             ELQIVNA+ LEL AT+KLPSRVPYGFHGTFI+  DLQ Q+
Sbjct  554   ELQIVNAMTLELEATVKLPSRVPYGFHGTFISCKDLQKQI  593



>emb|CAE00459.2| 9-cis-epoxycarotenoid dioxygenase [Arachis hypogaea]
Length=601

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/515 (75%), Positives = 446/515 (87%), Gaps = 1/515 (0%)
 Frame = -2

Query  1935  WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAV  1756
             WNL+Q+A A A+D AE AL S E + PLPKT DP VQIAGNFAPVPE    ++LP+ G +
Sbjct  88    WNLIQKAAAMAIDFAESALASHERRHPLPKTADPRVQIAGNFAPVPEHPSTHSLPIAGKL  147

Query  1755  PDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGL  1576
             P+CI+GVYVRNGANP++ P AGHHLFDGDGMVHAV    GS SYSCRFTET RLVQE+ L
Sbjct  148   PECIDGVYVRNGANPMYEPLAGHHLFDGDGMVHAVKFHNGSASYSCRFTETNRLVQEKSL  207

Query  1575  GRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDD  1396
             G+PVFPKAIGELHGHSG+ARLLLFYARGLFGLVD + G G+ANAGLVYFN RLLAMSEDD
Sbjct  208   GKPVFPKAIGELHGHSGIARLLLFYARGLFGLVDGKNGMGVANAGLVYFNNRLLAMSEDD  267

Query  1395  LPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNV  1216
             LPYHVRV P+GDL+TVGRYDFN QLKSTMIAHPKVDP SGE FALSYDV+ KPYLKYF  
Sbjct  268   LPYHVRVTPNGDLKTVGRYDFNGQLKSTMIAHPKVDPVSGELFALSYDVVSKPYLKYFKF  327

Query  1215  KSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSR  1036
                G KS DV+IPL VPTM+HDFAITEN+V++PDQQVVFKL EM+RGGS V+Y+K+K SR
Sbjct  328   NKDGTKSKDVDIPLKVPTMMHDFAITENFVVVPDQQVVFKLGEMMRGGSPVVYDKEKVSR  387

Query  1035  FGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENL  856
             FGIL K A +++GI W+E+PE FCFHLWNAWEE ETDE+VVIGSCMTP DSIFNEC+ENL
Sbjct  388   FGILDKNATDSDGIRWIEAPECFCFHLWNAWEEKETDEVVVIGSCMTPADSIFNECDENL  447

Query  855   KSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVS  676
             KS+LSEIRLNLKTG+ST+R II   ++QVNLEAGMVN++ LGRKTQ+AYLA+AEPWPKVS
Sbjct  448   KSVLSEIRLNLKTGKSTRRAII-REEEQVNLEAGMVNKSKLGRKTQFAYLALAEPWPKVS  506

Query  675   GFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIV  496
             GFAKVDLS+GE++K+MYG  K+GGEP F+PR+  SE+EDDG+IL+FVHDEK W+SELQ+V
Sbjct  507   GFAKVDLSSGEVKKYMYGGEKFGGEPMFLPRSAWSEREDDGYILAFVHDEKEWRSELQVV  566

Query  495   NAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             NA+ LEL ATI+LPSRVPYGFHGTFI S DL+ Q 
Sbjct  567   NAMTLELEATIELPSRVPYGFHGTFIQSKDLRKQA  601



>gb|AHJ80777.1| 9-cis-epoxicarotenoid dioxygenase 1 protein [Citrus reshni]
Length=606

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/531 (74%), Positives = 447/531 (84%), Gaps = 3/531 (1%)
 Frame = -2

Query  1983  EQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAP  1804
             +QQ  + ++ APS  KWN LQ+  A ALD  E ALVS+E Q P PKT DP VQIAGNF+P
Sbjct  79    KQQPKENDNFAPS--KWNFLQKTAALALDAVENALVSQERQHPFPKTADPTVQIAGNFSP  136

Query  1803  VPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSY  1624
             VPE+ V  NLP  G VPDCI GVYVRNGANPL  P AGHH FDGDGMVHAV    GSVSY
Sbjct  137   VPEKPVCQNLPTTGKVPDCIQGVYVRNGANPLHEPVAGHHFFDGDGMVHAVQFNKGSVSY  196

Query  1623  SCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANA  1444
             SCRFTET R VQER LGRPV PKAIGELHGH+G+ARLLLFY+R LFGLVD   GTG+ANA
Sbjct  197   SCRFTETNRFVQERSLGRPVIPKAIGELHGHTGIARLLLFYSRALFGLVDPSHGTGVANA  256

Query  1443  GLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFA  1264
             GLVYFN RLLAMSEDDLPYHVRV PSG+L+TVGR+DF+ QLKSTMIAHPKVDP +G+ FA
Sbjct  257   GLVYFNNRLLAMSEDDLPYHVRVTPSGELKTVGRFDFSGQLKSTMIAHPKVDPVTGDLFA  316

Query  1263  LSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEM  1084
             LSYDV++KPYLKYF     G KSPDVEIPL+ PTM+HDFAITEN+V++PDQQVVFKL+EM
Sbjct  317   LSYDVVKKPYLKYFQFSPQGIKSPDVEIPLEEPTMMHDFAITENFVVVPDQQVVFKLKEM  376

Query  1083  IRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGS  904
             I+GGS VIY+K K SRFGIL K A +A  + W+++P+ FCFHLWNAWEE E DE+VVIGS
Sbjct  377   IQGGSPVIYDKNKVSRFGILDKNATDASKMKWIDAPDCFCFHLWNAWEEPERDEVVVIGS  436

Query  903   CMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRK  724
             CMTP DSIFNEC+E+LKS+LSEIRLNL+TGEST+RPII + D+QVNLEAGMVNRNLLGRK
Sbjct  437   CMTPADSIFNECDESLKSVLSEIRLNLRTGESTRRPII-SEDEQVNLEAGMVNRNLLGRK  495

Query  723   TQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHIL  544
             T++AYLA+AEPWPKVSGFAKVDL TG++ KF YG  +YGGEP F PR+PNSE EDDG+ L
Sbjct  496   TRFAYLALAEPWPKVSGFAKVDLLTGQVNKFTYGGQRYGGEPLFFPRDPNSENEDDGYTL  555

Query  543   SFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +FVHDE+ WKSELQIVNA+ LEL AT+KLPSRVPYGFHGTFI++ DL  Q 
Sbjct  556   AFVHDEEEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISAKDLAKQA  606



>ref|XP_010552176.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Tarenaya hassleriana]
Length=592

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/567 (71%), Positives = 462/567 (81%), Gaps = 7/567 (1%)
 Frame = -2

Query  2079  LPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQP---KWNllqrava  1909
             L   SI M +   +  +   +++H+ SV+  P+Q      +P  S+    + NL Q+A A
Sbjct  29    LGCSSIPMTRTKHKPSV--SSSLHTPSVLHFPKQSSSPVVAPTTSKESDRELNLFQKAAA  86

Query  1908  aaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYV  1729
              ALD AE  LV+ E + PLPKT DP VQIAGNFAPV EQ VR NLPV G +PDCI GVY+
Sbjct  87    GALDAAESFLVNHERKHPLPKTADPHVQIAGNFAPVEEQPVRRNLPVVGRIPDCIKGVYI  146

Query  1728  RNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAI  1549
             RNGANPL  P AGHH FDGDGMVHAV    GSVSY+CRFT+T RLV ER LGRPVFPKAI
Sbjct  147   RNGANPLHEPVAGHHFFDGDGMVHAVQFEEGSVSYACRFTQTNRLVHERELGRPVFPKAI  206

Query  1548  GELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKP  1369
             GELHGH+G+ARL+LFYAR + GLVD   GTG+ANAGLVYFNGRLLAMSEDDLPYHVR+ P
Sbjct  207   GELHGHTGIARLMLFYARAMVGLVDPSHGTGVANAGLVYFNGRLLAMSEDDLPYHVRITP  266

Query  1368  SGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPD  1189
             +GDL+TVGRYDF  QLKSTMIAHPKVDPESGE FALSYDV+ KPYLKYF     G+KSPD
Sbjct  267   TGDLKTVGRYDFEGQLKSTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGKKSPD  326

Query  1188  VEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAK  1009
             VEI LD PTM+HDFAITEN+V+IPDQQVVFKL EMIRGGS V+Y+K K SRFGIL K A 
Sbjct  327   VEINLDQPTMMHDFAITENFVVIPDQQVVFKLPEMIRGGSPVVYDKNKISRFGILDKCAI  386

Query  1008  NAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRL  829
             ++ GI W+E+P+ FCFHLWNAWEE ETDE+VVIGSCM+PPDSIFNE EENLKS+LSEIRL
Sbjct  387   DSSGIRWIEAPDCFCFHLWNAWEEPETDEVVVIGSCMSPPDSIFNESEENLKSVLSEIRL  446

Query  828   NLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLST  649
             NLKTGES +RPII +  +QVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDLST
Sbjct  447   NLKTGESNRRPII-SEHEQVNLEAGMVNRNMLGRKTRFAYLALAEPWPKVSGFAKVDLST  505

Query  648   GEMQKFMYGDGKYGGEPFFVPRNPNSE-KEDDGHILSFVHDEKTWKSELQIVNAINLELL  472
             GE++K++YG+ +YGGEP F PR+ + E +EDDG+IL FVHDEKTWKSELQIVNA+ LEL 
Sbjct  506   GEVKKYLYGEDRYGGEPLFFPRDGSPENQEDDGYILCFVHDEKTWKSELQIVNAMTLELE  565

Query  471   ATIKLPSRVPYGFHGTFITSYDLQNQV  391
             AT+KLPSRVPYGFHGTFI + D   Q 
Sbjct  566   ATVKLPSRVPYGFHGTFIGASDTAKQA  592



>gb|EYU26242.1| hypothetical protein MIMGU_mgv1a025212mg [Erythranthe guttata]
Length=580

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/523 (73%), Positives = 441/523 (84%), Gaps = 5/523 (1%)
 Frame = -2

Query  1950  PSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLP  1771
             P Q +WN+LQ+A A A D  E AL + EL+RPLPKT DPGVQIAGNF+PVPE  V + L 
Sbjct  60    PPQSQWNILQKAAAMAFDAVETALTAHELRRPLPKTADPGVQIAGNFSPVPEHPVEHGLT  119

Query  1770  VDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLV  1591
             V G +PD I GVYVRNGANPLF P AGHH FDGDGM+HAV   GG+ SY+CRFTET+RL 
Sbjct  120   VAGKIPDSIRGVYVRNGANPLFEPAAGHHFFDGDGMIHAVKFDGGAASYACRFTETQRLA  179

Query  1590  QERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLA  1411
             QER LGRP+FPKAIGELHGHSG+ARLLLFYARGLF LVDHR G G+ANAGLVY N RLLA
Sbjct  180   QERALGRPIFPKAIGELHGHSGIARLLLFYARGLFDLVDHRHGAGVANAGLVYHNNRLLA  239

Query  1410  MSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYL  1231
             MSEDDLPYHVRV P+GDL+TV RY F  QL +TMIAHPKVDP +GE FALSYDV+QKPYL
Sbjct  240   MSEDDLPYHVRVTPAGDLQTVERYSFAGQLNTTMIAHPKVDPTTGEMFALSYDVVQKPYL  299

Query  1230  KYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEK  1051
             KYF    +GEKS DVEIP+  PTM+HDFAITEN+VIIPDQQVVFK+ EMIRGGS V+Y+K
Sbjct  300   KYFKFSKTGEKSADVEIPVSEPTMMHDFAITENFVIIPDQQVVFKMSEMIRGGSPVVYDK  359

Query  1050  KKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNE  871
              K +RFG+L K A+N++GI W+E P+ FCFHLWN+WEE E+DEIVVIGSCMTPPDSIFNE
Sbjct  360   NKTARFGVLDKYAENSDGIKWIEVPDCFCFHLWNSWEEPESDEIVVIGSCMTPPDSIFNE  419

Query  870   CEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEP  691
             C+E LKS+LSEIRLNL+TG+ST+RPI+   D QVNLEAGMVNRN LGRKT++AYLAIAEP
Sbjct  420   CDEGLKSVLSEIRLNLRTGKSTRRPIVSEVD-QVNLEAGMVNRNKLGRKTRFAYLAIAEP  478

Query  690   WPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDD---GHILSFVHDEKT  520
             WPKVSGFAKVDLS G++ KF YGD KYGGEP F+P+  NS+ + D   G+IL+FVHDEKT
Sbjct  479   WPKVSGFAKVDLSNGDVSKFFYGDEKYGGEPLFLPKE-NSDSDSDCEEGYILAFVHDEKT  537

Query  519   WKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             WKSELQIVNA+ +EL AT++LPSRVPYGFHGTFI+S DL+ Q 
Sbjct  538   WKSELQIVNALTMELEATVELPSRVPYGFHGTFISSKDLETQA  580



>ref|XP_004300667.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
 gb|AFU61915.1| 9-cis-epoxycarotenoid dioxygenase 2 [Fragaria x ananassa]
Length=619

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/538 (73%), Positives = 452/538 (84%), Gaps = 9/538 (2%)
 Frame = -2

Query  1986  PEQQLPDGESPAPSQP-----KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQI  1822
             P+ Q P   S + S+P     +WNL QR  A A+D  E ALVS+EL+ PLPKT DP VQI
Sbjct  85    PKDQKPLTSSSSNSKPVVQPQQWNLFQRVAAMAIDAMESALVSKELEHPLPKTADPKVQI  144

Query  1821  AGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTI-  1645
             AGNFAPVPEQ V+++LPV G +P+CI GVYVRNGANPL  P AGHHLFDGDGMVHA++  
Sbjct  145   AGNFAPVPEQPVKHSLPVTGKIPECIRGVYVRNGANPLHEPVAGHHLFDGDGMVHALSFN  204

Query  1644  TGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRR  1465
             + GS SY+CRFTET R+VQER LGRP+FPKAIGELHGHSG+ARL LFY RG  GLVD   
Sbjct  205   SDGSASYACRFTETHRMVQERALGRPMFPKAIGELHGHSGIARLALFYLRGACGLVDPSH  264

Query  1464  GTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDP  1285
             G G+ANAGLVYFNGRLLAMSEDDLPYHVRV  +GDL+T GRYDFNDQLKSTMIAHPKVDP
Sbjct  265   GLGVANAGLVYFNGRLLAMSEDDLPYHVRVTKTGDLKTEGRYDFNDQLKSTMIAHPKVDP  324

Query  1284  ESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQV  1105
              +GE FALSYDV+QKPYLKYF    +G KSPDVEIPL  PTM+HDFAITE +V+IPDQQV
Sbjct  325   ATGELFALSYDVVQKPYLKYFKFSPNGTKSPDVEIPLAQPTMMHDFAITERFVVIPDQQV  384

Query  1104  VFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETD  925
             VF L EMIRGGS VIY+K K +RFGIL K A +A GI WVE+P+ FCFHLWNAWEE +TD
Sbjct  385   VFNLPEMIRGGSPVIYDKNKVARFGILDKNASDASGIRWVEAPDCFCFHLWNAWEEPDTD  444

Query  924   EIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVN  745
             E+VVIGSCMTPPDSIFNEC+E L+S+LSEIRLNLKTG+ST+RPI     +Q+NLEAGMVN
Sbjct  445   EVVVIGSCMTPPDSIFNECDECLESVLSEIRLNLKTGKSTRRPI---CSEQMNLEAGMVN  501

Query  744   RNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEK  565
             RN LGRKT++AYLA+AEPWPKVSGFAKVDL TGE++K +YG+ ++GGEP F+PR+PNSE 
Sbjct  502   RNKLGRKTRFAYLALAEPWPKVSGFAKVDLFTGEVKKHIYGEQRFGGEPLFLPRDPNSEN  561

Query  564   EDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             EDDG+IL+FVHDEK WKSELQIVNA+ L+L A+IKLPSRVPYGFHGTFI+S DLQ Q 
Sbjct  562   EDDGYILAFVHDEKEWKSELQIVNAMTLKLEASIKLPSRVPYGFHGTFISSKDLQKQA  619



>ref|XP_010549494.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Tarenaya hassleriana]
Length=595

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/570 (69%), Positives = 466/570 (82%), Gaps = 12/570 (2%)
 Frame = -2

Query  2067  SISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPD-----------GESPAPSQPKWNllq  1921
             S++  KP RR +     A++S +++  P+Q  P+             S +   P WNLLQ
Sbjct  27    SLANTKPRRRKQTQTRCALNSPTLIQFPKQPYPNPIITEKPPPSSSSSSSSYPPHWNLLQ  86

Query  1920  ravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCIN  1741
             RA A ALD+A+ AL+SRE  +P+PKT DP  QIAGN+APVPEQ++R +LPV G +PDCI+
Sbjct  87    RAAATALDLAQSALLSRERSKPIPKTVDPRHQIAGNYAPVPEQSLRRSLPVSGVIPDCID  146

Query  1740  GVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVF  1561
             G Y+RNGANPL  P +GHHLFDGDGMVHAV I+GG  SYSCRFT TERLVQE+ LG PVF
Sbjct  147   GFYLRNGANPLLEPVSGHHLFDGDGMVHAVKISGGEASYSCRFTRTERLVQEKELGCPVF  206

Query  1560  PKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHV  1381
             PKAIGELHGHSG+ARL+LFYARGLFGL++H+ G G+ANAGLVYF+ RLLAMSEDDLPY V
Sbjct  207   PKAIGELHGHSGIARLMLFYARGLFGLLNHQNGMGVANAGLVYFHDRLLAMSEDDLPYQV  266

Query  1380  RVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGE  1201
             RV  +GDLETVGRYDF+ QLKS MIAHPK+DPE+ E FALSYDV++KPYLKYF     GE
Sbjct  267   RVTVNGDLETVGRYDFDGQLKSAMIAHPKIDPETKELFALSYDVVKKPYLKYFRFSPEGE  326

Query  1200  KSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILK  1021
             KSPDVEIPL  PTM+HDFAITEN+V+IPD QVVFK+ +M+ G S V Y+K+K SRFGIL 
Sbjct  327   KSPDVEIPLASPTMMHDFAITENFVVIPDHQVVFKIGDMVLGKSPVSYDKEKISRFGILP  386

Query  1020  KTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILS  841
             K A++A GIIW+ESPETFCFHLWNAWE  ETDE+VVIGSCMTP DSIFN+ +ENL S+LS
Sbjct  387   KNAEDASGIIWIESPETFCFHLWNAWESPETDEVVVIGSCMTPADSIFNDSDENLSSVLS  446

Query  840   EIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKV  661
             EIRLNLKTG+ST+RP+IP ++ Q+NLEAGMVNRN LGRKT++AYLAI EPWP+VSGFAKV
Sbjct  447   EIRLNLKTGKSTRRPVIPGSN-QMNLEAGMVNRNRLGRKTRFAYLAITEPWPRVSGFAKV  505

Query  660   DLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINL  481
             DL TGE + + YG  KYGGEP+FVPR  +S+ EDDG+ILSFVHDEKTWKSELQI+NA+NL
Sbjct  506   DLLTGESKNYFYGGKKYGGEPYFVPRGLDSDGEDDGYILSFVHDEKTWKSELQIINAVNL  565

Query  480   ELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             E  AT+KLPSRVPYGFHGTF+ S D+ NQ 
Sbjct  566   ERAATVKLPSRVPYGFHGTFVNSSDIVNQA  595



>dbj|BAF42336.1| 9-cis-epoxycarotenoid dioxygenase [Raphanus sativus]
Length=597

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/495 (76%), Positives = 419/495 (85%), Gaps = 0/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E Q PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD INGVYVRNGANPL  P 
Sbjct  103   SHEKQHPLPKTADPSVQIAGNFAPVNEQPVRRNLPVVGKIPDSINGVYVRNGANPLHEPV  162

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SYSCRFT+T R VQER LGRPVFPKAIGELHGH+G+AR
Sbjct  163   TGHHFFDGDGMVHAVKFEDGSASYSCRFTQTNRFVQERQLGRPVFPKAIGELHGHTGIAR  222

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   GLVD   GTG+ANAGLVYFN RLLAMSEDDLPY VR+ P GDL+TVGRYD
Sbjct  223   LMLFYARAAAGLVDPAHGTGVANAGLVYFNNRLLAMSEDDLPYQVRITPGGDLKTVGRYD  282

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             FN QL STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVEIPLD PTM+
Sbjct  283   FNGQLGSTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEIPLDQPTMM  342

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDF ITEN V+IPDQQVVFKLQEMIRGGS VIY+++K +RFGIL K A ++  I W+E+P
Sbjct  343   HDFVITENLVVIPDQQVVFKLQEMIRGGSPVIYDEEKVARFGILDKYAADSSEIRWIEAP  402

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
               FCFHLWNAWEEAETDE+VVIGSCMTPPDSIFNE +E+LKS+LSEIRLNL+TGEST+RP
Sbjct  403   GCFCFHLWNAWEEAETDEVVVIGSCMTPPDSIFNESDESLKSVLSEIRLNLRTGESTRRP  462

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   ++QVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDLSTGE++K +YGDG
Sbjct  463   IISDGEEQVNLEAGMVNRNMLGRKTEFAYLALAEPWPKVSGFAKVDLSTGEVKKHLYGDG  522

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+P       EDDGHIL FVHDEKTWKSELQIVNA++LE+ AT+KLPSRVPYG
Sbjct  523   RYGGEPLFLPGEEGEGAEDDGHILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYG  582

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  QV
Sbjct  583   FHGTFIGANDLAKQV  597



>gb|AAY89370.1| 9-cis-epoxycarotenoid dioxygenase 1 [Citrus sinensis]
Length=605

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/531 (74%), Positives = 447/531 (84%), Gaps = 4/531 (1%)
 Frame = -2

Query  1983  EQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAP  1804
             +QQ  + ++ APS  KWN LQ+A A ALD  E ALVS+E Q PLPKT DP VQIAGNF+P
Sbjct  79    KQQPKENDNFAPS--KWNFLQKAAALALDAVENALVSQERQHPLPKTADPTVQIAGNFSP  136

Query  1803  VPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSY  1624
             VPE+ V  NLP  G VPDCI GVYVRNGANPL  P AGHH FDGDGMVHAV    GSVSY
Sbjct  137   VPEKPVCQNLPTTGKVPDCIQGVYVRNGANPLHEPVAGHHFFDGDGMVHAVKFNKGSVSY  196

Query  1623  SCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANA  1444
             SCRFTET R  QER LGRPVFPKAIGELHGH+G+A +LLFY+R LFGLVD   GTG+ANA
Sbjct  197   SCRFTETNRFAQERSLGRPVFPKAIGELHGHTGIA-MLLFYSRALFGLVDPSHGTGVANA  255

Query  1443  GLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFA  1264
             GLVYFN RLLAMSEDDLPYHVRV PSG+L+TVGR+DF+ QLKSTMIAHPKVDP +G+ FA
Sbjct  256   GLVYFNNRLLAMSEDDLPYHVRVTPSGELKTVGRFDFSGQLKSTMIAHPKVDPVTGDLFA  315

Query  1263  LSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEM  1084
             LSYDV++KPYLKYF     G KSPDVEIPL+ PTM+HDFAITEN+V++PDQQVVFKL EM
Sbjct  316   LSYDVVKKPYLKYFQFSPQGIKSPDVEIPLEEPTMMHDFAITENFVVVPDQQVVFKLNEM  375

Query  1083  IRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGS  904
             IRGGS VIY+K K SRFGIL K A +A  + W+++P+ FCFHLWNAWEE E DE+VVIGS
Sbjct  376   IRGGSPVIYDKNKVSRFGILDKNATDASKMKWIDAPDCFCFHLWNAWEEPERDEVVVIGS  435

Query  903   CMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRK  724
             CMTP DSIFNEC+E+LKS+LSEIRLNLKTGEST+RPII + D+QVNLEAGMVNRNLLGRK
Sbjct  436   CMTPADSIFNECDESLKSVLSEIRLNLKTGESTRRPII-SEDEQVNLEAGMVNRNLLGRK  494

Query  723   TQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHIL  544
             T++AYLA+AEPWPKVSGFAKVDL TG++ KF+YGD +YGGEP F  R+PNSE EDDG+IL
Sbjct  495   TRFAYLALAEPWPKVSGFAKVDLLTGQVNKFIYGDQRYGGEPLFFSRDPNSENEDDGYIL  554

Query  543   SFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +FVHDEK WKSEL IVNA+ LEL AT+KLPSRVPYGFHGTFI + DL  Q 
Sbjct  555   AFVHDEKEWKSELPIVNAMTLELEATVKLPSRVPYGFHGTFIGAKDLAKQA  605



>ref|XP_008226239.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Prunus mume]
Length=622

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/527 (74%), Positives = 443/527 (84%), Gaps = 3/527 (1%)
 Frame = -2

Query  1971  PDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQ  1792
             P  +S  P   +WN LQRA A ALD  E AL+ +E Q PLPKT DP VQIAGNFAPVPE 
Sbjct  99    PSSKSSKPVPQQWNFLQRAAAMALDAMESALLLKEQQHPLPKTADPKVQIAGNFAPVPEH  158

Query  1791  AVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRF  1612
              V ++LPV G +P  I GVYVRNGANPL  P AGHH FDGDGMVHA+    G+ SY+CRF
Sbjct  159   PVEHSLPVTGKIPASIQGVYVRNGANPLHEPVAGHHFFDGDGMVHALQFKDGAASYACRF  218

Query  1611  TETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVY  1432
             TET R  QER LGRP+FPKAIGELHGHSG+ARLLLFYARG+FGLVD   G G+ANAGLVY
Sbjct  219   TETHRFSQERDLGRPLFPKAIGELHGHSGIARLLLFYARGMFGLVDPTHGIGVANAGLVY  278

Query  1431  FNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYD  1252
             FNGRLLAMSEDDLPYHV++  +GDL+TVGRYDF+ QLKSTMIAHPKVDP +GE FALSYD
Sbjct  279   FNGRLLAMSEDDLPYHVKITETGDLKTVGRYDFDKQLKSTMIAHPKVDPNTGELFALSYD  338

Query  1251  VIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGG  1072
             V+Q+PYLKYF V   GEKSPDVEI LD PTM+HDFAITE YV+IPDQQVVFKLQEMI GG
Sbjct  339   VVQRPYLKYFKVSPDGEKSPDVEINLDQPTMMHDFAITERYVVIPDQQVVFKLQEMITGG  398

Query  1071  SCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTP  892
             S VIY+K K SRFGIL K A+++ GI WV+ P+ FCFHLWNAWEE ETDE+VVIGSCMTP
Sbjct  399   SPVIYDKNKMSRFGILDKNAEDSSGIRWVDCPDCFCFHLWNAWEETETDEVVVIGSCMTP  458

Query  891   PDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYA  712
             PDSIFNEC+E L+S+LSEIRLNLKTG+ST+R I     + VNLEAGMVNRN LGRKT++A
Sbjct  459   PDSIFNECDEKLESVLSEIRLNLKTGKSTRRRIC---SENVNLEAGMVNRNKLGRKTRFA  515

Query  711   YLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVH  532
             YLA+AEPWPKVSGFAKVDLSTGE++K +YGD KYGGEP F+PR+PNSE EDDG+IL+FVH
Sbjct  516   YLALAEPWPKVSGFAKVDLSTGEVKKHIYGDEKYGGEPLFLPRDPNSENEDDGYILAFVH  575

Query  531   DEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +EK WKSELQIVNA++L++ ATI+LPSRVPYGFHGTFI+S DL+ Q 
Sbjct  576   NEKEWKSELQIVNAMDLKVEATIQLPSRVPYGFHGTFISSKDLEKQA  622



>ref|XP_009115186.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Brassica rapa]
Length=588

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/571 (69%), Positives = 459/571 (80%), Gaps = 9/571 (2%)
 Frame = -2

Query  2088  DLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAP-----SQPKWNll  1924
             DL  PS S S+     +++        ++SV   P    P+  SP P         WN L
Sbjct  22    DLDAPSPSSSVSYTNTKSR---RRKFSTNSVTDSPALLFPNYPSPKPIILEKDTSHWNPL  78

Query  1923  qravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCI  1744
             QRA +AA D AE AL+SRE  +PLPKT DP  QI+GN+APVPEQ+V+++L V G +PDCI
Sbjct  79    QRAASAAFDFAEAALLSRERSQPLPKTVDPRHQISGNYAPVPEQSVKSSLSVTGKIPDCI  138

Query  1743  NGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPV  1564
             +GVY+RNGANPLF P +GHHLFDGDGMVHAV IT G  SYSCRFTETERLVQE+ LG P+
Sbjct  139   DGVYLRNGANPLFEPVSGHHLFDGDGMVHAVKITNGDASYSCRFTETERLVQEKRLGSPI  198

Query  1563  FPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYH  1384
             FPKAIGELHGH+G+ARL+LFYARGLFGL++HR GTG+ANAGLVYF+ RLLAMSEDDLPY 
Sbjct  199   FPKAIGELHGHTGIARLMLFYARGLFGLLNHRNGTGVANAGLVYFHDRLLAMSEDDLPYQ  258

Query  1383  VRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSG  1204
             VRV   GDLETVGR+DF+ QL S MIAHPK+DPE+ E FALSYDV++KPYLKYF     G
Sbjct  259   VRVTDDGDLETVGRFDFDGQLNSAMIAHPKIDPETKELFALSYDVVKKPYLKYFRFSPEG  318

Query  1203  EKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGIL  1024
             EKSPDVEIPL  PTM+HDFAITEN+V+IPDQQVVFKL +M  G S V Y+ +K SRFGIL
Sbjct  319   EKSPDVEIPLASPTMMHDFAITENFVVIPDQQVVFKLADMFLGKSPVKYDGEKVSRFGIL  378

Query  1023  KKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSIL  844
              K A++A  +IWVESP+TFCFHLWNAWE  ETDE+VVIGSCMTP DSIFNEC+E L S+L
Sbjct  379   PKNAEDASEMIWVESPDTFCFHLWNAWESPETDEVVVIGSCMTPADSIFNECDEQLNSVL  438

Query  843   SEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAK  664
             SEIRLNLKTG+ST+R IIP +  Q+NLEAGMVNRN LGRKT+YAYLAIAEPWPKVSGFAK
Sbjct  439   SEIRLNLKTGKSTRRTIIPGS-VQMNLEAGMVNRNFLGRKTRYAYLAIAEPWPKVSGFAK  497

Query  663   VDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAIN  484
             VDLSTGE++   YGD KYGGEPFF+PR   S+ EDDG+I+SFVHDE+ WKSELQIVNA+ 
Sbjct  498   VDLSTGEVKNHFYGDKKYGGEPFFLPRGLESDGEDDGYIMSFVHDEEGWKSELQIVNAVT  557

Query  483   LELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             LEL ATIKLPSRVPYGFHGTF+ S D+ NQ 
Sbjct  558   LELEATIKLPSRVPYGFHGTFVNSADMLNQA  588



>gb|KDP27683.1| hypothetical protein JCGZ_19722 [Jatropha curcas]
Length=589

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/579 (69%), Positives = 458/579 (79%), Gaps = 25/579 (4%)
 Frame = -2

Query  2067  SISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQ------------------  1942
             SIS+ +P+R+  + C  ++ + S++  P+Q       P  S                   
Sbjct  14    SISIGRPSRKPNVTC--SLQTPSILHFPKQSTRTATYPPSSAISTSTTSNPINKSSSTDI  71

Query  1941  ---PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLP  1771
                P+WNLLQ+A +  LD  E  LVS E + PLPKT DP VQI+GNFAPVPEQ V  +LP
Sbjct  72    SVPPEWNLLQKAASMVLDKVENVLVSHERKYPLPKTADPTVQISGNFAPVPEQPVVRDLP  131

Query  1770  VDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLV  1591
             V G +PD I GVY+RNGANPL  P  GHH FDGDGMVHAV    GSVSY+CRFTET RLV
Sbjct  132   VTGKIPDSIRGVYLRNGANPLHEPVTGHHFFDGDGMVHAVRFEEGSVSYACRFTETNRLV  191

Query  1590  QERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLA  1411
             QER LGRP+FPKAIGELHGHSG+ARLLLFYARG+F +VD   G G+ANAGLVYFNGRLLA
Sbjct  192   QERKLGRPIFPKAIGELHGHSGIARLLLFYARGIFDIVDPSHGLGVANAGLVYFNGRLLA  251

Query  1410  MSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYL  1231
             MSEDDLPYHVRV P GDL+TVGRY+FN QLKSTMIAHPKVDP SGE FALSYDV+QKPYL
Sbjct  252   MSEDDLPYHVRVLPCGDLKTVGRYNFNGQLKSTMIAHPKVDPFSGELFALSYDVVQKPYL  311

Query  1230  KYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEK  1051
             KYF     G KS DVEI LD PTMIHDFAITE +V+IPDQQ+VFKL EMIRGGS VIY++
Sbjct  312   KYFRFSPIGTKSKDVEISLDEPTMIHDFAITEKFVVIPDQQLVFKLPEMIRGGSPVIYDE  371

Query  1050  KKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNE  871
              K SRFGIL K A ++  I W+E+P+ FCFHLWNAWEE E+DEIVVIGSCMTPPDSIFNE
Sbjct  372   NKISRFGILDKKANDSSKIRWIEAPDCFCFHLWNAWEEPESDEIVVIGSCMTPPDSIFNE  431

Query  870   CEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEP  691
             C+E+LKS+LSEIRLNLKTG+S +RPII +   QVNLEAGMVNRNLLGRKTQ+AYLA+AEP
Sbjct  432   CDESLKSVLSEIRLNLKTGKSIRRPII-SDKHQVNLEAGMVNRNLLGRKTQFAYLALAEP  490

Query  690   WPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKS  511
             WPKVSGFAKVDLSTGE +K++YGD KYGGEP F+P + NS KEDDG IL FVHDEK WKS
Sbjct  491   WPKVSGFAKVDLSTGETKKYIYGDNKYGGEPLFLP-DSNSGKEDDGFILCFVHDEKEWKS  549

Query  510   ELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             ELQIVNA NL+L AT+KLPSRVPYGFHGTFIT+ DL+ Q
Sbjct  550   ELQIVNAKNLQLEATVKLPSRVPYGFHGTFITAKDLEKQ  588



>emb|CDY26294.1| BnaA09g26450D [Brassica napus]
Length=589

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/569 (69%), Positives = 457/569 (80%), Gaps = 4/569 (1%)
 Frame = -2

Query  2088  DLGLPSKSISM---KKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqr  1918
             DL  PS S S+      +RR K    +   S +++  P    P           WN LQR
Sbjct  22    DLDAPSPSSSVCYTNTKSRRRKFSTNSVTDSPALLNFPNYPSPKPIILEKDTSNWNPLQR  81

Query  1917  avaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCING  1738
             A +AA D+AE AL+SRE  +PLPKT DP  QI+GN+APVPEQ+V+++L V G +PDCI+G
Sbjct  82    AASAAFDLAEAALLSRERSQPLPKTVDPRHQISGNYAPVPEQSVKSSLSVTGKIPDCIDG  141

Query  1737  VYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFP  1558
             VY+RNGANPLF P +GHHLFDGDGMVHAV IT G  SYSCRFTETERLVQE+ LG P+FP
Sbjct  142   VYLRNGANPLFEPVSGHHLFDGDGMVHAVKITNGDASYSCRFTETERLVQEKRLGSPIFP  201

Query  1557  KAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVR  1378
             KAIGELHGH+G+ARL+LFYARGLFGL++HR GTG+ANAGLVYF+ RLLAMSEDDLPY VR
Sbjct  202   KAIGELHGHTGIARLMLFYARGLFGLLNHRNGTGVANAGLVYFHDRLLAMSEDDLPYQVR  261

Query  1377  VKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEK  1198
             V   GDLETVGR+DF+ QL S MIAHPK+DPE+ E FALSYDV++KPYLKYF     GEK
Sbjct  262   VTDDGDLETVGRFDFDGQLNSAMIAHPKIDPETKELFALSYDVVKKPYLKYFRFSPEGEK  321

Query  1197  SPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKK  1018
             SPDVEIPL  PTM+HDFAITEN+V+IPDQQVVFKL +M  G S V Y+ +K SRFGIL K
Sbjct  322   SPDVEIPLASPTMMHDFAITENFVVIPDQQVVFKLSDMFLGKSPVKYDGEKVSRFGILPK  381

Query  1017  TAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSE  838
              A++A  +IWVESP+TFCFHLWNAWE  ETDE VVIGSCMTP DSIFNEC+E L S+LSE
Sbjct  382   NAEDASEMIWVESPDTFCFHLWNAWESPETDEAVVIGSCMTPADSIFNECDEQLNSVLSE  441

Query  837   IRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVD  658
             IRLNLKTG+ST+R IIP +  Q+NLEAGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVD
Sbjct  442   IRLNLKTGKSTRRTIIPGS-VQMNLEAGMVNRNFLGRKTRYAYLAIAEPWPKVSGFAKVD  500

Query  657   LSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLE  478
             LSTGE++   YGD KYGGEPFF+PR   S+ EDDG+I+SFVHDE+ WKSELQIVNA+ LE
Sbjct  501   LSTGEVKNHFYGDKKYGGEPFFLPRGLESDGEDDGYIMSFVHDEEGWKSELQIVNAVTLE  560

Query  477   LLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             L ATIKLPSRVPYGFHGTF+ S D+ NQ 
Sbjct  561   LEATIKLPSRVPYGFHGTFVNSADMLNQA  589



>ref|NP_174302.1| 9-cis-epoxycarotenoid dioxygenase [Arabidopsis thaliana]
 sp|Q9C6Z1.1|NCED5_ARATH RecName: Full=Probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic; Short=AtNCED5; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG50855.1|AC074176_4 9-cis-epoxycarotenoid dioxygenase, putative [Arabidopsis thaliana]
 dbj|BAE98872.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31178.1| 9-cis-epoxycarotenoid dioxygenase [Arabidopsis thaliana]
Length=589

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/569 (69%), Positives = 463/569 (81%), Gaps = 4/569 (1%)
 Frame = -2

Query  2091  VDLGLPSKSISMK--KPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqr  1918
             +D   PS S+S    KP RR K+   +   + +++  P    P+   P     +WN LQR
Sbjct  23    LDAPSPSSSVSFTNTKPRRR-KLSANSVSDTPNLLNFPNYPSPNPIIPEKDTSRWNPLQR  81

Query  1917  avaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCING  1738
             A +AALD AE AL+ RE  +PLPKT DP  QI+GN+APVPEQ+V+++L VDG +PDCI+G
Sbjct  82    AASAALDFAETALLRRERSKPLPKTVDPRHQISGNYAPVPEQSVKSSLSVDGKIPDCIDG  141

Query  1737  VYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFP  1558
             VY+RNGANPLF P +GHHLFDGDGMVHAV IT G  SYSCRFTETERLVQE+ LG P+FP
Sbjct  142   VYLRNGANPLFEPVSGHHLFDGDGMVHAVKITNGDASYSCRFTETERLVQEKQLGSPIFP  201

Query  1557  KAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVR  1378
             KAIGELHGHSG+ARL+LFYARGLFGL++H+ GTG+ANAGLVYF+ RLLAMSEDDLPY VR
Sbjct  202   KAIGELHGHSGIARLMLFYARGLFGLLNHKNGTGVANAGLVYFHDRLLAMSEDDLPYQVR  261

Query  1377  VKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEK  1198
             V  +GDLET+GR+DF+ QL S MIAHPK+DP + E FALSYDV++KPYLKYF     GEK
Sbjct  262   VTDNGDLETIGRFDFDGQLSSAMIAHPKIDPVTKELFALSYDVVKKPYLKYFKFSPEGEK  321

Query  1197  SPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKK  1018
             SPDVEIPL  PTM+HDFAITEN+V+IPDQQVVFKL +M  G S V Y+ +K SRFGIL +
Sbjct  322   SPDVEIPLASPTMMHDFAITENFVVIPDQQVVFKLSDMFLGKSPVKYDGEKISRFGILPR  381

Query  1017  TAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSE  838
              AK+A  ++WVESPETFCFHLWNAWE  ETDE+VVIGSCMTP DSIFNEC+E L S+LSE
Sbjct  382   NAKDASEMVWVESPETFCFHLWNAWESPETDEVVVIGSCMTPADSIFNECDEQLNSVLSE  441

Query  837   IRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVD  658
             IRLNLKTG+ST+R IIP +  Q+NLEAGMVNRNLLGRKT+YAYLAIAEPWPKVSGFAKVD
Sbjct  442   IRLNLKTGKSTRRTIIPGS-VQMNLEAGMVNRNLLGRKTRYAYLAIAEPWPKVSGFAKVD  500

Query  657   LSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLE  478
             LSTGE++   YG  KYGGEPFF+PR   S+ EDDG+I+SFVHDE++W+SEL IVNA+ LE
Sbjct  501   LSTGEVKNHFYGGKKYGGEPFFLPRGLESDGEDDGYIMSFVHDEESWESELHIVNAVTLE  560

Query  477   LLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             L AT+KLPSRVPYGFHGTF+ S D+ NQ 
Sbjct  561   LEATVKLPSRVPYGFHGTFVNSADMLNQA  589



>emb|CDY61838.1| BnaCnng38510D [Brassica napus]
Length=589

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/568 (69%), Positives = 458/568 (81%), Gaps = 2/568 (0%)
 Frame = -2

Query  2091  VDLGLPSKSIS-MKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqra  1915
             +D   PS S+S     +RR K    +   S +++T P    P+   P      WN LQRA
Sbjct  23    LDAPSPSSSVSYTNTKSRRRKFSTNSVTDSPALLTFPNYPSPNPIIPEKDTSHWNPLQRA  82

Query  1914  vaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGV  1735
              +AA D AE AL+SRE  +PLPKT DP  QI+GN+APVPEQ+V+++L V G +PDCI+GV
Sbjct  83    ASAAFDFAEAALLSRERSQPLPKTVDPRHQISGNYAPVPEQSVKSSLSVTGKIPDCIDGV  142

Query  1734  YVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPK  1555
             Y+RNGANPLF P +GHHLFDGDGMVHAV IT G  SYSCRFTETERLVQE+ LG P++PK
Sbjct  143   YLRNGANPLFEPVSGHHLFDGDGMVHAVKITNGDASYSCRFTETERLVQEKRLGSPIYPK  202

Query  1554  AIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRV  1375
             AIGELHGH+G+ARL+LFYARGLFGL++HR GTG+ANAGLVYF+ RLLAMSEDDLPY VRV
Sbjct  203   AIGELHGHTGIARLMLFYARGLFGLLNHRNGTGVANAGLVYFHDRLLAMSEDDLPYQVRV  262

Query  1374  KPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKS  1195
                GDLETVGR+DF+ QL S MIAHPK+DPE+ E FALSYDV++KPYLKYF     GEKS
Sbjct  263   TDDGDLETVGRFDFDGQLNSAMIAHPKIDPETKELFALSYDVVKKPYLKYFRFSPEGEKS  322

Query  1194  PDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKT  1015
             PDVEIPL  PTM+HDFAITEN+V+IPDQQVVFKL +M  G S V Y+ +K SRF IL K 
Sbjct  323   PDVEIPLASPTMMHDFAITENFVVIPDQQVVFKLSDMFLGKSPVKYDGEKVSRFAILPKN  382

Query  1014  AKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEI  835
             A++A  +IWVESP+TFCFHLWNAWE  ETDE+VVIGSCMTP DSIFNEC+E L S+LSEI
Sbjct  383   AEDASEMIWVESPDTFCFHLWNAWESPETDEVVVIGSCMTPADSIFNECDEQLNSVLSEI  442

Query  834   RLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDL  655
             RLNLKTG+ST+R IIP +  Q+NLEAGMVNRN LGRKT+YAYLAIAE WPKVSGFAKVDL
Sbjct  443   RLNLKTGKSTRRTIIPGS-VQMNLEAGMVNRNFLGRKTRYAYLAIAELWPKVSGFAKVDL  501

Query  654   STGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLEL  475
             STGE++   YG  KYGGEPFF+PR   S+ EDDG+I+SFVHDE++WKSELQIVNA+ LEL
Sbjct  502   STGEVKNHFYGYKKYGGEPFFLPRGLESDGEDDGYIMSFVHDEESWKSELQIVNAVTLEL  561

Query  474   LATIKLPSRVPYGFHGTFITSYDLQNQV  391
              AT+KLPSRVPYGFHGTF+ S D+ NQ 
Sbjct  562   EATVKLPSRVPYGFHGTFVNSADMVNQA  589



>gb|ABB52080.1| putative 9-cis epoxycarotenoid dioxygenase [Daucus carota subsp. 
sativus]
Length=588

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/578 (68%), Positives = 458/578 (79%), Gaps = 19/578 (3%)
 Frame = -2

Query  2076  PSKSISMKKPTRRAKIHCEAAVHSS-SVVTLPEQ-----QLPD----------GESPAPS  1945
             P+   S +   R+  ++C  A+ SS S++  P+Q     Q P            +S + +
Sbjct  14    PNIYSSQRDSPRKTNVNC--AIQSSPSILHFPKQSKQKYQTPSIPTTIVQPKHQDSSSSA  71

Query  1944  QPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVD  1765
              PKWN LQ+A + ALD  E  ++S+E   PLPKT DP VQI+GNFAPV EQ V+++LPV 
Sbjct  72    TPKWNFLQKAASMALDAVENIIISQEQSHPLPKTADPQVQISGNFAPVQEQPVQHHLPVT  131

Query  1764  GAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQE  1585
             G +P+CI+GVYVRNGANP F P  GHH FDGDGMVHAV    G  SY+CR+TETERL+QE
Sbjct  132   GKIPECISGVYVRNGANPHFEPTGGHHFFDGDGMVHAVKFKDGEASYACRYTETERLIQE  191

Query  1584  RGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMS  1405
             R LGR VFPKAIGELHGHSG+ARL LFYARGLFGLVDH +GTG+ANAGLVYFN RLLAMS
Sbjct  192   RNLGRTVFPKAIGELHGHSGIARLALFYARGLFGLVDHSQGTGVANAGLVYFNNRLLAMS  251

Query  1404  EDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKY  1225
             EDDLPYHV++ P GDL TV RY F+ QL STMIAHPK+DPE+ E  AL+Y+VIQKPYLKY
Sbjct  252   EDDLPYHVQITPKGDLRTVERYSFDGQLDSTMIAHPKIDPETNELIALTYNVIQKPYLKY  311

Query  1224  FNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKK  1045
             F V   G KS DV+I L  PTM+HDFAITEN+V+IPDQQVVFK+ EMI+GGS V+Y+K+K
Sbjct  312   FRVSPDGVKSSDVDIELADPTMMHDFAITENFVVIPDQQVVFKISEMIQGGSPVVYDKEK  371

Query  1044  KSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECE  865
              SRFG+L K AK+  GI WVE P+ FCFHLWNAWE+ E+DEIVVIGSCMTP DSIFNEC+
Sbjct  372   VSRFGVLDKYAKDGSGIKWVEVPDCFCFHLWNAWEDKESDEIVVIGSCMTPADSIFNECD  431

Query  864   ENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWP  685
             E L+S+LSEIRLNLKTG+ST+R II   D QVNLEAGMVN N LGRKTQ+AYLAIAEPWP
Sbjct  432   EGLESVLSEIRLNLKTGKSTRRAIISPED-QVNLEAGMVNINKLGRKTQFAYLAIAEPWP  490

Query  684   KVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSEL  505
             KVSGFAKVDL  GE++KF YGD KYGGEP F+PRNPNSE EDDG+IL+FVHDEK WKSEL
Sbjct  491   KVSGFAKVDLFNGEIKKFFYGDNKYGGEPLFLPRNPNSENEDDGYILAFVHDEKAWKSEL  550

Query  504   QIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             QIVNA+ LEL AT+KLPSRVPYGFHGTFI+  DL+ Q 
Sbjct  551   QIVNAMTLELEATVKLPSRVPYGFHGTFISEKDLEKQA  588



>ref|XP_007214657.1| hypothetical protein PRUPE_ppa002804mg [Prunus persica]
 gb|EMJ15856.1| hypothetical protein PRUPE_ppa002804mg [Prunus persica]
Length=632

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/527 (74%), Positives = 441/527 (84%), Gaps = 3/527 (1%)
 Frame = -2

Query  1971  PDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQ  1792
             P  +S  P   +WN LQRA A ALD  E AL+S+E Q PLPKT DP VQIAGNFAPVPE 
Sbjct  109   PSSKSSKPVPQQWNFLQRAAAMALDAMESALLSKEQQHPLPKTADPKVQIAGNFAPVPEH  168

Query  1791  AVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRF  1612
              V ++LPV G +P  I GVYVRNGANPL  P AGHH FDGDGMVHA+    G+ SY+CRF
Sbjct  169   PVEHSLPVTGKIPASIQGVYVRNGANPLHEPVAGHHFFDGDGMVHALQFKEGAASYACRF  228

Query  1611  TETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVY  1432
             TET R  QER LGRP+FPKAIGELHGHSG+ARLLLFYARG+F LVD   G G+ANAGLVY
Sbjct  229   TETHRFRQERDLGRPLFPKAIGELHGHSGIARLLLFYARGMFSLVDPTHGIGVANAGLVY  288

Query  1431  FNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYD  1252
             FNGRLLAMSEDDLPYH+++  +GDL+TVGRYDF+ QLKSTMIAHPKVDP +GE FALSYD
Sbjct  289   FNGRLLAMSEDDLPYHIKITETGDLKTVGRYDFDKQLKSTMIAHPKVDPTTGELFALSYD  348

Query  1251  VIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGG  1072
             V+Q+PYLKYF     GEKSPDVEI LD PTM+HDFAITE YV+IPDQQVVFKLQEMI GG
Sbjct  349   VVQRPYLKYFKFSPDGEKSPDVEINLDQPTMMHDFAITERYVVIPDQQVVFKLQEMITGG  408

Query  1071  SCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTP  892
             S VIY+K K SRFGIL K AK+A GI WV+ P+ FCFHLWNAWEE ETDE+VVIGSCMTP
Sbjct  409   SPVIYDKNKMSRFGILDKNAKDASGIRWVDCPDCFCFHLWNAWEEPETDEVVVIGSCMTP  468

Query  891   PDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYA  712
              DSIFNEC+E L+S+LSEIRLNLKTG+ST+R I     + VNLEAGMVNRN LGRKT++A
Sbjct  469   ADSIFNECDEKLESVLSEIRLNLKTGKSTRRRICA---ENVNLEAGMVNRNKLGRKTRFA  525

Query  711   YLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVH  532
             YLA+AEPWPKVSGFAKVDLSTGE++K +YGD KYGGEP F+PR+PNSE EDDG+IL+FVH
Sbjct  526   YLALAEPWPKVSGFAKVDLSTGEVKKHIYGDEKYGGEPLFLPRDPNSENEDDGYILAFVH  585

Query  531   DEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             DEK WKSELQIVNA++L++ ATI+LPSRVPYGFHGTFI+S DL+ Q 
Sbjct  586   DEKEWKSELQIVNAMDLKIEATIQLPSRVPYGFHGTFISSKDLEKQA  632



>gb|AIU94747.1| 9-cis-epoxycarotenoid dioxygenase [Morus alba var. multicaulis]
Length=607

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/593 (68%), Positives = 472/593 (80%), Gaps = 29/593 (5%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRRAK--IHCEAAVHSSSVVTLPEQ-------QLPDGESPAPS--QP  1939
             L L S + S     RR    I C   V + S+V +P+        Q P   +P P    P
Sbjct  16    LPLSSSTRSNNSANRRRTNYITCSLQVQTPSLVRIPQHTNTTPTYQAPTTINPIPKIKTP  75

Query  1938  K--------------WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPV  1801
             K              WNLLQRA AAALD AE ALV+RE + PLPKT DP VQIAGNFAPV
Sbjct  76    KDHSSKNTNSLPNQQWNLLQRAAAAALDAAETALVARERRHPLPKTADPRVQIAGNFAPV  135

Query  1800  PEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYS  1621
             PEQ V+++LPV G +P+CI GVYVRNGANP + P AGHH FDGDGMVHAV    G+ SY+
Sbjct  136   PEQPVQHSLPVTGKIPNCIEGVYVRNGANPHYEPVAGHHFFDGDGMVHAVKFNDGAASYA  195

Query  1620  CRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAG  1441
             CRFTET+RLVQER LGRPVFPKAIGELHGHSG+ARLLLFYARGLFGLVD   G G+ANAG
Sbjct  196   CRFTETKRLVQERALGRPVFPKAIGELHGHSGIARLLLFYARGLFGLVDASHGMGVANAG  255

Query  1440  LVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFAL  1261
             LVYFN  LLAMSEDDLPYHVRV P+GDL+TV R+DFN QLKS MIAHPK+DP SGE FAL
Sbjct  256   LVYFNRHLLAMSEDDLPYHVRVTPTGDLKTVDRFDFNGQLKSAMIAHPKLDPVSGELFAL  315

Query  1260  SYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMI  1081
             SYDVI+KPYLKYF   + G+KS DVEIP+D PTM+HDFAITEN+V+IPDQQVVFKLQEMI
Sbjct  316   SYDVIKKPYLKYFKFSTDGKKSDDVEIPIDQPTMMHDFAITENFVVIPDQQVVFKLQEMI  375

Query  1080  RGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSC  901
             RGGS V+++K K SRFG+L K AK  + I W+E+P+ FCFHLWNAWEE E+DEIVVIGSC
Sbjct  376   RGGSPVVFDKNKTSRFGVLDKNAKGEKDIKWIEAPDCFCFHLWNAWEEPESDEIVVIGSC  435

Query  900   MTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKT  721
             MTP DSIFNECEE+LKS+LSEIRLNLKTG+ST+RPII    +QVNLEAGMVNRN LGRKT
Sbjct  436   MTPADSIFNECEESLKSVLSEIRLNLKTGKSTRRPII-TDSEQVNLEAGMVNRNRLGRKT  494

Query  720   QYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPN---SEKEDDGH  550
             ++AYLA+AEPWPKVSGFAKVDL TG++ K++YGD ++GGEP F+PR+ +   S +EDDG+
Sbjct  495   RFAYLALAEPWPKVSGFAKVDLFTGQVTKYLYGDQRFGGEPLFLPRDSDINSSSEEDDGY  554

Query  549   ILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             IL+FVHDEK WKS+LQI+NA+N++L A+I LPSRVPYGFHGTFI+S DL+ Q+
Sbjct  555   ILAFVHDEKEWKSQLQIINAMNMKLEASIDLPSRVPYGFHGTFISSKDLEKQM  607



>ref|XP_008382970.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Malus domestica]
Length=615

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/530 (73%), Positives = 444/530 (84%), Gaps = 5/530 (1%)
 Frame = -2

Query  1980  QQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPV  1801
             Q+ P    P P Q  WNLLQRA + ALD  E AL+S+E Q PLPKT DP VQIAGNFAPV
Sbjct  91    QKSPTSSKPVPQQ--WNLLQRAASMALDAMESALLSKEKQHPLPKTSDPKVQIAGNFAPV  148

Query  1800  PEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYS  1621
             PE  V + LPV G +PD I GVYVRNGANPL  P AGHHLFDGDGMVHA+    G+ SY+
Sbjct  149   PEHPVEHYLPVTGKIPDSIQGVYVRNGANPLHEPVAGHHLFDGDGMVHALQFKDGTASYA  208

Query  1620  CRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAG  1441
             CRFTET R+ QER LGRP+FPKAIGELHGHSG+ARLLLFYARG+FGLVD   G G+ANAG
Sbjct  209   CRFTETSRISQERDLGRPLFPKAIGELHGHSGIARLLLFYARGMFGLVDPTHGIGVANAG  268

Query  1440  LVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFAL  1261
             LVY NG LLAMSEDDLPYHV++  +GDL+TVGRYDF  QLKSTMIAHPKVDP +G+ FAL
Sbjct  269   LVYHNGHLLAMSEDDLPYHVQITETGDLKTVGRYDFEGQLKSTMIAHPKVDPATGDLFAL  328

Query  1260  SYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMI  1081
             SYDV+Q+PYLKYF    +GEKSPD+EI L+ PTM+HDFAITE +V+IPDQQVVFKLQEMI
Sbjct  329   SYDVVQRPYLKYFKFSPNGEKSPDIEINLEQPTMMHDFAITERHVVIPDQQVVFKLQEMI  388

Query  1080  RGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSC  901
              GGS VIY+K K SRFGIL K AK+A GI WV+ P+ FCFHLWNAWEE ETDEIVVIGSC
Sbjct  389   GGGSPVIYDKNKMSRFGILDKNAKDASGIRWVDCPDCFCFHLWNAWEEPETDEIVVIGSC  448

Query  900   MTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKT  721
             MTPPDSIFNEC+ENL+S+LSEIRLNLKTG+ST+R I     + +NLEAGMVNRN LGRKT
Sbjct  449   MTPPDSIFNECDENLESVLSEIRLNLKTGKSTRRRIC---SENLNLEAGMVNRNKLGRKT  505

Query  720   QYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILS  541
             Q AYLA+AEPWPKVSGFAKVDLSTGE++K +YGD KYGGEP F+PR+PNSE EDDG+IL+
Sbjct  506   QSAYLALAEPWPKVSGFAKVDLSTGEVKKHIYGDEKYGGEPLFLPRDPNSEDEDDGYILA  565

Query  540   FVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             FVHDEK WKSELQIVN ++L++ ATI+LPSRVPYGFHGTFI++ DL+ Q 
Sbjct  566   FVHDEKKWKSELQIVNTMDLKVEATIQLPSRVPYGFHGTFISAKDLKKQA  615



>ref|XP_010478382.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Camelina sativa]
Length=593

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/574 (68%), Positives = 466/574 (81%), Gaps = 10/574 (2%)
 Frame = -2

Query  2091  VDLGLPSKSISMK--KPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQP-----KW  1933
             +D   PS S+S    K  RR+K+    +  S +  TL     P+  SP P  P     +W
Sbjct  23    LDAPSPSSSVSFTNTKQGRRSKLSSTNSSISDTTTTL--LNFPNYPSPNPIIPEKDTSRW  80

Query  1932  NllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVP  1753
             N LQRA +AALD AE AL+ RE  +PLPKT DP  QI+GN+APVPEQ V+++L VDG +P
Sbjct  81    NPLQRAASAALDFAETALLKRERSKPLPKTVDPRHQISGNYAPVPEQPVKSSLSVDGKIP  140

Query  1752  DCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLG  1573
             DCI+GVY+RNGANPLF P +GHHLFDGDGMVHAV IT G  SYSCRFTETERLVQE+ +G
Sbjct  141   DCIDGVYLRNGANPLFEPVSGHHLFDGDGMVHAVKITNGEASYSCRFTETERLVQEKQIG  200

Query  1572  RPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDL  1393
              P+FPKAIGELHGHSG+ARL+LFYARGLFGL++H+ GTG+ANAGLVYF+ RLLAMSEDDL
Sbjct  201   SPIFPKAIGELHGHSGIARLMLFYARGLFGLLNHKNGTGVANAGLVYFHDRLLAMSEDDL  260

Query  1392  PYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVK  1213
             PY VR+  +GDLETVGR+DF+ QL S MIAHPK+DP + E FALSYDV++KPYLKYF   
Sbjct  261   PYQVRITDNGDLETVGRFDFDGQLNSAMIAHPKIDPVTKEMFALSYDVVKKPYLKYFRFS  320

Query  1212  SSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRF  1033
               GEKSPDVEIPL  PTM+HDFAITEN+V+IPDQQVVF+L +M  G S V Y+ +K SRF
Sbjct  321   PDGEKSPDVEIPLASPTMMHDFAITENFVVIPDQQVVFQLSDMFLGKSPVKYDAEKISRF  380

Query  1032  GILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLK  853
             GIL + AK+A  ++WVESPETFCFHLWNAW+  ETDE+VVIGSCMTP DSIFNEC+E L 
Sbjct  381   GILPRNAKDASEMVWVESPETFCFHLWNAWDSPETDEVVVIGSCMTPADSIFNECDEQLD  440

Query  852   SILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSG  673
             S+LSEIRLNLKTG+ST+R IIP +D Q+NLEAGMVNRNLLGRKT+YAYLAIAEPWPKVSG
Sbjct  441   SVLSEIRLNLKTGKSTRRTIIPGSD-QMNLEAGMVNRNLLGRKTRYAYLAIAEPWPKVSG  499

Query  672   FAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVN  493
             FAKVDLSTG+++   YG  K+GGEPFF+PR   S+ EDDG+I+SFVHDE++W+SELQIVN
Sbjct  500   FAKVDLSTGKVKNHFYGGKKFGGEPFFLPRGLESDGEDDGYIMSFVHDEESWESELQIVN  559

Query  492   AINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             A+ +EL AT+KLPSRVPYGFHGTF+ S D+ NQ 
Sbjct  560   AVTMELEATVKLPSRVPYGFHGTFVNSADMLNQA  593



>ref|XP_002529528.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
 gb|EEF32866.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
Length=603

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/495 (76%), Positives = 428/495 (86%), Gaps = 3/495 (1%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E + PLPKT DP VQI GNFAPVPEQ+V ++LPV G +PD I+GVY+RNGANPL  P 
Sbjct  110   SHERKHPLPKTADPVVQICGNFAPVPEQSVVHSLPVAGKIPDSIHGVYIRNGANPLHEPV  169

Query  1695  AGHHLFDGDGMVHAVTI-TGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLA  1519
             AGHH FDGDGMVHAV    GGSVSY+CRFTET R VQER LGRPVFPKAIGELHGHSG+A
Sbjct  170   AGHHFFDGDGMVHAVQFEKGGSVSYACRFTETNRFVQERELGRPVFPKAIGELHGHSGIA  229

Query  1518  RLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRY  1339
             RLLLFYARGL GLVD   GTG+ANAGLVYFNGRLLAMSEDDLPYHVRV PSGDL+TV RY
Sbjct  230   RLLLFYARGLVGLVDPSHGTGVANAGLVYFNGRLLAMSEDDLPYHVRVLPSGDLKTVARY  289

Query  1338  DFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTM  1159
             DF+ QLKSTMIAHPKVDP SGE FALSYDV+QKP+LKYF     G+KSPDVEI LD PTM
Sbjct  290   DFDAQLKSTMIAHPKVDPVSGELFALSYDVVQKPFLKYFRFSPDGKKSPDVEISLDQPTM  349

Query  1158  IHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVES  979
             +HDFAITEN+V++PDQQVVFKL EMIRGGS VIY+K K SRFGIL K + +   I W+E+
Sbjct  350   MHDFAITENFVVVPDQQVVFKLPEMIRGGSPVIYDKNKMSRFGILDKNSNDGSKIKWIEA  409

Query  978   PETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKR  799
             P+ FCFHLWNAWEE ETDE+VV+GSCMTPPDSIFNECEE+LKS+LSEIRLNLKTG+ST+R
Sbjct  410   PDCFCFHLWNAWEEPETDEVVVVGSCMTPPDSIFNECEESLKSVLSEIRLNLKTGKSTRR  469

Query  798   PIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGD  619
              II +  +QVNLEAGMV+RNLLGRKT++AYLA+AEPWPKVSGFAKVDL+TGE+ K++YGD
Sbjct  470   AII-SQHEQVNLEAGMVSRNLLGRKTRFAYLALAEPWPKVSGFAKVDLNTGEVHKYVYGD  528

Query  618   GKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPY  439
              KYGGEP F+P + +S +ED G+IL FVHDEK WKSELQIVNA+NL+L AT+KLPSRVPY
Sbjct  529   SKYGGEPMFLPSS-DSAQEDSGYILCFVHDEKEWKSELQIVNAMNLKLEATVKLPSRVPY  587

Query  438   GFHGTFITSYDLQNQ  394
             GFHGTFI + DLQ Q
Sbjct  588   GFHGTFINASDLQKQ  602



>ref|XP_006307061.1| hypothetical protein CARUB_v10008647mg [Capsella rubella]
 gb|EOA39959.1| hypothetical protein CARUB_v10008647mg [Capsella rubella]
Length=596

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/575 (69%), Positives = 464/575 (81%), Gaps = 9/575 (2%)
 Frame = -2

Query  2091  VDLGLPSKSISMKKPTR---RAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQP-----K  1936
             +D   PS S+S    TR   R K+        S   T      P+  SP P  P     +
Sbjct  23    LDAPSPSSSVSFTNNTRTQGRRKLISSPNSSVSGDSTPALLNFPNYPSPNPIIPEKDTSR  82

Query  1935  WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAV  1756
             WN LQRA +AALD AE AL+ RE  +PLPKT DP  QI+GN+APVPEQ V++++ VDG +
Sbjct  83    WNPLQRAASAALDFAETALLRRERSKPLPKTVDPRHQISGNYAPVPEQPVKSSISVDGKI  142

Query  1755  PDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGL  1576
             PDCI+GVY+RNGANPLF P +GHHLFDGDGMVHAV I+ G  SYSCRFTETERLVQE+ L
Sbjct  143   PDCIDGVYLRNGANPLFEPVSGHHLFDGDGMVHAVKISNGEASYSCRFTETERLVQEKQL  202

Query  1575  GRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDD  1396
             G P+FPKAIGELHGH+G+ARL+LFYARGLFGL++H+ GTG+ANAGLVYF+ RLLAMSEDD
Sbjct  203   GSPIFPKAIGELHGHTGIARLMLFYARGLFGLLNHKNGTGVANAGLVYFHDRLLAMSEDD  262

Query  1395  LPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNV  1216
             LPY VR+  +GDLETVGR+DF+ QL S MIAHPK+DPE+ E FALSYDV++KPYLKYF +
Sbjct  263   LPYQVRITDNGDLETVGRFDFDGQLNSAMIAHPKIDPETKELFALSYDVVKKPYLKYFRI  322

Query  1215  KSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSR  1036
                GEKSPDVEIPL  PTM+HDFAITEN+V+IPDQQVVF+L +MI G S V Y+ +K SR
Sbjct  323   SPDGEKSPDVEIPLASPTMMHDFAITENFVVIPDQQVVFQLSDMILGKSPVKYDGEKISR  382

Query  1035  FGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENL  856
             FGIL + AK+A  ++WVESPETFCFHLWNAWE  ETDE+VVIGSCMTP DSIFNEC+E L
Sbjct  383   FGILPRNAKDASEMVWVESPETFCFHLWNAWESPETDEVVVIGSCMTPADSIFNECDEQL  442

Query  855   KSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVS  676
              S+LSEIRLNLKTG+ST+R IIP +  Q+NLEAGMVNRNLLGRKT+YAYLAIAEPWPKVS
Sbjct  443   NSVLSEIRLNLKTGKSTRRTIIPGS-VQMNLEAGMVNRNLLGRKTRYAYLAIAEPWPKVS  501

Query  675   GFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIV  496
             GFAKVDLSTGE++   YG  KYGGEPFF+PR   S+ EDDG+I+SFVHDE++W+SELQIV
Sbjct  502   GFAKVDLSTGEVKNHFYGGKKYGGEPFFLPRGLESDGEDDGYIMSFVHDEESWESELQIV  561

Query  495   NAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             NA+ LEL AT+KLPSRVPYGFHGTF+ S D+ NQ 
Sbjct  562   NAVTLELEATVKLPSRVPYGFHGTFVNSSDMLNQA  596



>dbj|BAE72091.1| Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 2
Length=607

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/581 (69%), Positives = 462/581 (80%), Gaps = 17/581 (3%)
 Frame = -2

Query  2085  LGLPSKSISM-KKP-TRRAKIHCEAAVHSSSVVTLPEQ----------QLPDGESPAPSQ  1942
             LG  S SIS  KKP  R A+     A+H+ S++  P+Q          +LP   S + S 
Sbjct  28    LGSSSTSISFCKKPNARTAQNSTLCALHTPSILQFPKQSVGKTSTCPVELPSSSSSSSSS  87

Query  1941  P----KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNL  1774
             P     WNL+Q+  A ALD  E  L +RE  + LPKT DP VQIAGNF+PVPEQ VR+ L
Sbjct  88    PVVQQNWNLIQKFAAMALDAVEDGLKAREKLQTLPKTADPNVQIAGNFSPVPEQPVRHCL  147

Query  1773  PVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERL  1594
             PV G +P+ I GVY+RNGANPLF P +GHHLFDGDGM++AV    GS SY+CRFTET+RL
Sbjct  148   PVAGKIPEHIQGVYLRNGANPLFEPTSGHHLFDGDGMIYAVKFDNGSASYACRFTETQRL  207

Query  1593  VQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLL  1414
             VQER +G+PVFPKAIGELHGHSG+A+LLLFYARGL GL+D  +G G+ANAGLVYFN  LL
Sbjct  208   VQERAIGKPVFPKAIGELHGHSGIAKLLLFYARGLCGLIDVTQGLGVANAGLVYFNNHLL  267

Query  1413  AMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPY  1234
             AMSEDDLPYHVRV PSGDL+T GRY+F  QL STMIAHPK+DP SGE FALSYDVIQKPY
Sbjct  268   AMSEDDLPYHVRVTPSGDLKTGGRYNFEGQLNSTMIAHPKLDPVSGELFALSYDVIQKPY  327

Query  1233  LKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYE  1054
             LKYF     G+KS DV I L  PTM+HDFAITEN+V++PD QVVFK+ EMI GGS V+Y+
Sbjct  328   LKYFWFSPDGKKSKDVAIDLGKPTMVHDFAITENFVVVPDHQVVFKMSEMITGGSPVMYD  387

Query  1053  KKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFN  874
             K+K SRFG+L K A+N   I WVE P+ FCFHLWNAWEE E+DE+VVIGSCMTP DSIFN
Sbjct  388   KEKVSRFGVLDKYAENGSDIKWVEVPDCFCFHLWNAWEEPESDEVVVIGSCMTPADSIFN  447

Query  873   ECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAE  694
             EC E LKS+LSEIRLNLKTG+ST+RPII + +  VNLEAGMVN+NLLGRK++YAYLAIAE
Sbjct  448   ECNEELKSVLSEIRLNLKTGKSTRRPII-SPENDVNLEAGMVNKNLLGRKSKYAYLAIAE  506

Query  693   PWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWK  514
             PWPKVSGFAKVDLSTG+ QKF+YGD KYGGEP F+PR+PNSE EDDGHIL+FVHDEKTWK
Sbjct  507   PWPKVSGFAKVDLSTGDTQKFIYGDEKYGGEPLFLPRDPNSEAEDDGHILAFVHDEKTWK  566

Query  513   SELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             SELQIVNA+ +EL AT+KLPSRVPYGFHGTFI + DL  Q 
Sbjct  567   SELQIVNAMTMELEATVKLPSRVPYGFHGTFINAKDLATQA  607



>ref|XP_010092722.1| hypothetical protein L484_024617 [Morus notabilis]
 gb|EXB52067.1| hypothetical protein L484_024617 [Morus notabilis]
Length=605

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/551 (72%), Positives = 457/551 (83%), Gaps = 17/551 (3%)
 Frame = -2

Query  2034  KIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRP  1855
             KI       S + ++LP QQ             WNLLQRA AAALD AE ALV++E + P
Sbjct  69    KIKTPKDNSSKNTISLPNQQ-------------WNLLQRAAAAALDAAETALVAQERRHP  115

Query  1854  LPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFD  1675
             LPKT DP VQIAGNFAPVPEQ V+++LPV G VP+CI GVYVRNGANP + P AGHH FD
Sbjct  116   LPKTADPRVQIAGNFAPVPEQPVQHSLPVTGKVPNCIEGVYVRNGANPHYEPVAGHHFFD  175

Query  1674  GDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYAR  1495
             GDGMVHAV    G+ SY+CRFTET+RLVQER LGRPVFPKAIGELHGHSG+ARLLLFYAR
Sbjct  176   GDGMVHAVKFNNGAASYACRFTETKRLVQERALGRPVFPKAIGELHGHSGIARLLLFYAR  235

Query  1494  GLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKS  1315
             GLFGLVD   G G+ANAGLVYFN RLLAMSEDDLPYHVRV P+GDL+TV R+DFN QLKS
Sbjct  236   GLFGLVDASHGMGVANAGLVYFNRRLLAMSEDDLPYHVRVTPAGDLKTVDRFDFNGQLKS  295

Query  1314  TMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITE  1135
              MIAHPK+DP SGE FALSYDVI+KPYLKYF   + G+KS DVEIP+D PTM+HDFAITE
Sbjct  296   AMIAHPKLDPVSGELFALSYDVIKKPYLKYFKFSTDGKKSDDVEIPIDQPTMMHDFAITE  355

Query  1134  NYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHL  955
             N+V+IPDQQVVFKL EMIRGGS V+Y+K K SRFG+L K AK  + I W+E+P+ FCFHL
Sbjct  356   NFVVIPDQQVVFKLPEMIRGGSPVVYDKNKTSRFGVLDKNAKGEKDIKWIEAPDCFCFHL  415

Query  954   WNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQ  775
             WNAWEE E+DEIVVIGSCMTP DSIFNECEE+LKS+LSEIRLNLKTG+ST+RPII    +
Sbjct  416   WNAWEEPESDEIVVIGSCMTPADSIFNECEESLKSVLSEIRLNLKTGKSTRRPII-TDSE  474

Query  774   QVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPF  595
             QVNLEAGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TG++ K++YGD ++GGEP 
Sbjct  475   QVNLEAGMVNRNQLGRKTRFAYLALAEPWPKVSGFAKVDLFTGQVTKYLYGDQRFGGEPL  534

Query  594   FVPRNPN---SEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGT  424
             F+PR  +   S +EDDG+IL+FVHDEK WKS+LQI+NA+N++L A+I LPSRVPYGFHGT
Sbjct  535   FLPRESDINFSSEEDDGYILAFVHDEKEWKSQLQIINAMNMKLEASIDLPSRVPYGFHGT  594

Query  423   FITSYDLQNQV  391
             FI+S DL+ Q+
Sbjct  595   FISSKDLEKQM  605



>ref|XP_002890850.1| nine-cis-epoxycarotenoid dioxygenase 5 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67109.1| nine-cis-epoxycarotenoid dioxygenase 5 [Arabidopsis lyrata subsp. 
lyrata]
Length=589

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/568 (68%), Positives = 461/568 (81%), Gaps = 2/568 (0%)
 Frame = -2

Query  2091  VDLGLPSKSISMKKPT-RRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqra  1915
             +D   PS S+S      RR K+   +   + +++  P    P+   P     +WN LQRA
Sbjct  23    LDAPSPSSSVSFTNTKQRRRKLSTNSVSDTPALLNSPNYPSPNPMIPEKDTSRWNPLQRA  82

Query  1914  vaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGV  1735
              +AALD AE AL+ RE  +PLPKT DP  QI+GN+APVPEQ+V+++L VDG +P+CI+GV
Sbjct  83    ASAALDFAETALLRRERSKPLPKTVDPRHQISGNYAPVPEQSVKSSLSVDGKIPECIDGV  142

Query  1734  YVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPK  1555
             Y+RNGANPLF P +GHHLFDGDGMVHAV IT G  SYSCRFTETERLVQE+ LG P+FPK
Sbjct  143   YLRNGANPLFEPVSGHHLFDGDGMVHAVKITNGDASYSCRFTETERLVQEKQLGSPIFPK  202

Query  1554  AIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRV  1375
             AIGELHGHSG+ARL+LFYARGLFGL++H+ GTG+ANAGLVYF+ RLLAMSEDDLPY VRV
Sbjct  203   AIGELHGHSGIARLMLFYARGLFGLLNHKNGTGVANAGLVYFHDRLLAMSEDDLPYQVRV  262

Query  1374  KPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKS  1195
               +GDLET+GR+DF+ QL S MIAHPK+DPE+ E FALSYDV++KPYLKYF     GEKS
Sbjct  263   TDNGDLETIGRFDFDGQLCSAMIAHPKIDPETKELFALSYDVVKKPYLKYFRFSPEGEKS  322

Query  1194  PDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKT  1015
             PDVEIPL  PTM+HDFAITE +V+IPDQQVVFKL +M  G S V Y+ +K SRFGIL + 
Sbjct  323   PDVEIPLASPTMMHDFAITEKFVVIPDQQVVFKLSDMFLGKSPVKYDGEKISRFGILPRN  382

Query  1014  AKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEI  835
             AK+A  ++WVESPETFCFHLWNAWE  ET+E+VVIGSCMTP DSIFNEC+E L S+LSEI
Sbjct  383   AKDASEMVWVESPETFCFHLWNAWESPETNEVVVIGSCMTPADSIFNECDEQLNSVLSEI  442

Query  834   RLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDL  655
             RLNLKTG+ST+R IIP +  Q+NLEAGMVNRNLLGRKT+YAYLAIAEPWPKVSGFAKVDL
Sbjct  443   RLNLKTGKSTRRTIIPGS-VQMNLEAGMVNRNLLGRKTRYAYLAIAEPWPKVSGFAKVDL  501

Query  654   STGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLEL  475
             STGE++   YG  KYGGEPFF+PR   S+ EDDG+I+SFVHDE++W+SEL IVNA+ LEL
Sbjct  502   STGEVKNHFYGGKKYGGEPFFLPRGLESDGEDDGYIMSFVHDEESWESELHIVNAVTLEL  561

Query  474   LATIKLPSRVPYGFHGTFITSYDLQNQV  391
              AT+KLPSRVPYGFHGTF+ S D+ NQ 
Sbjct  562   EATVKLPSRVPYGFHGTFVNSADMLNQA  589



>ref|XP_009367762.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009367763.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=617

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/530 (73%), Positives = 445/530 (84%), Gaps = 5/530 (1%)
 Frame = -2

Query  1980  QQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPV  1801
             Q+ P    P P Q  WNLLQRA + ALD  E AL+S+E Q PLPKT DP VQIAGNFAPV
Sbjct  93    QKSPTSSKPVPQQ--WNLLQRAASMALDAMESALLSKEKQHPLPKTSDPEVQIAGNFAPV  150

Query  1800  PEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYS  1621
             PE  V + LPV G +PD I G+YVRNGANPL  P AGHHLFDGDGMVHA+    G+ SY+
Sbjct  151   PEHPVEHYLPVTGKIPDSIQGLYVRNGANPLHEPVAGHHLFDGDGMVHALQFKDGTASYA  210

Query  1620  CRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAG  1441
             CRFTET R+ QER LGRP+FPKAIGELHGHSG+ARLLLFYARG+FGLVD   G G+ANAG
Sbjct  211   CRFTETSRISQERDLGRPLFPKAIGELHGHSGIARLLLFYARGMFGLVDPTHGVGVANAG  270

Query  1440  LVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFAL  1261
             LVY NG LLAMSEDDLPYHV++  +GDL+TVGRYDF  QLKSTMIAHPKVDP +GE FAL
Sbjct  271   LVYHNGHLLAMSEDDLPYHVQITETGDLKTVGRYDFEGQLKSTMIAHPKVDPATGELFAL  330

Query  1260  SYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMI  1081
             SYDV+Q+PYLKYF    +GEKSPD+EI L+ PTM+HDFAITE +V+IPDQ+VVFKLQEMI
Sbjct  331   SYDVVQRPYLKYFKFSPNGEKSPDIEINLEQPTMMHDFAITERHVVIPDQKVVFKLQEMI  390

Query  1080  RGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSC  901
              GG  VIY+K K SRFGIL K AK+A GI WV+ P+ FCFHLWNAWEE ETDEIVVIGSC
Sbjct  391   GGGYPVIYDKNKMSRFGILDKNAKDASGIRWVDCPDCFCFHLWNAWEEPETDEIVVIGSC  450

Query  900   MTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKT  721
             MTPPDSIFNEC+ENL+S+LSEIRLNLKTG+ST+R I     + +NLEAGMVNR+ LGRKT
Sbjct  451   MTPPDSIFNECDENLESVLSEIRLNLKTGKSTRRRIC---SENLNLEAGMVNRDKLGRKT  507

Query  720   QYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILS  541
             Q+AYLA+AEPWPKVSGFAKVDL TGE++K +YGD KYGGEP F+PR+PNSE EDDG+IL+
Sbjct  508   QFAYLALAEPWPKVSGFAKVDLPTGEVKKHIYGDEKYGGEPLFLPRDPNSENEDDGYILA  567

Query  540   FVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             FVHDEK WKSE+QIVNA++L++ ATI+LPSRVPYGFHGTFI++ DL+NQ 
Sbjct  568   FVHDEKKWKSEMQIVNAMDLKVEATIQLPSRVPYGFHGTFISTKDLKNQA  617



>ref|XP_008378396.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Malus domestica]
Length=614

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/565 (70%), Positives = 457/565 (81%), Gaps = 15/565 (3%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqravaa  1906
             + +P +S S ++P+   KI  E     S   +           P P Q  WNLLQRA + 
Sbjct  65    IQIPKRSPSYQQPSTPTKIPREDKTQKSKTSS----------KPVPQQ--WNLLQRAASM  112

Query  1905  aldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVR  1726
             ALD+ E AL+S+E Q PLPKT DP VQIAGNFAPVPE  V ++LPV G +PD I GVYVR
Sbjct  113   ALDIMESALLSKEKQTPLPKTSDPKVQIAGNFAPVPEHPVEHSLPVTGKIPDSIQGVYVR  172

Query  1725  NGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIG  1546
             NGANPL  P AGHHLFDGDGMVHA+    G+ SY+CRFTET R+ QER LGRP+FPKAIG
Sbjct  173   NGANPLHEPVAGHHLFDGDGMVHALQFKDGTASYACRFTETHRMSQERDLGRPLFPKAIG  232

Query  1545  ELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPS  1366
             ELHGHSG+ARLLLFYARG+FGLVD   G G+ANAGLVY NG LLAMSEDDLPYHV++  +
Sbjct  233   ELHGHSGIARLLLFYARGMFGLVDPSHGIGVANAGLVYHNGHLLAMSEDDLPYHVQITET  292

Query  1365  GDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDV  1186
             GDL+TVGRYDF  QLKSTMIAHPKVDP +GE FALSYDV+QKPYLKYF    SG+KSPDV
Sbjct  293   GDLKTVGRYDFEGQLKSTMIAHPKVDPATGELFALSYDVVQKPYLKYFKFSPSGDKSPDV  352

Query  1185  EIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKN  1006
             EI L+ PTM+HDFAITE +V+IPDQQVVFKLQEMI GGS VIY+K K SRFGIL K AK+
Sbjct  353   EINLEQPTMMHDFAITERHVVIPDQQVVFKLQEMIGGGSPVIYDKNKMSRFGILDKNAKD  412

Query  1005  AEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLN  826
             A GI WV+ P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIFNEC+ENL+S+LSEIRLN
Sbjct  413   ASGIQWVDCPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIFNECDENLESVLSEIRLN  472

Query  825   LKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTG  646
             LKT +ST+R I     + +NLEAGMVNRN LGRKT++ YLA+AEPWPKVSGFAKVDLSTG
Sbjct  473   LKTEKSTRRRICA---ENLNLEAGMVNRNRLGRKTRFTYLALAEPWPKVSGFAKVDLSTG  529

Query  645   EMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLAT  466
             E++K +YG+ KYGGEP F+PR+PNSE EDDG+IL+FVHDEK WKSELQIVNA++L++ AT
Sbjct  530   EVKKHIYGEEKYGGEPLFLPRDPNSENEDDGYILAFVHDEKEWKSELQIVNAMDLKVEAT  589

Query  465   IKLPSRVPYGFHGTFITSYDLQNQV  391
             I+LPSRVPYGFHGTFI + DL+ Q 
Sbjct  590   IQLPSRVPYGFHGTFIXAKDLEMQA  614



>ref|XP_011010890.1| PREDICTED: LOW QUALITY PROTEIN: probable 9-cis-epoxycarotenoid 
dioxygenase NCED5, chloroplastic [Populus euphratica]
Length=596

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/556 (72%), Positives = 456/556 (82%), Gaps = 11/556 (2%)
 Frame = -2

Query  2037  AKIHCEAAVHSSSVVT-LPEQQLPDGESPAPSQPK-------WNllqravaaaldvaega  1882
              KIH  + +HS SV+  L +  +P  +S     PK       WN LQRA A ALD+AE A
Sbjct  43    TKIH--STLHSPSVLNFLTQPVIPKEDSSVTVNPKTNRHQPLWNFLQRAAATALDMAEAA  100

Query  1881  lVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFR  1702
             LVS + QR LPKT DP VQIAGNF+PV EQ VR +L V G +P+CI+G+YVRNGANP   
Sbjct  101   LVSYQRQRLLPKTVDPRVQIAGNFSPVQEQKVRRSLQVTGTIPECIDGIYVRNGANPRLE  160

Query  1701  PKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGL  1522
             P AGHH FDGDGMVHA+ I  GS SYSCRFTETERL QER  GRPVFPKAIGELHGHSG+
Sbjct  161   PVAGHHFFDGDGMVHAMKIEKGSASYSCRFTETERLKQERERGRPVFPKAIGELHGHSGI  220

Query  1521  ARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGR  1342
             ARLLLFYARGL GL+DH +GTG+ANAGLVYFN RLLAMSEDDLPY VR+ P GDLETVGR
Sbjct  221   ARLLLFYARGLCGLLDHTKGTGVANAGLVYFNDRLLAMSEDDLPYQVRITPCGDLETVGR  280

Query  1341  YDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPT  1162
             Y+FN QLK +MIAHPK+DP S E FALSYDV+QKPYLKYF     G+KSPD++I L VPT
Sbjct  281   YNFNSQLKHSMIAHPKIDPVSKELFALSYDVVQKPYLKYFRFFPDGKKSPDIDIHLPVPT  340

Query  1161  MIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVE  982
             M+HDFAITEN+V+IPDQQVVFKLQEM+RGGS VIY+K KKSRFGIL K A +A+ IIWVE
Sbjct  341   MMHDFAITENFVVIPDQQVVFKLQEMLRGGSPVIYDKNKKSRFGILNKNATDAKDIIWVE  400

Query  981   SPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTK  802
             SP TFCFHLWNAWE  E++++VVIGSCMTPPDSIFN  +E+LKS+LSEIRLNLKTG+ST+
Sbjct  401   SPGTFCFHLWNAWEVPESNDVVVIGSCMTPPDSIFNYYDESLKSVLSEIRLNLKTGKSTR  460

Query  801   RPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYG  622
             RPII  ++  VNLEAGMVNRN LGR+T YAYLAIAEPWPKVSGFAKVDL TGE++++MYG
Sbjct  461   RPIIQESN-HVNLEAGMVNRNRLGRQTNYAYLAIAEPWPKVSGFAKVDLFTGEVRRYMYG  519

Query  621   DGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVP  442
             + +YGGEPFF+P N N E EDDG+IL FVHDEKTWKSELQIVNA NL+L A+++LPSRVP
Sbjct  520   NKRYGGEPFFLPTNQNCETEDDGYILGFVHDEKTWKSELQIVNAKNLQLEASVRLPSRVP  579

Query  441   YGFHGTFITSYDLQNQ  394
             YGFHGTFI    L NQ
Sbjct  580   YGFHGTFIDRRGLVNQ  595



>ref|XP_010694572.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=598

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/528 (73%), Positives = 444/528 (84%), Gaps = 3/528 (1%)
 Frame = -2

Query  1968  DGESPAPSQP-KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQ  1792
             +G+    SQP +WN +Q+AVA ALD+ E A+ S E + PLPKT DP VQIAGNFAPVPEQ
Sbjct  72    NGKRSLKSQPFQWNPIQKAVAGALDMVEKAINSHESEHPLPKTADPRVQIAGNFAPVPEQ  131

Query  1791  AVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITG-GSVSYSCR  1615
              V+ NLPV GA+P+CI GVYVRNGANPL+ P AGHH FDGDGM+H+V     GS SYSCR
Sbjct  132   GVQRNLPVTGAIPECIRGVYVRNGANPLYEPIAGHHFFDGDGMIHSVQFNNDGSASYSCR  191

Query  1614  FTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLV  1435
             FTET R VQE+ LGRP+FPKAIGELHGHSG+ARLLLFY+R LFGL+D   G G+ANAG+V
Sbjct  192   FTETNRFVQEKKLGRPIFPKAIGELHGHSGIARLLLFYSRALFGLLDQTNGIGVANAGVV  251

Query  1434  YFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSY  1255
             +FN RLLAMSEDDLPY VRV PSGDL+TVGRY+FN +LKSTMIAHPKVDP SGE FALSY
Sbjct  252   FFNNRLLAMSEDDLPYQVRVTPSGDLKTVGRYNFNGELKSTMIAHPKVDPVSGEMFALSY  311

Query  1254  DVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRG  1075
             DV+++PYLKYF   S G KSPDVEI L+ PTM+HDFAITENYVIIPD QVVFKLQEMI G
Sbjct  312   DVVKRPYLKYFWFGSDGTKSPDVEINLEAPTMMHDFAITENYVIIPDSQVVFKLQEMIGG  371

Query  1074  GSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMT  895
             GS V+Y+K+KKSRFGIL K +   + I W+E PE FCFHLWNAWEE ETDEIVVIGSCMT
Sbjct  372   GSPVVYDKEKKSRFGILPKYSTTCDEIQWIEVPECFCFHLWNAWEEPETDEIVVIGSCMT  431

Query  894   PPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQY  715
             P DSIFNEC+ENL S LSEIRLN KTG ST+R I+ ++D ++NLEAGMVNRN LGRKTQY
Sbjct  432   PADSIFNECDENLTSDLSEIRLNRKTGISTRREILSSSD-KMNLEAGMVNRNKLGRKTQY  490

Query  714   AYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFV  535
             AYLAIAEPWPKVSGFAKVDL TGE++KF YGDG YGGEP F+PR+ NSE+EDDG+IL+FV
Sbjct  491   AYLAIAEPWPKVSGFAKVDLFTGEVKKFEYGDGTYGGEPLFLPRDANSEREDDGYILAFV  550

Query  534   HDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             HDE  W+SEL+IVNA+ LEL+AT+KLPSRVPYGFHGTFI + DL  Q 
Sbjct  551   HDEINWESELKIVNAMTLELVATVKLPSRVPYGFHGTFINAKDLMAQA  598



>ref|XP_010460787.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Camelina sativa]
Length=593

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/574 (68%), Positives = 464/574 (81%), Gaps = 10/574 (2%)
 Frame = -2

Query  2091  VDLGLPSKSISMK--KPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQP-----KW  1933
             +D   PS S+S    K  RR+K+    +  S +  TL     P+  SP P  P     +W
Sbjct  23    LDAPSPSSSVSFTNTKLGRRSKLSSTNSSISDTTTTL--VNFPNYPSPNPIIPEKDTSRW  80

Query  1932  NllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVP  1753
             N LQRA +AALD AE AL+ RE  +PLPKT DP  QI+GN+APVPEQ V+++L VDG +P
Sbjct  81    NPLQRAASAALDFAETALLKRERSKPLPKTVDPRHQISGNYAPVPEQPVKSSLSVDGKIP  140

Query  1752  DCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLG  1573
             DCI+GVY+RNGANPLF P +GHHLFDGDGM+HAV I  G  SYSCRFTETERLVQE+ LG
Sbjct  141   DCIDGVYLRNGANPLFEPVSGHHLFDGDGMIHAVKIINGEASYSCRFTETERLVQEKQLG  200

Query  1572  RPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDL  1393
              P+FPKAIGELHGHSG+ARL+LFYARGLFGL++H+ GTG+ANAGLVYF+ RLLAMSEDDL
Sbjct  201   SPIFPKAIGELHGHSGIARLMLFYARGLFGLLNHKNGTGVANAGLVYFHDRLLAMSEDDL  260

Query  1392  PYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVK  1213
             PY VR+  +GDLETVGR+DF+ QL S MIAHPK+DP++ E FALSYDV++KPYLKYF   
Sbjct  261   PYQVRITDNGDLETVGRFDFDGQLNSAMIAHPKIDPKTKEMFALSYDVVKKPYLKYFRFS  320

Query  1212  SSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRF  1033
               GEKSPDVEIPL  PTM+HDFAITEN+V+IPDQQVVF+L +M  G S V Y+ +K SRF
Sbjct  321   PDGEKSPDVEIPLASPTMMHDFAITENFVVIPDQQVVFQLSDMFLGKSPVKYDGEKISRF  380

Query  1032  GILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLK  853
             GIL + AK+A  ++WVESPETFCFHLWNAWE  ETDE+VVIGSCMTP DSIFNEC+E L 
Sbjct  381   GILPRNAKDASEMVWVESPETFCFHLWNAWESPETDEVVVIGSCMTPADSIFNECDEQLD  440

Query  852   SILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSG  673
             S+LSEIRLNLKTG+ST+  IIP +D Q+NLEAGMVNRNLLGRKT+YAYLAIAEPWP+VSG
Sbjct  441   SVLSEIRLNLKTGKSTRITIIPGSD-QMNLEAGMVNRNLLGRKTRYAYLAIAEPWPRVSG  499

Query  672   FAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVN  493
             FAKVDLSTGE++   YG  K+GGEPF +PR   S+ EDDG+I+SFVHDE++W+SELQIVN
Sbjct  500   FAKVDLSTGEVKNHFYGGKKFGGEPFVLPRGLESDGEDDGYIMSFVHDEESWESELQIVN  559

Query  492   AINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             A+ +EL AT+KLPSRVPYGFHGTF+ S D+ NQ 
Sbjct  560   AVTMELEATVKLPSRVPYGFHGTFVNSADMLNQA  593



>ref|XP_010540581.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Tarenaya hassleriana]
Length=597

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/570 (70%), Positives = 466/570 (82%), Gaps = 9/570 (2%)
 Frame = -2

Query  2076  PSKSISMK--KPTRRAKIHCEAAVHSSSVVTLPEQQLP---DGESPAPSQ---PKWNllq  1921
             PS ++S    K  RR        ++S + +  P+   P     E+P+ S    P WNLLQ
Sbjct  29    PSSAVSFAYTKSPRRKPTQTPCVLNSPTFINFPKDPKPIPVTTENPSSSSSYPPHWNLLQ  88

Query  1920  ravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCIN  1741
             RA AAALD+AE AL+S E  +PLPKT DP  QIAGN+APVPE+ +R +LPV G +PD I+
Sbjct  89    RAAAAALDLAESALLSLERSQPLPKTVDPCHQIAGNYAPVPERPLRQSLPVSGDIPDGID  148

Query  1740  GVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVF  1561
             GVY+RNGANPLF P +GHHLFDGDGM+HAV I+GG  SYSCRFT+TERLVQE+ LG P+F
Sbjct  149   GVYLRNGANPLFEPVSGHHLFDGDGMIHAVKISGGEASYSCRFTQTERLVQEKELGCPIF  208

Query  1560  PKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHV  1381
             PKAIGELHGHSG+ARL+LFYARGLFGLV+HR GTG+ANAGL+YF+ RLLAMSEDDLPY V
Sbjct  209   PKAIGELHGHSGIARLMLFYARGLFGLVNHRNGTGVANAGLIYFHDRLLAMSEDDLPYQV  268

Query  1380  RVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGE  1201
             RV  +GDLETVGRYDF+ QLKS MIAHPK+DPE+ E FALSYDV++KPYLKYF     G 
Sbjct  269   RVTDNGDLETVGRYDFDGQLKSAMIAHPKIDPETKELFALSYDVVKKPYLKYFRFSPDGG  328

Query  1200  KSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILK  1021
             KSPDVEIPL  PTM+HDFAITEN+V+IPD QVVFKL +M+ G S V Y+K+K SRFGIL 
Sbjct  329   KSPDVEIPLTTPTMMHDFAITENFVVIPDHQVVFKLGDMVLGKSPVSYDKEKISRFGILP  388

Query  1020  KTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILS  841
             K A++A GIIWVESPETFCFHLWNAWE  +TDE+VVIGSCMTP DSIFNE +E L S+LS
Sbjct  389   KNAEDASGIIWVESPETFCFHLWNAWESPDTDEVVVIGSCMTPADSIFNESDEKLNSVLS  448

Query  840   EIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKV  661
             EIRLNL+TG+ST+RP+IP +D Q+NLEAGMVNRN LGRKT++AYLAIAEPWPKVSGFAKV
Sbjct  449   EIRLNLRTGKSTRRPVIPDSD-QMNLEAGMVNRNRLGRKTRFAYLAIAEPWPKVSGFAKV  507

Query  660   DLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINL  481
             DL TGE + + YG  KYGGEPFFV R  +S+ EDDG+IL+FVHDEKTWKSELQIVNA+NL
Sbjct  508   DLFTGESKNYFYGGMKYGGEPFFVRRGLDSDGEDDGYILTFVHDEKTWKSELQIVNAVNL  567

Query  480   ELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             EL AT+KLPSRVPYGFHGTF+ S D+ NQ 
Sbjct  568   ELEATVKLPSRVPYGFHGTFVNSADMVNQA  597



>dbj|BAE72092.1| Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 3
Length=583

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/562 (69%), Positives = 457/562 (81%), Gaps = 6/562 (1%)
 Frame = -2

Query  2079  LPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqravaaal  1900
             LPS S S+    +  KI C  A+ S S++  P+Q     + P+ +   WNLLQ+  A AL
Sbjct  27    LPS-SFSVSSRKKLKKISC--ALQSPSILQFPKQS--PFQLPSSTPDSWNLLQKFSAMAL  81

Query  1899  dvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNG  1720
             D  E  L+ +E +  LPKT DP VQI+GNF+PVPEQ+VR+ LPV G +P+ + GVY+RNG
Sbjct  82    DAIENGLIEQEKKHALPKTADPKVQISGNFSPVPEQSVRHCLPVVGEIPEHVQGVYLRNG  141

Query  1719  ANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGEL  1540
             ANPLF P +GHHLFDGDGM++AV    GS S++CR TET+RLVQER LG+PVFPKAIGEL
Sbjct  142   ANPLFEPTSGHHLFDGDGMIYAVKFENGSASFACRHTETQRLVQERALGKPVFPKAIGEL  201

Query  1539  HGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGD  1360
             HGHSG+A+LLLFYARGL GLVDH +G G+ANAGLVYFN RLLAMSEDDLPY VRV P+GD
Sbjct  202   HGHSGIAKLLLFYARGLCGLVDHSQGIGVANAGLVYFNNRLLAMSEDDLPYEVRVTPTGD  261

Query  1359  LETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEI  1180
             L+TVGRY+F++QLKSTMIAHPK+DP SGE F+LSYDVIQKPYLKYF     G KS DV I
Sbjct  262   LKTVGRYNFDEQLKSTMIAHPKLDPVSGELFSLSYDVIQKPYLKYFRFSPDGTKSKDVAI  321

Query  1179  PLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAE  1000
              L  PTM+HDF ITEN+V++PD QVVFK+ EMI GGS V+Y+K+K SRFG+L K A +  
Sbjct  322   DLAKPTMVHDFVITENFVVVPDHQVVFKMSEMITGGSPVVYDKEKVSRFGVLDKYADDGS  381

Query  999   GIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLK  820
              I WVE P+ FCFHLWNAWEE ETDE+VVIGSCMTP DSIFNE  E LKS+LSEIRLNLK
Sbjct  382   SIKWVEVPDCFCFHLWNAWEEPETDEVVVIGSCMTPADSIFNENNEELKSVLSEIRLNLK  441

Query  819   TGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEM  640
             TG+ST+R II + +  VNLEAGMVN+NLLGRK++YAYLAIAEPWPKVSGFAKVDLSTGE 
Sbjct  442   TGKSTRRAII-SPENDVNLEAGMVNKNLLGRKSKYAYLAIAEPWPKVSGFAKVDLSTGET  500

Query  639   QKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIK  460
             +KF+YG+ KYGGEP F+PR+PNSE EDDGHIL+FVHDEKTWKSELQIVNAI L+L AT+K
Sbjct  501   KKFIYGNQKYGGEPLFLPRDPNSETEDDGHILTFVHDEKTWKSELQIVNAITLQLEATVK  560

Query  459   LPSRVPYGFHGTFITSYDLQNQ  394
             LPSRVPYGFHGTFI++ DL  Q
Sbjct  561   LPSRVPYGFHGTFISANDLATQ  582



>ref|XP_009354854.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Pyrus x bretschneideri]
Length=613

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/565 (70%), Positives = 458/565 (81%), Gaps = 15/565 (3%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqravaa  1906
             + +P +S S ++P+   KI  E     S   +           P P Q  WNLLQRAV+ 
Sbjct  64    IQIPKRSPSYQQPSTPTKIPRENKTQKSRTSS----------KPVPQQ--WNLLQRAVSM  111

Query  1905  aldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVR  1726
             ALDV E AL+S+E Q PLPKT DP VQIAGNFAPVPE  V ++LPV G +PD I GVYVR
Sbjct  112   ALDVMESALLSKEKQTPLPKTSDPKVQIAGNFAPVPEHPVEHSLPVTGKIPDSIQGVYVR  171

Query  1725  NGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIG  1546
             NGANPL  P AGHHLFDGDGMVHA+    G+ SY+CRFTET R+ QER LGRP+FPKAIG
Sbjct  172   NGANPLHEPVAGHHLFDGDGMVHALQFKDGTASYACRFTETHRMSQERDLGRPLFPKAIG  231

Query  1545  ELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPS  1366
             ELHGHSG+ARLLLFYARG+FGLVD   G G+ANAGLVY N  LLAMSEDDLPYHV++  +
Sbjct  232   ELHGHSGIARLLLFYARGMFGLVDPSHGIGVANAGLVYHNCHLLAMSEDDLPYHVQITET  291

Query  1365  GDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDV  1186
             GDL+TVGRYDF  QLKSTMIAHPKVDP +GE FALSYDV+QKPYLKYF    SG+KSPDV
Sbjct  292   GDLKTVGRYDFEGQLKSTMIAHPKVDPATGELFALSYDVVQKPYLKYFKFSPSGDKSPDV  351

Query  1185  EIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKN  1006
             EI L+ PTM+HDFAITE +V+IPDQQVVFKLQEMI GGS VIY+K K SRFGIL K AK+
Sbjct  352   EINLEQPTMMHDFAITERHVVIPDQQVVFKLQEMIGGGSPVIYDKNKMSRFGILDKNAKD  411

Query  1005  AEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLN  826
             A GI WV+ P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIFNE +ENL+S+LSEIRLN
Sbjct  412   ASGIRWVDCPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIFNESDENLESVLSEIRLN  471

Query  825   LKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTG  646
             LKTG+ST+R I     + +NLEAGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDLSTG
Sbjct  472   LKTGKSTRRCICA---ENLNLEAGMVNRNKLGRKTRFAYLALAEPWPKVSGFAKVDLSTG  528

Query  645   EMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLAT  466
             E++K +YG+ KYGGEP F+PR+PN E EDDG+IL+FVHDEK WKSELQIVNA++L++ AT
Sbjct  529   EVKKHIYGEEKYGGEPMFLPRDPNWENEDDGYILAFVHDEKEWKSELQIVNAMDLKVEAT  588

Query  465   IKLPSRVPYGFHGTFITSYDLQNQV  391
             I+LPSRVPYGFHGTFI++ DL+ Q 
Sbjct  589   IQLPSRVPYGFHGTFISAKDLEKQA  613



>ref|XP_010060796.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW67664.1| hypothetical protein EUGRSUZ_F01409 [Eucalyptus grandis]
Length=600

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/540 (71%), Positives = 447/540 (83%), Gaps = 4/540 (1%)
 Frame = -2

Query  2007  SSSVVTLPEQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGV  1828
             +++V   P    P G+  AP   +WNLLQ+  + AL+  E ALVSREL++PLPKT DP V
Sbjct  64    TTAVAAPPSTSKPRGKQ-APV--RWNLLQKFASMALEAVEDALVSRELEQPLPKTSDPQV  120

Query  1827  QIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVT  1648
             QI+GNFAPVPEQ V ++LPV G +PDCI GVYVRNGANPL++P AGHHLFDGDGM+HAV 
Sbjct  121   QISGNFAPVPEQPVLHSLPVAGQIPDCIRGVYVRNGANPLYQPVAGHHLFDGDGMIHAVH  180

Query  1647  ITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHR  1468
             +  GS SY+CRFT+T R VQER LGRP+FPKAIGELHGH G+ARLLLFYARG  GL+DH 
Sbjct  181   LADGSASYACRFTKTHRFVQERDLGRPIFPKAIGELHGHFGIARLLLFYARGACGLLDHG  240

Query  1467  RGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVD  1288
              G G+ANAGLVYFNGRLLAMSEDDLPY VRV    DL T+GRYDF  QL STMIAHPKVD
Sbjct  241   HGIGVANAGLVYFNGRLLAMSEDDLPYRVRVTADSDLNTIGRYDFGGQLDSTMIAHPKVD  300

Query  1287  PESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQ  1108
             P SGE FALSYDV++KPYLKYF     G KSPDVEIPL  PTM+HDFAITE +V+IPDQQ
Sbjct  301   PVSGELFALSYDVVRKPYLKYFRFSPDGRKSPDVEIPLAEPTMMHDFAITEQFVVIPDQQ  360

Query  1107  VVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAET  928
             VVFKL EM+RGGS VIY+K K SRFGI+ K A +A GI W++ P+ FCFHLWNAWEE E+
Sbjct  361   VVFKLNEMVRGGSPVIYDKAKTSRFGIMDKYASDASGIRWIDVPDCFCFHLWNAWEEPES  420

Query  927   DEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMV  748
             DE+VVIGSCMTPPDSIFNE +E+LKS+LSEIRLNLKTG+ST+RPII    +QVNLEAGMV
Sbjct  421   DEVVVIGSCMTPPDSIFNEQDESLKSVLSEIRLNLKTGKSTRRPIIRDESEQVNLEAGMV  480

Query  747   NRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNS-  571
             NRN LGRKT++AYLA+AEPWPKVSGFAKVDL+TG+++KFMYG+ +YGGEP F+PR  +S 
Sbjct  481   NRNRLGRKTRFAYLALAEPWPKVSGFAKVDLATGQVRKFMYGEQRYGGEPLFLPREASSG  540

Query  570   EKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
               EDDG++L+FVHDEK W+SELQIVNA  LEL AT++LPSRVPYGFHGTFI++ DL  Q 
Sbjct  541   SGEDDGYVLAFVHDEKEWRSELQIVNAATLELEATVQLPSRVPYGFHGTFISAEDLAKQA  600



>gb|KFK38809.1| hypothetical protein AALP_AA3G162900 [Arabis alpina]
Length=599

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/495 (75%), Positives = 419/495 (85%), Gaps = 0/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E Q PLPKT DP VQIAGNFAPV EQ +R NLPV G +PD I GVYVRNGANPL  P 
Sbjct  104   SHERQHPLPKTSDPTVQIAGNFAPVNEQPLRRNLPVIGKIPDSIKGVYVRNGANPLHEPV  163

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R VQER LG+PVFPKAIGELHGH+G+AR
Sbjct  164   TGHHFFDGDGMVHAVKFDDGSASYACRFTQTNRFVQERQLGKPVFPKAIGELHGHTGIAR  223

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   GLVD   GTG+ANAGLVYFNGRLLAMSEDDLPY V + P+GDL+TVGR+D
Sbjct  224   LMLFYARAAAGLVDPAHGTGVANAGLVYFNGRLLAMSEDDLPYQVEITPTGDLKTVGRFD  283

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPK+DPESGE FALSYDV+ KPYLKYF     G KSPDVEI LD PTM+
Sbjct  284   FDGQLESTMIAHPKIDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEIQLDQPTMM  343

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITE +V+IPDQQVVFKL EMIRGGS V+Y+K K +RFGIL K AK++  I W+E+P
Sbjct  344   HDFAITEKFVVIPDQQVVFKLPEMIRGGSPVVYDKNKIARFGILDKYAKDSSEIKWIEAP  403

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE ETDEIVVIGSCMTPPDSIFNE +ENLKS+LSEIRLNLKTG ST+RP
Sbjct  404   DCFCFHLWNAWEEVETDEIVVIGSCMTPPDSIFNESDENLKSVLSEIRLNLKTGLSTRRP  463

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   +QQVNLEAGMVNRN+LGRKT+YAYLA+AEPWPKVSGFAKVDL+TGE++K +YGD 
Sbjct  464   IITDGEQQVNLEAGMVNRNMLGRKTKYAYLALAEPWPKVSGFAKVDLATGEVKKHLYGDN  523

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+P + N   ED+G+IL FVHDEKTWKSELQIVNA++LE+ AT+KLPSRVPYG
Sbjct  524   RYGGEPLFLPGDNNGGGEDEGYILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYG  583

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  QV
Sbjct  584   FHGTFIGANDLVKQV  598



>ref|XP_010499525.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Camelina sativa]
Length=593

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/572 (68%), Positives = 462/572 (81%), Gaps = 6/572 (1%)
 Frame = -2

Query  2091  VDLGLPSKSISMK--KPTRRAKIHCEAAVHSSS---VVTLPEQQLPDGESPAPSQPKWNl  1927
             +D   PS S+S    K  RR+K+    +  S S   +V  P    P+   P     +WN 
Sbjct  23    LDAPSPSSSVSFTDTKHGRRSKLSSTNSSISDSTTTLVNFPNYPSPNPVIPEKDTSRWNP  82

Query  1926  lqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDC  1747
             LQRA +AALD AE AL+ RE  +PLPKT DP  QI+GN+APVPEQ V+++L VDG +PDC
Sbjct  83    LQRAASAALDFAETALLKRERSKPLPKTIDPRHQISGNYAPVPEQPVKSSLSVDGKIPDC  142

Query  1746  INGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRP  1567
             I+GVY+RNGANPLF P +GHHLFDGDGMVHAV I  G  SYSCRFTETERLVQE+ +G P
Sbjct  143   IDGVYLRNGANPLFEPVSGHHLFDGDGMVHAVKIINGEASYSCRFTETERLVQEKQIGSP  202

Query  1566  VFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPY  1387
             +FPKAIGELHGHSG+ARL+LFYARGLFGL++H+ GTG+ANAGLVYF+ RLLAMSEDDLPY
Sbjct  203   IFPKAIGELHGHSGIARLMLFYARGLFGLLNHKNGTGVANAGLVYFHDRLLAMSEDDLPY  262

Query  1386  HVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSS  1207
              VR+  +GDLETVGR+DF+ QL S MIAHPK+DPE+ E FALSYDV++KPYLKYF     
Sbjct  263   QVRITDNGDLETVGRFDFDGQLNSAMIAHPKIDPETKELFALSYDVVKKPYLKYFRFSPD  322

Query  1206  GEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGI  1027
             GEKSPDVEIPL  PTM+HDFAITEN+V+IPDQQVVF+L +M  G S V Y+ +K SRFGI
Sbjct  323   GEKSPDVEIPLASPTMMHDFAITENFVVIPDQQVVFQLSDMFLGKSPVKYDGEKISRFGI  382

Query  1026  LKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSI  847
             L + AK+A  ++WVESPETFCFHLWNAWE  ETDE+VVIGSCMTP DSIFNEC+E L S+
Sbjct  383   LPRNAKDASEMVWVESPETFCFHLWNAWESPETDEVVVIGSCMTPADSIFNECDEQLDSV  442

Query  846   LSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFA  667
             LSEIRLNLKTG+ST+  IIP +D Q+NLEAGMVNRNLLGRKT+YAYLAIAEPWP+VSGFA
Sbjct  443   LSEIRLNLKTGKSTRITIIPGSD-QMNLEAGMVNRNLLGRKTRYAYLAIAEPWPRVSGFA  501

Query  666   KVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAI  487
             KVDLSTGE++   YG  K+GGEPFF+PR   S+ EDDG+I+SFVHDE++W SELQIVNA+
Sbjct  502   KVDLSTGEVKNHFYGGKKFGGEPFFLPRGLESDGEDDGYIMSFVHDEESWVSELQIVNAV  561

Query  486   NLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
              +EL AT+KLPSRVPYGFHGTF+ S D+ NQ 
Sbjct  562   TMELEATVKLPSRVPYGFHGTFVNSADMLNQA  593



>ref|XP_009399013.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=617

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/529 (71%), Positives = 442/529 (84%), Gaps = 3/529 (1%)
 Frame = -2

Query  1971  PDGESPAPSQPKWNllqravaaaldvaegalVSRELQRP--LPKTWDPGVQIAGNFAPVP  1798
             P     + ++P+WNL QR  A ALD  E   +S+ L+RP  LPKT DP VQIAGNFAPV 
Sbjct  90    PQSSDDSSARPEWNLFQRCAATALDAIEEVFISKVLERPHPLPKTADPAVQIAGNFAPVG  149

Query  1797  EQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSC  1618
             EQA  +NLPV+G +P  INGVYVRNGANPLF P AGHH FDGDGMVHAV +  GS +Y+C
Sbjct  150   EQAPCHNLPVEGRIPPFINGVYVRNGANPLFEPVAGHHFFDGDGMVHAVHLRNGSAAYAC  209

Query  1617  RFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGL  1438
             R+TETERL QER +G+PVFPKAIGELHGHSG+ARLLLFYAR LFGLVD   G G+ANAGL
Sbjct  210   RYTETERLRQERAIGKPVFPKAIGELHGHSGVARLLLFYARSLFGLVDGGHGMGVANAGL  269

Query  1437  VYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALS  1258
             +YFN RLLAMSEDD+PYHVRV PSGDLETV RYDF+ QL+S+MIAHPK+DP S E FALS
Sbjct  270   IYFNDRLLAMSEDDIPYHVRVTPSGDLETVERYDFHGQLRSSMIAHPKLDPSSRELFALS  329

Query  1257  YDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIR  1078
             YDVI+KPYLKYF     G KSPDV+IPLD PTM+HDFAITENYV++PDQQVVFKLQEMIR
Sbjct  330   YDVIKKPYLKYFYFSPDGNKSPDVDIPLDQPTMMHDFAITENYVVVPDQQVVFKLQEMIR  389

Query  1077  GGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCM  898
             GGS VIY++ K +RFG+L K A +A  + WV+ P+ FCFHLWNAWEE  T E+VVIGSCM
Sbjct  390   GGSPVIYDRTKTARFGVLPKYAADASEMRWVDVPDCFCFHLWNAWEEPATGEVVVIGSCM  449

Query  897   TPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQ  718
             TPPDS+FNECEE+LKS+LSEIRL+L TG+ST+RPI+   D Q+NLEAGMVNRN+LGRKT+
Sbjct  450   TPPDSVFNECEESLKSVLSEIRLDLNTGKSTRRPILSPAD-QLNLEAGMVNRNMLGRKTR  508

Query  717   YAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSF  538
             YAYLAIAEPWPKVSGFAKVDL TG + KF++GDGKYGGEP+FVPR+P S +EDDG++LSF
Sbjct  509   YAYLAIAEPWPKVSGFAKVDLCTGAVSKFIFGDGKYGGEPYFVPRDPKSSREDDGYVLSF  568

Query  537   VHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +H+E T +SEL IVNA +++L A +KLPSRVPYGFHGTFI S DL++Q 
Sbjct  569   MHNENTSESELLIVNAADMQLEAAVKLPSRVPYGFHGTFIASRDLESQA  617



>gb|AIG92852.1| 9-cis-epoxycarotenoid dioxygenase [Malus prunifolia]
Length=614

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/565 (70%), Positives = 454/565 (80%), Gaps = 15/565 (3%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqravaa  1906
             + +P +S S ++P+   KI  E     S   +           P P Q  WNLLQRA + 
Sbjct  65    IQIPKRSPSYQQPSTPTKIPREDKTQKSKTSS----------KPVPQQ--WNLLQRAASM  112

Query  1905  aldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVR  1726
             ALD+ E AL+S+E Q PLPKT DP VQIAGNFAPVPE  V ++LPV G +PD I GVYVR
Sbjct  113   ALDIMESALLSKEKQTPLPKTSDPKVQIAGNFAPVPEHPVEHSLPVTGKIPDSIQGVYVR  172

Query  1725  NGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIG  1546
             NGANPL  P AGHHLFDGDGMVHA+    G+ SY+CRFTET R+ QER LGRP+FPKAIG
Sbjct  173   NGANPLHEPVAGHHLFDGDGMVHALQFKDGTASYACRFTETHRMSQERDLGRPLFPKAIG  232

Query  1545  ELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPS  1366
             ELHGHSG ARLLLFYARG+FGLVD   G G+ANAGLVY NG LLAMSEDDLPYHV++  +
Sbjct  233   ELHGHSGTARLLLFYARGMFGLVDPSHGIGVANAGLVYHNGHLLAMSEDDLPYHVQITET  292

Query  1365  GDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDV  1186
             GDL+TVGRYDF  QLKSTMIAHPKVDP +GE FALSYDV+QKPYLKYF    SG+KSPDV
Sbjct  293   GDLKTVGRYDFEGQLKSTMIAHPKVDPATGELFALSYDVVQKPYLKYFKFSPSGDKSPDV  352

Query  1185  EIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKN  1006
             EI L+ PTM+HDFAITE +V+IPDQQVVFKLQEMI GGS VIY+K K SRFGIL K AK+
Sbjct  353   EINLEQPTMMHDFAITERHVVIPDQQVVFKLQEMIGGGSPVIYDKNKMSRFGILDKNAKD  412

Query  1005  AEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLN  826
             A GI WV+ P+ FCFHLWNAWEE ETDEIVVIGSCMTPPDSIFNEC+ENL+S+LSE RLN
Sbjct  413   ASGIQWVDCPDCFCFHLWNAWEEPETDEIVVIGSCMTPPDSIFNECDENLESVLSETRLN  472

Query  825   LKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTG  646
             LK  +ST R I     + +NLEAGMVNRN LGRKT++ YLA+AEPWPKVSGFAKVDLSTG
Sbjct  473   LKAEKSTCRRICA---ENLNLEAGMVNRNRLGRKTRFTYLALAEPWPKVSGFAKVDLSTG  529

Query  645   EMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLAT  466
             E++K +YG+ KYGGEP F+PR+PNSE EDDG+IL+FVHDEK WKSELQIVNA++L++ AT
Sbjct  530   EVKKHIYGEEKYGGEPLFLPRDPNSENEDDGYILAFVHDEKEWKSELQIVNAMDLKVEAT  589

Query  465   IKLPSRVPYGFHGTFITSYDLQNQV  391
             I+LPSRVPYGFHGTFI++ DL+ Q 
Sbjct  590   IQLPSRVPYGFHGTFISAKDLEMQA  614



>gb|EYU38203.1| hypothetical protein MIMGU_mgv1a003133mg [Erythranthe guttata]
Length=605

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/498 (74%), Positives = 425/498 (85%), Gaps = 4/498 (1%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             + EL  PLPKT DPGVQIAGNF+PVPE  V ++LPV G +P+ + GVYVRNGANPL  P+
Sbjct  109   AHELGLPLPKTADPGVQIAGNFSPVPEHPVTHSLPVVGKIPESVRGVYVRNGANPLLEPQ  168

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             AGHH FDGDGM+HAV    G+ SYSCRFTET+RLVQER LGR +FPKAIGELHGHSG+AR
Sbjct  169   AGHHFFDGDGMIHAVQFADGAASYSCRFTETQRLVQERALGRSIFPKAIGELHGHSGIAR  228

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYARGLF LVDH +G+G+ANAG+VYFN RLLAMSEDDLPYHV + P+GDL+TVGRY 
Sbjct  229   LMLFYARGLFKLVDHGQGSGVANAGVVYFNNRLLAMSEDDLPYHVSITPAGDLKTVGRYS  288

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL STMIAHPK+DP SGE FALSYDV+QKPYLKYF    +GEKS DVEIPL  PTM+
Sbjct  289   FDGQLNSTMIAHPKIDPVSGELFALSYDVVQKPYLKYFRFSKTGEKSADVEIPLAEPTMM  348

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+VIIPDQQVVFKL EMIRGGS V+Y+K+K  RFG+L K + ++  + WV  P
Sbjct  349   HDFAITENHVIIPDQQVVFKLSEMIRGGSPVVYDKEKVCRFGVLNKYSSDSSEMKWVNVP  408

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE ETDEIVVIGSCMTPPDSIFNEC+E LKS+LSEIRLNLKTGEST++P
Sbjct  409   DCFCFHLWNAWEELETDEIVVIGSCMTPPDSIFNECDEGLKSVLSEIRLNLKTGESTRKP  468

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             I+  T +QVNLEAGMVNRN LGRKT++AYLAIAEPWPKVSGFAKVDL TGE++KFMYGD 
Sbjct  469   ILSET-EQVNLEAGMVNRNKLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGEVKKFMYGDD  527

Query  615   KYGGEPFFVPRN-PNS--EKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRV  445
             KYGGEP F+PR+ PNS  E+EDDG+IL+F HDEK  KSELQIVNA+ +EL A++KLPSRV
Sbjct  528   KYGGEPLFLPRDYPNSSDEEEDDGYILAFSHDEKNSKSELQIVNAVTMELEASVKLPSRV  587

Query  444   PYGFHGTFITSYDLQNQV  391
             PYGFHGTFI   +L NQ 
Sbjct  588   PYGFHGTFIGDKELANQA  605



>ref|XP_007149219.1| hypothetical protein PHAVU_005G051600g [Phaseolus vulgaris]
 gb|ESW21213.1| hypothetical protein PHAVU_005G051600g [Phaseolus vulgaris]
Length=615

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/528 (73%), Positives = 439/528 (83%), Gaps = 6/528 (1%)
 Frame = -2

Query  1974  LPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPE  1795
             L D + P P   KWN LQ+A A ALD+ E ALVS E + PLPKT DP VQIAGNFAPVPE
Sbjct  94    LSDTKQPFPQ--KWNFLQKAAATALDMVETALVSHESKHPLPKTADPRVQIAGNFAPVPE  151

Query  1794  QAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCR  1615
              A    LPV G +P CI+GVYVRNGANPL+ P AGHH FDGDGMVHAV  T G+ SY+CR
Sbjct  152   HAADQALPVVGKIPKCIDGVYVRNGANPLYEPVAGHHFFDGDGMVHAVKFTNGAASYACR  211

Query  1614  FTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLV  1435
             FTET+RL QE+ LGRPVFPKAIGELHGHSG+ARLLLFYAR LF LVD   G G+ANAGLV
Sbjct  212   FTETQRLAQEKSLGRPVFPKAIGELHGHSGIARLLLFYARSLFQLVDGSHGMGVANAGLV  271

Query  1434  YFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSY  1255
             YFN  LLAMSEDDLPYHVR+  +GDL TVGRYDFN QL STMIAHPK+DP +G+  ALSY
Sbjct  272   YFNNHLLAMSEDDLPYHVRITSNGDLTTVGRYDFNGQLNSTMIAHPKLDPVNGDLHALSY  331

Query  1254  DVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRG  1075
             DV+QKPYLKYF   + G KSPDVEIPL  PTM+HDFAITEN+V++PDQQVVFKL EMI G
Sbjct  332   DVVQKPYLKYFRFSADGVKSPDVEIPLKEPTMMHDFAITENFVVVPDQQVVFKLTEMITG  391

Query  1074  GSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMT  895
             GS V+Y+K K SRFGIL K AK+A  + W+++PE FCFHLWNAWEE ETDEIVVIGSCMT
Sbjct  392   GSPVVYDKNKTSRFGILDKNAKDANAMRWIDAPECFCFHLWNAWEEPETDEIVVIGSCMT  451

Query  894   PPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQY  715
             P DSIFNEC+E+LKS+LSEIRLNL+TG+ST+RPII +  +QVNLEAGMVNRN LGRKTQ+
Sbjct  452   PADSIFNECDESLKSVLSEIRLNLRTGKSTRRPII-SDAEQVNLEAGMVNRNKLGRKTQF  510

Query  714   AYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFV  535
             AYLA+AEPWPKVSGFAKVDL +GE+QK+MYG+ K+GGEP F+   PN E+E DG+IL+FV
Sbjct  511   AYLALAEPWPKVSGFAKVDLFSGEVQKYMYGEEKFGGEPLFL---PNGEEEGDGYILAFV  567

Query  534   HDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             HDEK WKSELQIVNA NL+L A+IKLPSRVPYGFHGTFI S DL+ Q 
Sbjct  568   HDEKEWKSELQIVNAQNLKLEASIKLPSRVPYGFHGTFIHSKDLRKQA  615



>dbj|BAF36655.1| putative 9-cis-epoxycarotenoid dioxygenase [Chrysanthemum x morifolium]
Length=601

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/572 (68%), Positives = 461/572 (81%), Gaps = 18/572 (3%)
 Frame = -2

Query  2067  SISMKKP---TRRAKIHCEAAVHSSSVVTLPEQ---------QLPDGESPAPSQPK-WNl  1927
             S+++KK    TR+  I   +A+ + S++ +P+Q         +LP   SP+P  P+ WNL
Sbjct  35    SVTVKKQGNQTRQNSI--RSALQTPSILQVPKQTPRKTSKTIELP-SLSPSPKVPQNWNL  91

Query  1926  lqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDC  1747
             LQ+  + ALD  E  +   E   PLPKT DP VQIAGNF+PVPEQ VR++LPV G +P+ 
Sbjct  92    LQKLASIALDAIEDRIKDNEKLHPLPKTVDPDVQIAGNFSPVPEQPVRHSLPVAGKIPEH  151

Query  1746  INGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRP  1567
              NGVY+RNGANPLF P +GHHLFDGDGM++AV    GS SY+CR TET RLVQER +G+P
Sbjct  152   FNGVYLRNGANPLFEPTSGHHLFDGDGMIYAVKFDNGSASYACRHTETHRLVQERAIGKP  211

Query  1566  VFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPY  1387
             VFPKAIGELHGHSG+A+LLLFYARGL GLVDH  G G+ANAGLVYFN RLLAMSEDDLPY
Sbjct  212   VFPKAIGELHGHSGIAKLLLFYARGLCGLVDHNNGIGVANAGLVYFNNRLLAMSEDDLPY  271

Query  1386  HVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSS  1207
             HVRV PSGDL+T GRY+FN QL+STMIAHPK+DP SGE FALSYDVI+KPYLKYF     
Sbjct  272   HVRVTPSGDLKTAGRYNFNGQLESTMIAHPKLDPVSGELFALSYDVIKKPYLKYFWFSPD  331

Query  1206  GEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGI  1027
             G+KS DVEI L+ PTM+HDFAITENYV++PD QVVFK+ EM+ GGS V+Y+K+K SRFG+
Sbjct  332   GKKSDDVEIDLEKPTMVHDFAITENYVVVPDHQVVFKMSEMVTGGSPVVYDKEKVSRFGV  391

Query  1026  LKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSI  847
             L K AKN  GI WVE P+ FCFHLWNAWEE E+DE+VVIGSCMTP DSIFNEC E LKS+
Sbjct  392   LDKYAKNGSGIKWVEVPDCFCFHLWNAWEEPESDEVVVIGSCMTPADSIFNECNEELKSV  451

Query  846   LSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFA  667
             LSEIRLNLKTG+ST+R II + +  VNLEAGMVN+NLLGRK++YAYLAIAEPWPKVSGFA
Sbjct  452   LSEIRLNLKTGKSTRRAII-SPENDVNLEAGMVNKNLLGRKSKYAYLAIAEPWPKVSGFA  510

Query  666   KVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAI  487
             KVDLSTGE +KF+YGD KYGGEP ++PR+ N+  EDDGHIL+FVHDEK WKSELQIVNA 
Sbjct  511   KVDLSTGETKKFIYGDEKYGGEPLYLPRD-NASDEDDGHILAFVHDEKAWKSELQIVNAK  569

Query  486   NLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
              ++L AT+ LPSRVPYGFHGTFI + DL +Q 
Sbjct  570   TMKLEATVMLPSRVPYGFHGTFIPARDLASQA  601



>sp|Q9M6E8.1|NCED1_PHAVU RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic; 
AltName: Full=PvNCED1; Flags: Precursor [Phaseolus 
vulgaris]
 gb|AAF26356.1|AF190462_1 9-cis-epoxycarotenoid dioxygenase [Phaseolus vulgaris]
Length=615

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/528 (73%), Positives = 438/528 (83%), Gaps = 6/528 (1%)
 Frame = -2

Query  1974  LPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPE  1795
             L D + P P   KWN LQ+A A  LD+ E ALVS E + PLPKT DP VQIAGNFAPVPE
Sbjct  94    LSDTKQPFPQ--KWNFLQKAAATGLDMVETALVSHESKHPLPKTADPKVQIAGNFAPVPE  151

Query  1794  QAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCR  1615
              A    LPV G +P CI+GVYVRNGANPL+ P AGHH FDGDGMVHAV  T G+ SY+CR
Sbjct  152   HAADQALPVVGKIPKCIDGVYVRNGANPLYEPVAGHHFFDGDGMVHAVKFTNGAASYACR  211

Query  1614  FTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLV  1435
             FTET+RL QE+ LGRPVFPKAIGELHGHSG+ARLLLFYAR LF LVD   G G+ANAGLV
Sbjct  212   FTETQRLAQEKSLGRPVFPKAIGELHGHSGIARLLLFYARSLFQLVDGSHGMGVANAGLV  271

Query  1434  YFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSY  1255
             YFN  LLAMSEDDLPYHVR+  +GDL TVGRYDFN QL STMIAHPK+DP +G+  ALSY
Sbjct  272   YFNNHLLAMSEDDLPYHVRITSNGDLTTVGRYDFNGQLNSTMIAHPKLDPVNGDLHALSY  331

Query  1254  DVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRG  1075
             DV+QKPYLKYF   + G KSPDVEIPL  PTM+HDFAITEN+V++PDQQVVFKL EMI G
Sbjct  332   DVVQKPYLKYFRFSADGVKSPDVEIPLKEPTMMHDFAITENFVVVPDQQVVFKLTEMITG  391

Query  1074  GSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMT  895
             GS V+Y+K K SRFGIL K AK+A  + W+++PE FCFHLWNAWEE ETDEIVVIGSCMT
Sbjct  392   GSPVVYDKNKTSRFGILDKNAKDANAMRWIDAPECFCFHLWNAWEEPETDEIVVIGSCMT  451

Query  894   PPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQY  715
             P DSIFNEC+E+LKS+LSEIRLNL+TG+ST+RPII +  +QVNLEAGMVNRN LGRKTQ+
Sbjct  452   PADSIFNECDESLKSVLSEIRLNLRTGKSTRRPII-SDAEQVNLEAGMVNRNKLGRKTQF  510

Query  714   AYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFV  535
             AYLA+AEPWPKVSGFAKVDL +GE+QK+MYG+ K+GGEP F+   PN E+E DG+IL+FV
Sbjct  511   AYLALAEPWPKVSGFAKVDLFSGEVQKYMYGEEKFGGEPLFL---PNGEEEGDGYILAFV  567

Query  534   HDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             HDEK WKSELQIVNA NL+L A+IKLPSRVPYGFHGTFI S DL+ Q 
Sbjct  568   HDEKEWKSELQIVNAQNLKLEASIKLPSRVPYGFHGTFIHSKDLRKQA  615



>ref|XP_004504912.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like, 
partial [Cicer arietinum]
Length=586

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/584 (68%), Positives = 467/584 (80%), Gaps = 26/584 (4%)
 Frame = -2

Query  2091  VDLGLPSKS-ISMK-KPTRRAKIHCEAAVHSSSVVTLPEQ----------QLPDGESPAP  1948
             +DLGL  KS + +K KP R+     E A+HS SV+  P+Q            P+     P
Sbjct  11    IDLGLYIKSTVKLKMKPNRKV---LECALHSPSVLDFPKQPYINPLITKENTPETIIKKP  67

Query  1947  SQP-KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLP  1771
              +  +WN +Q+A A AL++ E AL+SRELQ PLPKT DP +QIAGNFAPVPEQ V ++LP
Sbjct  68    KESSQWNPIQKAAAMALNMFESALLSRELQHPLPKTSDPRIQIAGNFAPVPEQPVVHSLP  127

Query  1770  VDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLV  1591
             V G +PDC+NGVY+RNGANP+F P +GHHLFDGDGMVHAVTI  G+ SY+CRFTETERLV
Sbjct  128   VTGTIPDCVNGVYLRNGANPMFEPVSGHHLFDGDGMVHAVTINDGAASYACRFTETERLV  187

Query  1590  QERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLA  1411
             QER LGR +FPKAIGELHGHSG+ARLLLFYARGLFG+VDHR G G+ANAGLVYFN +LLA
Sbjct  188   QERQLGRAMFPKAIGELHGHSGIARLLLFYARGLFGIVDHRHGAGVANAGLVYFNNKLLA  247

Query  1410  MSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYL  1231
             MSEDDLPY + + PSGDL T+GRY+F +QL STMIAHPK+DP SGE FALSYDV  +PYL
Sbjct  248   MSEDDLPYELTITPSGDLRTIGRYNFLNQLHSTMIAHPKIDPVSGELFALSYDV-ARPYL  306

Query  1230  KYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEK  1051
             KYF     G+KSPDVEI L VPTM HDFAITEN+V+IPD QVVFKL EMI+GGS VI++ 
Sbjct  307   KYFRFTPDGKKSPDVEIRLPVPTMTHDFAITENFVVIPDHQVVFKLDEMIKGGSPVIFDG  366

Query  1050  KKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNE  871
              KKSRFG+L K AK+   IIWVESP+TFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNE
Sbjct  367   AKKSRFGVLPKYAKDCSSIIWVESPDTFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNE  426

Query  870   CEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEP  691
              +E+LKS+LSEIRLNLKTGEST+R +IP     +NLEAGMVNRN LGRKT++AYLA+AEP
Sbjct  427   SDESLKSVLSEIRLNLKTGESTRRCLIP----NMNLEAGMVNRNRLGRKTRFAYLAVAEP  482

Query  690   WPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVP-----RNPNSEKEDDGHILSFVHDE  526
             WPKVSGFAKVDL +GE++   YGDG+YGGEPFF+P     R      EDDG+I+  VHDE
Sbjct  483   WPKVSGFAKVDLVSGEVKTHSYGDGRYGGEPFFLPTGSSGRCEYENGEDDGYIVVLVHDE  542

Query  525   KTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             +  KSEL+IVNA++L++ AT+KLPSRVPYGFHGTF+ + DL  Q
Sbjct  543   RRCKSELEIVNAVDLKVEATVKLPSRVPYGFHGTFVEAKDLALQ  586



>dbj|BAF36657.2| putative 9-cis-epoxycarotenoid dioxygenase [Chrysanthemum x morifolium]
Length=582

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/545 (70%), Positives = 446/545 (82%), Gaps = 8/545 (1%)
 Frame = -2

Query  2019  AAVHSSSVVTLPEQ---QLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLP  1849
              A+ S S+ + P++   +LP    P      WN+ Q+  A ALD  E +L+ +E + PLP
Sbjct  42    CALQSHSITSFPKESPFELPKSNFPD----SWNIFQKISALALDAVETSLIKQEQKHPLP  97

Query  1848  KTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGD  1669
             KT +P +QI+GNFAPVPEQ VR++LPV G +P  I+GVY+RNGANPLF P +GHHLFDGD
Sbjct  98    KTANPDIQISGNFAPVPEQPVRHHLPVQGTIPRHIDGVYLRNGANPLFEPISGHHLFDGD  157

Query  1668  GMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGL  1489
             GM++AV    G  SY+CRFTET+RLVQER +G+PVFPKAIG+LHGHSG+A+LLLFYARGL
Sbjct  158   GMIYAVKFDQGEASYACRFTETQRLVQERAIGKPVFPKAIGKLHGHSGIAKLLLFYARGL  217

Query  1488  FGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTM  1309
              GLVDH  G G+ANAGLVYFN RLLAMSEDDLPY V+V  +GDL+TVGRY+F++QLKSTM
Sbjct  218   CGLVDHSHGIGVANAGLVYFNNRLLAMSEDDLPYEVKVTSNGDLKTVGRYNFDEQLKSTM  277

Query  1308  IAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENY  1129
             IAHPKVDP SGE FALSYDV++KPYLKYF     G KS DV I L  PTM+HDFAITENY
Sbjct  278   IAHPKVDPVSGELFALSYDVVKKPYLKYFRFSPDGVKSKDVAIDLGKPTMVHDFAITENY  337

Query  1128  VIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWN  949
             V++PD QVVFKL EMI GGS V+Y+K+K SRFG+L K A++  GI WVE P+ FCFHLWN
Sbjct  338   VVVPDHQVVFKLSEMITGGSPVVYDKEKVSRFGVLDKYAEDGSGIKWVEVPDCFCFHLWN  397

Query  948   AWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQV  769
             AWEE E DE+VVIGSCMTP DSIFNE  E LK +LSEIRLNLKTG+ST+RPII A +  V
Sbjct  398   AWEEPENDEVVVIGSCMTPADSIFNESNEELKGVLSEIRLNLKTGKSTRRPII-APENDV  456

Query  768   NLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFV  589
             NLEAGMVN+NLLGRKT++AYLAIAEPWPKVSGFAKVDL TGE +KF+YGD KYGGEP F+
Sbjct  457   NLEAGMVNKNLLGRKTKFAYLAIAEPWPKVSGFAKVDLQTGETKKFIYGDEKYGGEPLFL  516

Query  588   PRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSY  409
             PR+PNSE EDDGHIL+FVHDEKTWKSELQIVNA+ LEL A +KLPSRVPYGFHGTFI++ 
Sbjct  517   PRDPNSEAEDDGHILAFVHDEKTWKSELQIVNAMTLELEAVVKLPSRVPYGFHGTFISAK  576

Query  408   DLQNQ  394
             DL  Q
Sbjct  577   DLATQ  581



>dbj|BAE92965.1| 9-cis-epoxycarotenoid dioxygenase [Citrus limon]
Length=569

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/507 (76%), Positives = 433/507 (85%), Gaps = 3/507 (1%)
 Frame = -2

Query  1983  EQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAP  1804
             +QQ  + ++ APS  KWN LQ+A A ALD  E ALVS+E Q PLPKT DP VQIAGNF+P
Sbjct  66    KQQPKENDNFAPS--KWNFLQKAAALALDAVENALVSQERQHPLPKTADPTVQIAGNFSP  123

Query  1803  VPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSY  1624
             VP++ V  NLP  G VPDCI GVYVRNGANPL  P AGHH FDGDGMVHAV    GSVSY
Sbjct  124   VPQKPVCQNLPTTGKVPDCIQGVYVRNGANPLHEPVAGHHFFDGDGMVHAVKFNEGSVSY  183

Query  1623  SCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANA  1444
             SCRFTET R VQER LGRPVFPKAIGELHGH+G+ARLLLFY+R LFGLVD   GTG+ANA
Sbjct  184   SCRFTETNRFVQERSLGRPVFPKAIGELHGHTGIARLLLFYSRALFGLVDPSHGTGVANA  243

Query  1443  GLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFA  1264
             GLVYFN RLLAMSEDDLPYHVRV PSGDL+TVGR+DF+ QLKSTMIAHPKVDP +G+FFA
Sbjct  244   GLVYFNNRLLAMSEDDLPYHVRVTPSGDLKTVGRFDFSGQLKSTMIAHPKVDPVTGDFFA  303

Query  1263  LSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEM  1084
             LSYDVI+KPYLKYF     G KSPDVEIPL+ PTM+HDFAITEN+V++PDQQVVFKL EM
Sbjct  304   LSYDVIKKPYLKYFRFSPQGIKSPDVEIPLEEPTMMHDFAITENFVVVPDQQVVFKLNEM  363

Query  1083  IRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGS  904
             IRGGS VIY+K K SRFGIL K A +A  + W+++P+ FCFHLWNAWEE E DE+VVIGS
Sbjct  364   IRGGSPVIYDKNKVSRFGILDKNATDASKMKWIDAPDCFCFHLWNAWEEPERDEVVVIGS  423

Query  903   CMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRK  724
             CMTP DSIFNEC+E+LKS+LSEIRLNLKTGEST+RPII + D+QVNLEAGMVNRNLLGRK
Sbjct  424   CMTPADSIFNECDESLKSVLSEIRLNLKTGESTRRPII-SEDEQVNLEAGMVNRNLLGRK  482

Query  723   TQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHIL  544
             T++AYLA+AEPWPKVSGFAKVDL TG++ KF+YGD +YGGEP F PR+PNSE EDDG+IL
Sbjct  483   TRFAYLALAEPWPKVSGFAKVDLLTGQVNKFIYGDQRYGGEPLFFPRDPNSENEDDGYIL  542

Query  543   SFVHDEKTWKSELQIVNAINLELLATI  463
             +FVHDEK WKSELQIVNA+ LEL AT+
Sbjct  543   AFVHDEKEWKSELQIVNAMTLELEATV  569



>dbj|BAC10551.1| nine-cis-epoxycarotenoid dioxygenase3 [Pisum sativum]
Length=608

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/574 (68%), Positives = 467/574 (81%), Gaps = 22/574 (4%)
 Frame = -2

Query  2067  SISMKKPTRRAKIHCEAAVHSSSVVTLPEQQ----LPDGESPAPS---QPK----WNllq  1921
             ++ +KKP R+  +  + AVHS SV+  P+Q     L + E+   +   +PK    WN LQ
Sbjct  41    TLKLKKPNRKMLL-LQCAVHSPSVLDYPKQSYKQPLINKENDTETIIHKPKESSQWNPLQ  99

Query  1920  ravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCIN  1741
             +A A AL++ E AL+SRELQ PLPKT DP +QIAGNFAPVPEQ V ++LPV G +P C+N
Sbjct  100   KAAAIALNMFESALLSRELQYPLPKTSDPRIQIAGNFAPVPEQPVVHSLPVTGKIPRCVN  159

Query  1740  GVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVF  1561
             GVYVRNGANP+F P +GHHLFDGDGMVHAVT+  G  SY+CRFTETERLVQER LGR +F
Sbjct  160   GVYVRNGANPMFEPVSGHHLFDGDGMVHAVTMNDGVASYACRFTETERLVQERELGRAMF  219

Query  1560  PKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHV  1381
             PKAIGELHGHSG+ARL+LFYAR L G+VDHRRG+G+ANAGLVYF+G+LLAMSEDDLPY +
Sbjct  220   PKAIGELHGHSGIARLMLFYARSLCGIVDHRRGSGVANAGLVYFDGKLLAMSEDDLPYEL  279

Query  1380  RVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGE  1201
             ++ P GDL+TVGRY F DQL STMIAHPK+DP SGE FALSY+V  +PYLKYF     G+
Sbjct  280   QITPYGDLKTVGRYSFLDQLHSTMIAHPKIDPISGELFALSYEV-ARPYLKYFRFSPDGK  338

Query  1200  KSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILK  1021
             KSPDVEI L VPTMIHDFAITENYV+IPD QVVFKL+EMI+G S VI++  KKSRFG+L 
Sbjct  339   KSPDVEIRLSVPTMIHDFAITENYVVIPDHQVVFKLEEMIKGCSPVIFDGAKKSRFGVLP  398

Query  1020  KTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILS  841
             K AK+A  IIWV+SP+TFCFHLWNAWEE E DEIVVIGSCMTPPDSIFNE +ENLKS+LS
Sbjct  399   KYAKDASSIIWVDSPDTFCFHLWNAWEEPEADEIVVIGSCMTPPDSIFNESDENLKSVLS  458

Query  840   EIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKV  661
             EIRLNLKTG+ST+R I+P    Q+NLEAGMVNRN LGRKT++AYLA+AEPWPKVSGFAKV
Sbjct  459   EIRLNLKTGKSTRRSIVP----QMNLEAGMVNRNRLGRKTRFAYLAVAEPWPKVSGFAKV  514

Query  660   DLSTGEMQKFMYGDGKYGGEPFFVP-----RNPNSEKEDDGHILSFVHDEKTWKSELQIV  496
             DL +GE++K  YGDG++GGEPFF+P     R     +ED G+I++ VHDE+  KSELQIV
Sbjct  515   DLESGEVKKHSYGDGRFGGEPFFLPTRRSGRCEYENEEDGGYIMALVHDERRCKSELQIV  574

Query  495   NAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             NA+NLE+ AT+KLPSRVPYGFHGTF+ + DL  Q
Sbjct  575   NAVNLEVEATVKLPSRVPYGFHGTFVEAKDLTFQ  608



>gb|AEN94304.1| 9-cis-epoxycarotenoid dioxygenase [Brassica napus]
Length=592

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/574 (69%), Positives = 457/574 (80%), Gaps = 14/574 (2%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPA---------PSQPKW  1933
             L  P  SI M    +R K++  +A+H+   +  P+Q      SPA         P   + 
Sbjct  24    LSSPQNSIPMTSRVQR-KLNVSSALHTPPALHFPKQPT---NSPAIAVNPKAKEPDTKQM  79

Query  1932  NllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVP  1753
             NL QRA A+ALD AEG LVS E Q  LPKT DP VQIAGNFAPV EQ VR NLPV G +P
Sbjct  80    NLFQRAAASALDAAEGLLVSHERQHQLPKTADPSVQIAGNFAPVNEQPVRRNLPVVGKIP  139

Query  1752  DCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLG  1573
             D I GVYVRNGANPL  P  GHH FDGDGMVHAV    G+ SY+CRFT+T R +QER LG
Sbjct  140   DSIKGVYVRNGANPLHEPVTGHHFFDGDGMVHAVKFEDGTASYACRFTQTNRFIQERRLG  199

Query  1572  RPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDL  1393
             RPVFPKAIGELHGH+G+ARL+LFYAR   GLVD   GTG+ANAGLVYFN RLLAMSEDDL
Sbjct  200   RPVFPKAIGELHGHTGIARLMLFYARAAAGLVDPAHGTGVANAGLVYFNNRLLAMSEDDL  259

Query  1392  PYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVK  1213
             PY VR+ PSGDL+TVGRYDFN QL+STMIAHPKVDPESGE FALSYDV+ KP+LKYF   
Sbjct  260   PYQVRITPSGDLKTVGRYDFNGQLESTMIAHPKVDPESGELFALSYDVVSKPFLKYFRFS  319

Query  1212  SSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRF  1033
               G KSPDVEI LD PTM+HDFAITEN+V+IPDQQVVFKL EMIRGGS V+Y+K+K +RF
Sbjct  320   PEGIKSPDVEINLDQPTMMHDFAITENFVVIPDQQVVFKLPEMIRGGSPVVYDKEKVARF  379

Query  1032  GILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLK  853
             G+L K A ++  I W+E+ E FCFHLWNAWEE ET+EIVVIGSCMTPPDSIFNE +ENL+
Sbjct  380   GVLDKYAGDSSAIRWIEAQECFCFHLWNAWEEPETEEIVVIGSCMTPPDSIFNEADENLE  439

Query  852   SILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSG  673
             S+LSEIRLNL+TGEST+RPII   ++QVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSG
Sbjct  440   SVLSEIRLNLRTGESTRRPIISDGEEQVNLEAGMVNRNMLGRKTRFAYLALAEPWPKVSG  499

Query  672   FAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVN  493
             FAKVDL TGE++K++YG  +YGGEP F+P + N   EDDG+IL FVHDE+TWKSELQIVN
Sbjct  500   FAKVDLFTGEVKKYLYGGDRYGGEPLFLPGDEN-RAEDDGYILCFVHDEETWKSELQIVN  558

Query  492   AINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             A++LE+ AT+KLPSRVPYGFHGTFI + DL  QV
Sbjct  559   AVSLEVEATVKLPSRVPYGFHGTFIGANDLATQV  592



>ref|XP_006407071.1| hypothetical protein EUTSA_v10020337mg [Eutrema salsugineum]
 gb|ESQ48524.1| hypothetical protein EUTSA_v10020337mg [Eutrema salsugineum]
Length=601

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/496 (74%), Positives = 419/496 (84%), Gaps = 1/496 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E Q PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P 
Sbjct  106   SHERQHPLPKTADPSVQIAGNFAPVNEQPVRRNLPVVGIIPDSIKGVYVRNGANPLHEPV  165

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R +QER LGRPVFPKAIGELHGH+G+AR
Sbjct  166   TGHHFFDGDGMVHAVKFEDGSASYACRFTQTNRFIQERQLGRPVFPKAIGELHGHTGIAR  225

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   G+VD   GTG+ANAGLVYFNGRLLAMSEDDLPY V++   GDL+TVGRYD
Sbjct  226   LMLFYARAAAGIVDPAHGTGVANAGLVYFNGRLLAMSEDDLPYQVQITQGGDLKTVGRYD  285

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVEI LD PTM+
Sbjct  286   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEIQLDQPTMM  345

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITE +V+IPDQQVVFKL EMIRGGS V+Y++ K +RFGIL K A+++  I W+++P
Sbjct  346   HDFAITEKFVVIPDQQVVFKLPEMIRGGSPVVYDENKVARFGILDKYAEDSSKIRWIDAP  405

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE ET+EIVVIGSCMTPPDSIFNE +ENLKS+LSEIRLNLKTGEST+RP
Sbjct  406   DCFCFHLWNAWEEPETEEIVVIGSCMTPPDSIFNEYDENLKSVLSEIRLNLKTGESTRRP  465

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   +QQVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDL+TGE++K +YGD 
Sbjct  466   IISDGEQQVNLEAGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLATGEVKKHLYGDN  525

Query  615   KYGGEPFFVPRN-PNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPY  439
             +YGGEP F+P +  N+  EDDGHIL FVHDEKTWKSELQIVNA+ LE+ AT+KLPSRVPY
Sbjct  526   RYGGEPLFLPGDEKNNGGEDDGHILCFVHDEKTWKSELQIVNAVTLEVEATVKLPSRVPY  585

Query  438   GFHGTFITSYDLQNQV  391
             GFHGTFI + DL  QV
Sbjct  586   GFHGTFIGANDLAQQV  601



>emb|CDX88443.1| BnaC06g38870D [Brassica napus]
Length=602

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/495 (74%), Positives = 424/495 (86%), Gaps = 4/495 (1%)
 Frame = -2

Query  1875  SRELQR-PLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRP  1699
             S E +R PLPKT DP VQIAGNF PVPEQ V++NLPV G VP+CI GVYVRNGANPL +P
Sbjct  108   SHERRRHPLPKTADPAVQIAGNFFPVPEQPVKHNLPVTGTVPECIQGVYVRNGANPLHKP  167

Query  1698  KAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLA  1519
              +GHHLFDGDGMVHAV    GSVSYSCRFTET R VQER LGR VFPKAIGELHGH G+A
Sbjct  168   ISGHHLFDGDGMVHAVRFNNGSVSYSCRFTETNRFVQERELGRSVFPKAIGELHGHLGIA  227

Query  1518  RLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRY  1339
             +L+LF ARGLFGLVD  RG G+ANAGLVYFNG LLAMSEDDLPYHV+V  +GDLET GRY
Sbjct  228   KLMLFNARGLFGLVDPTRGLGVANAGLVYFNGHLLAMSEDDLPYHVKVTQTGDLETSGRY  287

Query  1338  DFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTM  1159
             DF+ QLKSTMIAHPK+DPE+ E FALSYDV+ KPYLKYF   S+G+KSPDVEIPLD PTM
Sbjct  288   DFDGQLKSTMIAHPKLDPETRELFALSYDVVSKPYLKYFRFSSAGQKSPDVEIPLDQPTM  347

Query  1158  IHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVES  979
             IHDFAITEN+V++PDQQVVF+L EMIRGGS V+Y+K KKSRFG+L K A++A  + W+E 
Sbjct  348   IHDFAITENFVVVPDQQVVFRLPEMIRGGSPVVYDKNKKSRFGVLSKYAEDASSMRWIEV  407

Query  978   PETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKR  799
              + FCFHLWNAWEEAETDE+VVIGSCMTPPDSIFNE +E L+S+LSEIRLNLKTGEST+R
Sbjct  408   EDCFCFHLWNAWEEAETDEVVVIGSCMTPPDSIFNEHDETLQSVLSEIRLNLKTGESTRR  467

Query  798   PIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGD  619
             P+I    +++NLEAGMVNRNLLGRKT++AYLA+ EPWPKVSGFAKVDLSTGE+QK++YGD
Sbjct  468   PVI---SEKLNLEAGMVNRNLLGRKTRFAYLALTEPWPKVSGFAKVDLSTGEVQKYIYGD  524

Query  618   GKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPY  439
             GK+GGEP F+P   +   ED G+++ FVHDE+  +SELQI+NA++L+L AT+ LPSRVPY
Sbjct  525   GKFGGEPLFMPEGSSDATEDSGYVMVFVHDEENVRSELQIINAVSLKLEATVTLPSRVPY  584

Query  438   GFHGTFITSYDLQNQ  394
             GFHGTFI++ DL  Q
Sbjct  585   GFHGTFISNEDLLKQ  599



>ref|XP_006302015.1| hypothetical protein CARUB_v10019990mg, partial [Capsella rubella]
 gb|EOA34913.1| hypothetical protein CARUB_v10019990mg, partial [Capsella rubella]
Length=616

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/518 (74%), Positives = 436/518 (84%), Gaps = 6/518 (1%)
 Frame = -2

Query  1944  QPKWNllqravaaaldvaegalVSRELQR-PLPKTWDPGVQIAGNFAPVPEQAVRNNLPV  1768
              PK N +QR  A  LD  E A+VS EL+R PLPKT DP VQIAGNF PVPE+ V +NLPV
Sbjct  103   NPKLNPVQRTAANILDAVESAMVSHELRRHPLPKTADPTVQIAGNFFPVPERPVVHNLPV  162

Query  1767  DGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQ  1588
              GAVP+CI GVYVRNGANPL +P +GHHLFDGDGM+H+V    GSVSY+CRFTET RLVQ
Sbjct  163   TGAVPECIQGVYVRNGANPLHKPVSGHHLFDGDGMIHSVQFDNGSVSYACRFTETNRLVQ  222

Query  1587  ERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAM  1408
             ER  GRPVFPKAIGELHGH G+A+L+LF  RGLFGLVD  RG G+ANAGLVYFNG LLAM
Sbjct  223   ERESGRPVFPKAIGELHGHLGIAKLMLFNTRGLFGLVDPTRGLGVANAGLVYFNGHLLAM  282

Query  1407  SEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLK  1228
             SEDDLPYHV+V  +GDLET+GRYDF+ QLKSTMIAHPK+DPE+ E FALSYDV+ KPYLK
Sbjct  283   SEDDLPYHVKVTQTGDLETLGRYDFDCQLKSTMIAHPKIDPETRELFALSYDVVSKPYLK  342

Query  1227  YFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKK  1048
             YF     GEKSPDVEIPLD PTMIHDFAITEN+V+IPDQQVVF+L EMIRGGS V+Y++ 
Sbjct  343   YFRFSPDGEKSPDVEIPLDQPTMIHDFAITENFVVIPDQQVVFRLPEMIRGGSPVVYDEN  402

Query  1047  KKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNEC  868
             KKSRFGIL K AK+A  I W+E P+ FCFHLWNAWEE ETDE+VVIGSCMTPPDSIFNE 
Sbjct  403   KKSRFGILNKQAKDASSIQWIEVPDCFCFHLWNAWEEPETDEVVVIGSCMTPPDSIFNEH  462

Query  867   EENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPW  688
             +E L+S+LSEIRLNLKTGEST+RP+I    +QVNLEAGMVNRNLLGRKT++ YLA+ EPW
Sbjct  463   DETLESVLSEIRLNLKTGESTRRPVI---SEQVNLEAGMVNRNLLGRKTRFVYLALTEPW  519

Query  687   PKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSE  508
             PKVSGFAKVD+STGE+QK++YGDGKYGGEP F+P      +ED G+I+ FVHDE+  KSE
Sbjct  520   PKVSGFAKVDISTGEIQKYIYGDGKYGGEPLFLPSGDG--EEDGGYIMVFVHDEEKVKSE  577

Query  507   LQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             LQI+NA+NL+L AT+ LPSRVPYGFHGTFI+  DL NQ
Sbjct  578   LQIINAVNLKLEATVALPSRVPYGFHGTFISKEDLLNQ  615



>gb|KEH38404.1| 9-cis-epoxycarotenoid dioxygenase [Medicago truncatula]
Length=610

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/585 (66%), Positives = 462/585 (79%), Gaps = 31/585 (5%)
 Frame = -2

Query  2073  SKSISMKKP---TRRAKIHCEAAVHSSSVVTLPEQQLPD-------GESPAPSQP-----  1939
             S SI++KK    ++  KI C       + +  P+Q  P         + P P+QP     
Sbjct  31    SNSITLKKKRSISQNNKISCSL----QTTLPFPKQYQPSKPKTVIPTKEPKPNQPITKTL  86

Query  1938  ----------KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQA  1789
                       KWNLLQ+A A ALD  E  L+ +E + PLPKT DP VQIAGNFAPVPE  
Sbjct  87    PKQQQEQKQHKWNLLQKAAATALDFVETTLIKQEQKHPLPKTSDPRVQIAGNFAPVPEHP  146

Query  1788  VRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFT  1609
             V  +LP+ G +P  I+GVY+RNGANPL+ P AGHH FDGDGMVHAV  T GSVSYSCRFT
Sbjct  147   VTQSLPITGKIPTNIDGVYLRNGANPLYEPVAGHHFFDGDGMVHAVKFTNGSVSYSCRFT  206

Query  1608  ETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYF  1429
             ET RL QE+ LGRPVFPKAIGELHGHSG+ARL L+YAR L GLVD   G G+ANAGLVYF
Sbjct  207   ETHRLAQEKALGRPVFPKAIGELHGHSGIARLALYYARSLCGLVDGTHGMGVANAGLVYF  266

Query  1428  NGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDV  1249
             N RLLAMSEDD+PYH+RV P+GDL TV RYDF++QLKSTMIAHPKVDP     +ALSYDV
Sbjct  267   NNRLLAMSEDDIPYHIRVTPNGDLTTVCRYDFDNQLKSTMIAHPKVDPVDKNMYALSYDV  326

Query  1248  IQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGS  1069
             +QKPYLKYF   +SG KSPDVEIPL+ PTM+HDFAITEN+V++PDQQVVFKL EMIRGGS
Sbjct  327   VQKPYLKYFRFDASGVKSPDVEIPLEQPTMMHDFAITENFVVVPDQQVVFKLGEMIRGGS  386

Query  1068  CVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPP  889
              V+Y+K+K SRFG+L K A+++  +IW+++PE FCFHLWNAWEE E DE+VVIGSCMTP 
Sbjct  387   PVVYDKEKVSRFGVLSKNAEDSSEMIWIDAPECFCFHLWNAWEEPENDEVVVIGSCMTPA  446

Query  888   DSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAY  709
             DSIFNECEENL+S+LSEIRLNLKTG+ST+RPII  + +QVNLEAGMVN+N LGRKTQ+AY
Sbjct  447   DSIFNECEENLESVLSEIRLNLKTGKSTRRPIIKES-EQVNLEAGMVNKNKLGRKTQFAY  505

Query  708   LAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHD  529
             LA+AEPWPKVSGFAKVDL +GE++K++YG+ ++GGEP F+P N +SE EDDG+IL+FVHD
Sbjct  506   LALAEPWPKVSGFAKVDLFSGEVKKYIYGENRFGGEPLFLP-NSDSENEDDGYILTFVHD  564

Query  528   EKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             EK WKSELQIVNA  L+L A+I+LPSRVPYGFHGTFI S DL+ Q
Sbjct  565   EKEWKSELQIVNAATLKLEASIQLPSRVPYGFHGTFINSNDLKKQ  609



>gb|AAS68632.2| putative 9-cis-epoxycarotenoid dioxygenase [Chorispora bungeana]
Length=599

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/572 (69%), Positives = 458/572 (80%), Gaps = 8/572 (1%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTR-RAKIHCEAAVHSSSVVTLPEQQ-----LPDGESPAPSQPK-WNl  1927
             L L S S S+   +R + K++  +A+H+   +  P+Q      +     P  S+ K  N 
Sbjct  29    LRLESYSCSIPMTSRVQRKLNASSALHTPPALHFPKQSSNSPAIVVNPKPKESEAKQMNF  88

Query  1926  lqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDC  1747
              QRA AAALD AEG LVS E Q PLPKT DP VQIAGNFAPV EQ +R NLPV G +PD 
Sbjct  89    FQRAAAAALDAAEGFLVSHERQHPLPKTADPSVQIAGNFAPVNEQPLRRNLPVVGKIPDS  148

Query  1746  INGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRP  1567
             I GVYVRNGANPL  P  GHH FDGDGMVHAV    GS SY+CRFT+T R VQER LGRP
Sbjct  149   IKGVYVRNGANPLHEPVTGHHFFDGDGMVHAVKFEDGSASYACRFTQTNRFVQERELGRP  208

Query  1566  VFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPY  1387
             VFPKAIGELHGH+G+ARL+LFYAR   G+V+  +GTG+ANAGLVYFNGRLLAMSEDDLPY
Sbjct  209   VFPKAIGELHGHTGIARLMLFYARAAAGIVEPGQGTGVANAGLVYFNGRLLAMSEDDLPY  268

Query  1386  HVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSS  1207
              VR+ P GDL+TVGR+DF+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     
Sbjct  269   QVRITPGGDLKTVGRFDFDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPD  328

Query  1206  GEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGI  1027
             G+KSPDVEI LD PTM+HDFAITE +V++PDQQVVFKL EM RGGS V+Y+K K SRFGI
Sbjct  329   GKKSPDVEIQLDQPTMMHDFAITEKFVVVPDQQVVFKLPEMFRGGSPVVYDKNKVSRFGI  388

Query  1026  LKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSI  847
             L K A+++  I W++ P+ FCFHLWNAWEE ET+EIVVIGSCMTPPDSIFNE +ENLKS+
Sbjct  389   LDKYAEDSSNIKWIDVPDCFCFHLWNAWEEPETEEIVVIGSCMTPPDSIFNESDENLKSV  448

Query  846   LSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFA  667
             LSEIRLNLKTGES +RPII   D+QVN EAGMVNRN+LGRKT++AYLA+AEPWPKVSGFA
Sbjct  449   LSEIRLNLKTGESNRRPIISDEDKQVNPEAGMVNRNMLGRKTKFAYLALAEPWPKVSGFA  508

Query  666   KVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAI  487
             KVDLSTGE++K +YG+ +YGGEP F+P + N   EDDG+IL FVHDEKTWKSELQIVNA+
Sbjct  509   KVDLSTGEVKKHLYGENRYGGEPLFLPGD-NEGGEDDGYILCFVHDEKTWKSELQIVNAV  567

Query  486   NLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +LE+ AT+KLPSRVPYGFHGTFI + DL  QV
Sbjct  568   SLEVEATVKLPSRVPYGFHGTFIGASDLAKQV  599



>emb|CDX97576.1| BnaA05g25030D [Brassica napus]
Length=597

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/567 (70%), Positives = 458/567 (81%), Gaps = 10/567 (2%)
 Frame = -2

Query  2073  SKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQ------LPDGESPAPSQPKWNllqrav  1912
             S S+ M   ++R K++  +A+H+   +  P+Q       + + ++      + NL QRA 
Sbjct  35    SCSVPMTNRSQR-KLNVSSALHTHPALHFPKQSSTSPAIIVNPKTKESDTKQMNLFQRAA  93

Query  1911  aaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVY  1732
             AAALD AEG LVS E Q PLPKT DP VQIAGNFAPV EQ +R NLPV G +PD I GVY
Sbjct  94    AAALDAAEGFLVSHERQHPLPKTADPSVQIAGNFAPVNEQPLRRNLPVVGKIPDSIKGVY  153

Query  1731  VRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKA  1552
             VRNGANPL  P  GHH FDGDGMVHAVT   GS SY+CRFT T R +QER LGRPVFPKA
Sbjct  154   VRNGANPLHEPVTGHHFFDGDGMVHAVTFEDGSASYACRFTLTNRFIQERQLGRPVFPKA  213

Query  1551  IGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVK  1372
             IGELHGH+G+ARL+LFYAR   GLVD   GTG+ANAGLVYFN RLLAMSEDDLPY VR+ 
Sbjct  214   IGELHGHTGIARLMLFYARAAAGLVDPAHGTGVANAGLVYFNNRLLAMSEDDLPYQVRIT  273

Query  1371  PSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSP  1192
             P GDL+TVGRYDF+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     GEKSP
Sbjct  274   PGGDLKTVGRYDFDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGEKSP  333

Query  1191  DVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTA  1012
             DVEI LD PTM+HDFAITEN+V+IPDQQVVFKLQEMIRGGS VIY+K+K +RFGIL K A
Sbjct  334   DVEIQLDQPTMMHDFAITENFVVIPDQQVVFKLQEMIRGGSPVIYDKEKVARFGILDKYA  393

Query  1011  KNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIR  832
              ++ GI W+E+   FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE +ENLKS+LSEIR
Sbjct  394   ADSSGIRWIEARNCFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESDENLKSVLSEIR  453

Query  831   LNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLS  652
             LNL+TGEST+RPII   DQQVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDL+
Sbjct  454   LNLRTGESTRRPIISDGDQQVNLEAGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLA  513

Query  651   TGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELL  472
             TGE++K +YGD +YGGEP F+   P    EDDGHIL FVHDE TWKSELQIVNA++LE+ 
Sbjct  514   TGEVKKHLYGDDRYGGEPLFL---PGEGAEDDGHILCFVHDEMTWKSELQIVNAVSLEVE  570

Query  471   ATIKLPSRVPYGFHGTFITSYDLQNQV  391
             AT+KLPSRVPYGFHGTFI + DL NQV
Sbjct  571   ATVKLPSRVPYGFHGTFIGASDLANQV  597



>ref|XP_006389988.1| hypothetical protein EUTSA_v10019707mg [Eutrema salsugineum]
 gb|ESQ27274.1| hypothetical protein EUTSA_v10019707mg [Eutrema salsugineum]
Length=611

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/553 (70%), Positives = 447/553 (81%), Gaps = 10/553 (2%)
 Frame = -2

Query  2034  KIHCEAAVHSSSVVTLPEQQLPDGESPAP----SQPKWNllqravaaaldvaegalVSRE  1867
             K+   ++  S +   L ++   D  S  P      PK N +QR  A  LD  E A++S E
Sbjct  61    KLTVSSSQQSPTTYQLQKELCNDAASLIPKMTNQSPKLNPVQRTAATILDAVENAMLSHE  120

Query  1866  LQR-PLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAG  1690
              +R PLPKT DP VQIAGNF PVPEQ VR+NLPV G VP+CI GVYVRNGANPL +P +G
Sbjct  121   RRRHPLPKTADPAVQIAGNFFPVPEQPVRHNLPVSGTVPECIQGVYVRNGANPLHKPISG  180

Query  1689  HHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLL  1510
             HH FDGDGM+HAV    GSVSY+CRFTET R VQER LGR VFPKAIGELHGH G+A+L+
Sbjct  181   HHFFDGDGMIHAVRFDNGSVSYACRFTETNRFVQERELGRSVFPKAIGELHGHLGIAKLM  240

Query  1509  LFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFN  1330
             LF ARGLFGLVD   G G+ANAGLVYFNG LLAMSEDDLPYHVRV P+GDLET GRYDF+
Sbjct  241   LFNARGLFGLVDPTHGLGVANAGLVYFNGHLLAMSEDDLPYHVRVTPTGDLETSGRYDFD  300

Query  1329  DQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHD  1150
              QLKSTMIAHPK+DPE+ E FALSYDV+ KP+LKYF     GEKSPDVEIPLD PTMIHD
Sbjct  301   GQLKSTMIAHPKIDPETRELFALSYDVVSKPFLKYFRFTPDGEKSPDVEIPLDQPTMIHD  360

Query  1149  FAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPET  970
             FAITEN V+IPDQQVVF+L EMIRGGS V+Y+KKKKSRFGIL K A++A  I W+E  + 
Sbjct  361   FAITENLVVIPDQQVVFRLPEMIRGGSPVVYDKKKKSRFGILNKYAEDASSIRWIEVADC  420

Query  969   FCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNEC-EENLKSILSEIRLNLKTGESTKRPI  793
             FCFHLWNAWEE ETDEIVVIGSCMTPPDSIFNE  EE L+S+LSEIRLNLKTGEST+RP+
Sbjct  421   FCFHLWNAWEEPETDEIVVIGSCMTPPDSIFNEHDEETLESVLSEIRLNLKTGESTRRPV  480

Query  792   IPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGK  613
             I    ++VNLEAGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDLSTGE+QK++YG GK
Sbjct  481   I---SEKVNLEAGMVNRNFLGRKTRFAYLALAEPWPKVSGFAKVDLSTGEIQKYIYGHGK  537

Query  612   YGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGF  433
             YGGEP F+P + + + ED+G+I+ FVHDE+  KSELQI+NA+NL+L AT+ LPSRVPYGF
Sbjct  538   YGGEPLFMP-DVSGDGEDNGYIMVFVHDEEKVKSELQIINAVNLKLEATVTLPSRVPYGF  596

Query  432   HGTFITSYDLQNQ  394
             HGTFI++ DL  Q
Sbjct  597   HGTFISNEDLMKQ  609



>ref|XP_010666721.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=602

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/582 (67%), Positives = 465/582 (80%), Gaps = 17/582 (3%)
 Frame = -2

Query  2085  LGLPSKS-ISMKKPTRRAK--IHCEAAVHSS--SVVTLPE-------QQLPDGESPAPSQ  1942
             L  PS++ IS KK T+++   I+ ++A+ S+  S++  P               S   ++
Sbjct  21    LAFPSRAMISTKKHTKKSTDYINIQSALQSAAPSILHFPHPIHEPYPVPPTTTTSKPQNR  80

Query  1941  PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDG  1762
             P+WN+ Q+A AAALD+AE AL++RE   PLPKT DP VQIAGNFAPVPEQ V+  LP+ G
Sbjct  81    PQWNIFQKAAAAALDLAESALLTRERTHPLPKTSDPLVQIAGNFAPVPEQPVKRALPIKG  140

Query  1761  AVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQER  1582
              +P CI+GVYVRNGANPLF P AGHHLFDGDGMVHAVTI  G  SYSCRFTET RL QER
Sbjct  141   EIPACIDGVYVRNGANPLFEPTAGHHLFDGDGMVHAVTIHNGVASYSCRFTETSRLAQER  200

Query  1581  GLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSE  1402
              LGRPVFPK+IGELHGHSG+ARL+LF++R LFGL+D   G G+ANAGL+YFNGRLLAMSE
Sbjct  201   ELGRPVFPKSIGELHGHSGIARLMLFFSRSLFGLLDSEHGMGVANAGLIYFNGRLLAMSE  260

Query  1401  DDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYF  1222
             DD+PY +RV P+GDL TVGR+DF+ QLKSTMIAHPK+DPES E FALSYDVI+ PYLKYF
Sbjct  261   DDIPYQLRVTPAGDLRTVGRFDFDGQLKSTMIAHPKLDPESKELFALSYDVIKTPYLKYF  320

Query  1221  NVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKK  1042
                  GEKSPD+EIPL+ PTM+HDFAIT+N+V+IPDQQVVFK++EMI GGS V+Y+K K 
Sbjct  321   KFTQDGEKSPDLEIPLNEPTMMHDFAITKNFVVIPDQQVVFKMKEMITGGSPVVYDKNKT  380

Query  1041  SRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEE  862
             SRFG+++K AKNA  I WV SP+TFCFHLWNAWEE  TDEIVVIGSCMTPPDSIFNEC+E
Sbjct  381   SRFGVMRKDAKNASEITWVNSPDTFCFHLWNAWEEPGTDEIVVIGSCMTPPDSIFNECDE  440

Query  861   NLKSILSEIRLNLKTGESTKRPIIPATDQ-QVNLEAGMVNRNLLGRKTQYAYLAIAEPWP  685
             NLKS+LSEIRLN++TG ST+R II       +NLEAGMVNRN LGRKT++AYLAIAEPWP
Sbjct  441   NLKSVLSEIRLNIRTGRSTRRAIIDFNQHDHINLEAGMVNRNFLGRKTRFAYLAIAEPWP  500

Query  684   KVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNS----EKEDDGHILSFVHDEKTW  517
             KVSGFAKVDL TGE++KF+YG  KYGGEPFF+PR+ ++      EDDG+++ FVHDE   
Sbjct  501   KVSGFAKVDLVTGEVKKFLYGGEKYGGEPFFLPRDHSNLDEPSSEDDGYVMGFVHDENKG  560

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
              SEL IVNA NL+  A++KLPSRVPYGFHGTF+ S +L +Q 
Sbjct  561   TSELVIVNATNLQEEASVKLPSRVPYGFHGTFVRSEELIHQA  602



>ref|XP_009146365.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic 
[Brassica rapa]
Length=597

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/565 (70%), Positives = 457/565 (81%), Gaps = 10/565 (2%)
 Frame = -2

Query  2067  SISMKKPTRRAKIHCEAAVHSSSVVTLPEQQ------LPDGESPAPSQPKWNllqravaa  1906
             S+ M   ++R K++  +A+H+   +  P+Q       + + ++      + NL QRA AA
Sbjct  37    SVPMTNRSQR-KLNVSSALHTHPALHFPKQSSTSPAIIVNPKTKESDTKQMNLFQRAAAA  95

Query  1905  aldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVR  1726
             ALD AEG LVS E Q PLPKT DP VQIAGNFAPV EQ +R NLPV G +PD I GVYVR
Sbjct  96    ALDAAEGFLVSHERQHPLPKTADPSVQIAGNFAPVNEQPLRRNLPVVGKIPDSIKGVYVR  155

Query  1725  NGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIG  1546
             NGANPL  P  GHH FDGDGMVHAV    GS SY+CRFT+T R +QER LGRPVFPKAIG
Sbjct  156   NGANPLHEPVTGHHFFDGDGMVHAVKFEDGSASYACRFTQTNRFIQERQLGRPVFPKAIG  215

Query  1545  ELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPS  1366
             ELHGH+G+ARL+LFYAR   GLVD   GTG+ANAGLVYFN RLLAMSEDDLPY VR+ P 
Sbjct  216   ELHGHTGIARLMLFYARAAAGLVDPAHGTGVANAGLVYFNNRLLAMSEDDLPYQVRITPG  275

Query  1365  GDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDV  1186
             GDL+TVGRYDF+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     GEKSPDV
Sbjct  276   GDLKTVGRYDFDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGEKSPDV  335

Query  1185  EIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKN  1006
             EI LD PTM+HDFAITEN+V+IPDQQVVFKLQEMIRGGS VIY+K+K +RFGIL K A +
Sbjct  336   EIQLDQPTMMHDFAITENFVVIPDQQVVFKLQEMIRGGSPVIYDKEKVARFGILDKYAAD  395

Query  1005  AEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLN  826
             + GI W+E+P+ FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE +ENLKS+L EIRLN
Sbjct  396   SSGIRWIEAPDCFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESDENLKSVLCEIRLN  455

Query  825   LKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTG  646
             L+TGEST+RPII   DQQVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDL+TG
Sbjct  456   LRTGESTRRPIISDGDQQVNLEAGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLATG  515

Query  645   EMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLAT  466
             E++K +YGD +YGGEP F+   P    EDDGHIL FVHDE TW SELQIVNA++LE+ AT
Sbjct  516   EVKKHLYGDDRYGGEPLFL---PGEGAEDDGHILCFVHDEMTWTSELQIVNAVSLEVEAT  572

Query  465   IKLPSRVPYGFHGTFITSYDLQNQV  391
             +KLPSRVPYGFHGTFI + DL NQV
Sbjct  573   VKLPSRVPYGFHGTFIGASDLANQV  597



>ref|XP_008787808.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Phoenix dactylifera]
Length=609

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/585 (67%), Positives = 457/585 (78%), Gaps = 29/585 (5%)
 Frame = -2

Query  2073  SKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQ---------LPDGESPAPS--------  1945
             SKSI + + T    IHC  +  S S++ LP Q          +   +SP+P         
Sbjct  30    SKSIKLLRKT--PPIHCSTS--SQSILNLPTQSSSYFPPSLYVVKEDSPSPETKTDQRKH  85

Query  1944  -----QPKWNllqravaaaldvaegalVSRELQ--RPLPKTWDPGVQIAGNFAPVPEQAV  1786
                  +P+WN LQR  AAALD  E   +S  L+   PLPKT DP VQIAGNFAPV EQ  
Sbjct  86    RHQTGRPQWNFLQRMAAAALDTVEDGFISNMLEGPHPLPKTADPSVQIAGNFAPVGEQPP  145

Query  1785  RNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTE  1606
               +LPV G +P  INGVYVRNGANPLF+P AGHH FDGDGMVHAV +  G+ SY+CRFTE
Sbjct  146   HQDLPVSGRIPPSINGVYVRNGANPLFQPVAGHHFFDGDGMVHAVHLRNGAASYTCRFTE  205

Query  1605  TERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFN  1426
             TERL QER LGRP+FPKAIGELHGHSG+ARLLLFYARGLFGLVD   GTG+ANAGLVYF+
Sbjct  206   TERLRQERALGRPIFPKAIGELHGHSGIARLLLFYARGLFGLVDPSHGTGVANAGLVYFH  265

Query  1425  GRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVI  1246
              RLLAMSEDDLPYHVR+ PSGDLETVGRYDF+ QL+S MIAHPK+DP + E FALSYDVI
Sbjct  266   DRLLAMSEDDLPYHVRITPSGDLETVGRYDFDGQLRSAMIAHPKLDPATRELFALSYDVI  325

Query  1245  QKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSC  1066
             QKPYLKYF     GEKSPDVEIPLD PTM+HDFAIT+N+V+IPDQQVVFKLQEMIRGGS 
Sbjct  326   QKPYLKYFRFSPDGEKSPDVEIPLDQPTMMHDFAITDNFVVIPDQQVVFKLQEMIRGGSP  385

Query  1065  VIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPD  886
             V+Y++ K SRFGIL K A +A  ++WV+ P+ FCFHLWNAWEE  + E+VVIGSCMTP D
Sbjct  386   VVYDRSKTSRFGILPKYAADATEMVWVDVPDCFCFHLWNAWEEPASGEVVVIGSCMTPAD  445

Query  885   SIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYL  706
             SIFNE +E+LKS+LSEIRL+  TG ST+RPI+   D Q+NLEAGMVNRN LGRKT+YAYL
Sbjct  446   SIFNESDESLKSVLSEIRLDPATGRSTRRPIVAPGD-QLNLEAGMVNRNKLGRKTRYAYL  504

Query  705   AIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDE  526
             AIAEPWPKVSGFAKVDL TGE+ KF+YGD +YGGEP+F+PR+  S  EDDG++L+F+H+E
Sbjct  505   AIAEPWPKVSGFAKVDLFTGEVAKFIYGDNRYGGEPYFLPRDATSPTEDDGYVLTFMHNE  564

Query  525   KTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
              T +SEL IVNA ++ L A++KLPSRVPYGFHGTFI S DL++Q 
Sbjct  565   TTSESELLIVNAADMRLQASVKLPSRVPYGFHGTFINSKDLESQA  609



>dbj|BAE92963.1| 9-cis-epoxycarotenoid dioxygenase [Citrus unshiu]
Length=569

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/507 (75%), Positives = 430/507 (85%), Gaps = 3/507 (1%)
 Frame = -2

Query  1983  EQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAP  1804
             +QQ  + ++ APS  KWN LQ+A A ALD  E ALVS+E Q PLPKT DP VQIAGNF+P
Sbjct  66    KQQPKENDNFAPS--KWNFLQKAAALALDAVENALVSQERQHPLPKTADPTVQIAGNFSP  123

Query  1803  VPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSY  1624
             VPE+ V  NLP  G VPDCI GVYVRNGANPL  P AGHH FDGDGMVHAV    GSVSY
Sbjct  124   VPEKPVCQNLPTTGKVPDCIQGVYVRNGANPLHEPVAGHHFFDGDGMVHAVKFNKGSVSY  183

Query  1623  SCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANA  1444
             SCRFTET R VQER LG PVFPKAIGELHGH+G+ARLLLFY+R LFGLVD   GTG+ANA
Sbjct  184   SCRFTETNRFVQERSLGHPVFPKAIGELHGHTGIARLLLFYSRALFGLVDPSHGTGVANA  243

Query  1443  GLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFA  1264
             GLVYFN RLLAMSEDDLPYHVRV PSGDL+TVGR+DF+ QLKSTMIAHPKVDP +G+ FA
Sbjct  244   GLVYFNNRLLAMSEDDLPYHVRVTPSGDLKTVGRFDFSGQLKSTMIAHPKVDPVTGDLFA  303

Query  1263  LSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEM  1084
             LSYDV++KPYLKYF     G KSPDVEIPL+ PTM+HDFAITEN+V++PDQQVVFKL EM
Sbjct  304   LSYDVVKKPYLKYFRFSPQGIKSPDVEIPLEEPTMMHDFAITENFVVVPDQQVVFKLNEM  363

Query  1083  IRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGS  904
             IRGGS VIY+K K SRFGIL K A +A  + W+++P+ FCFHLWNAWEE E DE+VVIGS
Sbjct  364   IRGGSPVIYDKNKVSRFGILDKNATDASKMKWIDAPDCFCFHLWNAWEEPERDEVVVIGS  423

Query  903   CMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRK  724
             CMTP DSIFNEC+E+LKS+LSEIRLNLKTGEST+RP+I + D+QVNLEAGMVNRNLLGRK
Sbjct  424   CMTPADSIFNECDESLKSVLSEIRLNLKTGESTRRPLI-SEDEQVNLEAGMVNRNLLGRK  482

Query  723   TQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHIL  544
             T++ YLA+AEPWPKVSGFAKVDL TG++ KF+YGD +YGGEP F PR+PNSE EDDG+IL
Sbjct  483   TRFVYLALAEPWPKVSGFAKVDLLTGQVNKFIYGDQRYGGEPLFFPRDPNSENEDDGYIL  542

Query  543   SFVHDEKTWKSELQIVNAINLELLATI  463
             +FVHDEK WKSELQIVNA+ LEL AT+
Sbjct  543   AFVHDEKEWKSELQIVNAMTLELEATV  569



>ref|XP_009398335.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=601

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/551 (69%), Positives = 450/551 (82%), Gaps = 6/551 (1%)
 Frame = -2

Query  2037  AKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQR  1858
             A  H E A    + V +P  +         ++P+WNL+QR  AAALD  E A VS  L+R
Sbjct  55    APCHKEVA---PTTVAMPASKPDQSTQSCGARPRWNLVQRMAAAALDTIEDAFVSNVLER  111

Query  1857  P--LPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHH  1684
             P  LPKT DP VQIAGNFAPV EQA  ++LPV+G +P  I+GVYVRNGANPLF P AGHH
Sbjct  112   PRPLPKTADPAVQIAGNFAPVDEQAPCHDLPVEGRIPSFISGVYVRNGANPLFEPVAGHH  171

Query  1683  LFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLF  1504
              FDGDGMVHAV +  G+ +Y+CR+TETERL QER +G+PVFPKAIGELHGHSG+ARLLLF
Sbjct  172   FFDGDGMVHAVHLRNGAATYACRYTETERLRQERAIGKPVFPKAIGELHGHSGIARLLLF  231

Query  1503  YARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQ  1324
             YAR LFGLV+  RG G+ANAGLVYFN RLLAMSEDD+PYHVR+ PSGDLETV RYDF  Q
Sbjct  232   YARSLFGLVNGSRGMGVANAGLVYFNDRLLAMSEDDIPYHVRITPSGDLETVERYDFGGQ  291

Query  1323  LKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFA  1144
             L+S+MIAHPK+DP S E FALSYDVIQKPYLKYF     G+KSPDVEIPL+ PTM+HDFA
Sbjct  292   LRSSMIAHPKLDPFSRELFALSYDVIQKPYLKYFYFSPDGKKSPDVEIPLEQPTMMHDFA  351

Query  1143  ITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFC  964
             ITENYV++PDQQVVFKLQEMIRGGS V+Y++ K +RFG+L K A +A  + WV+ P+ FC
Sbjct  352   ITENYVVVPDQQVVFKLQEMIRGGSPVVYDQAKTARFGVLPKYAADASEMRWVDVPDCFC  411

Query  963   FHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPA  784
             FHLWNAWEE  T E+VVIGSCMTPPDS+FNECEE L S+LSEIRL+L TG+ST+R I+  
Sbjct  412   FHLWNAWEEPATGEVVVIGSCMTPPDSVFNECEERLNSVLSEIRLDLNTGKSTRRSILSP  471

Query  783   TDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGG  604
              D Q+NLEAGMVNRN+LGRKT+YAYLAIAEPWPKVSGFAKVDL TGE+ KF++GD +YGG
Sbjct  472   AD-QLNLEAGMVNRNMLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEISKFIFGDSRYGG  530

Query  603   EPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGT  424
             EP+F+PR+ NS +EDDG++L+F+HDEKT  SEL IVNA+++ L A++KLPSRVPYGFHGT
Sbjct  531   EPYFLPRDSNSLREDDGYVLTFMHDEKTSASELLIVNAVDMRLEASVKLPSRVPYGFHGT  590

Query  423   FITSYDLQNQV  391
             F+ S DL++Q 
Sbjct  591   FVGSKDLESQA  601



>dbj|BAC10550.1| nine-cis-epoxycarotenoid dioxygenase2 [Pisum sativum]
Length=601

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/528 (71%), Positives = 437/528 (83%), Gaps = 3/528 (1%)
 Frame = -2

Query  1974  LPDGESPAPSQP-KWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVP  1798
             LP    P   Q  KWNLLQ+A A  LD  E  L+ +E + PLPKT DP VQIAGNFAPVP
Sbjct  75    LPSNTKPLHKQEQKWNLLQQAAATTLDFVETTLIKQESKHPLPKTSDPRVQIAGNFAPVP  134

Query  1797  EQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSC  1618
             E  V  NLP+ G +P  I+GVY+RNGANPL  P AGHH FDGDGMVHAV  T GSVSYSC
Sbjct  135   EHPVTQNLPITGKLPKGIDGVYLRNGANPLHEPVAGHHFFDGDGMVHAVKFTNGSVSYSC  194

Query  1617  RFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGL  1438
             RFTET RL QE+ LGRPVFPKAIGELHGHSG+ARL+L+YAR L GLVD   G G+ANAGL
Sbjct  195   RFTETHRLAQEKALGRPVFPKAIGELHGHSGIARLMLYYARSLCGLVDGTHGMGVANAGL  254

Query  1437  VYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALS  1258
             VYFN RLLAMSEDD+PYHVRV P+GDL TV RYDFNDQLKSTMIAHPKVDP     +ALS
Sbjct  255   VYFNNRLLAMSEDDIPYHVRVTPNGDLTTVCRYDFNDQLKSTMIAHPKVDPVDKNLYALS  314

Query  1257  YDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIR  1078
             YDV+QKPYLKYF   S+G KSPDVEIPL  PTM+HDFAITEN+V++PDQQVVFKL EMIR
Sbjct  315   YDVVQKPYLKYFRFDSNGVKSPDVEIPLAEPTMMHDFAITENFVVVPDQQVVFKLGEMIR  374

Query  1077  GGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCM  898
             GGS V+Y+K+K SRFG+L K A+NA  + W+++PE FCFHLWNAWEE E DE+VVIGSCM
Sbjct  375   GGSPVVYDKEKVSRFGVLSKNAENASEMKWIDAPECFCFHLWNAWEEPENDEVVVIGSCM  434

Query  897   TPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQ  718
             TP DSIFNEC+E+LKS+LSEIRLNLKTG+ST+R II  + + +NLEAGMVN+N LGRKTQ
Sbjct  435   TPADSIFNECDESLKSVLSEIRLNLKTGKSTRRAIIQES-EHMNLEAGMVNKNKLGRKTQ  493

Query  717   YAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSF  538
             +AYLA+AEPWPKVSGFAKVDL +GE++K++YG+ ++GGEP F+P N +SE EDDG+IL+F
Sbjct  494   FAYLALAEPWPKVSGFAKVDLFSGEVKKYLYGENRFGGEPLFLP-NEDSENEDDGYILTF  552

Query  537   VHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             VHDEK WKSE+QIVNA+NL+L A I LPSRVPYGFHGTFI S +L+ Q
Sbjct  553   VHDEKEWKSEIQIVNAVNLKLEACIPLPSRVPYGFHGTFIHSKELEKQ  600



>ref|NP_188062.1| 9-cis-epoxycarotenoid dioxygenase NCED3 [Arabidopsis thaliana]
 sp|Q9LRR7.1|NCED3_ARATH RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic; 
Short=AtNCED3; AltName: Full=Protein SALT TOLERANT 
1; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01336.1| 9-cis-epoxycarotenoid dioxygenase [Arabidopsis thaliana]
 dbj|BAB70609.1| neoxanthin cleavage enzyme [Arabidopsis thaliana]
 gb|AEE75526.1| 9-cis-epoxycarotenoid dioxygenase NCED3 [Arabidopsis thaliana]
 gb|AFA52661.1| 9-cis-epoxycarotenoid dioxygenase (NCED3) [synthetic construct]
Length=599

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/495 (74%), Positives = 420/495 (85%), Gaps = 2/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E   PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P 
Sbjct  106   SHEKLHPLPKTADPSVQIAGNFAPVNEQPVRRNLPVVGKLPDSIKGVYVRNGANPLHEPV  165

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R VQER LGRPVFPKAIGELHGH+G+AR
Sbjct  166   TGHHFFDGDGMVHAVKFEHGSASYACRFTQTNRFVQERQLGRPVFPKAIGELHGHTGIAR  225

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   G+VD   GTG+ANAGLVYFNGRLLAMSEDDLPY V++ P+GDL+TVGR+D
Sbjct  226   LMLFYARAAAGIVDPAHGTGVANAGLVYFNGRLLAMSEDDLPYQVQITPNGDLKTVGRFD  285

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVEI LD PTM+
Sbjct  286   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEIQLDQPTMM  345

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V++PDQQVVFKL EMIRGGS V+Y+K K +RFGIL K A+++  I W+++P
Sbjct  346   HDFAITENFVVVPDQQVVFKLPEMIRGGSPVVYDKNKVARFGILDKYAEDSSNIKWIDAP  405

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE ETDE+VVIGSCMTPPDSIFNE +ENLKS+LSEIRLNLKTGEST+RP
Sbjct  406   DCFCFHLWNAWEEPETDEVVVIGSCMTPPDSIFNESDENLKSVLSEIRLNLKTGESTRRP  465

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   DQQVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDL+TGE++K +YGD 
Sbjct  466   IISNEDQQVNLEAGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLTTGEVKKHLYGDN  525

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+P      +ED+G+IL FVHDEKTWKSELQIVNA++LE+ AT+KLPSRVPYG
Sbjct  526   RYGGEPLFLPG--EGGEEDEGYILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYG  583

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  QV
Sbjct  584   FHGTFIGADDLAKQV  598



>dbj|BAM72560.1| 9-cis-epoxycarotenoid dioxygenase [Cicer arietinum]
Length=620

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/516 (72%), Positives = 433/516 (84%), Gaps = 2/516 (0%)
 Frame = -2

Query  1935  WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAV  1756
             WNL Q+A A ALD  E  L+++E + PLPKT DP VQI+GNFAPVPE  V ++LPV G +
Sbjct  106   WNLFQKAAATALDFVETTLITQERKHPLPKTADPRVQISGNFAPVPEHPVTHSLPVTGKI  165

Query  1755  PDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGL  1576
             P CI+GVY+RNGANP + P AGHH FDGDGMVHAV  T GSVSYSCRFTET RL QE+ L
Sbjct  166   PKCIDGVYLRNGANPHYEPVAGHHFFDGDGMVHAVKFTNGSVSYSCRFTETHRLAQEKAL  225

Query  1575  GRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDD  1396
             GRPVFPKAIGELHGHSG+ARL+L+YAR LF LVD   G G+ANAGLVYFN RLLAMSEDD
Sbjct  226   GRPVFPKAIGELHGHSGIARLMLYYARSLFNLVDGSHGMGVANAGLVYFNNRLLAMSEDD  285

Query  1395  LPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNV  1216
             +PY +RV P+GDL TV RYDFN+QLKSTMIAHPKVDP     +ALSYDVIQKPYLKYF  
Sbjct  286   IPYQIRVTPNGDLTTVCRYDFNNQLKSTMIAHPKVDPIDNNLYALSYDVIQKPYLKYFRF  345

Query  1215  KSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSR  1036
              S+G KSPDVEIPL  PTM+HDFAITEN+V++PDQQVVFKL EMIRGGS V+Y K+K SR
Sbjct  346   DSNGVKSPDVEIPLAEPTMMHDFAITENFVVVPDQQVVFKLGEMIRGGSPVVYNKEKVSR  405

Query  1035  FGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENL  856
             FG+L K AK++  + W+++P+ FCFHLWNAWEE E DE+VVIGSCMTP DSIFNECEE+L
Sbjct  406   FGVLPKNAKDSSDMKWIDAPDCFCFHLWNAWEEKENDEVVVIGSCMTPADSIFNECEESL  465

Query  855   KSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVS  676
             KS+LSEIRLNLKTG+ST+R II  + Q VNLEAGMVN+N LGRKTQ+AYLA+AEPWPKVS
Sbjct  466   KSVLSEIRLNLKTGKSTRRAIIDES-QHVNLEAGMVNKNKLGRKTQFAYLALAEPWPKVS  524

Query  675   GFAKVDLSTGEMQKFMYGDGKYGGEPFFVPR-NPNSEKEDDGHILSFVHDEKTWKSELQI  499
             GFAKVDL +G++ K++YGD ++GGEP F+P  + NS +EDDG+IL+FVHDEK WKSELQI
Sbjct  525   GFAKVDLFSGQVNKYLYGDQRFGGEPLFLPTLDSNSGREDDGYILTFVHDEKEWKSELQI  584

Query  498   VNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             VNAI L+L A+IKLPSRVPYGFHGTFI S DL+ Q 
Sbjct  585   VNAITLKLEASIKLPSRVPYGFHGTFIHSNDLKKQA  620



>gb|AAY82458.1| 9-cis-epoxycarotenoid dioxygenase 1 [Cuscuta reflexa]
Length=586

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/518 (73%), Positives = 429/518 (83%), Gaps = 5/518 (1%)
 Frame = -2

Query  1941  PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDG  1762
             P+WN  QRA A ALD  EG L   EL++PLPKT DP VQI+GNFAPV E  VR  LPV G
Sbjct  73    PRWNFFQRAAAMALDAVEGKLTEHELEQPLPKTADPKVQISGNFAPVTEHPVRQALPVAG  132

Query  1761  AVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQER  1582
              VPDCI GVYVRNGANPL    AGHH FDGDGMVHAV    G VSY+CRFTET+R VQER
Sbjct  133   RVPDCIQGVYVRNGANPLHELAAGHHFFDGDGMVHAVQFKNGDVSYACRFTETQRFVQER  192

Query  1581  GLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSE  1402
              LGRPVFPKAIGELHGH+G+ARL+L YARGLFGLVDH +G G+ANAGLVYFN RLLAMSE
Sbjct  193   ALGRPVFPKAIGELHGHTGIARLMLLYARGLFGLVDHSKGIGVANAGLVYFNNRLLAMSE  252

Query  1401  DDLPYHVRVKPSGD-LETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKY  1225
             DDLPYHVRV PSGD L+TV RYDF+ +LKSTMIAHPK+DP SGE FALSYDVIQKPYLKY
Sbjct  253   DDLPYHVRVTPSGDKLKTVERYDFDGKLKSTMIAHPKLDPVSGELFALSYDVIQKPYLKY  312

Query  1224  FNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKK  1045
             F    SGEKS D+EIP+  PTM+HDFAITE +V++PDQQVVFK+ EM+ GGS V+Y++ K
Sbjct  313   FWFSKSGEKSQDIEIPVPEPTMMHDFAITERFVVVPDQQVVFKISEMVHGGSPVVYDRNK  372

Query  1044  KSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECE  865
              SRFG+L K AK++  + WVE P+ FCFHLWNAWEE ETDEIVV+GSCMTPPDSIFNE +
Sbjct  373   VSRFGVLNKYAKDSSEMKWVEVPDCFCFHLWNAWEEPETDEIVVVGSCMTPPDSIFNETD  432

Query  864   ENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWP  685
             E L+SILSEIRLNL TG+ST++PII      VNLEAGMVNRN LGRKT+YAYLAIAEPWP
Sbjct  433   EGLQSILSEIRLNLNTGKSTRKPII---QPHVNLEAGMVNRNKLGRKTRYAYLAIAEPWP  489

Query  684   KVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSEL  505
             KVSGFAKVDL TGE++KFMYG+ KYGGEP F+P +  +E EDDG+IL+F HDEK WKSEL
Sbjct  490   KVSGFAKVDLFTGEVEKFMYGEEKYGGEPLFLPGDDEAE-EDDGYILTFAHDEKAWKSEL  548

Query  504   QIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             QIVNA  L+L AT+KLPSRVPYGFHGTFI + DL  QV
Sbjct  549   QIVNAQTLKLEATVKLPSRVPYGFHGTFINAMDLATQV  586



>ref|XP_010472055.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic 
[Camelina sativa]
Length=606

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/518 (73%), Positives = 434/518 (84%), Gaps = 6/518 (1%)
 Frame = -2

Query  1944  QPKWNllqravaaaldvaegalVSRELQR-PLPKTWDPGVQIAGNFAPVPEQAVRNNLPV  1768
              PK N +QR  A  LD  E A+VS E +R PLPKT DP VQI+GNF PVPE+ V +NLPV
Sbjct  93    NPKLNPVQRTAATILDAVENAMVSHERRRHPLPKTADPTVQISGNFFPVPEKPVVHNLPV  152

Query  1767  DGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQ  1588
              G +P+CI GVYVRNGANPL +P +GHHLFDGDGM+H+V    GSVSY+CRFTET RLVQ
Sbjct  153   TGTLPECIQGVYVRNGANPLHKPVSGHHLFDGDGMIHSVQFDNGSVSYACRFTETNRLVQ  212

Query  1587  ERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAM  1408
             ER  GRPVFPKAIGELHGH G+A+L+LF  RGLFGLV+  RG G+ANAGLVYFNG LLAM
Sbjct  213   ERESGRPVFPKAIGELHGHLGIAKLMLFNTRGLFGLVEPTRGLGVANAGLVYFNGHLLAM  272

Query  1407  SEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLK  1228
             SEDDLPYHV+V  +GDLET GRYDF+ QL+STMIAHPK+DPE+ E FALSYDV+ KPYLK
Sbjct  273   SEDDLPYHVKVTQTGDLETSGRYDFDGQLQSTMIAHPKIDPETRELFALSYDVVSKPYLK  332

Query  1227  YFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKK  1048
             YF   S GEKSPDVEIPLD PTMIHDFAITEN+V+IPDQQVVF+L EMIRGGS V+Y++ 
Sbjct  333   YFRFTSDGEKSPDVEIPLDQPTMIHDFAITENFVVIPDQQVVFRLPEMIRGGSPVVYDEN  392

Query  1047  KKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNEC  868
             KKSRFGIL K AK+A  I W+E P+ FCFHLWNAWEE ETDE+VVIGSCMTPPDSIFNE 
Sbjct  393   KKSRFGILNKYAKDASSIHWIEVPDCFCFHLWNAWEELETDEVVVIGSCMTPPDSIFNEH  452

Query  867   EENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPW  688
             +E L+S+LSEIRLNLKTGEST+RP+I    +QVNLEAGMVNRNLLGRKT++ YLA+ EPW
Sbjct  453   DETLESVLSEIRLNLKTGESTRRPVI---TEQVNLEAGMVNRNLLGRKTRFVYLALTEPW  509

Query  687   PKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSE  508
             PKVSGFAKVD+STGE+QK++YGDGKYGGEP F+P      +EDDG+I+ FVHDE+  KSE
Sbjct  510   PKVSGFAKVDISTGEIQKYIYGDGKYGGEPLFLPSGDG--EEDDGYIMVFVHDEEKVKSE  567

Query  507   LQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             LQI+NA+NL+L AT+ LPSRVPYGFHGTFI+  DL  Q
Sbjct  568   LQIINAVNLKLEATVTLPSRVPYGFHGTFISKEDLLKQ  605



>ref|XP_002862994.1| nine-cis-epoxycarotenoid dioxygenase 9 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39253.1| nine-cis-epoxycarotenoid dioxygenase 9 [Arabidopsis lyrata subsp. 
lyrata]
Length=606

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/495 (74%), Positives = 417/495 (84%), Gaps = 6/495 (1%)
 Frame = -2

Query  1875  SRELQR-PLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRP  1699
             S E +R PLPKT DP VQIAGNF PVPEQ V +NLPV G VPDCI GVYVRNGANPL RP
Sbjct  114   SHERRRHPLPKTADPAVQIAGNFFPVPEQPVVHNLPVAGTVPDCIQGVYVRNGANPLHRP  173

Query  1698  KAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLA  1519
              +GHHLFDGDGMVHAV    GSVSY+CRFTET RLVQER  GRPVFPKAIGELHGH G+A
Sbjct  174   ISGHHLFDGDGMVHAVRFDNGSVSYACRFTETNRLVQEREFGRPVFPKAIGELHGHLGIA  233

Query  1518  RLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRY  1339
             +L+LF  RGLFGLVD   G G+ANAGLVYFNG LLAMSEDDLPYHV+V  +GDLET GRY
Sbjct  234   KLMLFNTRGLFGLVDPTGGLGVANAGLVYFNGHLLAMSEDDLPYHVKVTQTGDLETSGRY  293

Query  1338  DFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTM  1159
             DF+ QLKSTMIAHPK+DPE+ E FALSYDV+ KPYLKYF   S GEKSPDVEIPLD PTM
Sbjct  294   DFDGQLKSTMIAHPKIDPETRELFALSYDVVSKPYLKYFRFTSDGEKSPDVEIPLDQPTM  353

Query  1158  IHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVES  979
             IHDFAIT+N+V+IPDQQVVF+L EMIRGGS V+Y++KKKSRFGIL K AK A  I W+E 
Sbjct  354   IHDFAITKNFVVIPDQQVVFRLPEMIRGGSPVVYDEKKKSRFGILNKYAKEASSIQWIEV  413

Query  978   PETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKR  799
             P+ FCFHLWN+WEE ETDE+VVIGSCMTPPDSIFNE +E L  +LSEIRLNLKTGEST+R
Sbjct  414   PDCFCFHLWNSWEEPETDEVVVIGSCMTPPDSIFNEHDETLHCVLSEIRLNLKTGESTRR  473

Query  798   PIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGD  619
             P+I    +QVNLEAGMVNRNLLG+KT++AYLA+ EPWPKVSGF KVDLSTG++QK++YGD
Sbjct  474   PVI---SEQVNLEAGMVNRNLLGKKTRFAYLALTEPWPKVSGFVKVDLSTGDIQKYIYGD  530

Query  618   GKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPY  439
             GKYGGEP F+P      +ED G+I+ FVHDE+  KSELQI+NA+N++L AT+ LPSRVPY
Sbjct  531   GKYGGEPLFLPSGDG--EEDGGYIMVFVHDEEKVKSELQIINAVNMKLEATVTLPSRVPY  588

Query  438   GFHGTFITSYDLQNQ  394
             GFHGTFI+  DL  Q
Sbjct  589   GFHGTFISKEDLSKQ  603



>dbj|BAB11932.1| neoxanthin cleavage enzyme [Vigna unguiculata]
Length=612

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/528 (73%), Positives = 441/528 (84%), Gaps = 6/528 (1%)
 Frame = -2

Query  1974  LPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPE  1795
             L D   P P   KWN LQ+A A ALD+ E ALVS E + PLPKT DP VQIAGNFAPVPE
Sbjct  91    LSDTNQPLPQ--KWNFLQKAAATALDLVETALVSHERKHPLPKTADPRVQIAGNFAPVPE  148

Query  1794  QAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCR  1615
              A    LPV G +P CI+GVYVRNGANPL+ P AGHH FDGDGMVHAV  T G+ SY+CR
Sbjct  149   HAADQGLPVVGKIPKCIDGVYVRNGANPLYEPVAGHHFFDGDGMVHAVKFTNGAASYACR  208

Query  1614  FTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLV  1435
             FTET+RL QE+ LGRPVFPKAIGELHGHSG+ARLLLFYARGLFGLVD  +G G+ANAGLV
Sbjct  209   FTETQRLSQEKSLGRPVFPKAIGELHGHSGIARLLLFYARGLFGLVDGSQGMGVANAGLV  268

Query  1434  YFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSY  1255
             YFN  LLAMSEDDLPYHVR+ P+GDL TVGRYDFN QL STMIAHPK+DP  G+  ALSY
Sbjct  269   YFNNHLLAMSEDDLPYHVRITPNGDLTTVGRYDFNGQLNSTMIAHPKLDPVDGDLHALSY  328

Query  1254  DVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRG  1075
             DVIQKPYLKYF     G KSPDVEIPL  PTM+HDFAITEN+V++PDQQVVFKL EMI G
Sbjct  329   DVIQKPYLKYFRFSPDGVKSPDVEIPLKEPTMMHDFAITENFVVVPDQQVVFKLTEMITG  388

Query  1074  GSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMT  895
             GS V+Y+K K SRFGIL K AK+A  + W+++P+ FCFHLWNAWEE ET+E+VVIGSCMT
Sbjct  389   GSPVVYDKNKTSRFGILHKNAKDANAMRWIDAPDCFCFHLWNAWEEPETEEVVVIGSCMT  448

Query  894   PPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQY  715
             P DSIFNECEE+LKS+LSEIRLNL+TG+ST+RPII +  +QVNLEAGMVNRN LGRKTQ+
Sbjct  449   PADSIFNECEESLKSVLSEIRLNLRTGKSTRRPII-SDAEQVNLEAGMVNRNKLGRKTQF  507

Query  714   AYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFV  535
             AYLA+AEPWPKVSGFAKVDL +GE++K+MYG+ K+GGEP F+   PN +KEDDG+IL+FV
Sbjct  508   AYLALAEPWPKVSGFAKVDLLSGEVKKYMYGEEKFGGEPLFL---PNGQKEDDGYILAFV  564

Query  534   HDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             HDEK WKSELQIVNA NL+L A+IKLPSRVPYGFHGTFI S DL+ Q 
Sbjct  565   HDEKEWKSELQIVNAQNLKLEASIKLPSRVPYGFHGTFIHSKDLRKQA  612



>emb|CDX98455.1| BnaC05g39200D [Brassica napus]
Length=597

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/495 (75%), Positives = 419/495 (85%), Gaps = 3/495 (1%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E Q PLPKT DP VQIAGNFAPV EQ +R NLPV G +PD I GVYVRNGANPL  P 
Sbjct  106   SHERQHPLPKTADPSVQIAGNFAPVNEQPLRRNLPVVGKIPDSIKGVYVRNGANPLHEPV  165

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R +QER LGRPVFPKAIGELHGH+G+AR
Sbjct  166   TGHHFFDGDGMVHAVKFEDGSASYACRFTQTNRFIQERQLGRPVFPKAIGELHGHTGIAR  225

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   GLVD   GTG+ANAGLVYFN RLLAMSEDD PY VR+ P GDL+TVGRYD
Sbjct  226   LMLFYARAAAGLVDPAHGTGVANAGLVYFNNRLLAMSEDDSPYQVRITPGGDLKTVGRYD  285

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     GEKSPDVEI LD PTM+
Sbjct  286   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGEKSPDVEIQLDQPTMM  345

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKLQEMIRGGS VIY+K+K +RFGIL K A ++ GI W+E+P
Sbjct  346   HDFAITENFVVIPDQQVVFKLQEMIRGGSPVIYDKEKVARFGILDKYAADSSGIRWIEAP  405

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE +ENLKS+LSEIRLNL+TGEST+RP
Sbjct  406   DCFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESDENLKSVLSEIRLNLRTGESTRRP  465

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   ++QVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVD++TGE++K +YGD 
Sbjct  466   IISDGEEQVNLEAGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDITTGEVKKHLYGDN  525

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+   P    EDDGHIL FVHDEKTWKSELQIVNA+ LE+ AT+KLPSRVPYG
Sbjct  526   RYGGEPLFL---PGEGAEDDGHILCFVHDEKTWKSELQIVNAVCLEVEATVKLPSRVPYG  582

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  QV
Sbjct  583   FHGTFIGASDLAKQV  597



>ref|XP_010941288.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic [Elaeis 
guineensis]
Length=615

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/541 (70%), Positives = 442/541 (82%), Gaps = 6/541 (1%)
 Frame = -2

Query  2007  SSSVVTLPEQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRP--LPKTWDP  1834
             S +  T P+Q+      P  ++P+WN +QR  AAALD  E A +S  L+ P  LP+T DP
Sbjct  79    SPATSTKPDQR---NHRPQTARPQWNFIQRLAAAALDAVENAFISNVLEGPHLLPQTADP  135

Query  1833  GVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHA  1654
              VQIAGNFAPV EQ   ++LPV G +P  INGVYVRNGANPLF P AGHH FDGDGMVHA
Sbjct  136   AVQIAGNFAPVDEQPPHHDLPVSGRIPPSINGVYVRNGANPLFEPVAGHHFFDGDGMVHA  195

Query  1653  VTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVD  1474
             V +  GS SY+CRFTETERL QER +GRP+FPKAIGELHGHSG+ARLLLFYARGLFGLVD
Sbjct  196   VRLRNGSASYACRFTETERLRQERAIGRPIFPKAIGELHGHSGIARLLLFYARGLFGLVD  255

Query  1473  HRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPK  1294
                GTG+ANAGL+YF+ RLLAMSEDDLPYHVR+ PSGDLETVGRYDF+ QL+S MIAHPK
Sbjct  256   ASHGTGVANAGLIYFHDRLLAMSEDDLPYHVRITPSGDLETVGRYDFDGQLRSAMIAHPK  315

Query  1293  VDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPD  1114
             +DP + E FALSYDVIQKPYLKYF     G KSPDVEIPLD PTM+HDFA+T+N+V+IPD
Sbjct  316   LDPATRELFALSYDVIQKPYLKYFRFSPDGNKSPDVEIPLDQPTMMHDFAMTDNFVVIPD  375

Query  1113  QQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEA  934
             QQVVFKLQEMIRGGS V+Y++ K SRFGIL K A +A  ++WV+ P+ FCFHLWNAWEE 
Sbjct  376   QQVVFKLQEMIRGGSPVVYDRSKTSRFGILPKYAADASEMMWVDVPDCFCFHLWNAWEEP  435

Query  933   ETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAG  754
              T E+VVIGSCMTP DSIFNE +E+LKS+LSEIRL+  TG+ST+R I+ A D Q+NLEAG
Sbjct  436   ATGEVVVIGSCMTPADSIFNENDESLKSVLSEIRLDPSTGKSTRRHIL-APDDQLNLEAG  494

Query  753   MVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPN  574
             MVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL TGE+ KFMYG  +YGGEP+FV R+  
Sbjct  495   MVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLLTGEVAKFMYGGSRYGGEPYFVARDAA  554

Query  573   SEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             S +EDDGH+L+F+HDE T +SEL IVNA ++ L A++KLPSRVPYGFHGTFI S DL++Q
Sbjct  555   SPREDDGHVLAFMHDETTSESELLIVNAADMRLQASVKLPSRVPYGFHGTFINSKDLESQ  614

Query  393   V  391
              
Sbjct  615   A  615



>ref|XP_004488719.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Cicer arietinum]
Length=620

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/516 (72%), Positives = 432/516 (84%), Gaps = 2/516 (0%)
 Frame = -2

Query  1935  WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAV  1756
             WNL Q+A A ALD  E  L+++E + PLPKT DP VQI+GNFAPVPE  V ++LPV G +
Sbjct  106   WNLFQKAAATALDFVETTLITQERKHPLPKTADPRVQISGNFAPVPEHPVTHSLPVTGKI  165

Query  1755  PDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGL  1576
             P CI+GVY+RNGANP + P AGHH FDGDGMVHAV  T GSVSYSCRFTET RL QE+ L
Sbjct  166   PKCIDGVYLRNGANPHYEPVAGHHFFDGDGMVHAVKFTNGSVSYSCRFTETHRLAQEKAL  225

Query  1575  GRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDD  1396
             GRPVFPKAIGELHGHSG+ARL+L+YAR LF LVD   G G+ANAGLVYFN RLLAMSEDD
Sbjct  226   GRPVFPKAIGELHGHSGIARLMLYYARSLFNLVDGSHGMGVANAGLVYFNNRLLAMSEDD  285

Query  1395  LPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNV  1216
             +PY +RV P+GDL TV RYDFN+QLKSTMIAHPKVDP     +ALSYDVIQKPYLKYF  
Sbjct  286   IPYQIRVTPNGDLTTVCRYDFNNQLKSTMIAHPKVDPIDNNLYALSYDVIQKPYLKYFRF  345

Query  1215  KSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSR  1036
              S+G KSPDVEIPL  PTM+HDFAITEN+V++PDQQVVFKL EMIRGGS V+Y K+K SR
Sbjct  346   DSNGVKSPDVEIPLAEPTMMHDFAITENFVVVPDQQVVFKLGEMIRGGSPVVYNKEKVSR  405

Query  1035  FGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENL  856
             FG+L K AK++  + W+++P+ FCFHLWNAWEE E DE+VVIGSCMTP DSIFNECEE+L
Sbjct  406   FGVLPKNAKDSSDMKWIDAPDCFCFHLWNAWEEKENDEVVVIGSCMTPADSIFNECEESL  465

Query  855   KSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVS  676
             KS+LSEIRLNLKTG+ST+R II  + Q VNLEAGMVN+N LGRKTQ+AYLA+AE WPKVS
Sbjct  466   KSVLSEIRLNLKTGKSTRRAIIDES-QHVNLEAGMVNKNKLGRKTQFAYLALAETWPKVS  524

Query  675   GFAKVDLSTGEMQKFMYGDGKYGGEPFFVPR-NPNSEKEDDGHILSFVHDEKTWKSELQI  499
             GFAKVDL +G++ K++YGD ++GGEP F+P  + NS +EDDG+IL+FVHDEK WKSELQI
Sbjct  525   GFAKVDLFSGQVNKYLYGDQRFGGEPLFLPTLDSNSGREDDGYILTFVHDEKEWKSELQI  584

Query  498   VNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             VNAI L+L A+IKLPSRVPYGFHGTFI S DL+ Q 
Sbjct  585   VNAITLKLEASIKLPSRVPYGFHGTFIHSNDLKKQA  620



>ref|NP_177960.1| 9-cis-epoxycarotenoid dioxygenase [Arabidopsis thaliana]
 sp|Q9M9F5.1|NCED9_ARATH RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic; 
Short=AtNCED9; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF71797.1|AC013430_6 F3F9.10 [Arabidopsis thaliana]
 gb|AEE36100.1| 9-cis-epoxycarotenoid dioxygenase [Arabidopsis thaliana]
Length=657

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/517 (73%), Positives = 433/517 (84%), Gaps = 6/517 (1%)
 Frame = -2

Query  1941  PKWNllqravaaaldvaegalVSRELQR-PLPKTWDPGVQIAGNFAPVPEQAVRNNLPVD  1765
             PK N +QR  A  LD  E A++S E +R P PKT DP VQIAGNF PVPE+ V +NLPV 
Sbjct  143   PKLNPVQRTAAMVLDAVENAMISHERRRHPHPKTADPAVQIAGNFFPVPEKPVVHNLPVT  202

Query  1764  GAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQE  1585
             G VP+CI GVYVRNGANPL +P +GHHLFDGDGMVHAV    GSVSY+CRFTET RLVQE
Sbjct  203   GTVPECIQGVYVRNGANPLHKPVSGHHLFDGDGMVHAVRFDNGSVSYACRFTETNRLVQE  262

Query  1584  RGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMS  1405
             R  GRPVFPKAIGELHGH G+A+L+LF  RGLFGLVD   G G+ANAGLVYFNG LLAMS
Sbjct  263   RECGRPVFPKAIGELHGHLGIAKLMLFNTRGLFGLVDPTGGLGVANAGLVYFNGHLLAMS  322

Query  1404  EDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKY  1225
             EDDLPYHV+V  +GDLET GRYDF+ QLKSTMIAHPK+DPE+ E FALSYDV+ KPYLKY
Sbjct  323   EDDLPYHVKVTQTGDLETSGRYDFDGQLKSTMIAHPKIDPETRELFALSYDVVSKPYLKY  382

Query  1224  FNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKK  1045
             F   S GEKSPDVEIPLD PTMIHDFAITEN+V+IPDQQVVF+L EMIRGGS V+Y++KK
Sbjct  383   FRFTSDGEKSPDVEIPLDQPTMIHDFAITENFVVIPDQQVVFRLPEMIRGGSPVVYDEKK  442

Query  1044  KSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECE  865
             KSRFGIL K AK+A  I W+E P+ FCFHLWN+WEE ETDE+VVIGSCMTPPDSIFNE +
Sbjct  443   KSRFGILNKNAKDASSIQWIEVPDCFCFHLWNSWEEPETDEVVVIGSCMTPPDSIFNEHD  502

Query  864   ENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWP  685
             E L+S+LSEIRLNLKTGEST+RP+I    +QVNLEAGMVNRNLLGRKT+YAYLA+ EPWP
Sbjct  503   ETLQSVLSEIRLNLKTGESTRRPVI---SEQVNLEAGMVNRNLLGRKTRYAYLALTEPWP  559

Query  684   KVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSEL  505
             KVSGFAKVDLSTGE++K++YG+GKYGGEP F+P      +ED G+I+ FVHDE+  KSEL
Sbjct  560   KVSGFAKVDLSTGEIRKYIYGEGKYGGEPLFLPS--GDGEEDGGYIMVFVHDEEKVKSEL  617

Query  504   QIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             Q++NA+N++L AT+ LPSRVPYGFHGTFI+  DL  Q
Sbjct  618   QLINAVNMKLEATVTLPSRVPYGFHGTFISKEDLSKQ  654



>gb|AAL07104.1| putative 9-cis-epoxycarotenoid dioxygenase [Arabidopsis thaliana]
Length=599

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/495 (74%), Positives = 419/495 (85%), Gaps = 2/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E   PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P 
Sbjct  106   SHEKLHPLPKTADPSVQIAGNFAPVNEQPVRRNLPVVGKLPDSIKGVYVRNGANPLHEPV  165

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R VQER LGRPVFPKAIGELHGH+G+AR
Sbjct  166   TGHHFFDGDGMVHAVKFEHGSASYACRFTQTNRFVQERQLGRPVFPKAIGELHGHTGIAR  225

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   G+VD   GTG+ANAGLVYFNGRLLAMSEDDLPY V++ P+GDL+TVGR+D
Sbjct  226   LMLFYARAAAGIVDPAHGTGVANAGLVYFNGRLLAMSEDDLPYQVQITPNGDLKTVGRFD  285

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVEI LD PTM+
Sbjct  286   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEIQLDQPTMM  345

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V++PDQQVVFKL EMI GGS V+Y+K K +RFGIL K A+++  I W+++P
Sbjct  346   HDFAITENFVVVPDQQVVFKLPEMILGGSPVVYDKNKVARFGILDKYAEDSSNIKWIDAP  405

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE ETDE+VVIGSCMTPPDSIFNE +ENLKS+LSEIRLNLKTGEST+RP
Sbjct  406   DCFCFHLWNAWEEPETDEVVVIGSCMTPPDSIFNESDENLKSVLSEIRLNLKTGESTRRP  465

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   DQQVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDL+TGE++K +YGD 
Sbjct  466   IISNEDQQVNLEAGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLTTGEVKKHLYGDN  525

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+P      +ED+G+IL FVHDEKTWKSELQIVNA++LE+ AT+KLPSRVPYG
Sbjct  526   RYGGEPLFLPG--EGGEEDEGYILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYG  583

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  QV
Sbjct  584   FHGTFIGADDLAKQV  598



>ref|XP_010537673.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic-like 
[Tarenaya hassleriana]
Length=627

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/490 (75%), Positives = 419/490 (86%), Gaps = 1/490 (0%)
 Frame = -2

Query  1863  QRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHH  1684
             Q  LPKT DP VQIAGNF+PVPE  V++ LPV G VP  I GVYVRNGANPL +P +GHH
Sbjct  138   QNQLPKTADPAVQIAGNFSPVPEHPVQSYLPVTGKVPPRIQGVYVRNGANPLHQPVSGHH  197

Query  1683  LFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLF  1504
             LFDGDGMVHAV    GSVSY+CRFTET RLV+ER LGRPVFPKAIGELHGH G+ARLLLF
Sbjct  198   LFDGDGMVHAVRFDQGSVSYACRFTETNRLVRERELGRPVFPKAIGELHGHFGIARLLLF  257

Query  1503  YARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQ  1324
              ARGL GL+D  RG G+ANAGLVYFN RLLAMSEDDLPY VRV  +GDLETVGR++F  Q
Sbjct  258   QARGLAGLLDPTRGLGVANAGLVYFNNRLLAMSEDDLPYQVRVTQTGDLETVGRHNFCGQ  317

Query  1323  LKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFA  1144
             LKSTMIAHPK+DP++ E FALSYDV+ KPYL+YF     GEKSPDV IPLD PTMIHDFA
Sbjct  318   LKSTMIAHPKIDPKTRELFALSYDVVSKPYLRYFRFTPDGEKSPDVVIPLDQPTMIHDFA  377

Query  1143  ITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFC  964
             ITEN+V++PDQQVVFKL EMIRGGS VIY+K KKSRFG+L K AK++  I W+E+P+ FC
Sbjct  378   ITENFVVVPDQQVVFKLSEMIRGGSPVIYDKNKKSRFGVLNKYAKDSSSIRWIEAPDCFC  437

Query  963   FHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPA  784
             FHLWNAWEE ETDE+VVIGSCMTPPDSIFNE +ENL+S+LSEIRLNLKTGEST+RP+I +
Sbjct  438   FHLWNAWEEPETDEVVVIGSCMTPPDSIFNEHDENLQSVLSEIRLNLKTGESTRRPVI-S  496

Query  783   TDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGG  604
              ++QVNLEAGMVNRNLLG KT++AYLA+AEPWPKVSGFAKVDL+TGE+ K++YGDGKYGG
Sbjct  497   GEEQVNLEAGMVNRNLLGTKTRFAYLALAEPWPKVSGFAKVDLTTGEIHKYIYGDGKYGG  556

Query  603   EPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGT  424
             EP F+P N  S +ED+G IL FVHDEK W+SELQIVNA  LEL A ++LPSRVPYGFHGT
Sbjct  557   EPLFLPENSISGEEDEGSILVFVHDEKRWRSELQIVNASTLELEAIVELPSRVPYGFHGT  616

Query  423   FITSYDLQNQ  394
             FI+S +L+ Q
Sbjct  617   FISSEELEKQ  626



>dbj|BAE92964.1| 9-cis-epoxycarotenoid dioxygenase [Citrus sinensis]
Length=569

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/507 (75%), Positives = 429/507 (85%), Gaps = 3/507 (1%)
 Frame = -2

Query  1983  EQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAP  1804
             +QQ  + ++ APS  KWN LQ+A A ALD  E ALVS+E Q PLPKT DP VQIAGNF+P
Sbjct  66    KQQPKENDNFAPS--KWNFLQKAAALALDAVENALVSQERQHPLPKTADPTVQIAGNFSP  123

Query  1803  VPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSY  1624
             VPE+ V  NLP  G VPDCI GVYVRNGANPL  P AGHH FDGDGMVHAV    GSVSY
Sbjct  124   VPEKPVCQNLPTTGKVPDCIQGVYVRNGANPLHEPVAGHHFFDGDGMVHAVQFNKGSVSY  183

Query  1623  SCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANA  1444
             SCRFTET R VQER LGRPVFPKAIGELHGH+G+ARLLLFY+R LFGLVD   GTG+ANA
Sbjct  184   SCRFTETNRFVQERSLGRPVFPKAIGELHGHTGIARLLLFYSRALFGLVDPSHGTGVANA  243

Query  1443  GLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFA  1264
             GLVYFN RLLAMSEDDLPYHVRV PSGDL+TVGR+DF+ QLKSTMIAHPKVDP +G+ FA
Sbjct  244   GLVYFNNRLLAMSEDDLPYHVRVTPSGDLKTVGRFDFSGQLKSTMIAHPKVDPVTGDLFA  303

Query  1263  LSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEM  1084
             LSYDV++KPYLKYF     G KSPDVEIP + PTM+HDFAITEN+V++PDQQVVFKL EM
Sbjct  304   LSYDVVKKPYLKYFRFSPQGIKSPDVEIPPEEPTMMHDFAITENFVVVPDQQVVFKLNEM  363

Query  1083  IRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGS  904
             IRGGS VIY+K K SRFGIL K A +A  + W+++P+ FCFHLWNAWEE E DE+VVIGS
Sbjct  364   IRGGSPVIYDKNKVSRFGILDKNATDASKMKWIDAPDCFCFHLWNAWEEPERDEVVVIGS  423

Query  903   CMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRK  724
             CMTP DSIFNEC+E+LKS+LSEIRLNLKTGEST+RP+I + D+QVNLEAGMVNRNLLGRK
Sbjct  424   CMTPADSIFNECDESLKSVLSEIRLNLKTGESTRRPLI-SEDEQVNLEAGMVNRNLLGRK  482

Query  723   TQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHIL  544
             T++AYLA+AEPWPKVSGFAKVDL TG++ KF+YG  +YGGEP F PR+PNSE ED G+IL
Sbjct  483   TRFAYLALAEPWPKVSGFAKVDLLTGQVNKFIYGGQRYGGEPLFFPRDPNSENEDVGYIL  542

Query  543   SFVHDEKTWKSELQIVNAINLELLATI  463
             +FVHDEK WKSELQIVNA+ LEL AT+
Sbjct  543   AFVHDEKEWKSELQIVNAMTLELEATV  569



>ref|XP_008809583.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Phoenix dactylifera]
Length=616

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/567 (67%), Positives = 458/567 (81%), Gaps = 7/567 (1%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqravaa  1906
             L LP+ S S   P+    ++ + A   +   + P+Q+    +    ++P+WN LQR  +A
Sbjct  55    LNLPAHSSSYHPPS----LYVKEAATITKPSSKPDQRKHRRDDGRSNRPQWNFLQRLASA  110

Query  1905  aldvaegalVSRELQRP--LPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVY  1732
             ALD  E A +S  L+RP  LPKT DP VQIAGNFAPV EQ   ++LPV G +P  INGVY
Sbjct  111   ALDSVEDAFISNVLERPHPLPKTSDPAVQIAGNFAPVGEQPPHHDLPVSGHIPPFINGVY  170

Query  1731  VRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKA  1552
             VRNGANP F+P AGHH FDGDGMVHAV +  G+ SY+CRFTETERL QER LGRP+FPKA
Sbjct  171   VRNGANPHFQPVAGHHFFDGDGMVHAVHLRNGAASYTCRFTETERLRQERALGRPIFPKA  230

Query  1551  IGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVK  1372
             IGELHGHSG+ARLLLFYAR LFGLVD   GTG+ANAGL+YF+ RLLAMSEDDLPYHVRV 
Sbjct  231   IGELHGHSGIARLLLFYARALFGLVDPSHGTGVANAGLIYFHERLLAMSEDDLPYHVRVN  290

Query  1371  PSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSP  1192
             PSGDLETVGRYDF+ QL+S MIAHPK+DP S E FALSYDVIQKPYLKYF+   +GEKSP
Sbjct  291   PSGDLETVGRYDFDGQLRSAMIAHPKLDPVSRELFALSYDVIQKPYLKYFHFSPAGEKSP  350

Query  1191  DVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTA  1012
             DVEIPLD PTM+HDFAITEN+V+IPDQQVVFKL EMIRGGS V+Y++ K SRFGIL K A
Sbjct  351   DVEIPLDQPTMMHDFAITENFVVIPDQQVVFKLPEMIRGGSPVVYDRSKTSRFGILPKHA  410

Query  1011  KNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIR  832
              +A  + WV+ P+ FCFHLWNAWEE  T E+VV+GSCMTP DSIFNE +E L+S+LSEIR
Sbjct  411   ADASEMKWVDVPDCFCFHLWNAWEEPGTGEVVVLGSCMTPADSIFNESDETLRSVLSEIR  470

Query  831   LNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLS  652
             L+  TG+ST+RPI+  TD Q+NLEAGMVNRN LGRKT+YAYLAIA PWPKVSGFAKVDL 
Sbjct  471   LDPTTGKSTRRPILGPTD-QLNLEAGMVNRNKLGRKTRYAYLAIANPWPKVSGFAKVDLF  529

Query  651   TGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELL  472
             TGE+ KF++G+ +YGGEP+FVPR+ +S +EDDG++L+F+H+EKT +SEL IVNA+++ L 
Sbjct  530   TGEVAKFIFGEDRYGGEPYFVPRHASSPREDDGYVLTFMHNEKTSQSELLIVNAVDMRLE  589

Query  471   ATIKLPSRVPYGFHGTFITSYDLQNQV  391
             A++KLPSRVPYGFHGTFI S DL++Q 
Sbjct  590   ASVKLPSRVPYGFHGTFINSKDLESQA  616



>gb|AGI98130.1| 9-cis-epoxycarotenoid dioxygenase [Narcissus tazetta]
Length=600

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/582 (65%), Positives = 458/582 (79%), Gaps = 30/582 (5%)
 Frame = -2

Query  2055  KKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAP------------------------  1948
             K P++ ++IHC ++ HS  ++ LP Q       P P                        
Sbjct  22    KSPSKLSRIHCSSSPHS--LLDLPSQSPQSYNCPTPLVKQEPDINISHSNPITIIPSTKS  79

Query  1947  -SQPKWNllqravaaaldvaegalVSRELQRP--LPKTWDPGVQIAGNFAPVPEQAVRNN  1777
               +PKWN+ Q+A AAALD  E   +S+ L++P  LPKT DP VQI+GN+APV EQ    +
Sbjct  80    SQKPKWNIFQQATAAALDAIEQNFISKVLEKPHPLPKTADPRVQISGNYAPVSEQEPHQS  139

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV+G +P  INGVYVRNGANPL  P AGHHLFDGDGM+HAVT   G  +Y CRFTETER
Sbjct  140   LPVEGRIPPFINGVYVRNGANPLLEPVAGHHLFDGDGMIHAVTFRNGKAAYCCRFTETER  199

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             L QER +G+PVFPKAIGELHGHSG+ARL+LFYARGL GL+D   GTG+ NAGL+YF+ RL
Sbjct  200   LKQEREIGKPVFPKAIGELHGHSGIARLMLFYARGLIGLLDSSHGTGVTNAGLIYFHDRL  259

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV++ P+GDLETVGRYDF+ QL S MIAHPK+DP S E FALSYDVIQKP
Sbjct  260   LAMSEDDLPYHVKITPNGDLETVGRYDFDGQLSSAMIAHPKLDPVSKELFALSYDVIQKP  319

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF     G KS DVEI LD PTM+HDFAITEN+VI+PDQQVVFKLQEMIRGGS VIY
Sbjct  320   YLKYFRFSPDGNKSADVEIELDQPTMMHDFAITENFVIVPDQQVVFKLQEMIRGGSPVIY  379

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K +RFGIL K AK+A+ + WVE PE FCFHLWNAWE+ ET EIVVIGSCMTP DSIF
Sbjct  380   DKNKIARFGILPKYAKDAKEMKWVEVPECFCFHLWNAWEDEETGEIVVIGSCMTPADSIF  439

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E+L+S+LSEIRLN +TG+ST+RPII +  +Q+NLEAGMVNRN LGRKT+YAYLAIA
Sbjct  440   NECDESLESVLSEIRLNPRTGKSTRRPII-SEPEQLNLEAGMVNRNRLGRKTRYAYLAIA  498

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKVDL +GE++KF+YG+  YGGEP+F+PR+  S++EDDG+I++FVH+E+T 
Sbjct  499   EPWPKVSGFAKVDLQSGEVRKFIYGENCYGGEPYFIPRDAGSKREDDGYIVTFVHNEETS  558

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +SEL+IVNA ++ L A++KLPSRVPYGFHGTFI S +LQ+Q 
Sbjct  559   ESELRIVNAADMRLEASVKLPSRVPYGFHGTFIGSKELQSQA  600



>emb|CDY52448.1| BnaA07g39250D [Brassica napus]
Length=602

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/496 (73%), Positives = 421/496 (85%), Gaps = 4/496 (1%)
 Frame = -2

Query  1875  SRELQR-PLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRP  1699
             S E +R PLPKT DP VQIAGNF PVPEQ V++NLPV G VP+CI GVYVRNGANPL +P
Sbjct  108   SHERRRHPLPKTADPAVQIAGNFFPVPEQPVKHNLPVTGTVPECIQGVYVRNGANPLHKP  167

Query  1698  KAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLA  1519
              +GHHLFDGDGM+HAV    GSVSYSCRFTET R VQER LGR VFPKAIGELHGH G+A
Sbjct  168   ISGHHLFDGDGMIHAVRFNNGSVSYSCRFTETNRFVQERELGRSVFPKAIGELHGHLGIA  227

Query  1518  RLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRY  1339
             +L+LF ARGLFGL+D  +G G+ANAGLVYFNG LLAMSEDDLPYHV+V  +GDLET GRY
Sbjct  228   KLMLFNARGLFGLLDPTQGLGVANAGLVYFNGHLLAMSEDDLPYHVKVTQTGDLETSGRY  287

Query  1338  DFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTM  1159
             DF+ QLKSTMIAHPK+DPE+ E FALSYDV+ KPYLKYF   S G+KSPDVEIPLD PTM
Sbjct  288   DFDGQLKSTMIAHPKLDPETRELFALSYDVVSKPYLKYFRFSSDGQKSPDVEIPLDQPTM  347

Query  1158  IHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVES  979
             IHDFAITEN+V++PDQQVVF+L EMIRGGS V+Y+K KKSRFG+L K A++A  + W+E 
Sbjct  348   IHDFAITENFVVVPDQQVVFRLPEMIRGGSPVVYDKNKKSRFGVLDKYAEDASSMRWIEV  407

Query  978   PETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKR  799
              + FCFHLWNAWEEAETDE+VVIGSCMTPPDSIFNE +E L+S+LSEIRLNL+TGEST+R
Sbjct  408   EDCFCFHLWNAWEEAETDEVVVIGSCMTPPDSIFNEHDETLQSVLSEIRLNLRTGESTRR  467

Query  798   PIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGD  619
             P+I    +++NLEAGMVNRNLLGRKT++AYLA+ EPWPKVSGFAKVDLSTGE+QK++YGD
Sbjct  468   PVI---SEELNLEAGMVNRNLLGRKTRFAYLALTEPWPKVSGFAKVDLSTGEVQKYIYGD  524

Query  618   GKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPY  439
             GKYGGEP F+P   +   E  G+++ FVHDE+  +SELQI+NA +L+L AT+ LPSRVPY
Sbjct  525   GKYGGEPLFMPEGSSYAGEGGGYVMVFVHDEENVRSELQIINAGSLKLEATVTLPSRVPY  584

Query  438   GFHGTFITSYDLQNQV  391
             GFHGTFI++ DL  Q 
Sbjct  585   GFHGTFISNEDLLKQA  600



>gb|AEG78287.1| 9-cis-epoxycarotenoid dioxygenase [Gladiolus hybrid cultivar]
Length=611

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/519 (72%), Positives = 432/519 (83%), Gaps = 4/519 (1%)
 Frame = -2

Query  1941  PKWNllqravaaaldvaegalVSRELQRP--LPKTWDPGVQIAGNFAPVPEQAVRNNLPV  1768
             P+WN+ Q+A +  LD+ E + ++  L++P  LPKT DP VQIAGNFAPV EQ    NLPV
Sbjct  95    PQWNIFQQAASTLLDLVEDSFITNLLEKPHPLPKTSDPSVQIAGNFAPVEEQPPHQNLPV  154

Query  1767  DGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQ  1588
              G +P  INGVYVRNGANPLF P AGHH FDGDGMVHAV +  G  SYSCRFTETERL Q
Sbjct  155   SGRIPPFINGVYVRNGANPLFEPVAGHHFFDGDGMVHAVRLQNGKASYSCRFTETERLRQ  214

Query  1587  ERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAM  1408
             ER +GRP+FPKAIGELHGHSG+ARLLLFYARGL G+VD   GTG+ANAGL+YFN RLLAM
Sbjct  215   ERAIGRPIFPKAIGELHGHSGIARLLLFYARGLVGIVDPTHGTGVANAGLIYFNDRLLAM  274

Query  1407  SEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLK  1228
             SEDDLPYHVRV PSGDLETVGRYDF+ QL S MIAHPK+DP + E FALSY+VIQKPYLK
Sbjct  275   SEDDLPYHVRVSPSGDLETVGRYDFDGQLDSAMIAHPKLDPVTKELFALSYNVIQKPYLK  334

Query  1227  YFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKK  1048
             YF    +GEK+PDVEIPLD PTM+HDFAITEN+VI+P QQVVFKLQEMIRGGS V+Y+K+
Sbjct  335   YFRFSPNGEKAPDVEIPLDQPTMMHDFAITENFVIVPGQQVVFKLQEMIRGGSPVVYDKE  394

Query  1047  KKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNEC  868
             K +RFGIL K AK+A  + WV+ PE FCFHLWNAWE+ ET E+VVIGS MTP DSIFNEC
Sbjct  395   KTARFGILPKYAKDASEMKWVDVPECFCFHLWNAWEDNETGEVVVIGSSMTPADSIFNEC  454

Query  867   EENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPW  688
              E L+S LSEIRLN KTG+ST+RPI+  +D Q NLEAGMVNRN LGRKT++AYLAIAEPW
Sbjct  455   NETLESALSEIRLNPKTGKSTRRPILSPSD-QFNLEAGMVNRNRLGRKTRFAYLAIAEPW  513

Query  687   PKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSE  508
             PKVSGFAKVDLSTGE+ KF+YGD KYGGEP+FVPR   S +EDDG++L+FVHDE+T +SE
Sbjct  514   PKVSGFAKVDLSTGEVHKFIYGDNKYGGEPYFVPRE-GSTREDDGYVLAFVHDEETSESE  572

Query  507   LQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             LQIVN  ++ L AT+KLPSRVPYGFHGTFI + +L+ Q 
Sbjct  573   LQIVNGTDMRLEATVKLPSRVPYGFHGTFIGTKELETQA  611



>gb|AGT28471.1| 9-cis-epoxycarotenoid dioxygenase [Narcissus tazetta]
Length=600

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/582 (65%), Positives = 462/582 (79%), Gaps = 30/582 (5%)
 Frame = -2

Query  2055  KKPTRRAKIHCEAAVHSSSVVTLPEQ-------------QLPD------------GESPA  1951
             K P++ ++IHC ++ HS  ++ LP Q             Q PD              + +
Sbjct  22    KPPSKLSRIHCSSSPHS--LLDLPSQSPQSYNCSTPLVKQEPDINITHSNPITIIPSTKS  79

Query  1950  PSQPKWNllqravaaaldvaegalVSRELQRP--LPKTWDPGVQIAGNFAPVPEQAVRNN  1777
               +PKWN+ Q+A AAALD  E   +S+ L++P  LPKT DP VQI+GN+APV EQ    +
Sbjct  80    SQKPKWNIFQQATAAALDAIEQNFISKVLEKPHPLPKTADPRVQISGNYAPVSEQEPHQS  139

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV+G +P  INGVYVRNGANPL  P AGHHLFDGDGM+HAVT   G  +Y CRFTETER
Sbjct  140   LPVEGRIPPFINGVYVRNGANPLLEPVAGHHLFDGDGMIHAVTFRNGKAAYCCRFTETER  199

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             L QER +G+PVFPKAIGELHGHSG+ARL+LFYARGL GL+D   GTG+AN GL+YF+ RL
Sbjct  200   LKQEREIGKPVFPKAIGELHGHSGIARLMLFYARGLIGLLDSSNGTGVANTGLIYFHDRL  259

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHV++ P+GDLETVGRYDF+ QL S MIAHPK+DP S E FALSYDVIQKP
Sbjct  260   LAMSEDDLPYHVKITPNGDLETVGRYDFDGQLSSAMIAHPKLDPVSKELFALSYDVIQKP  319

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF     G+KS DVEI LD PTM+HDFAITEN+VI+PDQQVVFKLQEMIRGGS VIY
Sbjct  320   YLKYFRFSPDGKKSADVEIELDQPTMMHDFAITENFVIVPDQQVVFKLQEMIRGGSPVIY  379

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K +RFGIL K AK+A+ + WVE PE FCFHLWNAWE+ ET EIVVIGSCMTP DSIF
Sbjct  380   DKNKIARFGILPKYAKDAKEMKWVEVPECFCFHLWNAWEDEETGEIVVIGSCMTPADSIF  439

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NEC+E+L+S+LSEIRL+ +TG+ST+RPII +  +Q+NLEAGMVNRN LGRKT+YAYLAIA
Sbjct  440   NECDESLESVLSEIRLDPRTGKSTRRPII-SEPEQLNLEAGMVNRNRLGRKTRYAYLAIA  498

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKVDL +GE++KF+YGD  YGGEP+F+PR+  S++EDDG+I++FVH+E+T 
Sbjct  499   EPWPKVSGFAKVDLQSGEVRKFIYGDNCYGGEPYFIPRDAGSKREDDGYIVTFVHNEETS  558

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +SEL+IVNA ++ L A++KLPSRVPYGFHGTFI S +LQ+Q 
Sbjct  559   ESELRIVNAADMRLEASVKLPSRVPYGFHGTFIGSKELQSQA  600



>ref|XP_009106546.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic 
[Brassica rapa]
Length=673

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/496 (72%), Positives = 420/496 (85%), Gaps = 4/496 (1%)
 Frame = -2

Query  1875  SRELQR-PLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRP  1699
             S E +R PLPKT DP VQIAGNF PVPEQ V++NLPV G VP+CI GVYVRNGANPL +P
Sbjct  179   SHERRRHPLPKTADPAVQIAGNFFPVPEQPVKHNLPVTGTVPECIQGVYVRNGANPLHKP  238

Query  1698  KAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLA  1519
              +GHH FDGDGM+HAV    GSVSYSCRFTET R VQER LGR VFPKAIGELHGH G+A
Sbjct  239   ISGHHFFDGDGMIHAVRFNNGSVSYSCRFTETNRFVQERELGRSVFPKAIGELHGHLGIA  298

Query  1518  RLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRY  1339
             +L+LF ARGLFGL+D  +G G+ANAGLVYFNG LLAMSEDDLPYHV+V  +GDLET GRY
Sbjct  299   KLMLFNARGLFGLLDPTQGLGVANAGLVYFNGHLLAMSEDDLPYHVKVTQTGDLETSGRY  358

Query  1338  DFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTM  1159
             DF+ QLKSTMIAHPK+DPE+ E FALSYDV+ KPYLKYF   S G+KSPDVEIPLD PTM
Sbjct  359   DFDGQLKSTMIAHPKLDPETRELFALSYDVVSKPYLKYFRFSSDGQKSPDVEIPLDQPTM  418

Query  1158  IHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVES  979
             IHDFAITEN+V++PDQQVVF+L EMIRGGS V+Y+K KKSRFG+L K A++A  + W+E 
Sbjct  419   IHDFAITENFVVVPDQQVVFRLPEMIRGGSPVVYDKNKKSRFGVLDKYAEDASSMRWIEV  478

Query  978   PETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKR  799
              + FCFHLWNAWEEAETDE+VVIGSCMTPPDSIFNE +E L+S+LSEIRLNL+TGEST+R
Sbjct  479   EDCFCFHLWNAWEEAETDEVVVIGSCMTPPDSIFNEHDETLQSVLSEIRLNLRTGESTRR  538

Query  798   PIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGD  619
             P+I    +++NLEAGMVNRNLLGRKT++AYLA+ EPWPKVSGFAKVDLSTGE+QK++YGD
Sbjct  539   PVI---SEELNLEAGMVNRNLLGRKTRFAYLALTEPWPKVSGFAKVDLSTGEVQKYIYGD  595

Query  618   GKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPY  439
             GKYGGEP F+P   +   E  G+++ FVHDE+  +SELQI+NA +L+L AT+ LPSRVPY
Sbjct  596   GKYGGEPLFMPEGSSYAGEGGGYVMVFVHDEENVRSELQIINAGSLKLEATVTLPSRVPY  655

Query  438   GFHGTFITSYDLQNQV  391
             GFHGTFI++ DL  Q 
Sbjct  656   GFHGTFISNEDLLKQA  671



>gb|EPS69338.1| 9-cis-epoxycarotenoid dioxygenase 3, partial [Genlisea aurea]
Length=506

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/509 (72%), Positives = 432/509 (85%), Gaps = 3/509 (1%)
 Frame = -2

Query  1941  PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDG  1762
             P++NL+QR  AAALD  EG L++ EL+ PLP+  DP VQIAGNF+PVPE  V   +PV G
Sbjct  1     PEFNLIQRVAAAALDSVEGMLMAHELKLPLPRRADPRVQIAGNFSPVPEFPVEEEIPVVG  60

Query  1761  AVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQER  1582
              +P+ I+GVYVRNGANPLF P+AGHH FDGDGM+HAV   GG+VSYSCRFTET+RL+QER
Sbjct  61    KIPESIDGVYVRNGANPLFEPQAGHHFFDGDGMIHAVKFRGGAVSYSCRFTETKRLIQER  120

Query  1581  GLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSE  1402
              LGRP+FPKAIGELHGH+G+ARLLLFYARG+F +VDHR G G+ANAGLV+FN RLLAMSE
Sbjct  121   SLGRPIFPKAIGELHGHTGIARLLLFYARGIFDIVDHRHGIGVANAGLVFFNRRLLAMSE  180

Query  1401  DDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYF  1222
             DDLPYHVRV P+GDLETVGRYDF  +L+S+MIAHPK+DP SGE F+LSY+ IQ+PYLKYF
Sbjct  181   DDLPYHVRVTPAGDLETVGRYDFGGKLQSSMIAHPKIDPISGEMFSLSYNPIQRPYLKYF  240

Query  1221  NVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKK  1042
                 +GEKS DVEIP+  PTM+HDFAITE +V+IPDQQVVFK+ EMIRGGS V+Y+++K 
Sbjct  241   RFSRTGEKSDDVEIPVSEPTMMHDFAITERFVVIPDQQVVFKMSEMIRGGSPVVYDREKV  300

Query  1041  SRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEE  862
             SRFG+L K AK+  GI W++ P  FCFHLWNAWEE  T E+VVIGSCMTP DSIFNEC+E
Sbjct  301   SRFGVLDKYAKSGSGIKWIQVPNCFCFHLWNAWEEPATGEVVVIGSCMTPADSIFNECDE  360

Query  861   NLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPK  682
              LKS+LSEIRLNL+TG+ST+R IIP  D QVNLEAGMVNRN LGRKT++AYLAIAEPWP+
Sbjct  361   GLKSVLSEIRLNLRTGKSTRRKIIPDAD-QVNLEAGMVNRNKLGRKTRFAYLAIAEPWPR  419

Query  681   VSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQ  502
             VSGFAKVDLSTGE++K  YGD KYGGEP F+P   NS+ EDDGHIL F HDEK+ KSELQ
Sbjct  420   VSGFAKVDLSTGEVKKIFYGDAKYGGEPLFLP--GNSDSEDDGHILVFTHDEKSSKSELQ  477

Query  501   IVNAINLELLATIKLPSRVPYGFHGTFIT  415
             I+NA NL+L A+++LPSRVPYGFHGTFI 
Sbjct  478   IINAANLKLHASVQLPSRVPYGFHGTFIA  506



>dbj|BAN15737.1| 9-cis-epoxy-carotenoid dioxygenase [Dianthus caryophyllus]
Length=592

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/494 (73%), Positives = 410/494 (83%), Gaps = 3/494 (1%)
 Frame = -2

Query  1869  ELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAG  1690
             E + PLPKT DP VQI+GNFAPV E  V++NLPV G +P CI G YVRNGANPL+ P AG
Sbjct  101   ETKSPLPKTSDPAVQISGNFAPVTEHPVQHNLPVSGVIPACIKGAYVRNGANPLYAPSAG  160

Query  1689  HHLFDGDGMVHAVTIT-GGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARL  1513
             HHLFDGDGM+H V     GS SY+CRFTET RLVQER LGRP+FPKAIGELHGHSG+ RL
Sbjct  161   HHLFDGDGMLHTVNFQPDGSASYACRFTETNRLVQERALGRPIFPKAIGELHGHSGIGRL  220

Query  1512  LLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDF  1333
              LFY R L GL+DH  G G+ANAG+VYFN RLLAMSEDD+PYHV+V PSGDL T GRYDF
Sbjct  221   ALFYTRSLLGLLDHSNGIGVANAGVVYFNDRLLAMSEDDIPYHVKVTPSGDLVTEGRYDF  280

Query  1332  NDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIH  1153
             + QL STMIAHPKVDP +GE FALSYDVI+KPYLKYF   + G K+PDV+I LD PTM+H
Sbjct  281   DGQLDSTMIAHPKVDPVTGELFALSYDVIKKPYLKYFWFNADGSKAPDVDIELDTPTMMH  340

Query  1152  DFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPE  973
             DFAITEN VIIPD QVVFKLQEMIRGGS V+Y+K+K SRFGIL K A+N+E + W+E P+
Sbjct  341   DFAITENCVIIPDSQVVFKLQEMIRGGSPVVYDKEKTSRFGILPKYARNSEDMQWIEVPD  400

Query  972   TFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPI  793
              FCFHLWNAWEE ETDEIVVIGSCMTP DSIFNEC+ENL S+LSEIRLN KTG+ST+R I
Sbjct  401   CFCFHLWNAWEEPETDEIVVIGSCMTPADSIFNECDENLSSVLSEIRLNRKTGKSTRREI  460

Query  792   IPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGK  613
             +  +D Q+NLEAGMVNRN+LGRKT+YAYLAIAEPWPKVSGFAKVDL TG + KF+YGD K
Sbjct  461   LKESD-QMNLEAGMVNRNMLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGNVTKFIYGDNK  519

Query  612   YGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGF  433
             YGGEP F+PR  +   EDDGHIL+FVHDE  W+SELQIVNA  +E+ A ++LPSRVPYGF
Sbjct  520   YGGEPLFLPRE-DGTSEDDGHILTFVHDEDKWESELQIVNAATMEVEALVQLPSRVPYGF  578

Query  432   HGTFITSYDLQNQV  391
             HGTFI + DL+ Q 
Sbjct  579   HGTFIAANDLKTQA  592



>ref|XP_010428966.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic-like 
[Camelina sativa]
Length=615

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/517 (72%), Positives = 429/517 (83%), Gaps = 6/517 (1%)
 Frame = -2

Query  1941  PKWNllqravaaaldvaegalVSRELQR-PLPKTWDPGVQIAGNFAPVPEQAVRNNLPVD  1765
             PK N +QR  A  LD  E A+VS E +R PLPKT DP VQI+GNF PVPE+ V +NLPV 
Sbjct  103   PKLNPVQRTAATILDAVENAMVSHERRRHPLPKTADPTVQISGNFFPVPEKPVVHNLPVT  162

Query  1764  GAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQE  1585
             G VP+CI GVYVRNGANPL +P +GHHLFDGDGM+HAV    GSVSY+CRFTET RLVQE
Sbjct  163   GTVPECIQGVYVRNGANPLHKPVSGHHLFDGDGMIHAVRFDNGSVSYACRFTETNRLVQE  222

Query  1584  RGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMS  1405
             R  GRPVFPKAIGELHGH G+A+L+LF  RGLFGLV+  RG G+ANAGLVYFNG LLAMS
Sbjct  223   RESGRPVFPKAIGELHGHLGIAKLMLFNTRGLFGLVEPTRGLGVANAGLVYFNGHLLAMS  282

Query  1404  EDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKY  1225
             EDDLPYHV+V  +GDL T GRYDF+ QL+STMIAHPK+DP + E F LSYDV+ KPYLKY
Sbjct  283   EDDLPYHVKVTQTGDLATSGRYDFDGQLQSTMIAHPKIDPVTRELFGLSYDVVSKPYLKY  342

Query  1224  FNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKK  1045
             F   S GEKSPDVEI LD PTMIHDFAITEN+V++PDQQVVF+L EMIRGGS V+Y++ K
Sbjct  343   FRFTSDGEKSPDVEIHLDQPTMIHDFAITENFVVVPDQQVVFRLPEMIRGGSPVVYDENK  402

Query  1044  KSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECE  865
             KSRFGIL K AK+A  I W+E P+ FCFHLWNAWEE ETDE+VVIGSCMTPPDSIFNE +
Sbjct  403   KSRFGILNKYAKDASSIQWIEVPDCFCFHLWNAWEEPETDEVVVIGSCMTPPDSIFNEHD  462

Query  864   ENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWP  685
             E L+S+LSEIRLNLKTGEST+RP+I    +QVNLEAGMVNRNLLGRKT++ YLA+ EPWP
Sbjct  463   ETLESVLSEIRLNLKTGESTRRPVI---TEQVNLEAGMVNRNLLGRKTRFVYLALTEPWP  519

Query  684   KVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSEL  505
             KVSGFAKVD+STGE+QK++YGD KYGGEP F+P      +EDDG+I+ FVHDE+  KSEL
Sbjct  520   KVSGFAKVDISTGEIQKYIYGDEKYGGEPLFLPSGDG--EEDDGYIMVFVHDEEKVKSEL  577

Query  504   QIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             QI+NA+NL+L AT+ LPSRVPYGFHGTFIT  DL  Q
Sbjct  578   QIINAVNLKLEATVTLPSRVPYGFHGTFITKEDLLKQ  614



>ref|XP_010416821.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic-like 
[Camelina sativa]
Length=608

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/518 (72%), Positives = 430/518 (83%), Gaps = 6/518 (1%)
 Frame = -2

Query  1944  QPKWNllqravaaaldvaegalVSRELQR-PLPKTWDPGVQIAGNFAPVPEQAVRNNLPV  1768
              PK N +QR  A  LD  E A+VS EL+R PLPKT DP VQI+GNF PVPE+ V +NLPV
Sbjct  95    NPKLNPVQRTAATILDAVENAMVSHELRRHPLPKTADPTVQISGNFFPVPEKPVVHNLPV  154

Query  1767  DGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQ  1588
              G VP+CI GVYVRNGANPL +P +GHHLFDGDGM+H+V    GSVSY+CRFTET RLVQ
Sbjct  155   TGTVPECIQGVYVRNGANPLHKPVSGHHLFDGDGMIHSVQFDNGSVSYACRFTETNRLVQ  214

Query  1587  ERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAM  1408
             ER  GRPVFPKAIGELHGH G+A+L+LF  RGLFGLVD  RG G+ANAGLVYFNG LLAM
Sbjct  215   ERESGRPVFPKAIGELHGHLGIAKLMLFNTRGLFGLVDSTRGLGVANAGLVYFNGHLLAM  274

Query  1407  SEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLK  1228
             SEDDLPY+V+V  +GDLET GRYDF+ QLKSTMIAHPK+DP + E FALSYD++ KPYLK
Sbjct  275   SEDDLPYYVKVTQTGDLETSGRYDFDGQLKSTMIAHPKIDPVTRELFALSYDIVSKPYLK  334

Query  1227  YFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKK  1048
             YF   S GEKS DVEIPLD PTMIHDFAITEN+V+IPDQQVVF+L EMIRGGS V+Y++ 
Sbjct  335   YFRFTSDGEKSSDVEIPLDQPTMIHDFAITENFVVIPDQQVVFRLPEMIRGGSPVVYDEN  394

Query  1047  KKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNEC  868
             KKSRFGIL K AK+A  I W E P+ FCFHLWNAWEE +T+E+VVIGSCMTPPDSIFNE 
Sbjct  395   KKSRFGILNKYAKDASSIQWTEVPDCFCFHLWNAWEEPDTEEVVVIGSCMTPPDSIFNEH  454

Query  867   EENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPW  688
             +E L+S+LSEIRLNLKTGEST+RP+I    +Q+NLEAGMVNRNLLGRKT++ YLA+ EPW
Sbjct  455   DETLESVLSEIRLNLKTGESTRRPVI---SEQLNLEAGMVNRNLLGRKTRFVYLALTEPW  511

Query  687   PKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSE  508
             PKVSGFAKVD+STGE+QK++YGD KYGGEP F+P      +EDD +I+ FVHDE+  KSE
Sbjct  512   PKVSGFAKVDISTGEIQKYIYGDEKYGGEPLFLPSGDG--EEDDDYIMVFVHDEEKVKSE  569

Query  507   LQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             LQI+NA+NL+L AT+ LPSRVPYGFHGTFI+  DL  Q
Sbjct  570   LQIINAVNLKLEATVTLPSRVPYGFHGTFISKEDLLKQ  607



>ref|XP_010054257.1| PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxycarotenoid dioxygenase 
NCED1, chloroplastic [Eucalyptus grandis]
Length=599

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/517 (74%), Positives = 417/517 (81%), Gaps = 22/517 (4%)
 Frame = -2

Query  1941  PKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDG  1762
             P+WN LQ+A A ALD  E AL+SREL  PLPKT DP VQI GNFAPVPEQ V   LPV G
Sbjct  105   PRWNFLQKAAATALDFVESALISRELHHPLPKTADPNVQIGGNFAPVPEQPVCRYLPVAG  164

Query  1761  AVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQER  1582
              +PDCINGVYVRNGANPL  P AGHHLFDGDGMVHAVTI GGS SY+CRFTET RLVQER
Sbjct  165   KIPDCINGVYVRNGANPLHEPMAGHHLFDGDGMVHAVTIGGGSASYACRFTETRRLVQER  224

Query  1581  GLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSE  1402
              LGRPVFPKAIGELHGHSG+ARLLLFYARG FGL+DH  G+G+ANAGLVYFN RLLAMSE
Sbjct  225   ELGRPVFPKAIGELHGHSGIARLLLFYARGAFGLLDHSCGSGVANAGLVYFNNRLLAMSE  284

Query  1401  DDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYF  1222
             DDLPY VRVK SGDLETVGRYDF+ QLKSTMIAHPKVDP + E FALSYDV+ KPYLKYF
Sbjct  285   DDLPYQVRVKHSGDLETVGRYDFDGQLKSTMIAHPKVDPITRELFALSYDVVHKPYLKYF  344

Query  1221  NVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKK  1042
              V   GEKSPDVEIPL VPTM+HDFAITEN+V+IPDQQVVFKLQEM+RGGS VIY+K K 
Sbjct  345   RVSPDGEKSPDVEIPLPVPTMMHDFAITENFVVIPDQQVVFKLQEMLRGGSPVIYDKDKT  404

Query  1041  SRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEE  862
             SRFGIL K A +  GI WVE P TFCFHLWNAWEE E  E+VVIGSCMTP          
Sbjct  405   SRFGILDKRASDGSGIRWVEVPGTFCFHLWNAWEEPERGEVVVIGSCMTP----------  454

Query  861   NLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPK  682
                        N  TG+ST+RPI     +QVNLEAGMVNRNLLGRKT+YAYLAIAEPWPK
Sbjct  455   -----------NPTTGKSTRRPIF-TXSEQVNLEAGMVNRNLLGRKTKYAYLAIAEPWPK  502

Query  681   VSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQ  502
             VSGFAKV+L TGE++K+ YGD +YGGEPFF P   +   ED GHIL+FVHDE+ W SELQ
Sbjct  503   VSGFAKVNLETGEVKKYFYGDNRYGGEPFFSPAGQDPASEDHGHILAFVHDEEAWTSELQ  562

Query  501   IVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             IVNA NLEL A++KLPSRVPYGFHGTFI S DL +QV
Sbjct  563   IVNAENLELEASVKLPSRVPYGFHGTFIESKDLASQV  599



>dbj|BAN15738.1| 9-cis-epoxy-carotenoid dioxygenase [Dianthus caryophyllus]
Length=586

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/547 (69%), Positives = 433/547 (79%), Gaps = 20/547 (4%)
 Frame = -2

Query  1977  QLPDGESPAPSQPK-----------------WNllqravaaaldvaegalVSRELQRPLP  1849
             QLP  +SPA S P                  WN LQ+A AAALD  E AL + E + PLP
Sbjct  42    QLPLLDSPALSTPTTTDHHRHPITVNKKNNPWNPLQKAAAAALDAVENALTAFETKSPLP  101

Query  1848  KTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGD  1669
             KT DP VQI+GNFAPV E  V++NLPV G +P CI G YVRNGANPL+ P AGHHLFDGD
Sbjct  102   KTSDPAVQISGNFAPVTEHPVQHNLPVTGVIPACIKGAYVRNGANPLYAPSAGHHLFDGD  161

Query  1668  GMVHAVTIT-GGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARG  1492
             GM+H V     GS SY+CRFTET RLVQER LGRP+FPKAIGELHGHSG+ RL LFY R 
Sbjct  162   GMLHTVNFQPDGSASYACRFTETNRLVQERALGRPIFPKAIGELHGHSGIGRLALFYTRS  221

Query  1491  LFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKST  1312
             L GL+DH  G G+ANAG+VYFN RLLAMSEDD+PYHV+V PSGDL T GRYDF+ QL ST
Sbjct  222   LLGLLDHSNGIGVANAGVVYFNDRLLAMSEDDIPYHVKVTPSGDLVTEGRYDFDGQLDST  281

Query  1311  MIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITEN  1132
             MIAHPKVDP +GE FALSYDVI+KPYLKYF   + G K+PDV+I LD PTM+HDFAITEN
Sbjct  282   MIAHPKVDPVTGELFALSYDVIKKPYLKYFWFNADGSKAPDVDIELDTPTMMHDFAITEN  341

Query  1131  YVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLW  952
              VIIPD QVVFKLQEMIRGGS V+Y+K+K SRFGIL K A+N+E + W+E P+ FCFHLW
Sbjct  342   CVIIPDSQVVFKLQEMIRGGSPVVYDKEKTSRFGILPKYARNSEDMQWIEVPDCFCFHLW  401

Query  951   NAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQ  772
             NAWEE ETDEIVVIGSCMTP DSIFNEC+ENL S+LSEIRLN KTG+S +R I+  +D Q
Sbjct  402   NAWEEPETDEIVVIGSCMTPADSIFNECDENLSSVLSEIRLNRKTGKSIRREILKESD-Q  460

Query  771   VNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFF  592
             +NLEAGMVNRN+LGRKT+YAYLAIAEPWPKVSGFAKVDL TG + KF+YGD KYGGEP F
Sbjct  461   MNLEAGMVNRNMLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGNVTKFIYGDNKYGGEPLF  520

Query  591   VPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITS  412
             +PR  +   EDDGHIL+FVHDE  W+SELQIVNA  +E+ A ++LPSRVPYGFHGTFI +
Sbjct  521   LPRE-DGTSEDDGHILTFVHDEDKWESELQIVNAATMEVEALVQLPSRVPYGFHGTFIAA  579

Query  411   YDLQNQV  391
              DL+ Q 
Sbjct  580   NDLKTQA  586



>ref|XP_010487252.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=605

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/495 (75%), Positives = 422/495 (85%), Gaps = 1/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E   PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P 
Sbjct  112   SHERLHPLPKTADPSVQIAGNFAPVNEQPVRRNLPVVGKIPDSIKGVYVRNGANPLHEPV  171

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R VQER LGRPVFPKAIGELHGH+G+AR
Sbjct  172   TGHHFFDGDGMVHAVKFEDGSASYACRFTQTNRFVQERQLGRPVFPKAIGELHGHTGIAR  231

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   G+VD   GTG+ANAGLVYFNGRLLAMSEDDLPY VR+ P+GDL+TVGR+D
Sbjct  232   LMLFYARAAAGIVDPAHGTGVANAGLVYFNGRLLAMSEDDLPYQVRITPTGDLKTVGRFD  291

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVEI LD PTM+
Sbjct  292   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEIQLDQPTMM  351

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMIRGGS V+Y+K K SRFGIL K A+++  I W+E+P
Sbjct  352   HDFAITENFVVIPDQQVVFKLPEMIRGGSPVVYDKNKVSRFGILDKYAEDSSKIKWIEAP  411

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE +ENL+S+LSEIRLNL+TGEST+RP
Sbjct  412   DCFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESDENLESVLSEIRLNLRTGESTRRP  471

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   DQQVNLEAGMVNRN+LGRKT+YAYLA+AEPWPKVSGFAKVDL+TGE++K++YGD 
Sbjct  472   IISDGDQQVNLEAGMVNRNMLGRKTKYAYLALAEPWPKVSGFAKVDLTTGEVKKYLYGDN  531

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+P     E+ED+GHIL FVHDEKTWKSELQIVNA++LE+ AT+KLPSRVPYG
Sbjct  532   RYGGEPLFLPGE-GGEEEDEGHILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYG  590

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  Q+
Sbjct  591   FHGTFIGADDLAKQM  605



>gb|AAK00623.1| 9-cis-epoxycarotenoid dioxygenase [Persea americana]
Length=625

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/568 (67%), Positives = 450/568 (79%), Gaps = 4/568 (1%)
 Frame = -2

Query  2085  LGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqravaa  1906
             L LP K  +  KP+ +          S        Q   D   P    P WN+ QR  A 
Sbjct  59    LHLPPKQPTKSKPSIKKGEKSSTLTPSIEKNPGSHQVKTDQSGPNRVGPNWNIFQRTAAF  118

Query  1905  aldvaegalVSRELQR--PLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVY  1732
             ALD  E  L++R L+R  PLPKT DP VQIAGNFAPV E  V++ +PV G +P C++GVY
Sbjct  119   ALDAIEEKLIARVLERRHPLPKTADPEVQIAGNFAPVAEHPVQHGIPVAGRIPRCLDGVY  178

Query  1731  VRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKA  1552
             VRNGANPLF P AGHH FDGDGM+HAV    GS SYSCR+TET RLVQER L RP+FPKA
Sbjct  179   VRNGANPLFEPIAGHHFFDGDGMIHAVRFRNGSASYSCRYTETRRLVQERQLSRPIFPKA  238

Query  1551  IGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVK  1372
             IGELHGHSG+ARLLLFY RGLFGLV+   G G+ANAGLVYFN RLLAMSEDDLPYHVR+ 
Sbjct  239   IGELHGHSGIARLLLFYTRGLFGLVNADEGMGVANAGLVYFNRRLLAMSEDDLPYHVRIT  298

Query  1371  PSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSP  1192
             PSGDL+TVGR+DF++QL+S+MIAHPK+DPESGE F+LSYDV +KPYLKYF+    G KSP
Sbjct  299   PSGDLKTVGRHDFDNQLRSSMIAHPKLDPESGELFSLSYDVARKPYLKYFHFAPDGWKSP  358

Query  1191  DVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTA  1012
             DVEIPLD PTMIHDFAITEN+V+IPDQQVVFKL+EMIRGGS V+Y+K K SRFGIL K A
Sbjct  359   DVEIPLDRPTMIHDFAITENFVVIPDQQVVFKLEEMIRGGSPVVYDKNKTSRFGILPKYA  418

Query  1011  KNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIR  832
              +A  +IWV++P+ FCFHLWNAWEE E+ E+VV+GSCMTPPDSIFNE EE+LKSIL+EIR
Sbjct  419   PDASEMIWVDAPDCFCFHLWNAWEEPESGEVVVVGSCMTPPDSIFNENEESLKSILTEIR  478

Query  831   LNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLS  652
             LN +TGEST+R II    + +NLEAGMVNRN LGRKT++AYLAIAEPWPKVSG AKVDL 
Sbjct  479   LNTRTGESTRRTII-DPQKPLNLEAGMVNRNRLGRKTRFAYLAIAEPWPKVSGIAKVDLG  537

Query  651   TGEMQKFMYGDGKYGGEPFFVPRNPN-SEKEDDGHILSFVHDEKTWKSELQIVNAINLEL  475
             TGE+ +F+YG+ ++GGEP+F+PR P+ S +EDDG+++SF+HDEKT +SEL I+NA+N+ L
Sbjct  538   TGEVNRFVYGERQFGGEPYFIPREPSTSGREDDGYVVSFMHDEKTSRSELLILNAMNMRL  597

Query  474   LATIKLPSRVPYGFHGTFITSYDLQNQV  391
              A++ LPSRVPYGFHGTFI+S DL  Q 
Sbjct  598   EASVMLPSRVPYGFHGTFISSRDLAKQA  625



>gb|ACL00683.2| 9-cis-epoxycarotenoid dioxygenase 2 [Solanum lycopersicum]
Length=429

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/430 (83%), Positives = 392/430 (91%), Gaps = 1/430 (0%)
 Frame = -2

Query  1680  FDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFY  1501
             FDGDGMVHAVT+  GSVSYSCRFTETERLVQER LG PVFPKAIGELHGHSG+ARLLLFY
Sbjct  1     FDGDGMVHAVTVENGSVSYSCRFTETERLVQERELGHPVFPKAIGELHGHSGIARLLLFY  60

Query  1500  ARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQL  1321
             ARG+FGLVDH  GTG+ANAGLV+FN RLLAMSEDD+PYHV+V PSGDL+TVGRY+F+DQL
Sbjct  61    ARGVFGLVDHSHGTGVANAGLVFFNNRLLAMSEDDVPYHVQVLPSGDLQTVGRYNFDDQL  120

Query  1320  KSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAI  1141
             KSTMIAHPK+DP SGE FALSYDV+QKPYLK F     GEKSPDVEIPLDVPTM+HDFAI
Sbjct  121   KSTMIAHPKIDPVSGELFALSYDVVQKPYLKSFKFSPDGEKSPDVEIPLDVPTMMHDFAI  180

Query  1140  TENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCF  961
             TE+YV+IPDQQVVFKLQEMI+GGS VIY+K KKSRFGIL K A+N+E IIWVES ETFCF
Sbjct  181   TESYVVIPDQQVVFKLQEMIKGGSPVIYDKNKKSRFGILPKNAENSENIIWVESAETFCF  240

Query  960   HLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPAT  781
             HLWNAWEE ETDE++VIGSCMTPPDSIFNEC ENLKS+LSEIRLNLKTGEST+R  +P+ 
Sbjct  241   HLWNAWEEPETDEVIVIGSCMTPPDSIFNECNENLKSVLSEIRLNLKTGESTRRQ-LPSP  299

Query  780   DQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGE  601
               QVNLEAGMVNRN LGRKTQ+AYLAIAEPWPKVSGFAKVDLSTGE++K +YGD +YGGE
Sbjct  300   SDQVNLEAGMVNRNKLGRKTQFAYLAIAEPWPKVSGFAKVDLSTGEIKKHIYGDKRYGGE  359

Query  600   PFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             P F+PRN NSEKEDDG+IL+F HDEKTWKSELQIVNA+ LEL AT+KLPSRVPYGFHGTF
Sbjct  360   PLFLPRNVNSEKEDDGYILAFCHDEKTWKSELQIVNAMTLELEATVKLPSRVPYGFHGTF  419

Query  420   ITSYDLQNQV  391
             I+S DLQNQV
Sbjct  420   ISSKDLQNQV  429



>ref|XP_010923828.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Elaeis guineensis]
Length=620

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/573 (67%), Positives = 455/573 (79%), Gaps = 26/573 (5%)
 Frame = -2

Query  2088  DLGLPSKS--ISMKKPTRRAKIHCEAAVHSSSVVTLPEQQ---LPDGESPAPSQPKWNll  1924
             D+GLPS S   ++ KP+ +                 P+Q+     DG++  P    WNLL
Sbjct  67    DVGLPSPSSTATITKPSSK-----------------PDQRNYRRDDGQTARPHW-NWNLL  108

Query  1923  qravaaaldvaegalVSRELQRP--LPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPD  1750
             QR  A ALD  E A +S  L+RP  LPKT DP VQIAGNFAPV EQ   ++LPV G +P 
Sbjct  109   QRLAATALDTVEDAFISNVLERPHPLPKTSDPAVQIAGNFAPVGEQPPHHHLPVSGKIPP  168

Query  1749  CINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGR  1570
              INGVYVRNGANP F+P AGHH FDGDGMVHAV +  G+ SY+CRFTETERL QE  LGR
Sbjct  169   FINGVYVRNGANPHFQPVAGHHFFDGDGMVHAVHLRNGAASYACRFTETERLRQEHALGR  228

Query  1569  PVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLP  1390
             P+FPKAIGELHGHSG+ARLLLFYAR LFGLVD   GTG+ANAGL+YF+ RLLAMSEDDLP
Sbjct  229   PIFPKAIGELHGHSGIARLLLFYARSLFGLVDPSHGTGVANAGLIYFHDRLLAMSEDDLP  288

Query  1389  YHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKS  1210
             YHVR+  SGDLETVGRYDF+ QL+S MIAHPK+DP S E FALSYDVIQKPYLKYF    
Sbjct  289   YHVRITRSGDLETVGRYDFDGQLRSAMIAHPKLDPVSRELFALSYDVIQKPYLKYFRFSP  348

Query  1209  SGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFG  1030
             +GEKSPDVEIPLD PTM+HDFAITEN+V++PDQQVVFKLQEMI GGS V+Y++ K SRFG
Sbjct  349   AGEKSPDVEIPLDQPTMMHDFAITENFVVVPDQQVVFKLQEMIHGGSPVVYDRTKTSRFG  408

Query  1029  ILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKS  850
             IL K A +A  + WV+ P+ FCFHLWNAWEE  T E+VVIGSCMTP DSIFNE +E+L+S
Sbjct  409   ILPKHAADASEMKWVDVPDCFCFHLWNAWEEPGTGEVVVIGSCMTPADSIFNESDESLRS  468

Query  849   ILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGF  670
             +LSEIRL+  TG+ST+RPI+   D Q+NLEAGMVNRN LGRKT+YAYLAIAEPWPKVSGF
Sbjct  469   VLSEIRLDRTTGKSTRRPILAPAD-QLNLEAGMVNRNKLGRKTRYAYLAIAEPWPKVSGF  527

Query  669   AKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNA  490
             AKVDL TGE+ KFM+G+ +YGGEP+FVPR+P+S +EDDG++L+F+H+EKT +SEL IVNA
Sbjct  528   AKVDLFTGEVAKFMFGEERYGGEPYFVPRHPSSPREDDGYVLTFMHNEKTSESELLIVNA  587

Query  489   INLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
              ++ L A++KLPSRVPYGFHGTFI S DL++Q 
Sbjct  588   ADMRLEASVKLPSRVPYGFHGTFINSKDLESQA  620



>gb|AAY82459.1| putative 9-cis-epoxycarotenoid dioxygenase 2 [Cuscuta reflexa]
Length=636

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/568 (67%), Positives = 448/568 (79%), Gaps = 22/568 (4%)
 Frame = -2

Query  2046  TRRAKIHCEAAVHSSSVVTLPEQQLPDGESPAPSQPK--------------WNllqrava  1909
             ++  +++C     SS +        P+  SP  + PK              WNL QRA A
Sbjct  74    SKELRLNCSVQASSSML------HFPNKPSPPITIPKEESSVSPSSSPHRQWNLFQRAAA  127

Query  1908  aaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYV  1729
              ALD  E  +  REL+RPLPKT DP VQIAGNFAPVPEQ V + LPV G +P+C++GVYV
Sbjct  128   VALDAVESRITERELERPLPKTVDPRVQIAGNFAPVPEQPVCHALPVAGRIPECVSGVYV  187

Query  1728  RNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAI  1549
             RNGANP F P AGHH FDGDG+VHAV    G+ SY+CRFTET+RLVQER LGRP FPKAI
Sbjct  188   RNGANPHFEPVAGHHFFDGDGLVHAVQFKNGAASYACRFTETQRLVQERALGRPFFPKAI  247

Query  1548  GELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKP  1369
             GELHGHSG+ARLLLFY+RG+FGL+D  RGTG+ANAGLVYFN RLLAMSEDDLPYHVRV P
Sbjct  248   GELHGHSGIARLLLFYSRGIFGLLDRSRGTGVANAGLVYFNNRLLAMSEDDLPYHVRVTP  307

Query  1368  SGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPD  1189
             SG+ +TV RYDF+ +LKSTMIAHPK+DP SGE FALSYDVIQKPYLKYF    SGEKS D
Sbjct  308   SGEKKTVERYDFDGKLKSTMIAHPKLDPVSGELFALSYDVIQKPYLKYFWFSKSGEKSQD  367

Query  1188  VEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAK  1009
             +EIP+  PTM+HDFAITE +V++PDQQVVFK+ EM+ GGS V+Y+K K SRFG+L K AK
Sbjct  368   IEIPVPEPTMMHDFAITERFVVVPDQQVVFKISEMVHGGSPVVYDKSKASRFGVLNKYAK  427

Query  1008  NAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRL  829
             ++  + WVE P+ FCFHLWNAWE+AETDEIVVIGSCMTPPDS+FNEC+E LKS+LSEIRL
Sbjct  428   DSSEMKWVEVPDCFCFHLWNAWEDAETDEIVVIGSCMTPPDSVFNECDEGLKSVLSEIRL  487

Query  828   NLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLST  649
             NLKTG+ST++ II    + VNLEAGMVNR+ LGRKT+YAYLA+AEPWPKVSGFAKVDL T
Sbjct  488   NLKTGKSTRKAIIQNPSEDVNLEAGMVNRHKLGRKTRYAYLAVAEPWPKVSGFAKVDLFT  547

Query  648   GEMQKFMYGDGKYGGEPFFVP--RNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLEL  475
             G+++KFMYGD KYGGEP F P   +   E ED G++L+FVHDE+ W+SELQIVNA +LEL
Sbjct  548   GQVKKFMYGDEKYGGEPLFFPGDLDSEEEDEDGGYVLAFVHDERRWESELQIVNAQSLEL  607

Query  474   LATIKLPSRVPYGFHGTFITSYDLQNQV  391
              A++K   RVPYGFHGTFITS DL  QV
Sbjct  608   EASVKFTIRVPYGFHGTFITSNDLLTQV  635



>ref|XP_010487250.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010487251.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=599

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/495 (75%), Positives = 422/495 (85%), Gaps = 1/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E   PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P 
Sbjct  106   SHERLHPLPKTADPSVQIAGNFAPVNEQPVRRNLPVVGKIPDSIKGVYVRNGANPLHEPV  165

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R VQER LGRPVFPKAIGELHGH+G+AR
Sbjct  166   TGHHFFDGDGMVHAVKFEDGSASYACRFTQTNRFVQERQLGRPVFPKAIGELHGHTGIAR  225

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   G+VD   GTG+ANAGLVYFNGRLLAMSEDDLPY VR+ P+GDL+TVGR+D
Sbjct  226   LMLFYARAAAGIVDPAHGTGVANAGLVYFNGRLLAMSEDDLPYQVRITPTGDLKTVGRFD  285

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVEI LD PTM+
Sbjct  286   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEIQLDQPTMM  345

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMIRGGS V+Y+K K SRFGIL K A+++  I W+E+P
Sbjct  346   HDFAITENFVVIPDQQVVFKLPEMIRGGSPVVYDKNKVSRFGILDKYAEDSSKIKWIEAP  405

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE +ENL+S+LSEIRLNL+TGEST+RP
Sbjct  406   DCFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESDENLESVLSEIRLNLRTGESTRRP  465

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   DQQVNLEAGMVNRN+LGRKT+YAYLA+AEPWPKVSGFAKVDL+TGE++K++YGD 
Sbjct  466   IISDGDQQVNLEAGMVNRNMLGRKTKYAYLALAEPWPKVSGFAKVDLTTGEVKKYLYGDN  525

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+P     E+ED+GHIL FVHDEKTWKSELQIVNA++LE+ AT+KLPSRVPYG
Sbjct  526   RYGGEPLFLPGE-GGEEEDEGHILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYG  584

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  Q+
Sbjct  585   FHGTFIGADDLAKQM  599



>gb|EPS60683.1| 9-cis-epoxycarotenoid dioxygenase [Genlisea aurea]
Length=577

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/565 (67%), Positives = 444/565 (79%), Gaps = 19/565 (3%)
 Frame = -2

Query  2061  SMKKPTRRAKIHCEAAV---------HSSSVVTLPEQQLPDGESPAPSQPKWNllqrava  1909
             + +KP    KI C  +V          SS VV       P G+  A ++  WN  Q+A A
Sbjct  22    TTRKPL--CKIQCVRSVDCAFQAHRLQSSGVVR------PPGKDSA-TKVDWNFFQKAAA  72

Query  1908  aaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYV  1729
              AL+  E A+ +RE++ PLPKT DP +QIAGNF+PV EQ V+  LPV G +P+ I GVYV
Sbjct  73    TALEAVETAIAAREMEHPLPKTADPSIQIAGNFSPVKEQPVKKCLPVIGKIPESIEGVYV  132

Query  1728  RNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAI  1549
             RNGANPLF P AGHHLFDGDGM+HAV    GSVSY+CRFTET R VQER +GRP+FPKAI
Sbjct  133   RNGANPLFEPTAGHHLFDGDGMIHAVKFQNGSVSYACRFTETNRYVQERAIGRPIFPKAI  192

Query  1548  GELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKP  1369
             GELHGHSG+ARLLLFYARGLF L+DH  G G+ANAGLVYFNGRLLAMSEDDLPYHVR+  
Sbjct  193   GELHGHSGIARLLLFYARGLFKLLDHTAGAGVANAGLVYFNGRLLAMSEDDLPYHVRITG  252

Query  1368  SGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPD  1189
              GDL+TV RYDF+ +L +TMIAHPK+DP +GE FALSY+VI KPYL YF    +GEK+ D
Sbjct  253   DGDLQTVERYDFDGELNTTMIAHPKLDPVTGELFALSYNVINKPYLNYFRFSRTGEKTED  312

Query  1188  VEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAK  1009
             +EIP+  PTM+HDFAITE +VIIPDQQVVFKL EM+ GGS V+Y++ K +RFG+L K A 
Sbjct  313   LEIPISGPTMMHDFAITERFVIIPDQQVVFKLSEMLTGGSPVVYDENKVARFGVLDKYAG  372

Query  1008  NAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRL  829
             + E + W+E P  FCFHLWN+WEE ETDEIVVIGSCMTPPDSIFNECEE LKS+LSEIRL
Sbjct  373   STEQMKWIEVPNCFCFHLWNSWEEPETDEIVVIGSCMTPPDSIFNECEEGLKSVLSEIRL  432

Query  828   NLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLST  649
             NL+TGEST+RPI+   D QVNLEAGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL T
Sbjct  433   NLRTGESTRRPILSEND-QVNLEAGMVNRNRLGRKTRYAYLAIAEPWPKVSGFAKVDLFT  491

Query  648   GEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLA  469
             GE+ KF YGD KYGGEP F+P+N   E+EDDGH+L+F H E   +SELQIVNA  +EL A
Sbjct  492   GEVTKFFYGDNKYGGEPLFLPKNGEEEEEDDGHVLAFAHQENAGRSELQIVNARTMELEA  551

Query  468   TIKLPSRVPYGFHGTFITSYDLQNQ  394
             T+KLPSRVPYGFHGTFI + DL+NQ
Sbjct  552   TVKLPSRVPYGFHGTFIGARDLENQ  576



>ref|XP_010465340.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Camelina sativa]
Length=600

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/495 (74%), Positives = 417/495 (84%), Gaps = 0/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E   PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P 
Sbjct  106   SHERLHPLPKTSDPSVQIAGNFAPVNEQPVRRNLPVVGKIPDSIKGVYVRNGANPLHEPV  165

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R VQER LGRPVFPKAIGE HGH+G+AR
Sbjct  166   TGHHFFDGDGMVHAVKFEDGSASYACRFTQTNRFVQERQLGRPVFPKAIGEFHGHTGIAR  225

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   G+VD   GTG+ANAGLVYFNGRLLAMSEDDLPY VR+ P+GDL+TVGR+D
Sbjct  226   LMLFYARAAAGIVDPAHGTGVANAGLVYFNGRLLAMSEDDLPYQVRITPTGDLKTVGRFD  285

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVEI LD PTM+
Sbjct  286   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEIQLDQPTMM  345

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMIRGGS V+Y+K K SRFGIL K A+ +  I W+E+P
Sbjct  346   HDFAITENFVVIPDQQVVFKLPEMIRGGSPVVYDKNKVSRFGILDKYAEESSKIKWIEAP  405

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE +ENL+S+LSEIRLNL+TG ST+RP
Sbjct  406   DCFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESDENLESVLSEIRLNLRTGVSTRRP  465

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   DQQVNLEAGMVNRN+LGRKT+YAYLA+AEPWPKVSGFAKVDL+TGE++K +YGD 
Sbjct  466   IISDGDQQVNLEAGMVNRNMLGRKTKYAYLALAEPWPKVSGFAKVDLATGEVKKHLYGDN  525

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+P      +ED+GHIL FVHDEKTWKSELQIVNA++LE+ AT+KLPSRVPYG
Sbjct  526   RYGGEPLFLPGEGGEGEEDEGHILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYG  585

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  Q+
Sbjct  586   FHGTFIGAGDLAKQM  600



>ref|XP_010501914.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic 
[Camelina sativa]
Length=599

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/495 (75%), Positives = 421/495 (85%), Gaps = 1/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E   PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P 
Sbjct  106   SHERLHPLPKTADPSVQIAGNFAPVNEQPVRRNLPVVGKIPDSIKGVYVRNGANPLHEPV  165

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R VQER LGRPVFPKAIGELHGH+G+AR
Sbjct  166   TGHHFFDGDGMVHAVKFEDGSASYACRFTQTNRFVQERQLGRPVFPKAIGELHGHTGIAR  225

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   G+VD   GTG+ANAGLVYFNGRLLAMSEDDLPY VR+ P+GDL+TVGR+D
Sbjct  226   LMLFYARAAAGIVDPAHGTGVANAGLVYFNGRLLAMSEDDLPYQVRITPTGDLKTVGRFD  285

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVEI LD PTM+
Sbjct  286   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEIQLDQPTMM  345

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMIRGGS V+Y+K K SRFGIL K A+++  I W+++P
Sbjct  346   HDFAITENFVVIPDQQVVFKLPEMIRGGSPVVYDKNKVSRFGILDKYAEDSSKIKWIDAP  405

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE +ENL+S+LSEIRLNL+TG+ST+RP
Sbjct  406   DCFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESDENLESVLSEIRLNLRTGKSTRRP  465

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   DQQVNLEAGMVNRN+LGRKT+YAYLA+AEPWPKVSGFAKVDL+TGE++K +YGD 
Sbjct  466   IISDGDQQVNLEAGMVNRNMLGRKTKYAYLALAEPWPKVSGFAKVDLTTGEVKKHLYGDN  525

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+P     E+ED+GHIL FVHDEKTWKSELQIVNA++LE+ AT+KLPSRVPYG
Sbjct  526   RYGGEPLFLPGE-GGEEEDEGHILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYG  584

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  Q+
Sbjct  585   FHGTFIGADDLAKQM  599



>ref|XP_009406704.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=603

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/494 (71%), Positives = 420/494 (85%), Gaps = 4/494 (1%)
 Frame = -2

Query  1869  ELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAG  1690
             E +RPLP+T DP VQIAGNF PV E+    NLPVDG +P  ++GVYVRNGANPLF P AG
Sbjct  113   ERRRPLPRTADPAVQIAGNFGPVDERPPCRNLPVDGRIPASLDGVYVRNGANPLFEPVAG  172

Query  1689  HHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLL  1510
             HH FDGDGM+HAV I  G+ +Y+CR+TETERL QER +G+PVFPKAIGELHGHSG+ARLL
Sbjct  173   HHFFDGDGMIHAVQIRDGAATYACRYTETERLRQERAIGKPVFPKAIGELHGHSGVARLL  232

Query  1509  LFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFN  1330
             LF ARGLFGLVD   GTG+ANAGLVYFN RLLAMSEDD+PYHVR+ PSGDLETV RYDFN
Sbjct  233   LFMARGLFGLVDPTHGTGVANAGLVYFNDRLLAMSEDDVPYHVRITPSGDLETVERYDFN  292

Query  1329  DQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHD  1150
              QL S+MIAHPK+DP +GE FAL YDV++KPYLKYF     G+KSPDVEIPL+ PTM+HD
Sbjct  293   GQLCSSMIAHPKLDPSTGELFALCYDVVRKPYLKYFYFSPDGKKSPDVEIPLEQPTMMHD  352

Query  1149  FAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPET  970
             FAITEN+V++PDQQVVFKLQEMI GGS VIY+++K +RFGIL K A++A  + W++ P+ 
Sbjct  353   FAITENHVVVPDQQVVFKLQEMIHGGSPVIYDREKMARFGILPKRARDASEMKWIDVPDC  412

Query  969   FCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPII  790
             FCFHLWNAWEE  T E+VVIGSCMTPPDS+FN+CEE+L+S+L+EIRLNL TG+ST+RPI+
Sbjct  413   FCFHLWNAWEEPTTHEVVVIGSCMTPPDSVFNDCEESLRSVLTEIRLNLATGKSTRRPIL  472

Query  789   PATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKY  610
              +   Q+NLEAGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDLSTGE+ KF++G+ +Y
Sbjct  473   SS---QLNLEAGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLSTGEVSKFLFGESRY  529

Query  609   GGEPFFVPRNPNS-EKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGF  433
             GGEP FVPRN  +  +EDDG++L+F+HDE+T +SEL IVNA ++ L A ++LPSRVPYGF
Sbjct  530   GGEPCFVPRNAGALSREDDGYVLTFMHDERTSESELLIVNAGDMRLEAAVRLPSRVPYGF  589

Query  432   HGTFITSYDLQNQV  391
             HGTF+ S DLQ+Q 
Sbjct  590   HGTFVASKDLQSQA  603



>ref|XP_006297265.1| hypothetical protein CARUB_v10013279mg [Capsella rubella]
 gb|EOA30163.1| hypothetical protein CARUB_v10013279mg [Capsella rubella]
Length=598

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/495 (74%), Positives = 416/495 (84%), Gaps = 2/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E   PLPKT DP VQI GNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P 
Sbjct  106   SHERSHPLPKTADPEVQIGGNFAPVNEQPVRRNLPVVGKIPDSIKGVYVRNGANPLHEPV  165

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R VQER LGRPVFPKAIGELHGH+G+AR
Sbjct  166   TGHHFFDGDGMVHAVKFEDGSASYACRFTQTNRFVQERKLGRPVFPKAIGELHGHTGIAR  225

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   GLVD   GTG+ANAGLVYFNGRLLAMSEDDLPY VR+ P+GDL+TVGR+D
Sbjct  226   LMLFYARAAAGLVDPAHGTGVANAGLVYFNGRLLAMSEDDLPYQVRITPTGDLKTVGRFD  285

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVEI LD PTM+
Sbjct  286   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEIQLDQPTMM  345

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMIRGGS V+Y+K+K +RFGIL K A+++  I W+++P
Sbjct  346   HDFAITENFVVIPDQQVVFKLPEMIRGGSPVVYDKEKVARFGILDKYAEDSSKIKWIDAP  405

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE +ENLKS+LSEIRLNL+TGEST+RP
Sbjct  406   DCFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESDENLKSVLSEIRLNLRTGESTRRP  465

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   DQQVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDL+TGE++K +YGD 
Sbjct  466   IISDGDQQVNLEAGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLATGEVKKHLYGDN  525

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+P     E E   HIL FVHDEKTWKSELQIVNA++LE+ AT+KLPSRVPYG
Sbjct  526   RYGGEPLFLPGEGGEEDEG--HILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYG  583

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  Q 
Sbjct  584   FHGTFIGADDLAKQA  598



>ref|XP_009128294.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic-like 
[Brassica rapa]
Length=587

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/490 (72%), Positives = 416/490 (85%), Gaps = 3/490 (1%)
 Frame = -2

Query  1863  QRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHH  1684
               PLPKT  P VQIAGNF PVPEQ V++NLPV G +P+CI GVYVRNGANPL +P +GHH
Sbjct  98    HHPLPKTAAPAVQIAGNFFPVPEQPVQHNLPVTGTLPECIQGVYVRNGANPLHKPISGHH  157

Query  1683  LFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLF  1504
             LFDGDGMVHAV    GSVSYSCRFTET RLVQER LGR +FPKAIGELHGH G+A+L+LF
Sbjct  158   LFDGDGMVHAVRFNNGSVSYSCRFTETNRLVQERELGRSIFPKAIGELHGHLGIAKLMLF  217

Query  1503  YARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQ  1324
              ARGL GL+D  RG G+AN GL+YFNG LLAMSEDDLPYHV +  +GDL T GRYDFN Q
Sbjct  218   NARGLSGLIDTTRGLGVANTGLIYFNGYLLAMSEDDLPYHVIITQTGDLRTSGRYDFNGQ  277

Query  1323  LKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFA  1144
             LK+TMIAHPK+DPE+GE FALSYDV+ KPYLKYF   S+GEKSPDVEIPLD PTMIHDFA
Sbjct  278   LKTTMIAHPKLDPETGELFALSYDVVSKPYLKYFRFTSNGEKSPDVEIPLDEPTMIHDFA  337

Query  1143  ITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFC  964
             ITEN+V+IPDQQVVF+L EM+RG S V+Y+K+K+SRFG+L K  K+A  I+W+E P+ FC
Sbjct  338   ITENFVVIPDQQVVFRLAEMVRGVSPVVYDKEKRSRFGVLNKYDKDASLILWIEVPDCFC  397

Query  963   FHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPA  784
             FHLWNAWEE +TDE+VV+GSCMTPPDS+F E +E L+S+LSEIRLNLKTGEST+RP+I  
Sbjct  398   FHLWNAWEEPDTDEVVVVGSCMTPPDSVFKEHDETLQSVLSEIRLNLKTGESTRRPVI--  455

Query  783   TDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGG  604
               +++NLEAGMVNRNLLGRKT++AYLAI EPWPKVSGFAKVDLSTG++QK++YGDGKYGG
Sbjct  456   ISEELNLEAGMVNRNLLGRKTRFAYLAITEPWPKVSGFAKVDLSTGDVQKYVYGDGKYGG  515

Query  603   EPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGT  424
             EP F+P   +   ED G+I+ FVHDE+  KSELQI+NA++++L AT+ LPSRVPYGFHGT
Sbjct  516   EPLFLPE-VSGYGEDCGYIMVFVHDEEKVKSELQIINAVSMKLEATVTLPSRVPYGFHGT  574

Query  423   FITSYDLQNQ  394
             F+++ DL  Q
Sbjct  575   FMSNDDLMKQ  584



>ref|XP_002885045.1| nine-cis-epoxycarotenoid dioxygenase3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61304.1| nine-cis-epoxycarotenoid dioxygenase3 [Arabidopsis lyrata subsp. 
lyrata]
Length=599

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/493 (75%), Positives = 417/493 (85%), Gaps = 2/493 (0%)
 Frame = -2

Query  1869  ELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAG  1690
             E   PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P  G
Sbjct  108   ERLHPLPKTSDPSVQIAGNFAPVNEQPVRRNLPVVGKIPDSIKGVYVRNGANPLHEPVTG  167

Query  1689  HHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLL  1510
             HH FDGDGMVHAV    GS SY+CRFT+T R +QE  LGRPVFPKAIGELHGH+G+ARL+
Sbjct  168   HHFFDGDGMVHAVKFEDGSASYACRFTQTNRFIQESELGRPVFPKAIGELHGHTGIARLM  227

Query  1509  LFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFN  1330
             LFYAR   G+VD   GTG+ANAGLVYFNGRLLAMSEDDLPY VR+ PSGDL+TVGR+DF+
Sbjct  228   LFYARAAAGIVDPAHGTGVANAGLVYFNGRLLAMSEDDLPYQVRITPSGDLKTVGRFDFD  287

Query  1329  DQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHD  1150
              QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVEI LD PTM+HD
Sbjct  288   GQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEIQLDQPTMMHD  347

Query  1149  FAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPET  970
             FAITEN+V+IPDQQVVFKL EMIRGGS V+Y+K K SRFGIL K A+++  I W+++P+ 
Sbjct  348   FAITENFVVIPDQQVVFKLPEMIRGGSPVVYDKNKVSRFGILDKYAEDSSNIKWIDAPDC  407

Query  969   FCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPII  790
             FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE +ENLKS+LSEIRLNLKTGEST+RPII
Sbjct  408   FCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESDENLKSVLSEIRLNLKTGESTRRPII  467

Query  789   PATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKY  610
                DQQVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDL+TGE++K +YGD +Y
Sbjct  468   SDEDQQVNLEAGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLTTGEVKKHLYGDNRY  527

Query  609   GGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFH  430
             GGEP F+P      +ED+GHIL FVHDEKTW SELQIVNA++LE+ AT+KLPSRVPYGFH
Sbjct  528   GGEPLFLPG--EGGEEDEGHILCFVHDEKTWTSELQIVNAVSLEVEATVKLPSRVPYGFH  585

Query  429   GTFITSYDLQNQV  391
             GTFI + DL  QV
Sbjct  586   GTFIGADDLAKQV  598



>ref|XP_010529159.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic 
[Tarenaya hassleriana]
Length=579

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/492 (72%), Positives = 415/492 (84%), Gaps = 2/492 (0%)
 Frame = -2

Query  1863  QRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHH  1684
             +  LP+T DP VQIAGN+APVPEQ +R +LPV+G +PDCI+GVYVRNGANP+F P AGHH
Sbjct  89    EHSLPRTSDPRVQIAGNYAPVPEQPLRRSLPVEGTIPDCIDGVYVRNGANPMFEPIAGHH  148

Query  1683  LFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLF  1504
             LFDGDGMVHAV IT GS SY+CRFTETERL+QE+ LGR VFPKAIGELHGHSG+ARL LF
Sbjct  149   LFDGDGMVHAVKITNGSASYACRFTETERLIQEKRLGRAVFPKAIGELHGHSGIARLCLF  208

Query  1503  YARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQ  1324
             YARGLFGL++H+ G G+ANAGLVYFN RLLAMSEDDLPY +R+  +GDLETVGR+DFN Q
Sbjct  209   YARGLFGLINHQNGVGVANAGLVYFNNRLLAMSEDDLPYQLRITQTGDLETVGRFDFNGQ  268

Query  1323  LKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFA  1144
             LKS MIAHPK+DP++ E  ALSYDV++KPYLKYF     GEKSPDVEIPL+ PTMIHDFA
Sbjct  269   LKSAMIAHPKIDPDTKELHALSYDVVKKPYLKYFRFSPDGEKSPDVEIPLESPTMIHDFA  328

Query  1143  ITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFC  964
             ITEN+V+IPD QVVFKL EMI G S V+Y++ K SRFG++ K A ++  IIWVESP TFC
Sbjct  329   ITENFVVIPDHQVVFKLGEMIAGKSPVVYDRNKPSRFGLMPKGATDSAEIIWVESPGTFC  388

Query  963   FHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPA  784
             FHLWNAWE  ET+E+VVIGSCM+P DSIFNE +ENL+SILSE+R+NL+T   T R ++  
Sbjct  389   FHLWNAWESPETEEVVVIGSCMSPADSIFNESDENLRSILSEMRINLRTRVITCRALVKE  448

Query  783   TDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGG  604
              D QVNLEAGMVNRN LGRKT++AYLAIAEPWPKVSG AKVDL TGE+QK++YG  KYGG
Sbjct  449   AD-QVNLEAGMVNRNRLGRKTRFAYLAIAEPWPKVSGLAKVDLFTGEIQKYIYGGKKYGG  507

Query  603   EPFFVPRNP-NSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHG  427
             EPFF+PR   + E EDDG+I   VHDE+ WKSELQIVNA+NL+L AT+ LPSRVPYGFHG
Sbjct  508   EPFFLPRGCGDGENEDDGYIFCHVHDEEEWKSELQIVNAVNLQLEATVHLPSRVPYGFHG  567

Query  426   TFITSYDLQNQV  391
             TF+ S +L +Q+
Sbjct  568   TFVDSKELAHQL  579



>gb|EPS70455.1| hypothetical protein M569_04294 [Genlisea aurea]
Length=574

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/520 (70%), Positives = 434/520 (83%), Gaps = 6/520 (1%)
 Frame = -2

Query  1935  WNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAV  1756
             WN++Q A   A+   E A++S E +R LP+T DPGVQIAGNFAPV E   + NLPV G V
Sbjct  56    WNVIQTAADMAIGAVESAVLSLERRRGLPRTADPGVQIAGNFAPVTETPAKRNLPVTGTV  115

Query  1755  PDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITG--GSVSYSCRFTETERLVQER  1582
             PDC+ GVYVRNGANPL  P  GHHLFDGDGM+HAV I G   +  Y+CRFTET+RLVQER
Sbjct  116   PDCVTGVYVRNGANPLHEPVGGHHLFDGDGMIHAVEIDGRENAAGYACRFTETQRLVQER  175

Query  1581  GLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSE  1402
              LGRPVFPKAIGELHG  G+ RL+LFYARGLFGL+++  GTG+ANAGLVYF+ RLLAMSE
Sbjct  176   DLGRPVFPKAIGELHGRLGILRLMLFYARGLFGLLNYHGGTGVANAGLVYFHRRLLAMSE  235

Query  1401  DDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYF  1222
             DDLPY VR+  +GDLETVGRYDF+ QLKSTMIAHPK+DP SGE +ALSYDV+ KPYLKYF
Sbjct  236   DDLPYQVRITAAGDLETVGRYDFDGQLKSTMIAHPKIDPVSGELYALSYDVVSKPYLKYF  295

Query  1221  NVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKK  1042
                SSGEKSPDV I LD PTMIHDFAITEN+V+I D QVVF+LQEM+RGGS V+Y++ K 
Sbjct  296   KFSSSGEKSPDVGISLDSPTMIHDFAITENFVVIHDHQVVFRLQEMLRGGSPVVYDENKV  355

Query  1041  SRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEE  862
             SRFGIL+K A+N   IIWV+ PETFCFHLWNAWEE ++ EIVVIGSCMTPPDSIFNE +E
Sbjct  356   SRFGILRKNAENGGDIIWVDCPETFCFHLWNAWEERDSGEIVVIGSCMTPPDSIFNEKQE  415

Query  861   NLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPK  682
             +L+S+LSEIRLN  TGEST+RPII  +++Q+NLEAG VNR  LGRKT+YAYL+IAEPWPK
Sbjct  416   DLQSVLSEIRLNPITGESTRRPII-NSEKQMNLEAGTVNRKFLGRKTRYAYLSIAEPWPK  474

Query  681   VSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNP---NSEKEDDGHILSFVHDEKTWKS  511
             VSGFAKVDL+TG+  K++YGD ++GGEP+FVPR     +S  EDDG+IL FVHDE++ +S
Sbjct  475   VSGFAKVDLTTGKTTKYIYGDERFGGEPYFVPREEEKHHSCNEDDGYILVFVHDERSRRS  534

Query  510   ELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             ELQI+NA+NL+L ATIKLPSRVPYGFHGTFI+S +L++Q 
Sbjct  535   ELQIINAMNLQLEATIKLPSRVPYGFHGTFISSTELRDQA  574



>ref|XP_009388971.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=596

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/493 (72%), Positives = 416/493 (84%), Gaps = 1/493 (0%)
 Frame = -2

Query  1869  ELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAG  1690
             E  RPLPKT DP VQIAGNFAPV E+A  ++LPV G +P  ++GVYVRNGANPLF P AG
Sbjct  105   ERPRPLPKTADPAVQIAGNFAPVDERAPCHDLPVQGLIPPFVDGVYVRNGANPLFEPVAG  164

Query  1689  HHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLL  1510
             HH FDGDGMVHAV I  G+ +Y+CR+T+TERL QER +G+PVFPKAIGELHGHSG+ARLL
Sbjct  165   HHFFDGDGMVHAVHIHDGTAAYACRYTKTERLRQERAIGKPVFPKAIGELHGHSGIARLL  224

Query  1509  LFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFN  1330
             LFYAR LFGLVD  RG G+ANAGL+YFN RLLAMSEDD+PYHVRV  SGDLETV RYDF 
Sbjct  225   LFYARCLFGLVDGGRGIGVANAGLIYFNDRLLAMSEDDVPYHVRVTRSGDLETVERYDFG  284

Query  1329  DQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHD  1150
              QL+S+MIAHPK+DP S E FALSYDVI+KPYLKYF     G KSPDV+IP+D PTMIHD
Sbjct  285   GQLRSSMIAHPKLDPASRELFALSYDVIRKPYLKYFYFSPDGNKSPDVDIPVDKPTMIHD  344

Query  1149  FAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPET  970
             FAITEN+V++PDQQVVF+LQEM RGGS V+Y++ K +RFG+L K A +A  + WV  P+ 
Sbjct  345   FAITENHVVVPDQQVVFELQEMFRGGSPVVYDRAKTTRFGVLPKYAADAAEMRWVVVPDC  404

Query  969   FCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPII  790
             FCFHLWNAWEE  T E+VVIGSCMTPPDS+FNECEENL S+LSEIRL+L+TGES +RPI+
Sbjct  405   FCFHLWNAWEEPATGEVVVIGSCMTPPDSVFNECEENLASVLSEIRLDLRTGESKRRPIL  464

Query  789   PATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKY  610
              + D Q NLEAGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL TGEM KF++GDG+Y
Sbjct  465   -SPDNQPNLEAGMVNRNRLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEMSKFVFGDGRY  523

Query  609   GGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFH  430
             GGEP+FV R+PNS KEDDG +L+F+HDEKT +SEL IV+A ++ L A +KLP RVPYGFH
Sbjct  524   GGEPYFVARDPNSPKEDDGCVLTFMHDEKTSESELLIVDAADMRLEAAVKLPWRVPYGFH  583

Query  429   GTFITSYDLQNQV  391
             GTFI+S +L++Q 
Sbjct  584   GTFISSRELESQA  596



>emb|CDY39117.1| BnaA01g29390D [Brassica napus]
Length=553

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/495 (73%), Positives = 414/495 (84%), Gaps = 2/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E Q PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P 
Sbjct  61    SHERQHPLPKTADPSVQIAGNFAPVNEQPVRRNLPVVGTIPDSIKGVYVRNGANPLHEPV  120

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R +QER LG+PVFPKAIGELHGH+G+AR
Sbjct  121   TGHHFFDGDGMVHAVKFEDGSASYACRFTQTNRFIQERQLGKPVFPKAIGELHGHTGIAR  180

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   GLVD   GTG+ANAGLVYFN RLLAMSEDDLPY VR+ PSGDL+TVGRYD
Sbjct  181   LMLFYARAAAGLVDPGHGTGVANAGLVYFNNRLLAMSEDDLPYQVRITPSGDLKTVGRYD  240

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVEI L+ PTM+
Sbjct  241   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEINLEQPTMM  300

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMIRGGS V+Y++ K +RFG+L K A ++ GI W+E+P
Sbjct  301   HDFAITENFVVIPDQQVVFKLPEMIRGGSPVVYDENKVARFGVLDKYAGDSSGIKWIEAP  360

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
               FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE +ENLKS+LSEIRLNL+TGEST+RP
Sbjct  361   GCFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESDENLKSVLSEIRLNLRTGESTRRP  420

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   ++QVNLEAGMVNRN+LGR+T+YAYLA+AEPWPKVSGFAKVDL TGE++K +YGD 
Sbjct  421   IISDGEEQVNLEAGMVNRNMLGRRTRYAYLALAEPWPKVSGFAKVDLFTGEVEKHLYGDD  480

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+P     E +   +IL FVHDE TWKSELQIVNA++LE+ AT+KLPSRVPYG
Sbjct  481   RYGGEPLFLPGEGGGEDDG--YILCFVHDEMTWKSELQIVNAVSLEVEATVKLPSRVPYG  538

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  QV
Sbjct  539   FHGTFIGASDLAKQV  553



>ref|NP_001241616.1| probable 9-cis-epoxycarotenoid dioxygenase NCED5, chloroplastic-like 
[Glycine max]
 gb|AEK69514.1| 9-cis-epoxycarotenoid dioxygenase 1 [Glycine max]
Length=561

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/566 (66%), Positives = 450/566 (80%), Gaps = 21/566 (4%)
 Frame = -2

Query  2058  MKKPTRRAK------IHCEAAVHSSSVVTLPEQQLP-------DGESPAPSQPKWNllqr  1918
             M  PTR  K      ++C  A+HS  V   P Q          +   P   +P+WN  Q+
Sbjct  1     MGFPTRFPKKPIGEVVNC--ALHSPPVTHFPNQPFTKTLQITKEPTYPPAERPQWNPFQK  58

Query  1917  avaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCING  1738
             A A ALD+ E AL+SREL +PLPKT DP VQIAGNFAPVPE  V+++LPV G +PD +NG
Sbjct  59    AAAKALDMFESALLSRELSQPLPKTTDPRVQIAGNFAPVPEHPVQHSLPVIGTIPDAVNG  118

Query  1737  VYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFP  1558
             VY+RNGANPLF PKAGHHLFDGDGMVHAV I  G+ SY+CRFTET+RL+QE  LG+PVFP
Sbjct  119   VYLRNGANPLFHPKAGHHLFDGDGMVHAVKINHGTASYACRFTETQRLMQEHALGKPVFP  178

Query  1557  KAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVR  1378
             KAIGELHGHSG+ARL+LFYARGL G+VDHR G G ANAGLV+FNG+LLAMSEDDLPY +R
Sbjct  179   KAIGELHGHSGIARLMLFYARGLCGIVDHRSGAGSANAGLVFFNGKLLAMSEDDLPYELR  238

Query  1377  VKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGE-  1201
             +  SGDLET+GRY F+DQL S+MIAHPKVDP SGE F LSYDV  K YLKYF      E 
Sbjct  239   ITASGDLETIGRYSFHDQLNSSMIAHPKVDPISGELFTLSYDVTSK-YLKYFRFSPEEEK  297

Query  1200  KSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILK  1021
             KSPDVEIPL   TM HDFAITEN+V+IPDQ+VVFKL EMI+GGS VIY+ +KKSRFGIL 
Sbjct  298   KSPDVEIPLGAATMTHDFAITENFVVIPDQKVVFKLGEMIKGGSPVIYDDEKKSRFGILP  357

Query  1020  KTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILS  841
             K A +A  I+WVESP+TF FH WNAWEE ETDE+VVIGSCMTPPDSIF + EE+LKS+L+
Sbjct  358   KYASDASSIVWVESPDTFFFHFWNAWEERETDEVVVIGSCMTPPDSIFKDTEESLKSVLT  417

Query  840   EIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKV  661
             EIRLN+++G+ST+R ++    +++NLEAGMVNRN LGRKT++AYL IAEPWPKVSGFAKV
Sbjct  418   EIRLNIRSGKSTRRVVV----EEMNLEAGMVNRNRLGRKTRFAYLCIAEPWPKVSGFAKV  473

Query  660   DLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINL  481
             DL +GE+++  YG+ ++GGEPFF+P    +  ED+G++++FVHDE TW+SELQI+NA++L
Sbjct  474   DLESGEVKRHEYGERRFGGEPFFLPTRGENGNEDEGYVMAFVHDEVTWQSELQILNALDL  533

Query  480   ELLATIKLPSRVPYGFHGTFITSYDL  403
             +L ATI LPSRVPYGFHGTF+ + DL
Sbjct  534   KLEATIMLPSRVPYGFHGTFVEAMDL  559



>ref|XP_009397411.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=603

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/519 (70%), Positives = 429/519 (83%), Gaps = 3/519 (1%)
 Frame = -2

Query  1941  PKWNllqravaaaldvaegalVSRELQRP--LPKTWDPGVQIAGNFAPVPEQAVRNNLPV  1768
             P WNLLQR   AALD  E A +S  L+RP  LPKT DP VQI+GNFAPV EQA   NL V
Sbjct  86    PNWNLLQRFAVAALDTIEEAFISNVLERPHPLPKTADPAVQISGNFAPVGEQAPCRNLTV  145

Query  1767  DGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQ  1588
              G +P  I+GVYVRNGANPLF P AGHHLFDGDGMVHAV +  G+ +Y+CR+TETER  Q
Sbjct  146   QGRIPPSIDGVYVRNGANPLFEPVAGHHLFDGDGMVHAVHLRNGTAAYACRYTETERFRQ  205

Query  1587  ERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAM  1408
             ER +G+PVFPKAIGELHGHSG+ARLLLFYAR L GLVD  RG G+ANAGL+YFN RLLAM
Sbjct  206   ERAIGKPVFPKAIGELHGHSGIARLLLFYARSLCGLVDGSRGVGVANAGLIYFNDRLLAM  265

Query  1407  SEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLK  1228
             SEDD+PYHVR+ PSGDLETV RYDF+ +L+S+MIAHPK+DP S E FALSYDVI+KPYLK
Sbjct  266   SEDDIPYHVRITPSGDLETVERYDFHGELRSSMIAHPKLDPVSRELFALSYDVIKKPYLK  325

Query  1227  YFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKK  1048
             YF     G KS DVEIPLD PTM+HDFAIT+NYV++PDQQVVFKLQEMIRGGS VI+++ 
Sbjct  326   YFYFSPEGNKSADVEIPLDQPTMMHDFAITDNYVVVPDQQVVFKLQEMIRGGSPVIFDRA  385

Query  1047  KKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNEC  868
             K +RFG+L K A +A  + WV+ P+ FCFHLWNAWEE  T E+VVIGSCMTPPDS+FNEC
Sbjct  386   KTARFGVLPKYAADASEMRWVDVPDCFCFHLWNAWEEPATGEVVVIGSCMTPPDSVFNEC  445

Query  867   EENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPW  688
             EE+LKS+L+E RL+LK+G+ST  PI+   D Q+NLEAGMVNR ++GRKT+YAYLAIAEPW
Sbjct  446   EESLKSVLTETRLDLKSGKSTHHPILSPAD-QLNLEAGMVNRKMVGRKTRYAYLAIAEPW  504

Query  687   PKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSE  508
             PKVSGFAKVDLSTGE++KF+YGD ++GGEP+F+P+  +S  EDDG++LS VH+EKT KSE
Sbjct  505   PKVSGFAKVDLSTGEIKKFIYGDSRFGGEPYFLPKETDSSGEDDGYVLSLVHNEKTTKSE  564

Query  507   LQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             L IVN  +++L A +K+PSRVPYGFHGTF++S DL  Q 
Sbjct  565   LLIVNGADMQLEAAVKMPSRVPYGFHGTFVSSRDLVTQA  603



>emb|CDY33218.1| BnaC01g36910D [Brassica napus]
Length=598

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/495 (74%), Positives = 414/495 (84%), Gaps = 2/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E Q PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P 
Sbjct  106   SHERQHPLPKTADPSVQIAGNFAPVNEQPVRRNLPVVGKIPDSIKGVYVRNGANPLHEPV  165

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R +QER LG+PVFPKAIGELHGH+G+AR
Sbjct  166   TGHHFFDGDGMVHAVKFEDGSASYACRFTQTNRFIQERQLGKPVFPKAIGELHGHTGIAR  225

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   GLVD   GTG+ANAGLVYFN RLLAMSEDDLPY VR+ PSGDL+TVGRYD
Sbjct  226   LMLFYARAAAGLVDPGHGTGVANAGLVYFNNRLLAMSEDDLPYQVRITPSGDLKTVGRYD  285

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDV+I L+ PTM+
Sbjct  286   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVDINLEQPTMM  345

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMIRGGS V+Y++ K +RFG+L K A ++ GI W+E P
Sbjct  346   HDFAITENFVVIPDQQVVFKLPEMIRGGSPVVYDENKVARFGVLDKYAGDSSGIKWIEVP  405

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
               FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE  ENLKS+LSEIRLNL+TG+ST+RP
Sbjct  406   GCFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESNENLKSVLSEIRLNLRTGKSTRRP  465

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   +QQVNLEAGMVNRN+LGRKT+YAYLA+AEPWPKVSGFAKVDL TGE++K +YGD 
Sbjct  466   IISDGEQQVNLEAGMVNRNMLGRKTRYAYLALAEPWPKVSGFAKVDLFTGEVEKHIYGDN  525

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+P       EDDG+IL FVHDE TWKSELQIVNA++LE+ AT+KLPSRVPYG
Sbjct  526   RYGGEPLFLPG--EGGGEDDGYILCFVHDEMTWKSELQIVNAVSLEVEATVKLPSRVPYG  583

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  QV
Sbjct  584   FHGTFIGASDLAKQV  598



>ref|XP_009116867.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic 
[Brassica rapa]
Length=598

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/495 (74%), Positives = 415/495 (84%), Gaps = 2/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E Q PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P 
Sbjct  106   SHERQHPLPKTADPSVQIAGNFAPVNEQPVRRNLPVVGTIPDSIKGVYVRNGANPLHEPV  165

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAV    GS SY+CRFT+T R +QER LG+PVFPKAIGELHGH+G+AR
Sbjct  166   TGHHFFDGDGMVHAVKFEDGSASYACRFTQTNRFIQERQLGKPVFPKAIGELHGHTGIAR  225

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   GLVD   GTG+ANAGLVYFN RLLAMSEDDLPY VR+ PSGDL+TVGRYD
Sbjct  226   LMLFYARAAAGLVDPGHGTGVANAGLVYFNNRLLAMSEDDLPYQVRITPSGDLKTVGRYD  285

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVEI L+ PTM+
Sbjct  286   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEINLEQPTMM  345

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMIRGGS V+Y+K+K +RFG+L K A ++  I W+E+P
Sbjct  346   HDFAITENFVVIPDQQVVFKLPEMIRGGSPVVYDKEKVARFGVLDKYAGDSSAIKWIEAP  405

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
               FCFHLWNAWEE ET+E+VVIGS MTPPDSIFNE +ENLKS+LSEIRLNL+TGEST+RP
Sbjct  406   GCFCFHLWNAWEEPETEEVVVIGSRMTPPDSIFNESDENLKSVLSEIRLNLRTGESTRRP  465

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   ++QVNLEAGMVNRN+LGRKT+YAYLA+AEPWPKVSGFAKVDL TGE++K +YGD 
Sbjct  466   IISDGEEQVNLEAGMVNRNMLGRKTRYAYLALAEPWPKVSGFAKVDLFTGEVEKHLYGDD  525

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             +YGGEP F+P       EDDG+IL FVHDE TWKSELQIVNA++LE+ AT+KLPSRVPYG
Sbjct  526   RYGGEPLFLPG--EGGGEDDGYILCFVHDEMTWKSELQIVNAVSLEVEATVKLPSRVPYG  583

Query  435   FHGTFITSYDLQNQV  391
             FHGTFI + DL  QV
Sbjct  584   FHGTFIGASDLAKQV  598



>gb|AAV35466.1| 9-cis-epoxycarotenoid dioxygenase [Brassica rapa subsp. pekinensis]
Length=562

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/497 (72%), Positives = 411/497 (83%), Gaps = 5/497 (1%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E Q PLPKT DP VQIAGNFAPV EQ +R NLPV G +PD I GVYVRNGANPL  P 
Sbjct  67    SHERQHPLPKTADPSVQIAGNFAPVNEQPLRRNLPVVGKIPDSIKGVYVRNGANPLHEPV  126

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
              GHH FDGDGMVHAVT   GS SY+CRFT T R +QER LGRPVFPKAIGELHGH+G+AR
Sbjct  127   TGHHFFDGDGMVHAVTFEDGSASYACRFTLTNRFIQERQLGRPVFPKAIGELHGHTGIAR  186

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYAR   GLVD   GTG+ANAGLVYFN RLLAMSEDDLPY VR+ P GDL+TVGRYD
Sbjct  187   LMLFYARAAAGLVDPAHGTGVANAGLVYFNNRLLAMSEDDLPYQVRITPGGDLKTVGRYD  246

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+STMIAHPKVDPESGE FALSYDV+ KPYLKYF     GEKSPDVEI LD PT++
Sbjct  247   FDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGEKSPDVEIQLDQPTIM  306

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HD  ITEN+V++PDQQVVFKLQEMIRGGS VIY+K+K +RFGIL K A ++ GI W+E+P
Sbjct  307   HDLPITENFVVLPDQQVVFKLQEMIRGGSPVIYDKEKVARFGILDKYAADSSGIRWIEAP  366

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE +ENLKS+LSEIRLNL+TGEST+RP
Sbjct  367   DCFCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESDENLKSVLSEIRLNLRTGESTRRP  426

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             II   DQQVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDL+TGE++K +YGD 
Sbjct  427   IISDGDQQVNLEAGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLATGEVKKHLYGDD  486

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNA--INLELLATIKLPSRVP  442
             +YGGEP F+   P    EDDGHIL FVHDEKTWKS + +++A  ++ E +A ++LP RVP
Sbjct  487   RYGGEPLFL---PGEGAEDDGHILCFVHDEKTWKSCVNVIDAKTMSAEPVAVVELPHRVP  543

Query  441   YGFHGTFITSYDLQNQV  391
             YGFH  F+T   LQ Q 
Sbjct  544   YGFHAFFVTEEQLQEQT  560



>gb|ACX33872.1| NCED3 [Lilium formosanum]
Length=603

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/522 (71%), Positives = 428/522 (82%), Gaps = 4/522 (1%)
 Frame = -2

Query  1950  PSQPKWNllqravaaaldvaegalVSRELQRP--LPKTWDPGVQIAGNFAPVPEQAVRNN  1777
             PS P WN  QRA AAALDV E  + S  L+RP  LPKT DP VQIAGNFAPV EQ   +N
Sbjct  84    PSSPHWNFFQRAAAAALDVIEEGI-SNILERPHPLPKTADPAVQIAGNFAPVGEQPPHHN  142

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P  INGVYVRNGANPL  P AGHH FDGDGM+H+V I GG+ SY+CRFTETER
Sbjct  143   LPVTGRIPPFINGVYVRNGANPLHEPVAGHHFFDGDGMIHSVQIRGGAASYACRFTETER  202

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
               QER +GRP+FPKAIGELHGHSG+ARL LFYARG FGL+D  RG G+ANAGLVYFN RL
Sbjct  203   FRQERAIGRPLFPKAIGELHGHSGIARLALFYARGAFGLLDASRGIGVANAGLVYFNDRL  262

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPY +RV   GDLETV RY+FN QL S MIAHPK+DP +GE FALSYDVIQ+P
Sbjct  263   LAMSEDDLPYQIRVTAEGDLETVERYNFNGQLTSAMIAHPKLDPATGELFALSYDVIQQP  322

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF     G KSPDV+IPLD PTM+HDFAITEN+VI+PDQQVVFKLQEMI GGS V+Y
Sbjct  323   YLKYFWFSPDGVKSPDVDIPLDQPTMMHDFAITENFVIVPDQQVVFKLQEMISGGSPVVY  382

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K +RFGIL K A +A  + WV+ P+ FCFHLWNAWEE  T E+VVIGSCMTP DSIF
Sbjct  383   DKTKTARFGILPKYATDAAEMKWVDVPDCFCFHLWNAWEEPATGEVVVIGSCMTPADSIF  442

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NE +ENL+S+LSEIRL+ KTG+ST+RPI+P + +Q+NLEAGMVNRN LGRK+++AYLAIA
Sbjct  443   NESDENLESVLSEIRLDPKTGKSTRRPILPQS-EQINLEAGMVNRNWLGRKSRFAYLAIA  501

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKVDLSTGE+ KF+YGD  YGGEP+FVP   +   EDDG+ILS++H+E T 
Sbjct  502   EPWPKVSGFAKVDLSTGEVTKFIYGDNCYGGEPYFVPMEGSRRGEDDGYILSYMHNEATS  561

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +SEL IVNA ++ L A++KLPSRVPYGFHGTFI+S DL++Q 
Sbjct  562   ESELVIVNAADMRLEASVKLPSRVPYGFHGTFISSKDLKSQA  603



>ref|XP_009408528.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=603

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/550 (67%), Positives = 436/550 (79%), Gaps = 7/550 (1%)
 Frame = -2

Query  2031  IHCEAAVHSSSVVTLPEQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQR--  1858
              H EA    +S    P Q    G     ++  WNLLQ   AAALD  E A VS  L+R  
Sbjct  58    FHKEATTSVASKSRRPAQS---GGDDGAARTSWNLLQWVAAAALDTVEQAFVSNVLERGH  114

Query  1857  PLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLF  1678
             PLPKT DP VQIAGNFAPV E+   + L V+G +P  I+GVYVRNGANP F P AGHH F
Sbjct  115   PLPKTADPAVQIAGNFAPVDERPPCHGLLVEGRIPVSIDGVYVRNGANPQFEPVAGHHFF  174

Query  1677  DGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYA  1498
             DGDGMVHAV +  G+ +YSCR+TETERL QER +G+PVFPKAIGELHGHSG+ARLLLFYA
Sbjct  175   DGDGMVHAVRLCNGAAAYSCRYTETERLRQERAIGKPVFPKAIGELHGHSGVARLLLFYA  234

Query  1497  RGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLK  1318
             R LFGLVD  RG G+ANAGLVYFN RLLAMSEDD+PYHVR+ PSGDLETV RYDF  QL 
Sbjct  235   RSLFGLVDGSRGMGVANAGLVYFNDRLLAMSEDDVPYHVRITPSGDLETVERYDFGGQLG  294

Query  1317  STMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAIT  1138
             S+MIAHPK+DP S E FALSYDVI +PYLKYF     GEKS DVEIPL+ PTM HDFAIT
Sbjct  295   SSMIAHPKLDPVSRELFALSYDVIHRPYLKYFYFSPDGEKSADVEIPLEQPTMTHDFAIT  354

Query  1137  ENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFH  958
             ENYV++PDQQVVFKLQEM+RGGS V+Y+  K +RFG+L K A +A  + WV+ P+ FCFH
Sbjct  355   ENYVVVPDQQVVFKLQEMVRGGSPVVYDTTKTARFGVLPKYAADASEMRWVDVPDCFCFH  414

Query  957   LWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATD  778
             LWNAWEE  T E+VVIGSCMTPPDS+FNE EENL+S+LSEIRL+L TGES +RPI+   D
Sbjct  415   LWNAWEEPATGEVVVIGSCMTPPDSVFNEREENLRSVLSEIRLDLHTGESRRRPILSPAD  474

Query  777   QQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEP  598
              QVNLEAG VNRN++GRKT++AYLA+AEPWPKVSGF K+DL TGE ++F++GDG+YGGEP
Sbjct  475   -QVNLEAGTVNRNMMGRKTRHAYLAVAEPWPKVSGFTKIDLFTGETKQFIFGDGRYGGEP  533

Query  597   FFVPRN-PNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             +FVP N  ++  +DDG++L+F+HDE+T +SEL IVNA N+ L AT+KLPSRVPYGFHGTF
Sbjct  534   YFVPSNDSDACSDDDGYVLTFMHDEETLESELLIVNAANMRLEATVKLPSRVPYGFHGTF  593

Query  420   ITSYDLQNQV  391
             ITS DL++Q 
Sbjct  594   ITSSDLESQA  603



>ref|NP_001241251.1| probable 9-cis-epoxycarotenoid dioxygenase NCED5, chloroplastic-like 
[Glycine max]
 gb|AEK69515.1| 9-cis-epoxycarotenoid dioxygenase 2 [Glycine max]
Length=587

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/569 (64%), Positives = 451/569 (79%), Gaps = 17/569 (3%)
 Frame = -2

Query  2094  TVDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQQLPDGE------SPAPSQPKW  1933
             T DLG P++    KKP R+     + A+HS  V+  P Q     E      +    +P+W
Sbjct  29    TRDLGFPTRF--QKKPIRKV---VDCALHSPPVIHFPNQPYNKPEITKEPTTSTAERPQW  83

Query  1932  NllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVP  1753
             N  Q+A A ALD+ E AL+SREL +P PKT DP VQIAGNFAPVPE  V ++LPV G +P
Sbjct  84    NPFQKAAAKALDMFESALLSRELNQPFPKTTDPRVQIAGNFAPVPEHPVEHSLPVIGTIP  143

Query  1752  DCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLG  1573
             D INGVY+RNGANPLF+PKAGHHLFDGDGMVHAV    G+ SY+CRFTET+RL+QER LG
Sbjct  144   DAINGVYLRNGANPLFKPKAGHHLFDGDGMVHAVKFNDGTASYACRFTETQRLMQERKLG  203

Query  1572  RPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDL  1393
             +PVFPKAIGELHGHSG+ARL+LFYARGL G+VDHRRG G ANAGLV+FNG+LLAMSEDD 
Sbjct  204   KPVFPKAIGELHGHSGIARLMLFYARGLCGIVDHRRGAGAANAGLVFFNGKLLAMSEDDF  263

Query  1392  PYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVK  1213
             PY +R+  SGDLET+GRY F+ QL S+MIAHPKVDP SGE F LSYDV  K  LKYF+  
Sbjct  264   PYELRITASGDLETIGRYSFHGQLNSSMIAHPKVDPVSGELFTLSYDVTSK-ILKYFHFS  322

Query  1212  SSGE-KSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSR  1036
                E KSPD+EIPLD PTM HDFAITEN+V+IPDQQVVFKL EMI+GGS VIY+ +KKSR
Sbjct  323   PEDERKSPDIEIPLDAPTMTHDFAITENFVVIPDQQVVFKLGEMIKGGSPVIYDGEKKSR  382

Query  1035  FGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENL  856
             FGIL K A +A  I+WV+SP+TF FH WNAWEE + DE+VVIGSCMTPPDSIFN+ EE L
Sbjct  383   FGILPKYASDASSIVWVDSPDTFFFHFWNAWEERDKDEVVVIGSCMTPPDSIFNDREERL  442

Query  855   KSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVS  676
             KS+L+E+RLN+++G++ +R ++    +++NLEAGMVNR  LGRKT++AYL IAEPWPKVS
Sbjct  443   KSVLTEVRLNMRSGKARRRVLV----EEMNLEAGMVNRKRLGRKTRFAYLCIAEPWPKVS  498

Query  675   GFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIV  496
             G AKVDL +GE+++  YG+ ++GGEPFF+P    +  ED+G++++FVHDE TW+SELQI+
Sbjct  499   GVAKVDLESGEVKRHEYGERRFGGEPFFLPTRGGNGNEDEGYVMAFVHDEMTWQSELQIL  558

Query  495   NAINLELLATIKLPSRVPYGFHGTFITSY  409
             NA++L+L AT+ LPSRVPYGFHGTF+ ++
Sbjct  559   NALDLKLEATVMLPSRVPYGFHGTFVEAH  587



>gb|ADP20466.1| 9-cis-epoxycarotenoid dioxygenase [Diospyros kaki]
Length=447

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/423 (82%), Positives = 387/423 (91%), Gaps = 1/423 (0%)
 Frame = -2

Query  1680  FDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFY  1501
             FDGDGMVHAVTI GGSVSYSCRFTET RLVQER LGRPVFPKAIGELHGHSG+ARLLLF+
Sbjct  1     FDGDGMVHAVTINGGSVSYSCRFTETRRLVQERSLGRPVFPKAIGELHGHSGIARLLLFF  60

Query  1500  ARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQL  1321
             ARG+FGLVDHR GTG+ANAGLVYFN RLLAMSE+DLPY VRV PSGDLETVGRYDFN QL
Sbjct  61    ARGVFGLVDHRHGTGVANAGLVYFNHRLLAMSEEDLPYQVRVSPSGDLETVGRYDFNGQL  120

Query  1320  KSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAI  1141
             +S+MIAHPK+DP +GE FALSYDV++KPYLKYF   + G KSPDVEIPL+ PTMIHDFAI
Sbjct  121   RSSMIAHPKLDPVTGELFALSYDVVKKPYLKYFLFSADGTKSPDVEIPLEAPTMIHDFAI  180

Query  1140  TENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCF  961
             TE YV+IPDQQVVFKLQEM+ GGS VIY+K KKSRFGIL K A+ A  IIWVESPETFCF
Sbjct  181   TEKYVVIPDQQVVFKLQEMVGGGSPVIYDKNKKSRFGILSKRARKASEIIWVESPETFCF  240

Query  960   HLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPAT  781
             H+WNAWEE E+DE+VVIGSCMTPPDSIFNEC+ENLKS++SEIRLNLKTGEST+RPIIP +
Sbjct  241   HIWNAWEEPESDEVVVIGSCMTPPDSIFNECDENLKSVISEIRLNLKTGESTRRPIIPHS  300

Query  780   DQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGE  601
             D  +NLEAGMVNRN LG+KT Y YLAIAEPWPKVSGFAKVDLSTG++ KF+YG+G+YGGE
Sbjct  301   D-HINLEAGMVNRNKLGQKTPYVYLAIAEPWPKVSGFAKVDLSTGKVHKFIYGEGRYGGE  359

Query  600   PFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             P+FVPR+ NSE+EDDG+IL FVHDEKTWKSELQIVNA+NL+L A++KLPSRVPYGFHGTF
Sbjct  360   PYFVPRDVNSEREDDGYILGFVHDEKTWKSELQIVNAMNLKLEASVKLPSRVPYGFHGTF  419

Query  420   ITS  412
             I+S
Sbjct  420   ISS  422



>gb|AGI97131.1| 9-cis-epoxy carotenoid dioxygenase [Lilium longiflorum]
Length=603

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/583 (65%), Positives = 447/583 (77%), Gaps = 26/583 (4%)
 Frame = -2

Query  2073  SKSISM-KKPTRRAK-IHCEAAVHSSSVVTLPEQQLPDGESP------------------  1954
             SKS+ + ++P R AK I C A+ HS  ++  P        SP                  
Sbjct  25    SKSMKLLRRPVRPAKTIRCAASSHS--LIDFPSHSSSFYPSPLVDTPTTTKPTLPHRIQS  82

Query  1953  APSQPKWNllqravaaaldvaegalVSRELQRP--LPKTWDPGVQIAGNFAPVPEQAVRN  1780
              PS P WN  QRA AAALDV E  + S  L+RP  LPKT DP VQIAGNFAPV EQ   +
Sbjct  83    KPSSPHWNFFQRAAAAALDVIEEGI-SNILERPHPLPKTADPAVQIAGNFAPVGEQPPHH  141

Query  1779  NLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETE  1600
             NLPV G +P  INGVYVRNGANPL  P AGHH FDGDGM+H+V I GG+  Y+CRFTETE
Sbjct  142   NLPVTGRIPPFINGVYVRNGANPLHEPVAGHHFFDGDGMIHSVQIRGGAACYACRFTETE  201

Query  1599  RLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGR  1420
             R  QER +GRP+FPKAIGELHGHSG+ARL LFYARG FGL+D  RG G+ANAGLVYFN R
Sbjct  202   RFRQERAIGRPLFPKAIGELHGHSGIARLALFYARGAFGLLDASRGIGVANAGLVYFNDR  261

Query  1419  LLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQK  1240
             LLAMSEDDLPY +RV   GDLETV RY+FN QL S MIAHPK+DP +GE FALSYDVIQ+
Sbjct  262   LLAMSEDDLPYQIRVTAEGDLETVERYNFNGQLTSAMIAHPKLDPATGELFALSYDVIQQ  321

Query  1239  PYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVI  1060
             PYLKYF     G  SPDV+IPLD PTM+HDFAITEN+VI+PDQQVVFKLQEMI GG  V+
Sbjct  322   PYLKYFWFSPDGVMSPDVDIPLDQPTMMHDFAITENFVIVPDQQVVFKLQEMISGGWPVV  381

Query  1059  YEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSI  880
             Y+K K +RFGIL K A +A  + WV+ P+ FCFHLWNAWEE  T E+VVIGSCMTP DSI
Sbjct  382   YDKTKTARFGILPKYATDAAEMKWVDVPDCFCFHLWNAWEEPATGEVVVIGSCMTPADSI  441

Query  879   FNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAI  700
             FNE +ENL+S+LSEIRL+ KTG+ST+RPI+P + +Q+NLEAGMVNRN LGRK+++AYLAI
Sbjct  442   FNESDENLESVLSEIRLDPKTGKSTRRPILPQS-EQINLEAGMVNRNWLGRKSRFAYLAI  500

Query  699   AEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKT  520
             AEPWPKVSGFAKVDLSTGE+ KF+YGD  YGGEP+FVP   +   EDDG+ILS++H+E T
Sbjct  501   AEPWPKVSGFAKVDLSTGEVTKFIYGDNCYGGEPYFVPMEGSRRGEDDGYILSYMHNEAT  560

Query  519   WKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
              +SEL IVNA ++ L A++KLPSRVPYGFHGTFI+S DL++Q 
Sbjct  561   SESELVIVNAADMRLEASVKLPSRVPYGFHGTFISSKDLKSQA  603



>gb|ACD44928.1| plastid 9-cis-epoxycarotenoid dioxygenase [Crocus sativus]
Length=611

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/490 (72%), Positives = 412/490 (84%), Gaps = 3/490 (1%)
 Frame = -2

Query  1857  PLPKTWDPGVQIAGNFAPVPEQAVRN-NLPVDGAVPDCINGVYVRNGANPLFRPKAGHHL  1681
             PLPKT DP +QIAGNFAPV EQ   + +LPV G +P  ING YVRNGANPLF P AGHHL
Sbjct  124   PLPKTSDPAIQIAGNFAPVEEQPPHDESLPVTGRIPPFINGAYVRNGANPLFEPVAGHHL  183

Query  1680  FDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFY  1501
             FDGDGMVHAV +  G  +YSCRFTETERL QER +GRPVFPKAIGELHGHSG+A   LFY
Sbjct  184   FDGDGMVHAVRLQNGKATYSCRFTETERLRQERAIGRPVFPKAIGELHGHSGIAACSLFY  243

Query  1500  ARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQL  1321
             ARGL G+VD   GTG+ANAGL+YFN RLLAMSEDDLPYHVR+  SGDLETVGRYDF+ QL
Sbjct  244   ARGLAGIVDPTHGTGVANAGLIYFNDRLLAMSEDDLPYHVRISQSGDLETVGRYDFDGQL  303

Query  1320  KSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAI  1141
              S MIAHPK+DP + E FALSY+VIQKP+LKYF     GEK+PDVEIPL  PTM++DFAI
Sbjct  304   DSPMIAHPKIDPATKELFALSYNVIQKPFLKYFRFSPDGEKAPDVEIPLAGPTMMNDFAI  363

Query  1140  TENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCF  961
             TEN+V++PDQQVVFKLQEMIRGGS V+Y+K+K +RFGIL K A +A  + WV+ PE FCF
Sbjct  364   TENFVVVPDQQVVFKLQEMIRGGSPVVYDKEKTARFGILPKYASDASEMKWVDVPECFCF  423

Query  960   HLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPAT  781
             H WNAWE++ET E+VVIGS MTP DSIFNEC+E+L+S+LSEIRLN KTG+ST+RPI+  +
Sbjct  424   HFWNAWEDSETGEVVVIGSSMTPADSIFNECDESLESVLSEIRLNPKTGKSTRRPILSPS  483

Query  780   DQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGE  601
             + Q NLEAGMVNRN +GRKT++AYLAIAEPWPKVSGFAKVDLSTGE++K +YGDGKYGGE
Sbjct  484   N-QFNLEAGMVNRNRIGRKTRFAYLAIAEPWPKVSGFAKVDLSTGEVEKLIYGDGKYGGE  542

Query  600   PFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             P+FVPR   S +EDDG++L+FVHDE+T +SELQIVN  ++ L A++KLPSRVPYGFHGTF
Sbjct  543   PYFVPRE-GSTREDDGYVLAFVHDEETSESELQIVNGTDMRLEASVKLPSRVPYGFHGTF  601

Query  420   ITSYDLQNQV  391
             I S +L+ Q 
Sbjct  602   IGSKELETQA  611



>dbj|BAN15739.1| 9-cis-epoxy-carotenoid dioxygenase [Dianthus caryophyllus]
Length=589

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/496 (70%), Positives = 406/496 (82%), Gaps = 2/496 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E   PLPK+ DP +QI+GNFAPVPE  V +NLPV G +P CI G YVRNGANPL +P 
Sbjct  95    SWESSTPLPKSSDPVIQISGNFAPVPEHPVTHNLPVTGQIPKCIKGAYVRNGANPLHQPL  154

Query  1695  AGHHLFDGDGMVHAVTIT-GGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLA  1519
             AGHHLFDGDGM+H V     GS SY+CRFTET RLVQER LGRP+FPK+IGELHGH GL 
Sbjct  155   AGHHLFDGDGMIHTVHFHPDGSASYACRFTETNRLVQERELGRPIFPKSIGELHGHCGLG  214

Query  1518  RLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRY  1339
             RL+L Y R L GL+DH +G G+ANAG+V+FNGRLLAMSEDD+PY VRV  +GDL+T GR+
Sbjct  215   RLMLLYTRSLLGLLDHDKGIGVANAGVVFFNGRLLAMSEDDVPYQVRVTSTGDLKTEGRF  274

Query  1338  DFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTM  1159
             DF+  LKS+MIAHPK+DP +GE F LSYDVI+KPYLKYF V S G KS DV++ L+  TM
Sbjct  275   DFDGHLKSSMIAHPKIDPSTGELFGLSYDVIKKPYLKYFRVNSEGVKSADVDVELETATM  334

Query  1158  IHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVES  979
             +HDFAITEN V+IPD QVVFK+ EMIRGGS V+Y+ +K SRFGIL K A+NA+ I W+E 
Sbjct  335   VHDFAITENCVVIPDGQVVFKMHEMIRGGSPVVYDNEKTSRFGILPKYAENADSIEWIEV  394

Query  978   PETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKR  799
             PE FCFHLWNAWEE ET+EIVVIGSCMTP DSIFNEC+E+L S+LSEIRLN  TG+ST+R
Sbjct  395   PECFCFHLWNAWEEPETNEIVVIGSCMTPADSIFNECDESLSSVLSEIRLNRTTGKSTRR  454

Query  798   PIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGD  619
              I+  +D Q+NLEAGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL TGE+ K+ YG 
Sbjct  455   EILSGSD-QMNLEAGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVSKYFYGG  513

Query  618   GKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPY  439
              KYGGEP F+P   N + E++GHIL+FVHDEK W SELQIVNA+ ++L+AT++LPSRVPY
Sbjct  514   EKYGGEPLFLPCGENVDSEEEGHILAFVHDEKNWTSELQIVNAVTMDLVATVQLPSRVPY  573

Query  438   GFHGTFITSYDLQNQV  391
             GFHGTFIT  DL  QV
Sbjct  574   GFHGTFITDQDLLTQV  589



>ref|XP_010439868.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic-like 
[Camelina sativa]
Length=583

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/495 (70%), Positives = 412/495 (83%), Gaps = 1/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             SRE   PLPKT DP VQIAGN++PVPE  VR NL V+G +PDCI+G YVRNGANP+F P 
Sbjct  90    SREQDTPLPKTADPRVQIAGNYSPVPESPVRRNLTVEGTIPDCIDGAYVRNGANPMFEPI  149

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             AGHHLFDGDGMVHAV IT GS SY+CRFT+TERLVQE+ LGRPVFPKAIGELHGHSG+AR
Sbjct  150   AGHHLFDGDGMVHAVKITNGSASYACRFTKTERLVQEKRLGRPVFPKAIGELHGHSGVAR  209

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYARGL GL++++ G G+ANAGLVYFN RLLAMSEDDLPY +++  +GDL+TVGRYD
Sbjct  210   LMLFYARGLCGLINNQNGVGVANAGLVYFNNRLLAMSEDDLPYQLKITQTGDLQTVGRYD  269

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL S MIAHPK+DP + E  +LSYDV++KPYLKYF     G KSP++EIPL+ PTMI
Sbjct  270   FDGQLNSAMIAHPKLDPVTKELHSLSYDVVKKPYLKYFRFSPDGVKSPELEIPLETPTMI  329

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITENYV+IPDQQVVFKL EMI G S V+++ +K SR GI+ K A  A  IIWV SP
Sbjct  330   HDFAITENYVVIPDQQVVFKLGEMISGKSPVVFDGEKVSRLGIMHKDATEASEIIWVNSP  389

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             ETFCFHLWNAWE  ET+EIVVIGSCMTP DSIFNE +E+L+S+LSEIR+NL+T E+T+R 
Sbjct  390   ETFCFHLWNAWESPETEEIVVIGSCMTPADSIFNERDESLRSVLSEIRINLRTREATRRA  449

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             ++   ++ VNLE GMVNRN LGRKT++A+LAIA+PWPKVSGFAKVDLSTGEM+K++YG  
Sbjct  450   LL-VNNEDVNLEIGMVNRNRLGRKTRFAFLAIADPWPKVSGFAKVDLSTGEMKKYIYGGE  508

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             KYGGEPFF+P     E EDDG+I   VHDE+   SELQI+NA +LEL ATIKLPSRVPYG
Sbjct  509   KYGGEPFFLPGGDGGENEDDGYIFCHVHDEEKETSELQIINAGSLELEATIKLPSRVPYG  568

Query  435   FHGTFITSYDLQNQV  391
             FHGTF+ S +L +Q+
Sbjct  569   FHGTFVDSSELVDQL  583



>ref|NP_193569.1| 9-cis-epoxycarotenoid dioxygenase NCED2 [Arabidopsis thaliana]
 sp|O49505.1|NCED2_ARATH RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic; 
Short=AtNCED2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16715.1| neoxanthin cleavage enzyme - like protein [Arabidopsis thaliana]
 emb|CAB78837.1| neoxanthin cleavage enzyme-like protein [Arabidopsis thaliana]
 gb|ABO38778.1| At4g18350 [Arabidopsis thaliana]
 gb|AEE84030.1| 9-cis-epoxycarotenoid dioxygenase NCED2 [Arabidopsis thaliana]
Length=583

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/497 (70%), Positives = 416/497 (84%), Gaps = 4/497 (1%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E   PLPKT DP VQIAGN++PVPE +VR NL V+G +PDCI+GVY+RNGANP+F P 
Sbjct  89    SHEQDSPLPKTADPRVQIAGNYSPVPESSVRRNLTVEGTIPDCIDGVYIRNGANPMFEPT  148

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             AGHHLFDGDGMVHAV IT GS SY+CRFT+TERLVQE+ LGRPVFPKAIGELHGHSG+AR
Sbjct  149   AGHHLFDGDGMVHAVKITNGSASYACRFTKTERLVQEKRLGRPVFPKAIGELHGHSGIAR  208

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYARGL GL++++ G G+ANAGLVYFN RLLAMSEDDLPY +++  +GDL+TVGRYD
Sbjct  209   LMLFYARGLCGLINNQNGVGVANAGLVYFNNRLLAMSEDDLPYQLKITQTGDLQTVGRYD  268

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QLKS MIAHPK+DP + E  ALSYDV++KPYLKYF     G KSP++EIPL+ PTMI
Sbjct  269   FDGQLKSAMIAHPKLDPVTKELHALSYDVVKKPYLKYFRFSPDGVKSPELEIPLETPTMI  328

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMI G S V+++ +K SR GI+ K A  A  IIWV SP
Sbjct  329   HDFAITENFVVIPDQQVVFKLGEMISGKSPVVFDGEKVSRLGIMPKDATEASQIIWVNSP  388

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             ETFCFHLWNAWE  ET+EIVVIGSCM+P DSIFNE +E+L+S+LSEIR+NL+T ++T+R 
Sbjct  389   ETFCFHLWNAWESPETEEIVVIGSCMSPADSIFNERDESLRSVLSEIRINLRTRKTTRRS  448

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             ++   ++ VNLE GMVNRN LGRKT++A+LAIA PWPKVSGFAKVDL TGEM+K++YG  
Sbjct  449   LL--VNEDVNLEIGMVNRNRLGRKTRFAFLAIAYPWPKVSGFAKVDLCTGEMKKYIYGGE  506

Query  615   KYGGEPFFVPRNPNS--EKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVP  442
             KYGGEPFF+P N  +  E EDDG+I   VHDE+T  SELQI+NA+NL+L ATIKLPSRVP
Sbjct  507   KYGGEPFFLPGNSGNGEENEDDGYIFCHVHDEETKTSELQIINAVNLKLEATIKLPSRVP  566

Query  441   YGFHGTFITSYDLQNQV  391
             YGFHGTF+ S +L +Q+
Sbjct  567   YGFHGTFVDSNELVDQL  583



>ref|XP_010517551.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic 
[Camelina sativa]
Length=583

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/495 (70%), Positives = 413/495 (83%), Gaps = 1/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             SRE   PLPKT DP VQIAGN++PVPE  VR NL V+G +PDCI+GVYVRNGANP+F P 
Sbjct  90    SREHDTPLPKTADPRVQIAGNYSPVPESPVRRNLTVEGTIPDCIDGVYVRNGANPMFEPI  149

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             AGHHLFDGDGMVHAV IT GS SY+CRFT+TERLVQE+ +GRP+FPKAIGELHGHSG+AR
Sbjct  150   AGHHLFDGDGMVHAVKITNGSASYACRFTKTERLVQEKRVGRPLFPKAIGELHGHSGIAR  209

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYARGL GL++++ G G+ANAGLVYFN RLLAMSEDDLPY +++  +GDL+TVGRYD
Sbjct  210   LMLFYARGLCGLINNQNGVGVANAGLVYFNNRLLAMSEDDLPYQLKITQTGDLQTVGRYD  269

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL S MIAHPK+DP + E  +LSYDVI+KPYLKYF     G KSP++EIPL+ PTMI
Sbjct  270   FDGQLNSAMIAHPKLDPVTKELHSLSYDVIKKPYLKYFRFSPDGVKSPELEIPLETPTMI  329

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMI G S V+++ +K SR GI+ K A  A  IIWV SP
Sbjct  330   HDFAITENFVVIPDQQVVFKLGEMISGKSPVVFDGEKVSRLGIMPKDATEASEIIWVNSP  389

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             ETFCFHLWNAWE  ET+EIVVIGSCMTP DSIFNE +E+L+S+LSEIR+NL+T E+T+R 
Sbjct  390   ETFCFHLWNAWESPETEEIVVIGSCMTPADSIFNERDESLRSVLSEIRINLRTREATRRA  449

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             ++    + VNLE GMVNRN LGRKT++A+LAIA+PWPKVSGFAKVDLSTGEM+K++YG  
Sbjct  450   LL-VNKEDVNLEIGMVNRNRLGRKTRFAFLAIADPWPKVSGFAKVDLSTGEMKKYIYGGE  508

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             KYGGEPFF+P     E EDDG+I   VHDE+   SELQIVNA++L+L ATIKLPSRVPYG
Sbjct  509   KYGGEPFFLPGGDGGENEDDGYIFCHVHDEEKETSELQIVNAVSLKLEATIKLPSRVPYG  568

Query  435   FHGTFITSYDLQNQV  391
             FHGTF+ S +L +Q+
Sbjct  569   FHGTFVDSSELVDQL  583



>ref|XP_010535003.1| PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxycarotenoid dioxygenase 
NCED3, chloroplastic-like [Tarenaya hassleriana]
Length=579

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/493 (74%), Positives = 408/493 (83%), Gaps = 19/493 (4%)
 Frame = -2

Query  1869  ELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAG  1690
             E   PLPKT DP VQIAGNFAPV EQ VR NLPV G +PD I GVYVRNGANPL  P AG
Sbjct  104   ERNHPLPKTADPQVQIAGNFAPVEEQPVRRNLPVVGKIPDSIKGVYVRNGANPLHEPVAG  163

Query  1689  HHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLL  1510
             HH FDGDGMVHA+    GSVSY+CRFT+T RLVQER LGRPVFPKAIGELHGH+G+ARL+
Sbjct  164   HHFFDGDGMVHAIRFEDGSVSYACRFTQTNRLVQERELGRPVFPKAIGELHGHTGIARLM  223

Query  1509  LFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFN  1330
             LFYAR + GLVD   GTG+ANAGLVYFNGRLLAMSEDDLPYHVR+ P+ DL+T GRYDFN
Sbjct  224   LFYARAMVGLVDPTHGTGVANAGLVYFNGRLLAMSEDDLPYHVRITPTADLKTDGRYDFN  283

Query  1329  DQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHD  1150
              QLKSTMIAHPKVDPESGE FALSYDV+ KPYLKYF     G KSPDVE+ LD PTM+HD
Sbjct  284   GQLKSTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEVNLDQPTMMHD  343

Query  1149  FAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPET  970
             FAITEN+V+IPDQQVVFKL EMIRGGS V+Y+K K SRFGIL K A+++ GI W+++P+ 
Sbjct  344   FAITENFVVIPDQQVVFKLPEMIRGGSPVVYDKNKVSRFGILDKYARDSSGIRWIDAPDC  403

Query  969   FCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPII  790
             FCFHLWNAWEE ET+E+VVIGSCMTPPDSIFNE +ENLKS+LSEIRLNLKTGEST+RPII
Sbjct  404   FCFHLWNAWEEPETEEVVVIGSCMTPPDSIFNESDENLKSVLSEIRLNLKTGESTRRPII  463

Query  789   PATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKY  610
              +  +QVNLEAGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKV                 
Sbjct  464   -SDSEQVNLEAGMVNRNMLGRKTRFAYLALAEPWPKVSGFAKVT----------------  506

Query  609   GGEPFFVPRNPNSE-KEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGF  433
              GEP F+P + + E +EDDG+IL FVHDEKTWKSELQIVNA+ LEL AT+KLPSRVPYGF
Sbjct  507   -GEPLFLPCDASPENQEDDGYILCFVHDEKTWKSELQIVNAMTLELEATVKLPSRVPYGF  565

Query  432   HGTFITSYDLQNQ  394
             HGTFI + DL  Q
Sbjct  566   HGTFIGAGDLAKQ  578



>ref|XP_002870052.1| nine-cis-epoxycarotenoid dioxygenase 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46311.1| nine-cis-epoxycarotenoid dioxygenase 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=576

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/497 (69%), Positives = 414/497 (83%), Gaps = 4/497 (1%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             SRE   PLPKT DP +QIAGN++PVPE  VR NL V+G +PDCI+GVY+RNGANP+F P 
Sbjct  82    SREQDTPLPKTADPRIQIAGNYSPVPESPVRRNLTVEGTIPDCIDGVYIRNGANPMFEPT  141

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             AGHHLFDGDGMVHAV IT GS SY+CRFT+TERLVQE+ LGRPVFPKAIGELHGHSG+AR
Sbjct  142   AGHHLFDGDGMVHAVKITNGSASYACRFTKTERLVQEKRLGRPVFPKAIGELHGHSGIAR  201

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYARGL GL++++ G G+ANAGLVYFN RLLAMSEDD PY +++  +GDL+TVGRYD
Sbjct  202   LMLFYARGLCGLINNQNGVGVANAGLVYFNNRLLAMSEDDFPYQLKITQTGDLQTVGRYD  261

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F++QLKS MIAHPK+DP + E  ALSYDV++KPYLKYF     G KSP++EIPL+ PTMI
Sbjct  262   FDNQLKSAMIAHPKLDPVTKELHALSYDVVKKPYLKYFRFSPDGVKSPELEIPLETPTMI  321

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMI G S V+++ +K SR GI+ K A     IIWV SP
Sbjct  322   HDFAITENFVVIPDQQVVFKLGEMISGKSPVVFDGEKVSRLGIMPKDATEVSQIIWVNSP  381

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             ETFCFHLWNAWE  ET+EIVVIGSCM+P DSIFNE +E+L+S+LSEIR+NL+T EST+R 
Sbjct  382   ETFCFHLWNAWESPETEEIVVIGSCMSPADSIFNERDESLRSVLSEIRINLRTRESTRRA  441

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             ++   ++ VNLE GMVNRN LGRKT++A+LAIA+PWPKVSGFAKVDL TGEM+K++YG  
Sbjct  442   LL--VNEDVNLEIGMVNRNRLGRKTRFAFLAIADPWPKVSGFAKVDLCTGEMKKYIYGGE  499

Query  615   KYGGEPFFVPRNPNS--EKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVP  442
             KYGGEPFF+P +  +  E EDDG+I   VHDE+   SELQI+NA+NL L ATIKLPSRVP
Sbjct  500   KYGGEPFFLPGSSGNGEENEDDGYIFCHVHDEEKKTSELQIINAVNLNLEATIKLPSRVP  559

Query  441   YGFHGTFITSYDLQNQV  391
             YGFHGTF+ S +L +Q+
Sbjct  560   YGFHGTFVDSSELVDQL  576



>ref|XP_010434549.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic-like 
[Camelina sativa]
Length=583

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/495 (70%), Positives = 410/495 (83%), Gaps = 1/495 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             SRE   PLPKT DP VQIAGN++PVPE  VR N+ VDG +PDCI+GVYVRNGANP+F P 
Sbjct  90    SREQDTPLPKTADPRVQIAGNYSPVPESPVRRNITVDGTIPDCIDGVYVRNGANPMFEPI  149

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             AGHHLFDGDGMVH V IT GS SY+CRFT+TERLVQE+ LGRPVFPKAIGELHGHSG+AR
Sbjct  150   AGHHLFDGDGMVHDVKITNGSASYACRFTKTERLVQEKRLGRPVFPKAIGELHGHSGIAR  209

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYARGL GL++++ G G+ANAGLVYFN RLLAMSEDDLPY +++  +GDL+TVGRYD
Sbjct  210   LMLFYARGLCGLINNQNGVGVANAGLVYFNNRLLAMSEDDLPYQLKITKTGDLQTVGRYD  269

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL S MIAHPK+DP + E  ALSYDVI+KP LKYF     G KSP++EIPL+ PTMI
Sbjct  270   FDGQLNSAMIAHPKLDPVTKELHALSYDVIKKPDLKYFRFSPDGVKSPELEIPLETPTMI  329

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMI G S V+++ +K SR GI+ K A  A  IIWV SP
Sbjct  330   HDFAITENFVVIPDQQVVFKLGEMISGKSPVVFDGEKVSRLGIMHKDATEASEIIWVNSP  389

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             ETFCFHLWNAWE  ET+EIVVIGSCMTP DSIFNE +E+L+S+LSEIR+NL+T E+T+R 
Sbjct  390   ETFCFHLWNAWESPETEEIVVIGSCMTPADSIFNERDESLRSVLSEIRINLRTREATRRA  449

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             ++   ++ VNLE GMVNRN LGRKT++A+LAIA+PWPKVSGFAKVDLSTGEM+K++YG  
Sbjct  450   LL-VNNEDVNLEIGMVNRNRLGRKTRFAFLAIADPWPKVSGFAKVDLSTGEMKKYIYGGE  508

Query  615   KYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYG  436
             KYGGEPFF+P     E EDDG+I   VHDE    SELQI+NA +LEL ATIKLPSRVPYG
Sbjct  509   KYGGEPFFLPGGDGGENEDDGYIFCHVHDEDKETSELQIINAGSLELEATIKLPSRVPYG  568

Query  435   FHGTFITSYDLQNQV  391
             FHGTF+ S +L +Q+
Sbjct  569   FHGTFVDSSELVDQL  583



>gb|ACX33873.1| NCED3 [Lilium speciosum]
Length=603

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/581 (65%), Positives = 445/581 (77%), Gaps = 22/581 (4%)
 Frame = -2

Query  2073  SKSISM-KKPTR-RAKIHCEAAVHS-------------SSVVTLP---EQQLPDGESPAP  1948
             SKS+ + ++P R    I C A+ HS             S +V  P   +  LP      P
Sbjct  25    SKSMRLLRRPVRPVTTIRCAASSHSLIDFPSHSSSFYPSPLVDTPTTTKPNLPHRIQSQP  84

Query  1947  SQPKWNllqravaaaldvaegalVSRELQRP--LPKTWDPGVQIAGNFAPVPEQAVRNNL  1774
             S P WN  QRA AAALDV E  + S  L+RP  LPKT DP VQIAGNFAPV EQ   ++L
Sbjct  85    SSPHWNFFQRAAAAALDVIEDGI-SNILERPHPLPKTADPAVQIAGNFAPVGEQPPHHDL  143

Query  1773  PVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERL  1594
             PV G +P  INGVYVRNGANPL  P AGHH FDGDGM+H+V I GG+ SY+CRFTETER 
Sbjct  144   PVTGRIPPFINGVYVRNGANPLHEPVAGHHFFDGDGMIHSVQIRGGAASYACRFTETERF  203

Query  1593  VQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLL  1414
              QER +GRP+FPKAIGELHGHSG+ARL LFYAR  FGL+D  RG G+ANAGLVYFN RLL
Sbjct  204   RQERAIGRPLFPKAIGELHGHSGIARLALFYARSAFGLLDASRGIGVANAGLVYFNDRLL  263

Query  1413  AMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPY  1234
             AMSEDDLPY +RV   GDLETV RY+FN QL S MIAHPK+DP +GE FALSYDVIQKPY
Sbjct  264   AMSEDDLPYQIRVTAEGDLETVERYNFNGQLTSAMIAHPKLDPATGELFALSYDVIQKPY  323

Query  1233  LKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYE  1054
             LKYF     G KS DV+I LD PTM+HDFAITEN+VI+PDQQVVFKLQEMI GGS V+Y+
Sbjct  324   LKYFWFSPDGVKSSDVDIHLDQPTMMHDFAITENFVIVPDQQVVFKLQEMISGGSPVVYD  383

Query  1053  KKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFN  874
             K K +RFGIL K A +A  + WV+ P+ FCFHLWNAWEE  T E+VVIGSCMTP DSIFN
Sbjct  384   KTKTARFGILPKYATDAAEMKWVDVPDCFCFHLWNAWEEPATGEVVVIGSCMTPADSIFN  443

Query  873   ECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAE  694
             E +ENL+S+LSEIRL+ KTG+ST+RPI+P + +Q+NLEAGMVNRN LGRK+++AYLAIAE
Sbjct  444   ESDENLESVLSEIRLDPKTGKSTRRPILPQS-EQINLEAGMVNRNWLGRKSRFAYLAIAE  502

Query  693   PWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWK  514
             PWPKVSGFAKVD STGE+ KF+YG+  YGGEP+FVP   +   ED G+ILS++H+E T +
Sbjct  503   PWPKVSGFAKVDFSTGEVTKFIYGENCYGGEPYFVPMEGSRRGEDGGYILSYMHNEATSE  562

Query  513   SELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             SEL IVNA ++ L A++KLPSRVPYGFHGTFI+S DL++Q 
Sbjct  563   SELVIVNAADMRLEASVKLPSRVPYGFHGTFISSKDLESQA  603



>ref|XP_008446856.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Cucumis melo]
Length=599

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/567 (63%), Positives = 447/567 (79%), Gaps = 12/567 (2%)
 Frame = -2

Query  2067  SISMKKPTRRAKIHCEAAVHSSSVVTLPEQ-----QLPDGESPAPSQPK-WNllqravaa  1906
             +I  KKP +R ++    A++S  V   P+Q     ++ +  +     P  WNLLQ+  + 
Sbjct  35    NIVKKKPNQRKEV-ISFALNSPFVFHFPKQTNKPPRITEHHTSKCRHPSHWNLLQKVAST  93

Query  1905  aldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVR  1726
             A D+ E   ++ + Q  LPK +DP  QI GN+APVPEQ V ++LPV G +PD INGVY+R
Sbjct  94    AFDILEQTFLNNDNQN-LPKNFDPHFQIVGNYAPVPEQPVSHSLPVTGVIPDWINGVYLR  152

Query  1725  NGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIG  1546
             NGANP F+P AGHHLFDGDGM+HAVTI GG  SY+CRFTETERLVQE+ +GRPVFPKA+G
Sbjct  153   NGANPYFQPLAGHHLFDGDGMIHAVTIGGGRASYACRFTETERLVQEKSIGRPVFPKAVG  212

Query  1545  ELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPS  1366
             ELHGHSG+ARLLLFYARG FGL+DHRRGTG+ANAGLVYFNGRLLAMSEDDLPY VR+ PS
Sbjct  213   ELHGHSGIARLLLFYARGFFGLIDHRRGTGVANAGLVYFNGRLLAMSEDDLPYQVRITPS  272

Query  1365  GDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDV  1186
             GDL TVGRY+F  QL S M+AHPK+DPESGE FALSY+   KPYLK+F +   G+ SP +
Sbjct  273   GDLITVGRYNFEGQLNSPMVAHPKIDPESGELFALSYNFTHKPYLKHFRLTPDGKMSPKI  332

Query  1185  EIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKN  1006
             +IPLD+PTMIHDFAITE +V+IPDQQVVF LQ+M+ GGS V+Y++KK  RFG L K A +
Sbjct  333   DIPLDIPTMIHDFAITEKFVVIPDQQVVFNLQKMLTGGSPVMYDEKKNPRFGFLPKNATD  392

Query  1005  AEGIIWVESP-ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRL  829
             +  + WV+SP +TFCFHLWNAWEE E+D++VVI SCMTPPDSIFNE +E  K++L+EIR 
Sbjct  393   SSNLTWVDSPADTFCFHLWNAWEETESDDVVVIASCMTPPDSIFNERDEEFKAVLTEIRF  452

Query  828   NLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLST  649
             NL+TG+S+ RPI+ +  + +NLE G+VNR  LGRKTQY YLAI +PWPK  GFAKVD+S+
Sbjct  453   NLRTGKSSSRPIV-SESEHMNLEVGVVNRKRLGRKTQYVYLAITDPWPKACGFAKVDVSS  511

Query  648   GEMQKFMYGDGKYGGEPFFVPRNP--NSEKEDDGHILSFVHDEKTWKSELQIVNAINLEL  475
             GE++K++YGD +YGGEP+F+ R      E+EDDG+I+ FVHDEK W+SELQIVNAI+L+L
Sbjct  512   GEVKKYIYGDERYGGEPYFLGREMGFGCEEEDDGYIMVFVHDEKEWRSELQIVNAIDLKL  571

Query  474   LATIKLPSRVPYGFHGTFITSYDLQNQ  394
              A ++L SRVPYGFHGTF+ + DL++Q
Sbjct  572   EACVELKSRVPYGFHGTFVHANDLRHQ  598



>gb|ACX46382.1| plastid NCED3 [Lilium hybrid cultivar]
Length=603

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/522 (70%), Positives = 424/522 (81%), Gaps = 4/522 (1%)
 Frame = -2

Query  1950  PSQPKWNllqravaaaldvaegalVSRELQRP--LPKTWDPGVQIAGNFAPVPEQAVRNN  1777
             PS P WN  QRA AAALDV E  + S  L+RP  LPKT DP VQIAGNFAPV EQ   ++
Sbjct  84    PSSPHWNFFQRAAAAALDVIEDGI-SNILERPHPLPKTADPAVQIAGNFAPVGEQPPHHD  142

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P  INGVYVRNGANPL  P AGHH FDGDGM+H++ I GG+ SY+CRFTETER
Sbjct  143   LPVTGRIPPFINGVYVRNGANPLHEPVAGHHFFDGDGMIHSIQIRGGAASYACRFTETER  202

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
               QER +GRP+FPKAIGELHGHSG+ARL LFYAR  FGL+D  RG G+ANAGLVYFN RL
Sbjct  203   FRQERAIGRPLFPKAIGELHGHSGIARLALFYARSTFGLLDASRGIGVANAGLVYFNDRL  262

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPY +RV   GDLETV RY+FN QL S MIAHPK+DP +GE FALSYDVIQKP
Sbjct  263   LAMSEDDLPYQIRVTAEGDLETVERYNFNGQLTSAMIAHPKLDPATGELFALSYDVIQKP  322

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             YLKYF     G KS DV+I LD PTM+HDFAITEN+VI+PDQQVVFKLQEMI GGS V+Y
Sbjct  323   YLKYFWFSPDGVKSSDVDIHLDQPTMMHDFAITENFVIVPDQQVVFKLQEMISGGSPVVY  382

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +K K +RFGIL K A +A  + WV+ P+ FCFHLWNAWEE  T E+VVIGSCMTP DSIF
Sbjct  383   DKTKTARFGILPKYATDAAEMKWVDVPDCFCFHLWNAWEEPATGEVVVIGSCMTPADSIF  442

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NE +ENL+S+LSEIRL+ KTG+ST+RPI+P + +Q+NLEAGMVNRN LGRK+++AYLAIA
Sbjct  443   NESDENLESVLSEIRLDPKTGKSTRRPILPES-EQINLEAGMVNRNWLGRKSRFAYLAIA  501

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
             EPWPKVSGFAKVDLSTGE+ KF+YGD  YGGEP+FVP   +   ED G+ILS++H+E T 
Sbjct  502   EPWPKVSGFAKVDLSTGEVTKFIYGDNCYGGEPYFVPMEGSRRGEDGGYILSYMHNEATS  561

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
             +SEL IVNA ++ L A++KLPSRVPYGFHGTFI+S DL++Q 
Sbjct  562   ESELVIVNAADMRLEASVKLPSRVPYGFHGTFISSKDLESQA  603



>emb|CDY55629.1| BnaA03g58230D [Brassica napus]
Length=583

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/498 (69%), Positives = 412/498 (83%), Gaps = 7/498 (1%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             SRE   PLPKT DP +QIAGN+ PVPE  VR  L V+G +PDCI+GVYVRNGANP+F P 
Sbjct  87    SREQDTPLPKTADPRIQIAGNYFPVPEFPVRECLDVEGTIPDCIDGVYVRNGANPMFEPI  146

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             AGHHLFDGDGMVHAV IT GS SY+CRFT+TERL+QE+ LGRPVFPKAIGELHGHSG+AR
Sbjct  147   AGHHLFDGDGMVHAVKITNGSASYACRFTKTERLIQEKRLGRPVFPKAIGELHGHSGIAR  206

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYARGL GLV+++ G G+ANAGLVYFN RLLAMSEDDLPY +++  +GDL+TVGRYD
Sbjct  207   LMLFYARGLCGLVNNQNGVGVANAGLVYFNNRLLAMSEDDLPYQLKITQTGDLQTVGRYD  266

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QLKS+MIAHPK+DP + E  ALSYDV++KPYLKYF     G KSP++EIPL+ PTMI
Sbjct  267   FDGQLKSSMIAHPKLDPVTKELHALSYDVVKKPYLKYFRFSPDGVKSPELEIPLETPTMI  326

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMI G S VI++ +K SR GI+ K A  A  IIWV SP
Sbjct  327   HDFAITENFVVIPDQQVVFKLGEMIAGNSPVIFDGEKVSRLGIMPKDATEASEIIWVNSP  386

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             ETFCFHLWNAWE  ET+E+VVIGSCM+P DSIFNE +E+L+S+L+EIR+NL+T E+T+R 
Sbjct  387   ETFCFHLWNAWESPETEEVVVIGSCMSPADSIFNERDESLRSVLTEIRINLRTREATRRA  446

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             ++   D  VNLE GMVNRN LGRKT++A+LAIA+PWPKVSGFAKVDL TGE++K++YG  
Sbjct  447   LL---DDDVNLEIGMVNRNRLGRKTRFAFLAIADPWPKVSGFAKVDLFTGEIEKYIYGGE  503

Query  615   KYGGEPFFVPRNP----NSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSR  448
             KYGGEPFF+P         E EDDG+I S VHDE+   SELQI+NA+NL+L ATIKLPSR
Sbjct  504   KYGGEPFFLPSGSFDGNGGENEDDGYIFSHVHDEEKETSELQIINAVNLKLEATIKLPSR  563

Query  447   VPYGFHGTFITSYDLQNQ  394
             VPYGFHGTF+ S +L +Q
Sbjct  564   VPYGFHGTFVDSSELVDQ  581



>ref|XP_007144972.1| hypothetical protein PHAVU_007G198800g [Phaseolus vulgaris]
 gb|ESW16966.1| hypothetical protein PHAVU_007G198800g [Phaseolus vulgaris]
Length=587

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/580 (62%), Positives = 452/580 (78%), Gaps = 23/580 (4%)
 Frame = -2

Query  2091  VDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQ-----------QLPDGESPAPS  1945
              D+G P++    +K   R  + C  A+ S SV+  P Q             P   +  P 
Sbjct  20    TDMGFPTR---FEKKGIRKVVDC--ALQSPSVINFPNQPHHKSQNTKEPTTPAFTTDTPK  74

Query  1944  QPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVD  1765
             + +WN  Q+A A ALD+ E ALVSRELQ+PL KT DP +Q+AGNFAPVPE  ++++LPV 
Sbjct  75    RIQWNPFQKAAAMALDMFESALVSRELQQPLSKTTDPRLQLAGNFAPVPEHPLQHSLPVI  134

Query  1764  GAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQE  1585
             G +P+ +NGVY+RNGANPLF+PK+GHHLFDGDGMVHAV I  G+ SY+CRFT+T+RL+QE
Sbjct  135   GTIPEALNGVYLRNGANPLFQPKSGHHLFDGDGMVHAVKIADGNASYACRFTQTQRLMQE  194

Query  1584  RGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMS  1405
               LG+PVFPKAIG+LHG+SG+ARLLLFY RGL G++DHRRG G ANAGLV+FNG+LLAMS
Sbjct  195   SQLGKPVFPKAIGQLHGYSGIARLLLFYGRGLCGILDHRRGAGAANAGLVFFNGKLLAMS  254

Query  1404  EDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKY  1225
             EDDLPY +RV  SGD++T+GRY F+DQL S+MIAHPK+DP SGE F+LSYD I  P +KY
Sbjct  255   EDDLPYELRVTDSGDIKTIGRYSFHDQLNSSMIAHPKIDPISGELFSLSYD-ITSPCVKY  313

Query  1224  FNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKK  1045
             FN      KSP+VEI LD+ TM HDFAITEN+VIIPDQQVVFKL EM+ GGS V+Y+ KK
Sbjct  314   FNFSPKEVKSPEVEIRLDISTMTHDFAITENFVIIPDQQVVFKLGEMLNGGSPVMYDGKK  373

Query  1044  KSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECE  865
              SRFG+L K A +A  I+WVE+P  FCFHL+NAWEE +TDE+V+IGSCMTPPDSIFN+ E
Sbjct  374   PSRFGVLPKYATDASSILWVETPNMFCFHLFNAWEERDTDEVVLIGSCMTPPDSIFNDSE  433

Query  864   ENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWP  685
             ENL +IL+EIRLNL+TG +T+R ++P     +NLE GMVNR  LGRKTQ+AY+AIAEPWP
Sbjct  434   ENLTTILTEIRLNLRTGGTTRRVLVP----NMNLEVGMVNRKRLGRKTQFAYMAIAEPWP  489

Query  684   KVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSEL  505
             KVSG AKV+L++GEM+K  YGD ++GGEPFFVP    +  ED+G++++FVHDE TW+SEL
Sbjct  490   KVSGVAKVNLASGEMRKHEYGDRRFGGEPFFVPIGGGN--EDEGYVMAFVHDEVTWQSEL  547

Query  504   QIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV*H  385
             QI+N ++L+L AT+ LPSRVPYGFHGTF+ + DL  Q  H
Sbjct  548   QILNGVDLKLEATVILPSRVPYGFHGTFVEAKDLALQTIH  587



>gb|AAY82457.1| 9-cis-epoxycarotenoid dioxygenase 2 [Phaseolus vulgaris]
Length=589

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/580 (62%), Positives = 452/580 (78%), Gaps = 23/580 (4%)
 Frame = -2

Query  2091  VDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTLPEQ-----------QLPDGESPAPS  1945
              D+G P++    +K   R  + C  A+ S SV+  P Q             P   +  P 
Sbjct  22    TDMGFPTR---FEKKGIRKVVDC--ALQSPSVINFPNQPHHKSQNTKEPTTPAFTTDTPK  76

Query  1944  QPKWNllqravaaaldvaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVD  1765
             + +WN  Q+A A ALD+ E ALVSRELQ+PL KT DP +Q+AGNFAPVPE  ++++LPV 
Sbjct  77    RIQWNPFQKAAAMALDMFESALVSRELQQPLSKTTDPRLQLAGNFAPVPEHPLQHSLPVI  136

Query  1764  GAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQE  1585
             G +P+ +NGVY+RNGANPLF+PK+GHHLFDGDGMVHAV I  G+ SY+CRFT+T+RL+QE
Sbjct  137   GTIPEALNGVYLRNGANPLFQPKSGHHLFDGDGMVHAVKIADGNASYACRFTQTQRLMQE  196

Query  1584  RGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMS  1405
               LG+PVFPKAIG+LHG+SG+ARLLLFY RGL G++DHRRG G ANAGLV+FNG+LLAMS
Sbjct  197   SQLGKPVFPKAIGQLHGYSGIARLLLFYGRGLCGILDHRRGAGAANAGLVFFNGKLLAMS  256

Query  1404  EDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKY  1225
             EDDLPY +RV  SGD++T+GRY F+DQL S+MIAHPK+DP SGE F+LSYD I  P +KY
Sbjct  257   EDDLPYELRVTDSGDIKTIGRYSFHDQLNSSMIAHPKIDPISGELFSLSYD-ITSPCVKY  315

Query  1224  FNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKK  1045
             FN      KSP+VEI LD+ TM HDFAITEN+VIIPDQQVVFKL EM+ GGS V+Y+ KK
Sbjct  316   FNFSPKEVKSPEVEIRLDISTMTHDFAITENFVIIPDQQVVFKLGEMLNGGSPVMYDGKK  375

Query  1044  KSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECE  865
              SRFG+L K A +A  I+WVE+P  FCFHL+NAWEE +TDE+V+IGSCMTPPDSIFN+ E
Sbjct  376   PSRFGVLPKYATDASSILWVETPNMFCFHLFNAWEERDTDEVVLIGSCMTPPDSIFNDSE  435

Query  864   ENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWP  685
             ENL +IL+EIRLNL+TG +T+R ++P     +NLE GMVNR  LGRKTQ+AY+AIAEPWP
Sbjct  436   ENLTTILTEIRLNLRTGGTTRRVLVP----NMNLEVGMVNRKRLGRKTQFAYMAIAEPWP  491

Query  684   KVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSEL  505
             KVSG AKV+L++GEM+K  YGD ++GGEPFFVP    +  ED+G++++FVHDE TW+SEL
Sbjct  492   KVSGVAKVNLASGEMRKHEYGDRRFGGEPFFVPIGGGN--EDEGYVMAFVHDEVTWQSEL  549

Query  504   QIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV*H  385
             QI+N ++L+L AT+ LPSRVPYGFHGTF+ + DL  Q  H
Sbjct  550   QILNGVDLKLEATVILPSRVPYGFHGTFVEAKDLALQTIH  589



>emb|CDY01534.1| BnaC07g35240D [Brassica napus]
Length=583

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/498 (69%), Positives = 412/498 (83%), Gaps = 7/498 (1%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             SRE   PLPKT DP +QIAGN+ PVPE  VR  L V+G +PDCI+GVYVRNGANP+F P 
Sbjct  88    SREQDTPLPKTADPRIQIAGNYFPVPEFPVRECLDVEGTIPDCIDGVYVRNGANPMFEPI  147

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             AGHHLFDGDGMVHAV IT GS SY+CRFT+TERL+QE+ LGRPVFPKAIGELHGHSG+AR
Sbjct  148   AGHHLFDGDGMVHAVKITNGSASYACRFTKTERLIQEKRLGRPVFPKAIGELHGHSGIAR  207

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYARGL GLV+++ G G+ANAGLVYFN RLLAMSEDDLPY +++  +GDL+TVGRYD
Sbjct  208   LMLFYARGLCGLVNNQNGVGVANAGLVYFNNRLLAMSEDDLPYQLKITQTGDLQTVGRYD  267

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QLKS+MIAHPK+DP + E  ALSYDV++KPYLKYF     G KSP++EIPL+ PTMI
Sbjct  268   FDGQLKSSMIAHPKLDPVTKELHALSYDVVKKPYLKYFRFSPEGVKSPELEIPLETPTMI  327

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMI G S VI++ +K SR GI+ K A  A  +IWV SP
Sbjct  328   HDFAITENFVVIPDQQVVFKLGEMIAGNSPVIFDGEKVSRLGIMPKDATEASEVIWVNSP  387

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             ETFCFHLWNAWE  +T+E+VVIGSCM+P DSIFNE +E+L+S+L+EIR+NL+T E+T+R 
Sbjct  388   ETFCFHLWNAWESPDTEEVVVIGSCMSPADSIFNERDESLRSVLTEIRINLRTREATRRA  447

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             ++   D  VNLE GMVNRN LGRKT++A+LAIA+PWPKVSGFAKVDL TGE++K++YG  
Sbjct  448   LL---DDDVNLEIGMVNRNRLGRKTRFAFLAIADPWPKVSGFAKVDLCTGEIEKYIYGGD  504

Query  615   KYGGEPFFVP----RNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSR  448
             KYGGEPFF+P         E EDDG+I S VHDE+   SELQI+NA+NL+L ATIKLPSR
Sbjct  505   KYGGEPFFLPGGTVDGKGGENEDDGYIFSHVHDEEKETSELQIINAVNLKLEATIKLPSR  564

Query  447   VPYGFHGTFITSYDLQNQ  394
             VPYGFHGTF+ S +L +Q
Sbjct  565   VPYGFHGTFVDSSELVDQ  582



>ref|XP_009136923.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic 
[Brassica rapa]
Length=583

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/498 (69%), Positives = 412/498 (83%), Gaps = 7/498 (1%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             SRE   PLPKT DP +QIAGN+ PVPE  VR  L V+G +PDCI+GVYVRNGANP+F P 
Sbjct  87    SREQDTPLPKTADPRIQIAGNYFPVPEFPVRECLDVEGTIPDCIDGVYVRNGANPMFEPI  146

Query  1695  AGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             AGHHLFDGDGMVHAV IT GS SY+CRFT+TERL+QE+ LGRPVFPKAIGELHGHSG+AR
Sbjct  147   AGHHLFDGDGMVHAVKITNGSASYACRFTKTERLIQEKRLGRPVFPKAIGELHGHSGIAR  206

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L+LFYARGL GLV+++ G G+ANAGLVYFN RLLAMSEDDLPY +++  +GDL+TVGRYD
Sbjct  207   LMLFYARGLCGLVNNQNGVGVANAGLVYFNNRLLAMSEDDLPYQLKITQTGDLQTVGRYD  266

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QLKS+MIAHPK+DP + E  ALSYDV++KPYLKYF     G KSP++EIPL+ PTMI
Sbjct  267   FDGQLKSSMIAHPKLDPVTKELHALSYDVVKKPYLKYFRFSPDGVKSPELEIPLETPTMI  326

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V+IPDQQVVFKL EMI G S V+++ +K SR GI+ K A  A  IIWV SP
Sbjct  327   HDFAITENFVVIPDQQVVFKLGEMIAGNSPVVFDGEKVSRLGIMPKDATEASEIIWVNSP  386

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             ETFCFHLWNAWE  ET+E+VVIGSCM+P DSIFNE +E+L+S+L+EIR+NL+T E+T+R 
Sbjct  387   ETFCFHLWNAWESPETEEVVVIGSCMSPADSIFNERDESLRSVLTEIRINLRTREATRRA  446

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             ++   +  VNLE GMVNRN LGRKT++A+LAIA+PWPKVSGFAKVDL TGE++K++YG  
Sbjct  447   LL---EDDVNLEIGMVNRNRLGRKTRFAFLAIADPWPKVSGFAKVDLFTGEIEKYIYGGE  503

Query  615   KYGGEPFFVPRNP----NSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSR  448
             KYGGEPFF+P         E EDDG+I S VHDE+   SELQI+NA+NL+L ATIKLPSR
Sbjct  504   KYGGEPFFLPSGSFDGNGGENEDDGYIFSHVHDEEKETSELQIINAVNLKLEATIKLPSR  563

Query  447   VPYGFHGTFITSYDLQNQ  394
             VPYGFHGTF+ S +L +Q
Sbjct  564   VPYGFHGTFVDSSELVDQ  581



>ref|XP_006282855.1| hypothetical protein CARUB_v10006815mg [Capsella rubella]
 gb|EOA15753.1| hypothetical protein CARUB_v10006815mg [Capsella rubella]
Length=580

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/562 (65%), Positives = 446/562 (79%), Gaps = 7/562 (1%)
 Frame = -2

Query  2064  ISMKKPTRRAKI-HCEAAVHSSSVVTLPEQQLPDGESPAPSQP---KWNllqravaaald  1897
             +  K  TRR+KI  C   +  ++ +T   Q      +  P +    + N+ Q+A A A+D
Sbjct  22    LGFKPITRRSKIIKCTVQIDVTTDLTQKRQLFTPKTTATPPRHNPLRLNIFQKAAAIAID  81

Query  1896  vaegalVSRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGA  1717
              AE AL+SRE   PLPKT DP VQIAGN++PV E  VR NL V+G +P+CI+GVYVRNGA
Sbjct  82    AAERALISREHDTPLPKTADPRVQIAGNYSPVSESPVRRNLTVEGTIPECIDGVYVRNGA  141

Query  1716  NPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELH  1537
             NP+F P AGHHLFDGDGMVHAV IT GS SY+CRFT+TERLVQE+ LGRPVFPKAIGELH
Sbjct  142   NPMFEPIAGHHLFDGDGMVHAVKITNGSASYACRFTKTERLVQEKRLGRPVFPKAIGELH  201

Query  1536  GHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDL  1357
             GHSG+ARL+LFYARG+ GL+++R G G+ANAGLVYFN RLLAMSEDDLPY ++V  +GDL
Sbjct  202   GHSGIARLMLFYARGICGLINNRNGVGVANAGLVYFNNRLLAMSEDDLPYQLKVTQTGDL  261

Query  1356  ETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIP  1177
             +TVGR+DF+ QLKS MIAHPK+DP + E  ALSYDV++KPYLKYF     G KSP++EIP
Sbjct  262   QTVGRFDFDGQLKSAMIAHPKLDPVTKELHALSYDVVKKPYLKYFRFSPDGVKSPELEIP  321

Query  1176  LDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEG  997
             L+ PTMIHDFAITEN+V+IPDQQVVFKL EMI G S V+++ +K SR GI+ K A +A  
Sbjct  322   LETPTMIHDFAITENFVVIPDQQVVFKLGEMISGKSPVVFDGEKVSRLGIMPKDATDASE  381

Query  996   IIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKT  817
             IIWV SPETFCFHLWNAWE  ET+EIVVIGSCMTP DSIFNE +E+L+S+LSEIR+NL+T
Sbjct  382   IIWVNSPETFCFHLWNAWESPETEEIVVIGSCMTPADSIFNERDESLRSVLSEIRINLRT  441

Query  816   GESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQ  637
              E+T+R ++   ++ VNLE GMVNRN LGRKT++A+LAIA+PWPKVSGFAKVDL TGEM+
Sbjct  442   REATRRALL--VNEDVNLEIGMVNRNRLGRKTRFAFLAIADPWPKVSGFAKVDLFTGEMK  499

Query  636   KFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKL  457
             K++YG  KYGGEPFF+P       EDDG+I   VHDE+   SELQI+NA+NLEL ATIKL
Sbjct  500   KYIYGGEKYGGEPFFLPGE-GGGNEDDGYIFCHVHDEEKETSELQIINAVNLELEATIKL  558

Query  456   PSRVPYGFHGTFITSYDLQNQV  391
             PSRVPYGFHGTF+ S +L +Q+
Sbjct  559   PSRVPYGFHGTFVDSRELVDQL  580



>sp|C3VEQ3.1|NCED_ONCHC RecName: Full=9-cis-epoxycarotenoid dioxygenase, chloroplastic; 
Short=OgNCED; Flags: Precursor [Oncidium hybrid cultivar]
 gb|ACP27628.1| 9-cis-epoxycarotenoid dioxygenase [Oncidium hybrid cultivar]
Length=610

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/536 (69%), Positives = 446/536 (83%), Gaps = 4/536 (1%)
 Frame = -2

Query  1992  TLPEQQLPDGESPAPSQPKWNllqravaaaldvaegalVSRELQ--RPLPKTWDPGVQIA  1819
             T P++  P+ +S  PS+P WNL QRA AA L+  E  L+   L+   PLPKT DP VQIA
Sbjct  77    TCPKEIHPE-QSAKPSRPSWNLFQRAAAAVLEAVEDNLIQNLLESGHPLPKTADPAVQIA  135

Query  1818  GNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITG  1639
             GNFAPV EQ   ++LPVDG +P  INGVY+RNGANPLF P AGHH FDGDGMVHAV +  
Sbjct  136   GNFAPVGEQKPHHDLPVDGRIPPLINGVYLRNGANPLFEPVAGHHFFDGDGMVHAVHLRN  195

Query  1638  GSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGT  1459
             G  SY+CRFTETERL QER +GR +FPKAIGELHGHSG+ARLLLFYARGL GL+DH RGT
Sbjct  196   GRASYACRFTETERLKQERAVGRAIFPKAIGELHGHSGIARLLLFYARGLLGLIDHSRGT  255

Query  1458  GLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPES  1279
             G+ANAGL+YFN RLLAMSEDDLPYHVR+KP+GDLET GRYDF+ QL +TMIAHPK+DPE+
Sbjct  256   GVANAGLIYFNNRLLAMSEDDLPYHVRIKPNGDLETAGRYDFDGQLTTTMIAHPKLDPET  315

Query  1278  GEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVF  1099
              EFFALSYDVI+KPYLKYF     GEKSPDVEIPL  PTM+HDFAIT+N+VIIPDQQVVF
Sbjct  316   REFFALSYDVIKKPYLKYFRFSPCGEKSPDVEIPLPQPTMMHDFAITKNFVIIPDQQVVF  375

Query  1098  KLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEI  919
             KLQEMI GGS V+Y+K+K +RFG+L K A +A  + W++ P+ FCFHLWN+WEE ET+E+
Sbjct  376   KLQEMICGGSPVVYDKEKIARFGVLPKYAIDASEMQWIDVPDCFCFHLWNSWEEPETEEV  435

Query  918   VVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRN  739
             VVIGSCMTPPDSIFNE EENL+S+L+EIRLNL+TG+ST+RPI+   + Q+NLEAGMVNRN
Sbjct  436   VVIGSCMTPPDSIFNESEENLQSVLTEIRLNLRTGKSTRRPILRPGNSQINLEAGMVNRN  495

Query  738   LLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKED  559
              LGR+T++AYLAIAEPWPKVSGFAKVDL++GE+Q+F YGDG YGGEP+FVPR    ++ED
Sbjct  496   RLGRRTRFAYLAIAEPWPKVSGFAKVDLASGEIQRFEYGDGGYGGEPYFVPRE-GCDRED  554

Query  558   DGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV  391
              G++L+FVHDE+   SEL I+NA ++ L A ++LPSRVPYGF+GTF+++ +L +Q 
Sbjct  555   GGYVLAFVHDEREGSSELLIMNAADMRLEAAVRLPSRVPYGFYGTFVSATELHSQA  610



>ref|NP_001050765.1| Os03g0645900 [Oryza sativa Japonica Group]
 gb|AAW21319.1| 9-cis-epoxycarotenoid dioxygenase 3 [Oryza sativa Japonica Group]
 gb|ABF97874.1| viviparous-14, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12679.1| Os03g0645900 [Oryza sativa Japonica Group]
 gb|EAZ27934.1| hypothetical protein OsJ_11896 [Oryza sativa Japonica Group]
Length=608

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/498 (70%), Positives = 401/498 (81%), Gaps = 7/498 (1%)
 Frame = -2

Query  1866  LQRP--LPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKA  1693
             L+RP  LP T DP VQIAGNFAPV E      LPV G +P  INGVY RNGANP F P A
Sbjct  112   LERPHGLPSTADPAVQIAGNFAPVGETPPARALPVSGRIPPFINGVYARNGANPHFDPVA  171

Query  1692  GHHLFDGDGMVHAVTITGGSV-SYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             GHHLFDGDGMVHAV I  G+  SY+CRFTET RL QER +GRP+FPKAIGELHGHSG+AR
Sbjct  172   GHHLFDGDGMVHAVRIRNGAAESYACRFTETARLRQERAMGRPMFPKAIGELHGHSGIAR  231

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L LFYAR   GL+D   GTG+ANAGL+YFNGRLLAMSEDDLPY VRV   GDLETVGRYD
Sbjct  232   LALFYARAACGLLDPSHGTGVANAGLIYFNGRLLAMSEDDLPYQVRVTADGDLETVGRYD  291

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL   MIAHPK+DP +GE  ALSYDVI+KPYLKYF     G KS DVEIPLD PTMI
Sbjct  292   FDGQLGCAMIAHPKLDPATGELHALSYDVIKKPYLKYFYFAPDGTKSADVEIPLDQPTMI  351

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITENYV++PD QVVFKLQEM+RGGS V+ +K+K SRFG+L K A +A  ++WV+ P
Sbjct  352   HDFAITENYVVVPDHQVVFKLQEMLRGGSPVVLDKEKTSRFGVLPKHAADASEMVWVDVP  411

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEEA+TDE+VVIGSCMTP DSIFNE ++ L+S+L+EIRLN +TGEST+R 
Sbjct  412   DCFCFHLWNAWEEADTDEVVVIGSCMTPADSIFNESDDRLESVLTEIRLNTRTGESTRRA  471

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             I+P +  QVNLE GMVNRNLLGRKT+YAYLA+AEPWPKVSGFAKVDL+TGE+ KF YG+G
Sbjct  472   ILPPS-SQVNLEVGMVNRNLLGRKTRYAYLAVAEPWPKVSGFAKVDLATGELTKFEYGEG  530

Query  615   KYGGEPFFVPRNPNSEK---EDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRV  445
             ++GGEP FVP +  +     EDDG+ILSFVHDE+   SEL +VNA ++ L AT++LPSRV
Sbjct  531   RFGGEPCFVPMDAAAATPRGEDDGYILSFVHDERAGTSELLVVNAADMRLEATVQLPSRV  590

Query  444   PYGFHGTFITSYDLQNQV  391
             PYGFHGTFIT  +L  Q 
Sbjct  591   PYGFHGTFITGDELTTQA  608



>gb|AEK07906.1| 9-cis-epoxycarotenoid dioxygenase [Pyrus pyrifolia]
Length=429

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/429 (79%), Positives = 375/429 (87%), Gaps = 1/429 (0%)
 Frame = -2

Query  1680  FDGDGMVHAVTITGGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFY  1501
             FDGDGMVHAV+I  GS SY+CRFTET+RLVQER +GRPVFPKAIGELHGHSG+ARLLLF+
Sbjct  1     FDGDGMVHAVSIDSGSASYACRFTETQRLVQEREMGRPVFPKAIGELHGHSGIARLLLFF  60

Query  1500  ARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQL  1321
             ARG  GL+D   GTG+ANAGLVY NGRLLAMSEDDLPYHVRV  SGDLETVGRYDF+ QL
Sbjct  61    ARGALGLLDKNHGTGVANAGLVYHNGRLLAMSEDDLPYHVRVTKSGDLETVGRYDFDSQL  120

Query  1320  KSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAI  1141
              STMIAHPKVDPESG   ALSYDV+QKPYLKYF+   +G KSPDVEIPL  PTM+HDFAI
Sbjct  121   GSTMIAHPKVDPESGSLHALSYDVVQKPYLKYFHFSPNGAKSPDVEIPLAGPTMMHDFAI  180

Query  1140  TENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCF  961
             TENYV+IPDQQVVFKL +MI GGS VIY+K K SRFGILKK A NA+ IIWV+SP+TFCF
Sbjct  181   TENYVVIPDQQVVFKLGDMITGGSPVIYDKSKMSRFGILKKNADNADDIIWVDSPDTFCF  240

Query  960   HLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPAT  781
             HLWNAWEE E+DE+VVIGSCMTPPDSIFNEC+ENLKS+LSEIRLNLKTGES +R I+  +
Sbjct  241   HLWNAWEEPESDEVVVIGSCMTPPDSIFNECDENLKSVLSEIRLNLKTGESNRRAILSES  300

Query  780   DQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGE  601
             D  VNLEAGMVNRNLLGRKT++AYLAIAEPWPKVSGFAKVDLSTGE++KF YG+  YGGE
Sbjct  301   D-DVNLEAGMVNRNLLGRKTRFAYLAIAEPWPKVSGFAKVDLSTGEVKKFFYGEKMYGGE  359

Query  600   PFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTF  421
             PFFVP       EDDG+IL+FVHDEK WKSELQIVNA+N++L AT+KLPSRVPYGFHGTF
Sbjct  360   PFFVPSTEEGASEDDGYILTFVHDEKNWKSELQIVNAVNMKLEATVKLPSRVPYGFHGTF  419

Query  420   ITSYDLQNQ  394
             I   DL NQ
Sbjct  420   IEWKDLVNQ  428



>gb|AEK99289.1| 9-cis-epoxycarotenoid dioxygenase [Cucumis melo]
Length=428

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/429 (79%), Positives = 380/429 (89%), Gaps = 3/429 (1%)
 Frame = -2

Query  1674  GDGMVHAVTIT-GGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYA  1498
             GDGMVHAV  +  G VSY+CRFTET+RLVQER  GRPVFPKAIGELHGHSG+ARL+LFYA
Sbjct  1     GDGMVHAVEFSEAGGVSYACRFTETQRLVQERAYGRPVFPKAIGELHGHSGIARLMLFYA  60

Query  1497  RGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLK  1318
             RGLFGLVDH +G G+ANAGLVYFNGRLLAMSEDDLPY +RV P+GDL+TVGR+DF+ QLK
Sbjct  61    RGLFGLVDHNQGIGVANAGLVYFNGRLLAMSEDDLPYQIRVTPAGDLKTVGRFDFDGQLK  120

Query  1317  STMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAIT  1138
             STMIAHPK+DP SGE FALSYDVIQKPYLKYF     GEKSPDVEIPL  PTM+HDFAIT
Sbjct  121   STMIAHPKLDPVSGEMFALSYDVIQKPYLKYFKFSPEGEKSPDVEIPLPQPTMMHDFAIT  180

Query  1137  ENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFH  958
             E YV+IPDQQVVFKL EMIRGGS V+Y+K+K SRFGIL K A +A  I W+E+P+ FCFH
Sbjct  181   EKYVVIPDQQVVFKLPEMIRGGSPVVYDKEKTSRFGILDKNAADANAIKWIEAPDCFCFH  240

Query  957   LWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATD  778
             LWNAWEE ET+EIVVIGSCMTPPDSIFNECEENLKS+LSEIRLNL TG+ST+RPII  T 
Sbjct  241   LWNAWEEPETNEIVVIGSCMTPPDSIFNECEENLKSVLSEIRLNLSTGKSTRRPIISET-  299

Query  777   QQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEP  598
             +QVNLEAGMVNRNLLGRKTQ++YLA+AEPWPKVSGFAKVDL TGE++K++YG+ +YGGEP
Sbjct  300   EQVNLEAGMVNRNLLGRKTQFSYLALAEPWPKVSGFAKVDLFTGEIKKYLYGEQRYGGEP  359

Query  597   FFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFI  418
              F+PR   +E EDDGHIL+FVHDEK WKSELQIVNA+ LEL AT+KLPSRVPYGFHGTFI
Sbjct  360   LFLPRE-GAEAEDDGHILAFVHDEKEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFI  418

Query  417   TSYDLQNQV  391
             +S DLQ Q+
Sbjct  419   SSEDLQKQI  427



>dbj|BAN15740.1| 9-cis-epoxy-carotenoid dioxygenase [Dianthus caryophyllus]
Length=589

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/496 (69%), Positives = 400/496 (81%), Gaps = 2/496 (0%)
 Frame = -2

Query  1875  SRELQRPLPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPK  1696
             S E   PLPK+ DP +QI+GNFAPVPE  V +NLPV G +P CI G YVRNGANPL +P 
Sbjct  95    SWESSTPLPKSSDPVIQISGNFAPVPEHPVTHNLPVTGQIPKCIKGAYVRNGANPLHQPL  154

Query  1695  AGHHLFDGDGMVHAVTIT-GGSVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLA  1519
             AGHHLFDGDGM+H V     GS SY+CRFTET RLVQER LGRP+FPK+IGELHGH GL 
Sbjct  155   AGHHLFDGDGMIHTVHFHPDGSASYACRFTETNRLVQERELGRPIFPKSIGELHGHCGLG  214

Query  1518  RLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRY  1339
             RL+L Y R L GL+DH +G G+ANAG+V+FNGRLLAMSEDD+PY VRV  +GDL+T GR+
Sbjct  215   RLMLLYTRSLLGLLDHDKGIGVANAGVVFFNGRLLAMSEDDVPYQVRVTSTGDLKTEGRF  274

Query  1338  DFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTM  1159
             DF+  LKS+MIAHPK+DP +GE F LSYDVI+KPYLKYF V S G KS DV++ L+  TM
Sbjct  275   DFDGHLKSSMIAHPKIDPSTGELFGLSYDVIKKPYLKYFRVNSEGVKSADVDVELETATM  334

Query  1158  IHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVES  979
             +HDFAITEN V+IPD QVVFK+ EMIRGGS V+Y+ +K SRFGIL K A+NA+ I W E 
Sbjct  335   VHDFAITENCVVIPDGQVVFKMHEMIRGGSPVVYDNEKTSRFGILPKYAENADSIEWNEV  394

Query  978   PETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKR  799
             PE FCFHL NAWEE ET+E+VVIGS MT  DSIFNEC+E+L  ILSEIR N  TG+ST+R
Sbjct  395   PECFCFHLRNAWEEPETNEMVVIGSSMTLADSIFNECDESLSKILSEIRENRTTGKSTRR  454

Query  798   PIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGD  619
              I+  +D Q+NLEAGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL TGE+ K+ YG 
Sbjct  455   EILSGSD-QMNLEAGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVSKYFYGG  513

Query  618   GKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPY  439
              KYGGEP F+P   N + E++GHIL+FVHDEK W SELQIVNA+ ++L+AT++LPSRVPY
Sbjct  514   EKYGGEPLFLPCGENVDSEEEGHILAFVHDEKNWTSELQIVNAVTMDLVATVQLPSRVPY  573

Query  438   GFHGTFITSYDLQNQV  391
             GFHGTFIT  DL  QV
Sbjct  574   GFHGTFITDQDLLTQV  589



>gb|AAK00632.1| 9-cis-epoxycarotenoid dioxygenase [Persea americana]
Length=569

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/521 (69%), Positives = 427/521 (82%), Gaps = 5/521 (1%)
 Frame = -2

Query  1950  PSQPKWNllqravaaaldvaegalVSRELQR--PLPKTWDPGVQIAGNFAPVPEQAVRNN  1777
             P++ KWN  QRA A ALD  E + +S  L+R  PLPKT DP VQI+GNFAPV E  V+++
Sbjct  51    PNRAKWNFFQRAAAVALDTVEDSFISGVLERRHPLPKTSDPAVQISGNFAPVDEHPVQHH  110

Query  1776  LPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVSYSCRFTETER  1597
             LPV G +P C++GVY+RNGANPL  P AGHH FDGDGMVH+V++  G+ SY+CRFTET R
Sbjct  111   LPVSGRIPRCLDGVYLRNGANPLLEPVAGHHFFDGDGMVHSVSLRQGTASYACRFTETHR  170

Query  1596  LVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLANAGLVYFNGRL  1417
             LVQER +GRPVFPKAIGELHGHSG+ARLLLFYAR   GLVD   GTG+A AGLVYFN  L
Sbjct  171   LVQERAIGRPVFPKAIGELHGHSGIARLLLFYARTATGLVDGSSGTGVATAGLVYFNRHL  230

Query  1416  LAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFFALSYDVIQKP  1237
             LAMSEDDLPYHVRV  SGDLETVGR+DF  QL S MIAHPK+DP SGE FALSY+VI+KP
Sbjct  231   LAMSEDDLPYHVRVTSSGDLETVGRFDFMGQLNSAMIAHPKLDPASGELFALSYNVIKKP  290

Query  1236  YLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQEMIRGGSCVIY  1057
             +LK+F   S G+KSPDVEIP+D PTMIHDF ITEN+VIIPDQQVVFKLQEMIRGGS V+Y
Sbjct  291   FLKFFKFTSDGKKSPDVEIPIDQPTMIHDFVITENFVIIPDQQVVFKLQEMIRGGSPVVY  350

Query  1056  EKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIF  877
             +KKK +RFGIL KTA ++ G+ W+++P+ FCFHLW AWEE ETD++VVIGSCMTPPDSIF
Sbjct  351   DKKKTARFGILLKTAADSNGLRWIDAPDCFCFHLWTAWEEPETDQVVVIGSCMTPPDSIF  410

Query  876   NECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIA  697
             NE  ++LKS+L+EIRLNLKTG S++R I P+  + +NLE GMVNRN LGR    +  +  
Sbjct  411   NESNQSLKSVLTEIRLNLKTGLSSRREIDPS--RHLNLEVGMVNRNRLGRGPGVSLSSHC  468

Query  696   EPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHILSFVHDEKTW  517
              PWPKVSGFAKVDLSTGE+ KF+YG+  YGGEP+FV R+P +  EDDG++LSF+HDEKT 
Sbjct  469   RPWPKVSGFAKVDLSTGEVTKFIYGEQCYGGEPYFVSRDPVA-PEDDGYVLSFMHDEKTA  527

Query  516   KSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQ  394
             +SEL IVNAI ++L A++KLPSRVPYGFHGTFI+S DL NQ
Sbjct  528   RSELLIVNAITMQLEASVKLPSRVPYGFHGTFISSKDLANQ  568



>ref|XP_003561898.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase 1, chloroplastic-like 
[Brachypodium distachyon]
Length=599

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/498 (68%), Positives = 407/498 (82%), Gaps = 7/498 (1%)
 Frame = -2

Query  1866  LQRP--LPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKA  1693
             L++P  L +T DP VQIAGNFAPV E     +LPV G +P  INGVY RNGANP F P A
Sbjct  103   LEKPHGLSRTVDPAVQIAGNFAPVGETPPVQSLPVSGRIPPFINGVYARNGANPHFDPVA  162

Query  1692  GHHLFDGDGMVHAVTITGG-SVSYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             GHHLFDGDGMVHA+ I  G + +Y+ RFT+TERL QER LGRP+FPKAIGELHGHSG+AR
Sbjct  163   GHHLFDGDGMVHALRIRNGVAETYASRFTDTERLRQERALGRPMFPKAIGELHGHSGIAR  222

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L LFYAR   GLVD  RGTG+ANAGLVYFNG LLAMSEDD+PYHVRV  +GDL+TVGRYD
Sbjct  223   LALFYARSACGLVDPSRGTGVANAGLVYFNGHLLAMSEDDIPYHVRVTEAGDLQTVGRYD  282

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL+  MIAHPK+DP +G+  ALSYDVI+KPYLKYF   + G KS DVEIPLD PTMI
Sbjct  283   FDGQLECPMIAHPKLDPATGQLHALSYDVIKKPYLKYFYFAADGTKSADVEIPLDQPTMI  342

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V++PD QVVFKLQEM+RGGS V+ +K+K SRFG+L K A +A  ++WV+ P
Sbjct  343   HDFAITENFVVVPDHQVVFKLQEMLRGGSPVVLDKEKTSRFGVLPKCAADASEMVWVDVP  402

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEE +TDE+VVIGSCMTP DSIFNE +E L+S+L+EIRLN +TGEST+RP
Sbjct  403   DCFCFHLWNAWEEEDTDEVVVIGSCMTPADSIFNESDECLESVLTEIRLNTRTGESTRRP  462

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             I+ A  QQVNLE GMVN  LLGRKT+YAYLA+AEPWPKVSGFAKVDL+TGE+ KF YG+G
Sbjct  463   IL-APSQQVNLEVGMVNSTLLGRKTRYAYLAVAEPWPKVSGFAKVDLATGELTKFDYGEG  521

Query  615   KYGGEPFFVPRNPNSEK---EDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRV  445
             ++GGEP FVP +P +     EDDG+IL+FVHDE+   SEL +VNA ++ L ATI+LPSRV
Sbjct  522   RFGGEPCFVPMDPAAASPRGEDDGYILTFVHDERAGTSELLVVNAADMRLEATIQLPSRV  581

Query  444   PYGFHGTFITSYDLQNQV  391
             PYGFHGTF+ + +L++Q 
Sbjct  582   PYGFHGTFVKASELESQA  599



>ref|XP_004986352.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase 1, chloroplastic-like 
[Setaria italica]
Length=629

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/494 (70%), Positives = 403/494 (82%), Gaps = 7/494 (1%)
 Frame = -2

Query  1866  LQRP--LPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKA  1693
             L+RP  LP+T DP VQIAGNFAPV E+     LPV G +P  INGVY RNGANP F P A
Sbjct  115   LERPHGLPRTADPAVQIAGNFAPVGERPPTRELPVTGRIPPFINGVYARNGANPSFDPVA  174

Query  1692  GHHLFDGDGMVHAVTITGGSV-SYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             GHHLFDGDGMVHA+ I  G+  SY+CRFTET RL QE  +GRPVFPKAIGELHGHSG+AR
Sbjct  175   GHHLFDGDGMVHALRIRNGAAESYACRFTETARLRQELAIGRPVFPKAIGELHGHSGIAR  234

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L LFYAR   GLVD   GTG+ANAGLVYFNG LLAMSEDDLPYHVRV   GDLETVGRYD
Sbjct  235   LALFYARAACGLVDPSHGTGVANAGLVYFNGHLLAMSEDDLPYHVRVTDGGDLETVGRYD  294

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL   MIAHPK+DP +GE  ALSYDVI+KPYL+YF  +  G KS DVEIPLD PTMI
Sbjct  295   FDGQLGCAMIAHPKLDPATGELHALSYDVIKKPYLRYFYFRPDGTKSDDVEIPLDQPTMI  354

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITEN+V++PD QVVFKLQEM+RGGS V+ +K+K SRFG+L K AK+A  + WV+ P
Sbjct  355   HDFAITENFVVVPDHQVVFKLQEMLRGGSPVVLDKEKTSRFGVLPKHAKDASEMAWVDVP  414

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWE+ ET EIVVIGSCMTP DSIFNE +E+L+S+L+EIRL+ +TG ST+R 
Sbjct  415   DCFCFHLWNAWEDEETGEIVVIGSCMTPADSIFNESDEHLESVLTEIRLDTRTGRSTRRA  474

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             I+P + QQVNLE GMVNRNLLGRKT+YAYLA+AEPWPKVSGFAKVDL+TGEM KF YGDG
Sbjct  475   ILPPS-QQVNLEVGMVNRNLLGRKTRYAYLAVAEPWPKVSGFAKVDLATGEMTKFEYGDG  533

Query  615   KYGGEPFFVPRNPNSEK---EDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRV  445
             ++GGEP FVP +P +     EDDG++L+FVHDE+   SEL +VNA ++ L AT++LPSRV
Sbjct  534   RFGGEPCFVPMDPAAAHPRGEDDGYVLTFVHDERAGTSELLVVNAADMRLEATVQLPSRV  593

Query  444   PYGFHGTFITSYDL  403
             P+GFHGTFIT+ +L
Sbjct  594   PFGFHGTFITANEL  607



>gb|EAY91193.1| hypothetical protein OsI_12802 [Oryza sativa Indica Group]
Length=608

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/498 (69%), Positives = 399/498 (80%), Gaps = 7/498 (1%)
 Frame = -2

Query  1866  LQRP--LPKTWDPGVQIAGNFAPVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKA  1693
             L+RP  LP T DP VQIAGNFAPV E      LPV G +P  INGVY RNGANP F P A
Sbjct  112   LERPHGLPSTADPAVQIAGNFAPVGETPPARALPVSGRIPPFINGVYARNGANPHFDPVA  171

Query  1692  GHHLFDGDGMVHAVTITGGSV-SYSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLAR  1516
             GHHLFDGDGMVHAV I  G+  SY+CRFTET RL QER +GRP+FPKAIGELHGHSG+AR
Sbjct  172   GHHLFDGDGMVHAVRIRNGAAESYACRFTETARLRQERAMGRPMFPKAIGELHGHSGIAR  231

Query  1515  LLLFYARGLFGLVDHRRGTGLANAGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYD  1336
             L LFYAR   GL+D   GTG+ANAGLVYFNGRLLAMSEDDLPY VRV    DLETVGRYD
Sbjct  232   LALFYARAACGLLDPSHGTGVANAGLVYFNGRLLAMSEDDLPYQVRVTADDDLETVGRYD  291

Query  1335  FNDQLKSTMIAHPKVDPESGEFFALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMI  1156
             F+ QL   MIAHPK+DP +GE  ALSYDVI+KPYLKYF     G KS DVEIPLD PTMI
Sbjct  292   FDGQLGCAMIAHPKLDPATGELHALSYDVIKKPYLKYFYFAPDGTKSADVEIPLDQPTMI  351

Query  1155  HDFAITENYVIIPDQQVVFKLQEMIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESP  976
             HDFAITENYV++PD QVVFKLQEM+RGGS V+ +K+K SRFG+L K A +A  ++WV+ P
Sbjct  352   HDFAITENYVVVPDHQVVFKLQEMLRGGSPVVLDKEKTSRFGVLPKHAADASEMVWVDVP  411

Query  975   ETFCFHLWNAWEEAETDEIVVIGSCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRP  796
             + FCFHLWNAWEEA+TDE+VVIGSCMTP DSIFNE ++ L+S+L+EIRLN +TGEST+  
Sbjct  412   DCFCFHLWNAWEEADTDEVVVIGSCMTPADSIFNESDDRLESVLTEIRLNTRTGESTRCA  471

Query  795   IIPATDQQVNLEAGMVNRNLLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDG  616
             I+P +  QVNLE GMVNRNLLGRKT+YAYLA+AEPWPKVSGFAKVDL+TGE+ KF YG+G
Sbjct  472   ILPPS-SQVNLEVGMVNRNLLGRKTRYAYLAVAEPWPKVSGFAKVDLATGELTKFEYGEG  530

Query  615   KYGGEPFFVPRNPNSEK---EDDGHILSFVHDEKTWKSELQIVNAINLELLATIKLPSRV  445
             ++GGEP FVP +  +     EDDG+ILSFVHDE+   SEL +VNA ++ L AT++LPSRV
Sbjct  531   RFGGEPCFVPMDAAAATPRGEDDGYILSFVHDERAGTSELLVVNAADMRLEATVQLPSRV  590

Query  444   PYGFHGTFITSYDLQNQV  391
             PYGFHGTFIT  +L  Q 
Sbjct  591   PYGFHGTFITGDELTTQA  608



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6537744259740