BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16963_g2_i1 len=1248 path=[1264:0-582 20:583-1247]

Length=1248
                                                                      Score     E

ref|XP_009793584.1|  PREDICTED: amino acid permease 6-like              536   0.0      
ref|XP_011074307.1|  PREDICTED: amino acid permease 6                   532   0.0      
gb|EYU36417.1|  hypothetical protein MIMGU_mgv1a005426mg                531   0.0      
emb|CDP00979.1|  unnamed protein product                                531   0.0      
ref|XP_010320244.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    530   0.0      
ref|XP_010061591.1|  PREDICTED: amino acid permease 6-like              530   0.0      
emb|CAA70968.2|  amino acid transporter                                 527   0.0      Solanum tuberosum [potatoes]
gb|EYU34219.1|  hypothetical protein MIMGU_mgv1a005305mg                525   1e-180   
emb|CDP00978.1|  unnamed protein product                                523   7e-180   
ref|XP_009629042.1|  PREDICTED: amino acid permease 6-like              517   1e-177   
ref|XP_010245602.1|  PREDICTED: amino acid permease 6                   514   1e-176   
ref|XP_009127448.1|  PREDICTED: amino acid permease 6                   513   3e-176   
ref|XP_010440833.1|  PREDICTED: amino acid permease 6-like              513   5e-176   
emb|CAD92450.1|  amino acid permease 6                                  512   7e-176   Brassica napus [oilseed rape]
ref|XP_007018375.1|  Amino acid permease 6                              512   8e-176   
gb|KDP41551.1|  hypothetical protein JCGZ_15958                         512   1e-175   
ref|XP_010442428.1|  PREDICTED: amino acid permease 6                   512   1e-175   
ref|XP_011078457.1|  PREDICTED: amino acid permease 6-like              511   2e-175   
ref|XP_010482241.1|  PREDICTED: amino acid permease 6-like isofor...    511   2e-175   
ref|NP_001242816.1|  uncharacterized protein LOC100777963               511   2e-175   
gb|KHN08198.1|  Amino acid permease 6                                   511   2e-175   
ref|XP_003526513.1|  PREDICTED: amino acid permease 6-like              511   2e-175   
ref|XP_007222665.1|  hypothetical protein PRUPE_ppa004980mg             511   3e-175   
ref|XP_008219153.1|  PREDICTED: amino acid permease 6-like              510   6e-175   
ref|XP_006280391.1|  hypothetical protein CARUB_v10026318mg             509   9e-175   
gb|KEH36106.1|  transmembrane amino acid transporter family protein     505   1e-174   
ref|XP_009335480.1|  PREDICTED: amino acid permease 6-like              509   2e-174   
gb|KHN37208.1|  Amino acid permease 6                                   508   3e-174   
ref|XP_010556498.1|  PREDICTED: amino acid permease 6                   508   4e-174   
ref|XP_003603665.1|  Amino acid permease                                508   6e-174   
gb|AFK42490.1|  unknown                                                 507   7e-174   
ref|XP_002285557.1|  PREDICTED: amino acid permease 6                   506   2e-173   Vitis vinifera
ref|XP_010667459.1|  PREDICTED: amino acid permease 6-like              505   9e-173   
ref|XP_002510013.1|  amino acid transporter, putative                   504   1e-172   Ricinus communis
ref|XP_004136237.1|  PREDICTED: amino acid permease 6-like              503   5e-172   
ref|XP_004501076.1|  PREDICTED: amino acid permease 6-like              503   5e-172   
ref|XP_009357221.1|  PREDICTED: amino acid permease 6-like              502   6e-172   
ref|XP_003588450.1|  Amino acid transporter                             500   4e-171   
ref|XP_010104540.1|  hypothetical protein L484_025514                   500   5e-171   
ref|XP_008339056.1|  PREDICTED: amino acid permease 6                   498   4e-170   
ref|XP_002865746.1|  hypothetical protein ARALYDRAFT_495022             498   7e-170   
ref|XP_004299846.1|  PREDICTED: amino acid permease 6-like              497   9e-170   
ref|XP_007161529.1|  hypothetical protein PHAVU_001G077000g             496   1e-169   
gb|ADB92670.1|  amino acid permease 6                                   496   1e-169   
emb|CDY46779.1|  BnaCnng14480D                                          496   2e-169   
ref|XP_004498452.1|  PREDICTED: amino acid permease 6-like              495   2e-169   
ref|XP_011017028.1|  PREDICTED: amino acid permease 6-like              496   3e-169   
ref|NP_199774.1|  amino acid permease 6                                 495   6e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007137276.1|  hypothetical protein PHAVU_009G113800g             493   3e-168   
gb|KHG24473.1|  Amino acid permease 6 -like protein                     492   8e-168   
gb|KDO81357.1|  hypothetical protein CISIN_1g011548mg                   482   4e-166   
ref|XP_010064702.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    488   4e-166   
ref|XP_003550117.1|  PREDICTED: amino acid permease 6                   486   6e-166   
ref|XP_009148321.1|  PREDICTED: amino acid permease 8                   486   2e-165   
ref|XP_006417504.1|  hypothetical protein EUTSA_v10007516mg             485   3e-165   
ref|XP_010553668.1|  PREDICTED: amino acid permease 1-like              484   1e-164   
ref|XP_010458325.1|  PREDICTED: amino acid permease 8                   483   1e-164   
ref|XP_006433701.1|  hypothetical protein CICLE_v10000981mg             483   3e-164   
ref|NP_172472.1|  amino acid permease 8                                 483   3e-164   Arabidopsis thaliana [mouse-ear cress]
gb|KDO81356.1|  hypothetical protein CISIN_1g011548mg                   482   6e-164   
ref|XP_010314596.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    481   1e-163   
ref|NP_176132.1|  amino acid permease 1                                 481   1e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888218.1|  hypothetical protein ARALYDRAFT_893658             480   3e-163   
ref|XP_002301129.2|  amino acid transport protein AAP2                  480   3e-163   Populus trichocarpa [western balsam poplar]
gb|AAB87674.1|  neutral amino acid transport system II                  480   4e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102845.1|  PREDICTED: amino acid permease 1                   480   4e-163   
ref|XP_010490519.1|  PREDICTED: amino acid permease 8-like              479   5e-163   
ref|XP_006472367.1|  PREDICTED: amino acid permease 6-like              479   6e-163   
ref|XP_010943299.1|  PREDICTED: amino acid permease 6                   475   2e-161   
ref|XP_010268969.1|  PREDICTED: amino acid permease 6-like isofor...    471   3e-161   
emb|CAD92449.1|  amino acid permease 1                                  475   3e-161   Brassica napus [oilseed rape]
ref|XP_006392303.1|  hypothetical protein EUTSA_v10023431mg             474   6e-161   
ref|XP_010269102.1|  PREDICTED: amino acid permease 6-like              473   1e-160   
ref|XP_009138576.1|  PREDICTED: amino acid permease 1-like              474   1e-160   
ref|XP_006302194.1|  hypothetical protein CARUB_v10020203mg             474   1e-160   
ref|XP_002889785.1|  hypothetical protein ARALYDRAFT_471112             473   3e-160   
ref|XP_010269103.1|  PREDICTED: amino acid permease 6-like              472   4e-160   
emb|CDY04349.1|  BnaC04g18440D                                          472   6e-160   
ref|XP_006306441.1|  hypothetical protein CARUB_v10012383mg             471   7e-160   
gb|KFK40897.1|  hypothetical protein AALP_AA2G057600                    471   1e-159   
ref|XP_009113317.1|  PREDICTED: amino acid permease 1                   472   2e-159   
gb|KFK43300.1|  hypothetical protein AALP_AA1G106400                    467   2e-159   
ref|XP_010268968.1|  PREDICTED: amino acid permease 6-like isofor...    470   2e-159   
ref|XP_010268971.1|  PREDICTED: amino acid permease 6-like              469   3e-159   
emb|CDY04448.1|  BnaA03g59400D                                          470   3e-158   
emb|CDY60248.1|  BnaC01g42990D                                          467   9e-158   
emb|CDY44564.1|  BnaA01g21750D                                          467   1e-157   
ref|XP_004955421.1|  PREDICTED: amino acid permease 6-like              466   2e-157   
ref|XP_008801682.1|  PREDICTED: amino acid permease 6                   465   2e-157   
ref|XP_010470262.1|  PREDICTED: amino acid permease 1                   465   3e-157   
ref|XP_010414737.1|  PREDICTED: amino acid permease 1-like              464   1e-156   
ref|XP_006657428.1|  PREDICTED: amino acid permease 6-like              462   4e-156   
ref|XP_006417505.1|  hypothetical protein EUTSA_v10009701mg             461   4e-156   
gb|EEC81471.1|  hypothetical protein OsI_24794                          461   8e-156   Oryza sativa Indica Group [Indian rice]
ref|XP_002889784.1|  hypothetical protein ARALYDRAFT_888258             460   4e-155   
ref|XP_006346279.1|  PREDICTED: amino acid permease 6-like              458   9e-155   
ref|XP_009118279.1|  PREDICTED: amino acid permease 8-like              459   1e-154   
dbj|BAJ85485.1|  predicted protein                                      458   2e-154   
ref|XP_002461426.1|  hypothetical protein SORBIDRAFT_02g002440          458   2e-154   Sorghum bicolor [broomcorn]
ref|NP_001058839.1|  Os07g0134000                                       457   3e-154   Oryza sativa Japonica Group [Japonica rice]
emb|CDY53793.1|  BnaCnng25620D                                          457   3e-154   
emb|CDY48843.1|  BnaA09g14700D                                          457   3e-154   
gb|EEE66520.1|  hypothetical protein OsJ_22995                          457   3e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010490563.1|  PREDICTED: amino acid permease 8-like isofor...    456   5e-154   
ref|NP_001233983.1|  amino acid transporter                             456   8e-154   
ref|XP_010490547.1|  PREDICTED: amino acid permease 8-like isofor...    455   1e-153   
ref|XP_003557617.1|  PREDICTED: amino acid permease 6                   456   1e-153   
gb|KFK43301.1|  hypothetical protein AALP_AA1G106500                    456   1e-153   
ref|XP_010475859.1|  PREDICTED: amino acid permease 8-like              455   1e-153   
ref|XP_006487060.1|  PREDICTED: amino acid permease 6-like              452   2e-152   
gb|EYU39084.1|  hypothetical protein MIMGU_mgv1a018317mg                451   3e-152   
emb|CDY53831.1|  BnaA09g57230D                                          451   7e-152   
gb|KEH43993.1|  transmembrane amino acid transporter family protein     451   7e-152   
ref|XP_009148319.1|  PREDICTED: amino acid permease 8-like              450   2e-151   
ref|XP_011002369.1|  PREDICTED: amino acid permease 6-like              450   2e-151   
ref|XP_010475860.1|  PREDICTED: amino acid permease 8-like              450   2e-151   
ref|XP_009792204.1|  PREDICTED: amino acid permease 6-like              449   2e-151   
ref|XP_010243490.1|  PREDICTED: amino acid permease 6-like              449   3e-151   
ref|XP_002313926.2|  hypothetical protein POPTR_0009s08840g             449   4e-151   Populus trichocarpa [western balsam poplar]
emb|CDY22609.1|  BnaC08g42430D                                          449   7e-151   
ref|XP_009627462.1|  PREDICTED: amino acid permease 6-like              447   2e-150   
emb|CDY62727.1|  BnaC05g49200D                                          447   2e-150   
gb|EMS56484.1|  hypothetical protein TRIUR3_26560                       455   4e-150   
emb|CAA72006.1|  amino acid carrier                                     439   7e-150   Ricinus communis
ref|XP_009118276.1|  PREDICTED: amino acid permease 8-like isofor...    445   1e-149   
tpg|DAA59488.1|  TPA: hypothetical protein ZEAMMB73_156584              446   1e-149   
ref|XP_009118275.1|  PREDICTED: amino acid permease 8-like isofor...    445   2e-149   
ref|XP_006307429.1|  hypothetical protein CARUB_v10009053mg             444   3e-149   
gb|EYU39081.1|  hypothetical protein MIMGU_mgv1a023099mg                443   6e-149   
ref|NP_001136620.1|  uncharacterized protein LOC100216745               443   1e-148   Zea mays [maize]
ref|XP_004497265.1|  PREDICTED: amino acid permease 6-like              442   1e-148   
ref|XP_009397328.1|  PREDICTED: amino acid permease 6                   442   2e-148   
ref|XP_008789212.1|  PREDICTED: amino acid permease 8-like              442   2e-148   
ref|XP_009118277.1|  PREDICTED: amino acid permease 8-like isofor...    441   5e-148   
ref|XP_009118278.1|  PREDICTED: amino acid permease 8-like              441   7e-148   
emb|CDY57931.1|  BnaA06g38000D                                          440   7e-148   
ref|XP_002522103.1|  amino acid transporter, putative                   439   1e-147   Ricinus communis
emb|CDO97307.1|  unnamed protein product                                437   2e-147   
gb|KEH43994.1|  transmembrane amino acid transporter family protein     439   2e-147   
gb|KCW68582.1|  hypothetical protein EUGRSUZ_F02192                     439   3e-147   
emb|CDY62728.1|  BnaC05g49210D                                          439   4e-147   
gb|KEH43995.1|  transmembrane amino acid transporter family protein     437   1e-146   
ref|XP_004515440.1|  PREDICTED: amino acid permease 6-like              437   2e-146   
ref|XP_010250334.1|  PREDICTED: amino acid permease 4-like              438   7e-146   
emb|CDY57932.1|  BnaA06g38010D                                          434   2e-145   
dbj|BAC82953.1|  putative amino acid permease                           434   3e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009148320.1|  PREDICTED: amino acid permease 8-like              434   3e-145   
emb|CDY22607.1|  BnaC08g42410D                                          434   4e-145   
ref|XP_010915382.1|  PREDICTED: amino acid permease 1-like              434   5e-145   
ref|XP_010322323.1|  PREDICTED: amino acid transporter isoform X1       433   5e-145   
ref|XP_006365537.1|  PREDICTED: amino acid permease 3-like              433   9e-145   
ref|XP_004496860.1|  PREDICTED: amino acid permease 6-like              432   1e-144   
ref|XP_003535676.1|  PREDICTED: amino acid permease 6-like              432   1e-144   
ref|XP_007042690.1|  Amino acid permease 1                              431   4e-144   
gb|AAD16013.1|  amino acid transporter                                  427   6e-144   Nepenthes alata
ref|NP_001234606.1|  amino acid transporter                             430   1e-143   
ref|XP_006852747.1|  hypothetical protein AMTR_s00033p00113090          430   1e-143   
gb|KHG12273.1|  Amino acid permease 6 -like protein                     429   2e-143   
emb|CDY22608.1|  BnaC08g42420D                                          430   4e-143   
ref|NP_001057853.1|  Os06g0556000                                       427   1e-142   Oryza sativa Japonica Group [Japonica rice]
gb|EYU39082.1|  hypothetical protein MIMGU_mgv1a020135mg                427   1e-142   
emb|CDP08191.1|  unnamed protein product                                427   2e-142   
gb|ABR18002.1|  unknown                                                 427   3e-142   Picea sitchensis
gb|KEH43996.1|  transmembrane amino acid transporter family protein     426   3e-142   
ref|XP_003568418.2|  PREDICTED: amino acid permease 3-like isofor...    426   4e-142   
ref|XP_010231354.1|  PREDICTED: amino acid permease 3-like isofor...    426   4e-142   
ref|XP_002307053.2|  hypothetical protein POPTR_0005s06990g             426   6e-142   Populus trichocarpa [western balsam poplar]
ref|XP_006382883.1|  amino acid permease AAP1 family protein            426   7e-142   
ref|XP_010270272.1|  PREDICTED: amino acid permease 3                   426   7e-142   
dbj|BAJ95327.1|  predicted protein                                      426   8e-142   
emb|CDM85443.1|  unnamed protein product                                426   8e-142   
gb|EYU20407.1|  hypothetical protein MIMGU_mgv1a018639mg                425   1e-141   
ref|XP_002439825.1|  hypothetical protein SORBIDRAFT_09g020790          425   2e-141   Sorghum bicolor [broomcorn]
emb|CDM85442.1|  unnamed protein product                                424   2e-141   
dbj|BAK03421.1|  predicted protein                                      424   2e-141   
ref|XP_004962032.1|  PREDICTED: amino acid permease 3-like isofor...    425   2e-141   
ref|XP_010691537.1|  PREDICTED: amino acid permease 6-like              424   5e-141   
ref|XP_011031113.1|  PREDICTED: amino acid permease 4-like isofor...    424   6e-141   
ref|XP_009801366.1|  PREDICTED: amino acid permease 3-like              423   6e-141   
ref|XP_009388107.1|  PREDICTED: amino acid permease 3-like              423   7e-141   
ref|XP_009609434.1|  PREDICTED: amino acid permease 3-like              423   8e-141   
ref|XP_009411898.1|  PREDICTED: amino acid permease 3-like isofor...    422   1e-140   
ref|XP_006656161.1|  PREDICTED: amino acid permease 1-like              422   1e-140   
ref|XP_007048506.1|  Amino acid permease 2 isoform 1                    422   1e-140   
ref|XP_009411897.1|  PREDICTED: amino acid permease 3-like isofor...    422   2e-140   
ref|XP_002520323.1|  amino acid transporter, putative                   422   2e-140   Ricinus communis
ref|XP_002458869.1|  hypothetical protein SORBIDRAFT_03g041840          422   2e-140   Sorghum bicolor [broomcorn]
gb|AII99817.1|  amino acid transporter                                  421   3e-140   
ref|XP_002437146.1|  hypothetical protein SORBIDRAFT_10g021980          422   3e-140   Sorghum bicolor [broomcorn]
ref|XP_009767545.1|  PREDICTED: amino acid permease 3-like              421   3e-140   
ref|XP_009381189.1|  PREDICTED: amino acid permease 3-like              421   4e-140   
ref|XP_010095435.1|  hypothetical protein L484_013392                   421   4e-140   
emb|CDY21569.1|  BnaC09g47230D                                          421   4e-140   
ref|NP_001142349.1|  hypothetical protein                               421   5e-140   Zea mays [maize]
ref|XP_008654977.1|  PREDICTED: amino acid carrier isoform X1           421   6e-140   
ref|XP_006380397.1|  hypothetical protein POPTR_0007s04710g             421   6e-140   
ref|XP_009377726.1|  PREDICTED: amino acid permease 3-like              421   6e-140   
ref|XP_010546306.1|  PREDICTED: amino acid permease 4 isoform X1        420   9e-140   
emb|CBI21586.3|  unnamed protein product                                417   1e-139   
ref|XP_010652912.1|  PREDICTED: amino acid permease 3 isoform X1        421   1e-139   
ref|XP_002275881.1|  PREDICTED: amino acid permease 3 isoform X2        420   1e-139   Vitis vinifera
ref|XP_006351135.1|  PREDICTED: amino acid permease 3-like              420   1e-139   
ref|XP_006434261.1|  hypothetical protein CICLE_v10000991mg             420   1e-139   
ref|XP_002520322.1|  amino acid transporter, putative                   420   1e-139   Ricinus communis
ref|XP_011022870.1|  PREDICTED: amino acid permease 4-like              420   1e-139   
emb|CDX69918.1|  BnaA10g22670D                                          420   2e-139   
ref|XP_010684694.1|  PREDICTED: amino acid permease 3-like              420   2e-139   
ref|XP_008338672.1|  PREDICTED: amino acid permease 3-like              419   2e-139   
ref|NP_001055592.1|  Os05g0424000                                       420   2e-139   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008799058.1|  PREDICTED: amino acid permease 3-like              419   2e-139   
ref|XP_010063933.1|  PREDICTED: amino acid permease 3-like              419   3e-139   
gb|AIL30502.1|  amino acid transporter                                  419   3e-139   
ref|XP_009122500.1|  PREDICTED: amino acid permease 2                   419   3e-139   
gb|AIS71894.1|  amino acid transporter                                  419   3e-139   
ref|XP_004290907.1|  PREDICTED: amino acid permease 3-like              419   3e-139   
ref|XP_009596720.1|  PREDICTED: amino acid permease 3-like isofor...    419   3e-139   
ref|XP_007143143.1|  hypothetical protein PHAVU_007G047400g             418   4e-139   
ref|XP_009596721.1|  PREDICTED: amino acid permease 3-like isofor...    418   5e-139   
emb|CAN61092.1|  hypothetical protein VITISV_005276                     418   5e-139   Vitis vinifera
ref|XP_003634405.1|  PREDICTED: amino acid permease 3                   418   5e-139   
ref|NP_001149036.1|  amino acid carrier                                 418   5e-139   Zea mays [maize]
gb|KFK42132.1|  hypothetical protein AALP_AA2G215300                    418   7e-139   
ref|XP_007222611.1|  hypothetical protein PRUPE_ppa004936mg             418   7e-139   
ref|XP_006432100.1|  hypothetical protein CICLE_v10000986mg             418   7e-139   
ref|XP_006464914.1|  PREDICTED: amino acid permease 2-like              418   8e-139   
ref|XP_007019168.1|  Amino acid permease isoform 2                      418   8e-139   
dbj|BAK03497.1|  predicted protein                                      418   8e-139   
ref|XP_011074825.1|  PREDICTED: amino acid permease 3-like              418   9e-139   
ref|XP_009414606.1|  PREDICTED: amino acid permease 3-like              418   1e-138   
ref|XP_007019167.1|  Amino acid permease isoform 1                      417   1e-138   
ref|XP_008219594.1|  PREDICTED: amino acid permease 3-like              417   2e-138   
ref|XP_010444306.1|  PREDICTED: amino acid permease 4-like              416   2e-138   
ref|XP_008658969.1|  PREDICTED: uncharacterized protein LOC100501...    417   2e-138   
ref|XP_009339426.1|  PREDICTED: amino acid permease 3-like              417   2e-138   
emb|CDY53832.1|  BnaA09g57240D                                          434   2e-138   
ref|XP_011031114.1|  PREDICTED: amino acid permease 4-like isofor...    417   3e-138   
gb|KDP32820.1|  hypothetical protein JCGZ_12112                         416   4e-138   
ref|XP_006399392.1|  hypothetical protein EUTSA_v10013363mg             416   4e-138   
ref|XP_010269036.1|  PREDICTED: amino acid permease 3-like              416   4e-138   
gb|KHG13110.1|  Amino acid permease 6 -like protein                     414   4e-138   
ref|XP_004965605.1|  PREDICTED: amino acid permease 6-like              416   5e-138   
emb|CAF22024.1|  amino acid permease                                    416   6e-138   Brassica napus [oilseed rape]
ref|XP_010537371.1|  PREDICTED: amino acid permease 3                   415   7e-138   
ref|NP_196484.1|  amino acid permease 2                                 416   1e-137   Arabidopsis thaliana [mouse-ear cress]
emb|CDX88364.1|  BnaC06g38080D                                          415   1e-137   
ref|XP_009106399.1|  PREDICTED: amino acid permease 3                   414   1e-137   
emb|CDX81121.1|  BnaC03g03750D                                          415   1e-137   
ref|XP_010491540.1|  PREDICTED: amino acid permease 2-like              415   1e-137   
dbj|BAJ93107.1|  predicted protein                                      416   2e-137   
emb|CDX87522.1|  BnaA07g33510D                                          414   2e-137   
ref|XP_010025744.1|  PREDICTED: amino acid permease 4-like              415   2e-137   
ref|XP_007222588.1|  hypothetical protein PRUPE_ppa004920mg             414   2e-137   
ref|XP_008810907.1|  PREDICTED: amino acid permease 3-like              414   2e-137   
ref|XP_008219591.1|  PREDICTED: amino acid permease 3-like isofor...    414   2e-137   
ref|XP_008219592.1|  PREDICTED: amino acid permease 3-like isofor...    414   2e-137   
emb|CDX78353.1|  BnaA03g02650D                                          414   2e-137   
ref|XP_010452897.1|  PREDICTED: amino acid permease 2                   415   2e-137   
ref|XP_008338673.1|  PREDICTED: amino acid permease 3-like              414   2e-137   
ref|XP_009131105.1|  PREDICTED: amino acid permease 2                   414   3e-137   
ref|NP_001233979.1|  amino acid transporter                             414   3e-137   
ref|XP_006390096.1|  hypothetical protein EUTSA_v10018484mg             414   3e-137   
ref|XP_010484145.1|  PREDICTED: amino acid permease 4                   413   3e-137   
ref|XP_009130275.1|  PREDICTED: amino acid permease 4                   413   3e-137   
ref|XP_007213109.1|  hypothetical protein PRUPE_ppa023539mg             414   3e-137   
ref|XP_002968812.1|  hypothetical protein SELMODRAFT_90661              413   4e-137   
ref|XP_011102300.1|  PREDICTED: amino acid permease 3 isoform X1        414   4e-137   
ref|XP_011102302.1|  PREDICTED: amino acid permease 3 isoform X2        414   4e-137   
emb|CDY39844.1|  BnaC02g42740D                                          413   5e-137   
ref|XP_011002449.1|  PREDICTED: amino acid permease 3-like              413   5e-137   
emb|CDY31348.1|  BnaA02g33930D                                          413   5e-137   
ref|XP_010668714.1|  PREDICTED: amino acid permease 8-like              413   5e-137   
gb|EYU23867.1|  hypothetical protein MIMGU_mgv1a005496mg                413   5e-137   
gb|KHG20963.1|  Amino acid permease 3 -like protein                     413   6e-137   
ref|XP_010423021.1|  PREDICTED: amino acid permease 2-like              413   6e-137   
gb|AAM62803.1|  amino acid carrier, putative                            412   8e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300985.1|  hypothetical protein CARUB_v10021374mg             412   1e-136   
ref|XP_006279782.1|  hypothetical protein CARUB_v10027867mg             412   1e-136   
ref|XP_010461080.1|  PREDICTED: amino acid permease 4-like              412   1e-136   
ref|XP_008227519.1|  PREDICTED: amino acid permease 4 isoform X2        412   1e-136   
ref|XP_008227518.1|  PREDICTED: amino acid permease 4 isoform X1        412   1e-136   
gb|AAM61320.1|  amino acid transporter AAP4                             411   1e-136   
ref|XP_010428816.1|  PREDICTED: amino acid permease 3                   412   2e-136   
ref|XP_009389175.1|  PREDICTED: amino acid permease 4-like              413   2e-136   
ref|XP_011081743.1|  PREDICTED: amino acid permease 8-like isofor...    412   2e-136   
gb|AAM13223.1|  amino acid transporter AAP4                             411   2e-136   
ref|NP_177862.1|  amino acid permease 3                                 411   2e-136   
emb|CAA54631.1|  amino acid transporter                                 411   2e-136   
gb|AAM61227.1|  amino acid transport protein AAP2                       412   2e-136   
ref|XP_004290905.1|  PREDICTED: amino acid permease 2-like              411   2e-136   
ref|XP_011081742.1|  PREDICTED: amino acid permease 8-like isofor...    412   2e-136   
ref|NP_201190.1|  amino acid permease 4                                 411   2e-136   
ref|NP_001067425.1|  Os11g0195600                                       411   3e-136   
ref|XP_011003419.1|  PREDICTED: amino acid permease 3-like              411   3e-136   
ref|XP_009390074.1|  PREDICTED: amino acid permease 4-like isofor...    412   3e-136   
ref|XP_009390075.1|  PREDICTED: amino acid permease 4-like isofor...    412   3e-136   
ref|XP_002871360.1|  hypothetical protein ARALYDRAFT_487723             412   3e-136   
ref|XP_008442173.1|  PREDICTED: amino acid permease 4-like              410   3e-136   
emb|CDP10973.1|  unnamed protein product                                410   4e-136   
ref|XP_002442923.1|  hypothetical protein SORBIDRAFT_08g004960          411   4e-136   
ref|XP_002974163.1|  hypothetical protein SELMODRAFT_100110             410   4e-136   
ref|XP_010471931.1|  PREDICTED: amino acid permease 3-like              410   5e-136   
ref|XP_010668697.1|  PREDICTED: amino acid permease 8-like isofor...    411   5e-136   
emb|CDX88365.1|  BnaC06g38090D                                          410   7e-136   
ref|XP_002864872.1|  hypothetical protein ARALYDRAFT_496573             410   7e-136   
ref|XP_010416679.1|  PREDICTED: amino acid permease 3-like              410   7e-136   
ref|XP_008679681.1|  PREDICTED: amino acid permease 3-like              410   7e-136   
ref|XP_006386354.1|  hypothetical protein POPTR_0002s07960g             410   8e-136   
ref|XP_004977211.1|  PREDICTED: amino acid permease 3-like              410   9e-136   
ref|XP_002302223.1|  hypothetical protein POPTR_0002s07960g             410   9e-136   
ref|XP_010674405.1|  PREDICTED: amino acid permease 4                   410   9e-136   
ref|XP_004978920.1|  PREDICTED: amino acid permease 3-like              409   1e-135   
ref|XP_011027479.1|  PREDICTED: amino acid permease 3-like isofor...    410   1e-135   
dbj|BAJ86012.1|  predicted protein                                      410   1e-135   
ref|XP_006287587.1|  hypothetical protein CARUB_v10000805mg             410   1e-135   
ref|XP_010920126.1|  PREDICTED: amino acid permease 4-like              410   1e-135   
gb|EMT28481.1|  hypothetical protein F775_18207                         409   1e-135   
dbj|BAK07020.1|  predicted protein                                      409   1e-135   
ref|NP_001140430.1|  hypothetical protein                               409   2e-135   
ref|XP_006386355.1|  amino acid permease which transports basic a...    409   2e-135   
ref|XP_003542145.1|  PREDICTED: amino acid permease 3 isoform X1        409   2e-135   
ref|XP_010063420.1|  PREDICTED: amino acid permease 3-like              409   2e-135   
gb|KGN47695.1|  hypothetical protein Csa_6G381850                       409   2e-135   
ref|XP_004149429.1|  PREDICTED: amino acid permease 3-like              409   3e-135   
ref|XP_010229892.1|  PREDICTED: amino acid permease 8-like              409   3e-135   
ref|XP_003630316.1|  Amino acid permease                                408   3e-135   
ref|XP_004977210.1|  PREDICTED: amino acid permease 3-like              409   3e-135   
ref|XP_010232650.1|  PREDICTED: amino acid permease 3-like              409   4e-135   
ref|XP_002889140.1|  hypothetical protein ARALYDRAFT_476902             408   4e-135   
ref|XP_008227520.1|  PREDICTED: amino acid permease 4 isoform X3        408   4e-135   
ref|XP_010028716.1|  PREDICTED: amino acid permease 4-like              409   5e-135   
emb|CBI21597.3|  unnamed protein product                                403   5e-135   
ref|XP_006394236.1|  hypothetical protein EUTSA_v10004152mg             407   5e-135   
dbj|BAJ91439.1|  predicted protein                                      408   5e-135   
ref|NP_001149517.1|  amino acid permease 1                              408   5e-135   
ref|XP_011019567.1|  PREDICTED: amino acid permease 8-like              408   5e-135   
ref|XP_002977532.1|  hypothetical protein SELMODRAFT_176236             409   5e-135   
ref|XP_002449174.1|  hypothetical protein SORBIDRAFT_05g006010          408   6e-135   
ref|XP_011099674.1|  PREDICTED: amino acid permease 2-like              408   6e-135   
ref|NP_001066317.1|  Os12g0181600                                       407   7e-135   
ref|XP_006654425.1|  PREDICTED: amino acid permease 3-like              408   8e-135   
ref|XP_002309530.2|  hypothetical protein POPTR_0006s25230g             408   9e-135   
ref|XP_004156002.1|  PREDICTED: amino acid permease 4-like              407   9e-135   
ref|XP_006366236.1|  PREDICTED: amino acid permease 3-like              407   1e-134   
ref|XP_009390766.1|  PREDICTED: amino acid permease 4-like              408   1e-134   
ref|XP_004977213.1|  PREDICTED: amino acid permease 3-like              407   1e-134   
ref|XP_006383588.1|  hypothetical protein POPTR_0005s20390g             407   1e-134   
dbj|BAO45885.1|  amino acid permease                                    407   1e-134   
gb|KHN19623.1|  Amino acid permease 3                                   407   1e-134   
ref|XP_006596218.1|  PREDICTED: amino acid permease 3-like isofor...    407   1e-134   
ref|XP_003578826.1|  PREDICTED: amino acid permease 3-like              407   1e-134   
emb|CAA70969.1|  amino acid transporter                                 403   2e-134   
ref|XP_006662801.1|  PREDICTED: amino acid permease 3-like              406   2e-134   
ref|XP_009150448.1|  PREDICTED: amino acid permease 4                   406   2e-134   
ref|XP_006386360.1|  hypothetical protein POPTR_0002s08040g             407   2e-134   
ref|XP_003578825.1|  PREDICTED: amino acid permease 4-like              406   2e-134   
ref|XP_010911284.1|  PREDICTED: amino acid permease 3-like isofor...    407   2e-134   
ref|XP_011027478.1|  PREDICTED: amino acid permease 3-like isofor...    407   2e-134   
ref|XP_010911278.1|  PREDICTED: amino acid permease 3-like isofor...    407   3e-134   
gb|KHG16478.1|  Amino acid permease 2 -like protein                     406   3e-134   
gb|AFW56244.1|  hypothetical protein ZEAMMB73_131551                    406   3e-134   
ref|XP_008466753.1|  PREDICTED: amino acid permease 3-like              406   3e-134   
emb|CDX84450.1|  BnaC03g50500D                                          405   3e-134   
ref|NP_001045010.1|  Os01g0882800                                       406   3e-134   
gb|EEC68963.1|  hypothetical protein OsI_37697                          406   3e-134   
gb|EAY82481.1|  hypothetical protein OsI_37698                          406   3e-134   
ref|NP_001066316.1|  Os12g0181500                                       405   4e-134   
ref|XP_008781630.1|  PREDICTED: amino acid permease 3                   406   4e-134   
ref|XP_010668707.1|  PREDICTED: amino acid permease 8-like isofor...    401   4e-134   
ref|XP_004142635.1|  PREDICTED: amino acid permease 3-like              406   4e-134   
ref|XP_011027477.1|  PREDICTED: amino acid permease 3-like              406   4e-134   
ref|XP_003563762.1|  PREDICTED: amino acid permease 3-like              406   4e-134   
ref|XP_002442925.1|  hypothetical protein SORBIDRAFT_08g004990          405   5e-134   
ref|XP_003524313.1|  PREDICTED: amino acid permease 2-like              405   6e-134   
ref|XP_008662536.1|  PREDICTED: amino acid permease 3-like              405   6e-134   
gb|KDP32819.1|  hypothetical protein JCGZ_12111                         405   6e-134   
dbj|BAK02045.1|  predicted protein                                      405   8e-134   
ref|XP_010912574.1|  PREDICTED: amino acid permease 3-like              405   9e-134   
ref|XP_009379863.1|  PREDICTED: amino acid permease 4-like              405   1e-133   
ref|XP_004977212.1|  PREDICTED: amino acid permease 3-like              404   1e-133   
ref|XP_008788441.1|  PREDICTED: amino acid permease 4-like              405   2e-133   
gb|EYU32509.1|  hypothetical protein MIMGU_mgv1a005226mg                405   2e-133   
gb|EYU32508.1|  hypothetical protein MIMGU_mgv1a005226mg                404   2e-133   
ref|XP_009404321.1|  PREDICTED: amino acid permease 4-like              404   2e-133   
ref|XP_007137460.1|  hypothetical protein PHAVU_009G128600g             404   2e-133   
ref|XP_011003418.1|  PREDICTED: amino acid permease 3-like              404   2e-133   
ref|XP_011002450.1|  PREDICTED: amino acid permease 3-like              404   2e-133   
emb|CDO96925.1|  unnamed protein product                                405   3e-133   
ref|XP_006657053.1|  PREDICTED: amino acid permease 1-like              401   3e-133   
ref|XP_003560665.1|  PREDICTED: amino acid permease 1-like              403   3e-133   
ref|XP_004965607.1|  PREDICTED: amino acid permease 3-like              403   3e-133   
emb|CDY43761.1|  BnaA06g22970D                                          403   4e-133   
ref|XP_002442926.1|  hypothetical protein SORBIDRAFT_08g005000          403   4e-133   
ref|XP_003527948.1|  PREDICTED: amino acid permease 3                   403   5e-133   
ref|XP_008236004.1|  PREDICTED: amino acid permease 3-like              404   5e-133   
ref|XP_010653015.1|  PREDICTED: amino acid permease 4-like              404   5e-133   
ref|XP_008674422.1|  PREDICTED: amino acid permease 3-like              404   6e-133   
ref|XP_004978919.1|  PREDICTED: amino acid permease 3-like              402   7e-133   
ref|XP_002516531.1|  amino acid transporter, putative                   403   8e-133   
ref|XP_010063423.1|  PREDICTED: amino acid permease 3-like              402   8e-133   
ref|XP_004289864.1|  PREDICTED: amino acid permease 2-like              404   8e-133   
ref|XP_002306650.2|  hypothetical protein POPTR_0005s20400g             402   1e-132   
gb|KHN23179.1|  Amino acid permease 6                                   400   1e-132   
ref|XP_002975129.1|  hypothetical protein SELMODRAFT_442676             402   1e-132   
ref|XP_006852748.1|  hypothetical protein AMTR_s00033p00114390          402   2e-132   
ref|XP_008377748.1|  PREDICTED: amino acid permease 3-like              403   2e-132   
ref|XP_011046334.1|  PREDICTED: amino acid permease 3-like              403   2e-132   
emb|CBI20574.3|  unnamed protein product                                402   2e-132   
ref|XP_006645132.1|  PREDICTED: amino acid permease 2-like              401   3e-132   
gb|EMT26484.1|  hypothetical protein F775_32730                         401   3e-132   
dbj|BAD53557.1|  putative amino acid carrier                            400   4e-132   
ref|XP_002302224.2|  hypothetical protein POPTR_0002s08000g             400   5e-132   
gb|EEC80807.1|  hypothetical protein OsI_23357                          400   5e-132   
ref|XP_002441927.1|  hypothetical protein SORBIDRAFT_08g004980          400   5e-132   
ref|XP_002437148.1|  hypothetical protein SORBIDRAFT_10g022010          400   6e-132   
gb|ADE75660.1|  unknown                                                 401   7e-132   
gb|ABR16450.1|  unknown                                                 400   8e-132   
emb|CAN77083.1|  hypothetical protein VITISV_003992                     402   8e-132   
ref|XP_002277844.1|  PREDICTED: amino acid permease 8-like              400   9e-132   
gb|EYU37943.1|  hypothetical protein MIMGU_mgv1a004721mg                400   2e-131   
gb|KEH35330.1|  transmembrane amino acid transporter family protein     399   2e-131   
ref|XP_007198986.1|  hypothetical protein PRUPE_ppa020916mg             400   2e-131   
ref|XP_010095743.1|  hypothetical protein L484_003355                   399   2e-131   
ref|XP_008444195.1|  PREDICTED: amino acid permease 3-like              399   3e-131   
ref|XP_006847199.1|  hypothetical protein AMTR_s00017p00252280          399   4e-131   
ref|XP_007137459.1|  hypothetical protein PHAVU_009G128500g             398   4e-131   
emb|CAN69378.1|  hypothetical protein VITISV_008204                     398   4e-131   
ref|XP_010527720.1|  PREDICTED: amino acid permease 5-like isofor...    398   4e-131   
ref|XP_010927999.1|  PREDICTED: probable amino acid permease 7 is...    397   6e-131   
gb|KDP29639.1|  hypothetical protein JCGZ_18801                         399   7e-131   
ref|XP_006646758.1|  PREDICTED: amino acid permease 3-like              398   8e-131   
ref|XP_004503904.1|  PREDICTED: amino acid permease 2-like              397   8e-131   
ref|XP_010530203.1|  PREDICTED: amino acid permease 5                   397   8e-131   
ref|XP_006581783.1|  PREDICTED: amino acid permease 3-like isofor...    397   1e-130   
gb|EMT07264.1|  hypothetical protein F775_06597                         396   1e-130   
gb|AAX56951.1|  amino acid transporter                                  397   1e-130   
ref|XP_006473027.1|  PREDICTED: amino acid permease 3-like              397   1e-130   
ref|XP_007137762.1|  hypothetical protein PHAVU_009G153700g             396   1e-130   
ref|XP_003522571.1|  PREDICTED: amino acid permease 3-like isofor...    397   2e-130   
ref|XP_006581782.1|  PREDICTED: amino acid permease 3-like isofor...    397   2e-130   
ref|XP_002533728.1|  amino acid transporter, putative                   395   2e-130   
gb|KEH35329.1|  transmembrane amino acid transporter family protein     394   2e-130   
gb|AAF15944.1|AF061434_1  amino acid transporter a                      388   2e-130   
ref|XP_009764609.1|  PREDICTED: amino acid permease 4-like isofor...    397   2e-130   
ref|XP_007137763.1|  hypothetical protein PHAVU_009G153700g             396   3e-130   
gb|KCW70650.1|  hypothetical protein EUGRSUZ_F03824                     395   3e-130   
ref|XP_006356925.1|  PREDICTED: amino acid permease 3-like              395   3e-130   
ref|XP_007137761.1|  hypothetical protein PHAVU_009G153700g             396   5e-130   
gb|KHN44307.1|  Amino acid permease 3                                   395   6e-130   
gb|KEH35328.1|  transmembrane amino acid transporter family protein     395   7e-130   
ref|XP_002442913.1|  hypothetical protein SORBIDRAFT_08g004810          395   8e-130   
ref|XP_008368062.1|  PREDICTED: amino acid permease 3-like              395   9e-130   
ref|XP_004498350.1|  PREDICTED: amino acid permease 3-like isofor...    395   1e-129   
emb|CAC51425.1|  amino acid permease AAP4                               393   3e-129   
ref|XP_010252955.1|  PREDICTED: probable amino acid permease 7 is...    392   4e-129   
ref|XP_006578775.1|  PREDICTED: amino acid permease 3-like isofor...    392   4e-129   
ref|XP_006578773.1|  PREDICTED: amino acid permease 3-like isofor...    392   8e-129   
ref|XP_002534252.1|  amino acid transporter, putative                   392   8e-129   
ref|XP_007041865.1|  Amino acid permease 2 isoform 1                    393   1e-128   
gb|EMS68703.1|  hypothetical protein TRIUR3_33957                       391   1e-128   
ref|XP_010644646.1|  PREDICTED: probable amino acid permease 7 is...    390   2e-128   
ref|XP_004144658.1|  PREDICTED: amino acid permease 4-like              390   2e-128   
ref|XP_009339433.1|  PREDICTED: amino acid permease 3-like              391   3e-128   
gb|EAY82539.1|  hypothetical protein OsI_37761                          390   3e-128   
emb|CAA10608.1|  amino acid carrier                                     390   4e-128   
gb|KEH40510.1|  transmembrane amino acid transporter family protein     390   4e-128   
ref|XP_008442267.1|  PREDICTED: amino acid permease 4-like              390   5e-128   
emb|CBI20573.3|  unnamed protein product                                390   6e-128   
ref|XP_002277817.1|  PREDICTED: amino acid permease 8 isoform X1        390   6e-128   
ref|NP_001066354.2|  Os12g0195100                                       389   6e-128   
ref|XP_010252953.1|  PREDICTED: probable amino acid permease 7          389   6e-128   
ref|XP_004965606.1|  PREDICTED: amino acid permease 1-like              389   7e-128   
ref|XP_008668462.1|  PREDICTED: uncharacterized protein LOC100383...    390   8e-128   
ref|XP_009145052.1|  PREDICTED: amino acid permease 5                   390   8e-128   
ref|XP_002278086.1|  PREDICTED: amino acid permease 3                   390   1e-127   
ref|XP_006476001.1|  PREDICTED: amino acid permease 8-like isofor...    389   1e-127   
ref|XP_006450729.1|  hypothetical protein CICLE_v10010799mg             389   2e-127   
gb|AAX56952.1|  amino acid transporter                                  388   2e-127   
ref|XP_006858553.1|  hypothetical protein AMTR_s00071p00166670          389   2e-127   
emb|CDY36017.1|  BnaA08g04440D                                          389   2e-127   
ref|XP_010911832.1|  PREDICTED: amino acid permease 6-like              388   2e-127   
ref|XP_006474785.1|  PREDICTED: probable amino acid permease 7-li...    388   2e-127   
ref|XP_006393747.1|  hypothetical protein EUTSA_v10011449mg             388   2e-127   
ref|XP_011000347.1|  PREDICTED: probable amino acid permease 7 is...    387   3e-127   
ref|XP_008219720.1|  PREDICTED: amino acid permease 3-like              388   4e-127   
gb|AFW56242.1|  hypothetical protein ZEAMMB73_107595                    388   4e-127   
ref|XP_006486755.1|  PREDICTED: amino acid permease 3-like              389   6e-127   
ref|XP_006452734.1|  hypothetical protein CICLE_v10008202mg             382   6e-127   
ref|XP_006377989.1|  hypothetical protein POPTR_0011s16990g             386   7e-127   
ref|XP_010479037.1|  PREDICTED: amino acid permease 5 isoform X1        387   8e-127   
ref|XP_008377310.1|  PREDICTED: amino acid permease 3-like              387   1e-126   
ref|NP_001045595.1|  Os02g0102200                                       388   1e-126   
emb|CAC51423.1|  amino acid permease AAP1                               386   1e-126   
ref|XP_008663834.1|  PREDICTED: uncharacterized protein LOC103642302    407   1e-126   
gb|AFW56250.1|  hypothetical protein ZEAMMB73_465553                    407   1e-126   
ref|XP_007224395.1|  hypothetical protein PRUPE_ppa021701mg             386   1e-126   
ref|XP_009401329.1|  PREDICTED: probable amino acid permease 7          387   2e-126   
ref|XP_004505788.1|  PREDICTED: amino acid permease 2-like              387   2e-126   
ref|XP_009107481.1|  PREDICTED: amino acid permease 5-like              386   2e-126   
ref|XP_006307383.1|  hypothetical protein CARUB_v10009009mg             386   2e-126   
gb|EAY84081.1|  hypothetical protein OsI_05462                          386   2e-126   



>ref|XP_009793584.1| PREDICTED: amino acid permease 6-like [Nicotiana sylvestris]
Length=481

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/337 (79%), Positives = 301/337 (89%), Gaps = 3/337 (1%)
 Frame = -1

Query  1002  SQNPMYVE---EGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
              +N MYV    E  ++ KNFDDDG EKRTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  6     QKNTMYVSTELERGDVQKNFDDDGREKRTGTLLTASAHIITAVIGSGVLSLAWAIAQLGW  65

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS IT+FTS LLADCYRSPGP++G RNYTYMDVVRSHLGGVKV LCGL+QY
Sbjct  66    VAGPAVLFAFSFITYFTSTLLADCYRSPGPISGKRNYTYMDVVRSHLGGVKVTLCGLAQY  125

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
             ANLVG++IGYTITASISMVAVK+SNCFHK+GH+  CS+ SYP+M+IFA IQ+VLSQIPNF
Sbjct  126   ANLVGVTIGYTITASISMVAVKRSNCFHKHGHEASCSISSYPYMIIFAVIQVVLSQIPNF  185

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSI+AAVMSF Y+SIG+GLSIAK AG G    ++LTG  VGVDV+G++KIW+ FQ
Sbjct  186   HKLSWLSILAAVMSFTYASIGLGLSIAKAAGVGHHVKTSLTGTTVGVDVSGSEKIWKSFQ  245

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYSTVLIEIQDTLRS PPE+ VMK+AS  GVSTTT+FY++CG IGYAAFGN
Sbjct  246   AIGDIAFAYAYSTVLIEIQDTLRSQPPESKVMKRASLAGVSTTTLFYILCGTIGYAAFGN  305

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             DAPGNFLTGFGFYEPFWLID AN+CIA+HLVGAYQVF
Sbjct  306   DAPGNFLTGFGFYEPFWLIDFANVCIAVHLVGAYQVF  342



>ref|XP_011074307.1| PREDICTED: amino acid permease 6 [Sesamum indicum]
Length=483

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/340 (79%), Positives = 298/340 (88%), Gaps = 7/340 (2%)
 Frame = -1

Query  1002  SQNPMYVEEGREIL------KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQ  841
              +N MY+ +  E L      K+FDDDG  KRTGT++TASAHIITAVIGSGVLSL+WAIAQ
Sbjct  6     QKNSMYIAQPMESLETGHSSKSFDDDGRVKRTGTMLTASAHIITAVIGSGVLSLAWAIAQ  65

Query  840   LGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGL  661
             LGW AGPAVL AFS IT+FTS LLAD YR PGPV GTRNYTYM VVRSHLGG+KVQLCGL
Sbjct  66    LGWVAGPAVLMAFSFITYFTSTLLADSYRCPGPVHGTRNYTYMGVVRSHLGGLKVQLCGL  125

Query  660   SQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQI  481
             +QY NLVG++IGYTITASISMVAVK+SNCFHKNGHD  CS+ +YPFM IFA IQ++LSQI
Sbjct  126   AQYGNLVGVTIGYTITASISMVAVKRSNCFHKNGHDVKCSISNYPFMAIFAGIQIILSQI  185

Query  480   PNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWR  301
             PNFH+LSWLSIVAAVMSFAYSSIG+GLSIAKVAG G    S LTG  VGVDVTGADK+WR
Sbjct  186   PNFHKLSWLSIVAAVMSFAYSSIGLGLSIAKVAGGGHVRTS-LTGTTVGVDVTGADKVWR  244

Query  300   CFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAA  121
              FQAIG+IAFAYAYSTVLIEIQDTL+S P EN VMKKAS +GV+TTTVFYV+CGC+GYAA
Sbjct  245   SFQAIGDIAFAYAYSTVLIEIQDTLKSQPAENKVMKKASFVGVTTTTVFYVLCGCVGYAA  304

Query  120   FGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             FGN+APGNFLTGFGFYEPFWLID AN+CIA+HL+GAYQVF
Sbjct  305   FGNNAPGNFLTGFGFYEPFWLIDFANVCIAVHLIGAYQVF  344



>gb|EYU36417.1| hypothetical protein MIMGU_mgv1a005426mg [Erythranthe guttata]
Length=484

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/340 (79%), Positives = 304/340 (89%), Gaps = 7/340 (2%)
 Frame = -1

Query  1002  SQNPMYVEEGREILKN------FDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQ  841
             +++ +Y EE +E L+N      FDDDG  KRTGTLVTASAHIITAVIGSGVLSL+WAIAQ
Sbjct  7     NKSSIYSEETKESLENGGASKTFDDDGRLKRTGTLVTASAHIITAVIGSGVLSLAWAIAQ  66

Query  840   LGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGL  661
             LGW AGPAVLAAFS IT+FTS LLAD YRSPGP+ GTRNYTYMDVVRSHLGG KVQLCG+
Sbjct  67    LGWVAGPAVLAAFSFITYFTSTLLADSYRSPGPLHGTRNYTYMDVVRSHLGGYKVQLCGI  126

Query  660   SQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQI  481
             +QY NLVG++IGYTITASISMVAVK+SNCFH +GH+  CS+ + PFM+IFAAIQ++LSQI
Sbjct  127   AQYGNLVGVTIGYTITASISMVAVKRSNCFHIHGHEDKCSISNIPFMIIFAAIQIILSQI  186

Query  480   PNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWR  301
             PNFH+LSWLSIVAAVMSFAYSSIG+GLSIAKVAG G A  S LTG  VGVDV+G+DK+WR
Sbjct  187   PNFHKLSWLSIVAAVMSFAYSSIGLGLSIAKVAGGGHARTS-LTGTTVGVDVSGSDKVWR  245

Query  300   CFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAA  121
              FQ+IG+IAFAYAYSTVLIEIQDTL+S+P E+ VMKKAS +GVSTTTVFYV+CGC+GYAA
Sbjct  246   SFQSIGDIAFAYAYSTVLIEIQDTLKSNPSESKVMKKASLVGVSTTTVFYVLCGCVGYAA  305

Query  120   FGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             FGNDAPGNFLTGFGFYEPFWLID ANICIA+HLVGAYQVF
Sbjct  306   FGNDAPGNFLTGFGFYEPFWLIDFANICIAVHLVGAYQVF  345



>emb|CDP00979.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/337 (79%), Positives = 299/337 (89%), Gaps = 3/337 (1%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M + QNP   E G   LKNFDDDG  KRTGT++TASAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  10    MYLEQNPEAPENGD--LKNFDDDGRPKRTGTVITASAHIITAVIGSGVLSLAWAIAQLGW  67

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS ITFFTS +LAD YRSPGP+TG RNYTYMDVVRSHLGG KVQLCG++QY
Sbjct  68    VAGPAVLMAFSFITFFTSTMLADSYRSPGPITGRRNYTYMDVVRSHLGGYKVQLCGIAQY  127

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+G++IGYTITASISMVAVK+SNCFH+NGH   C + + PFM+IFAAIQ+ LSQIPNF
Sbjct  128   GNLIGVTIGYTITASISMVAVKRSNCFHRNGHHVKCHISNNPFMIIFAAIQIFLSQIPNF  187

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSI+AAVMSFAYSSIG+GLSIAKVAG G  A +TLTGV VGVDV+G +K+WR FQ
Sbjct  188   HKLSWLSILAAVMSFAYSSIGLGLSIAKVAGDG-IAKTTLTGVTVGVDVSGTEKVWRSFQ  246

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYSTVLIEIQDTLRSHPPE+ VMK AS +GVSTTT+FYV+CGC GYAAFGN
Sbjct  247   AIGDIAFAYAYSTVLIEIQDTLRSHPPESKVMKWASGVGVSTTTLFYVLCGCTGYAAFGN  306

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             +APGNFLTGFGFYEPFWLID AN+CIAIHL+GAYQVF
Sbjct  307   NAPGNFLTGFGFYEPFWLIDFANVCIAIHLIGAYQVF  343



>ref|XP_010320244.1| PREDICTED: LOW QUALITY PROTEIN: amino acid permease 6-like [Solanum 
lycopersicum]
Length=469

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/337 (79%), Positives = 302/337 (90%), Gaps = 3/337 (1%)
 Frame = -1

Query  1002  SQNPMYVE---EGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
              +N MYV    E  ++ KNFDDDG EKRTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  6     QKNAMYVSNELESGDVQKNFDDDGREKRTGTLLTASAHIITAVIGSGVLSLAWAIAQLGW  65

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS IT+FTS LLAD YRSPGP++G RNYTYMDVVRSHLGGVKV LCG++QY
Sbjct  66    VAGPAVLLAFSFITYFTSTLLADSYRSPGPISGKRNYTYMDVVRSHLGGVKVTLCGIAQY  125

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
             ANLVG++IGYTITASISMVAV++SNCFHKNGH+  CS+ SYP+M+IFA IQ+VLSQIPNF
Sbjct  126   ANLVGVTIGYTITASISMVAVRRSNCFHKNGHEASCSIGSYPYMIIFAVIQIVLSQIPNF  185

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSI+AAVMSF Y+SIG+GLSIAKVAG G    +TLTGVVVGVDV+G +K+WR FQ
Sbjct  186   HKLSWLSILAAVMSFTYASIGLGLSIAKVAGVGHHVKTTLTGVVVGVDVSGTEKVWRSFQ  245

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYSTVLIEIQDTL+S PPE+ VMK+AS  GVSTTT+FYV+CG IGYAAFGN
Sbjct  246   AIGDIAFAYAYSTVLIEIQDTLKSSPPESKVMKRASLAGVSTTTLFYVLCGTIGYAAFGN  305

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             DAPGNFLTGFGFYEPFWLID AN+CIA+HL+GAYQVF
Sbjct  306   DAPGNFLTGFGFYEPFWLIDFANVCIAVHLIGAYQVF  342



>ref|XP_010061591.1| PREDICTED: amino acid permease 6-like [Eucalyptus grandis]
 gb|KCW68572.1| hypothetical protein EUGRSUZ_F02185 [Eucalyptus grandis]
 gb|KCW68573.1| hypothetical protein EUGRSUZ_F02185 [Eucalyptus grandis]
Length=486

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/339 (78%), Positives = 297/339 (88%), Gaps = 3/339 (1%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M V Q+P     G  + KN DDDG  KRTGT+VTASAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  11    MRVEQDPEAFRSG-GVQKNLDDDGRVKRTGTVVTASAHIITAVIGSGVLSLAWAIAQLGW  69

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
               GP VLAAFS IT+FTS LLADCYRSP P+TG RNYTYMDVV++HLGG KVQLCGL+QY
Sbjct  70    VMGPVVLAAFSFITYFTSTLLADCYRSPDPITGERNYTYMDVVKAHLGGRKVQLCGLAQY  129

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFD--CSVPSYPFMMIFAAIQLVLSQIP  478
              NLVGI+IGYTITASISMVAVKKSNCFHKNGH+    C   SYPFM+IFA IQ+VLSQIP
Sbjct  130   GNLVGITIGYTITASISMVAVKKSNCFHKNGHEVKSVCETSSYPFMIIFACIQIVLSQIP  189

Query  477   NFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRC  298
             +FH+LSWLSIVAAVMSFAY+SIG+GLSIAKVAG G  A +TLTG  VGVDV+G++K+WR 
Sbjct  190   DFHKLSWLSIVAAVMSFAYASIGVGLSIAKVAGGGHHARTTLTGTTVGVDVSGSEKVWRV  249

Query  297   FQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAF  118
             FQA+GNIAFAYAYSTVL+EIQDTL+S PPEN VMK+AS IG+STTT+FY +CGCIGYAAF
Sbjct  250   FQAVGNIAFAYAYSTVLVEIQDTLKSSPPENKVMKRASLIGISTTTMFYALCGCIGYAAF  309

Query  117   GNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GNDAPGNFLTGFGFYEPFWLID AN+CIA+HL+GAYQVF
Sbjct  310   GNDAPGNFLTGFGFYEPFWLIDFANVCIAVHLIGAYQVF  348



>emb|CAA70968.2| amino acid transporter [Solanum tuberosum]
Length=469

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/337 (78%), Positives = 300/337 (89%), Gaps = 3/337 (1%)
 Frame = -1

Query  1002  SQNPMYVE---EGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
              +N MYV    E  ++ KNFDDDG EKRTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  6     QKNAMYVSNELENGDVQKNFDDDGREKRTGTLLTASAHIITAVIGSGVLSLAWAIAQLGW  65

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS IT+FTS LLADCYRSPGP++G RNYTYMDVVRSHLGGVKV LCG++QY
Sbjct  66    VAGPAVLFAFSFITYFTSTLLADCYRSPGPISGKRNYTYMDVVRSHLGGVKVTLCGIAQY  125

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
             ANLVG++IGYTITASISMVAVK+SNCFHKNGH+  CS+ SYP+M+IFA IQ+VLSQIPNF
Sbjct  126   ANLVGVTIGYTITASISMVAVKRSNCFHKNGHEASCSIESYPYMIIFAVIQIVLSQIPNF  185

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSI+AAVMSF Y+SIG+GLSIAK +G G    + LTGVVVGVDV+G +K+WR FQ
Sbjct  186   HKLSWLSILAAVMSFTYASIGLGLSIAKASGVGHHVKTALTGVVVGVDVSGTEKVWRSFQ  245

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYSTVLIEIQDTL+S P E+ VMK+AS  GVSTTT+FYV+CG IGYAAFGN
Sbjct  246   AIGDIAFAYAYSTVLIEIQDTLKSSPSESKVMKRASLAGVSTTTLFYVLCGTIGYAAFGN  305

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             +APGNFLTGFGFYEPFWLID AN+CIA+HLVGAYQVF
Sbjct  306   NAPGNFLTGFGFYEPFWLIDFANVCIAVHLVGAYQVF  342



>gb|EYU34219.1| hypothetical protein MIMGU_mgv1a005305mg [Erythranthe guttata]
Length=489

 Score =   525 bits (1352),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 264/329 (80%), Positives = 293/329 (89%), Gaps = 1/329 (0%)
 Frame = -1

Query  984  VEEGREIL-KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLA  808
            +E G E   KNFDDDG  +RTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW  GP+VL 
Sbjct  22   LENGEEAASKNFDDDGRVRRTGTLLTASAHIITAVIGSGVLSLAWAIAQLGWVVGPSVLF  81

Query  807  AFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISI  628
            AFS+IT+FTS LLAD YRSPGPV G+RNYTYMDVVRSHLGG KV LCGL+QY NLVG++I
Sbjct  82   AFSVITYFTSTLLADSYRSPGPVHGSRNYTYMDVVRSHLGGYKVGLCGLAQYGNLVGVTI  141

Query  627  GYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSI  448
            GYTITASISMVAVK+SNCFHK GH   CSV +YPFM IFAAIQ++LSQIPNFHELSWLSI
Sbjct  142  GYTITASISMVAVKRSNCFHKEGHGAKCSVSNYPFMAIFAAIQIILSQIPNFHELSWLSI  201

Query  447  VAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFA  268
            VAAVMSFAYSSIG+ LSIAK+AG G    ++LTG  VGVDVTG +K+WR FQAIG+IAFA
Sbjct  202  VAAVMSFAYSSIGLALSIAKLAGGGNHVRTSLTGTTVGVDVTGPEKVWRSFQAIGDIAFA  261

Query  267  YAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLT  88
            YAYSTVLIEIQDTL+S PPEN VMKKAS +GVSTTT+FYV+CGC+GYAAFGN+APGNFLT
Sbjct  262  YAYSTVLIEIQDTLKSPPPENRVMKKASFVGVSTTTIFYVLCGCLGYAAFGNNAPGNFLT  321

Query  87   GFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            GFGFYEPFWLID AN+CIAIHLVGAYQVF
Sbjct  322  GFGFYEPFWLIDFANVCIAIHLVGAYQVF  350



>emb|CDP00978.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   523 bits (1346),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 262/337 (78%), Positives = 297/337 (88%), Gaps = 3/337 (1%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M + QNP   E G   LKNFDDDG  KRTGT++TASA IITAVIGSGVLSL+WA+AQLGW
Sbjct  10    MYLEQNPEAPENGD--LKNFDDDGRPKRTGTVITASARIITAVIGSGVLSLAWAVAQLGW  67

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFSLITFFTS +LADCYRSPGP+TG RN TYMD VRSHLGG KVQLCG++QY
Sbjct  68    VAGPAVLMAFSLITFFTSTMLADCYRSPGPITGRRNNTYMDAVRSHLGGCKVQLCGIAQY  127

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
               L+G++IGYTI ASISMVAVK+SNCF +NGH   C + + PFM+IFAAIQ+ LSQIPNF
Sbjct  128   GKLIGVTIGYTIRASISMVAVKRSNCFRRNGHHVKCHISNNPFMIIFAAIQIFLSQIPNF  187

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSI+AAVMSFAYSSIG+GLSIAKVAG G  A +TLTGV VGVDV+G++K+WR FQ
Sbjct  188   HKLSWLSILAAVMSFAYSSIGLGLSIAKVAGDG-IAKTTLTGVTVGVDVSGSEKVWRSFQ  246

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYSTVLIEIQDTLRSHPPE+ VMK+AS +GVST T+FYV+CGCIGYAAFGN
Sbjct  247   AIGDIAFAYAYSTVLIEIQDTLRSHPPESKVMKRASGVGVSTITLFYVLCGCIGYAAFGN  306

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             +APGNFLTGFGFYEPFWLID AN+CIAIHL+GAYQVF
Sbjct  307   NAPGNFLTGFGFYEPFWLIDFANVCIAIHLIGAYQVF  343



>ref|XP_009629042.1| PREDICTED: amino acid permease 6-like [Nicotiana tomentosiformis]
Length=491

 Score =   517 bits (1331),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 258/338 (76%), Positives = 297/338 (88%), Gaps = 8/338 (2%)
 Frame = -1

Query  990  MYVE--------EGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLG  835
            MYVE        E  E+ KN DDDG EKRTGT++TASAHIITAVIGSGVLSL+WA+AQLG
Sbjct  12   MYVEHSAQGGVLESGEVHKNIDDDGREKRTGTVLTASAHIITAVIGSGVLSLAWAMAQLG  71

Query  834  WAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQ  655
            W AGP +L  FS IT+FTS LLADCYRSPGPV+G RNY+YM+VVRSHLGG+KVQLCG++Q
Sbjct  72   WVAGPVILFVFSFITYFTSTLLADCYRSPGPVSGKRNYSYMEVVRSHLGGIKVQLCGIAQ  131

Query  654  YANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPN  475
            Y NLVGI+IGYTITASISMVAV +SNCFHK GH   CSV +YP+M+IFAAIQ+VLSQIPN
Sbjct  132  YGNLVGITIGYTITASISMVAVVRSNCFHKKGHQASCSVSNYPYMIIFAAIQIVLSQIPN  191

Query  474  FHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCF  295
            FH+LSWLSI+AAVMSFAYS IG+GLSIAKVAG+G    ++LTGV VGVDV+G++K+WR F
Sbjct  192  FHKLSWLSILAAVMSFAYSLIGLGLSIAKVAGAGHHVKTSLTGVQVGVDVSGSEKLWRSF  251

Query  294  QAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFG  115
            Q+IG+IAFAYA++T+LIEIQDTLRS P EN VMK+AS +GV TTT+FYV+CG IGYAAFG
Sbjct  252  QSIGDIAFAYAFATILIEIQDTLRSPPEENKVMKRASLVGVFTTTLFYVLCGTIGYAAFG  311

Query  114  NDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            NDAPGNFLTGFGFYEPFWLID AN+CIAIHLVGAYQVF
Sbjct  312  NDAPGNFLTGFGFYEPFWLIDFANVCIAIHLVGAYQVF  349



>ref|XP_010245602.1| PREDICTED: amino acid permease 6 [Nelumbo nucifera]
Length=487

 Score =   514 bits (1325),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 256/320 (80%), Positives = 290/320 (91%), Gaps = 0/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN DDDG  KRTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW AGP+VL AFS IT+FT
Sbjct  27   KNLDDDGRAKRTGTLITASAHIITAVIGSGVLSLAWAIAQLGWVAGPSVLIAFSGITYFT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYRSP PVTG RNYTYMDVVR+HLGG+K+QLCGL+QY NLVGI+IGYTITASIS
Sbjct  87   STLLADCYRSPDPVTGKRNYTYMDVVRAHLGGIKIQLCGLAQYVNLVGITIGYTITASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M AVK+SNCFH +GH   C+V  YPF++IFA+IQ+VLSQIPNFH+LSWLSI+AAVMSFAY
Sbjct  147  MAAVKRSNCFHTHGHHTKCNVADYPFIIIFASIQIVLSQIPNFHKLSWLSILAAVMSFAY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GLS+AKVA       ++LTGV+VGVDVTG +K+W+ FQAIG+IAFAYAYSTVLIE
Sbjct  207  SSIGLGLSVAKVAEGSGDVRTSLTGVLVGVDVTGTEKVWKTFQAIGDIAFAYAYSTVLIE  266

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S PPEN VMKKAS IGVSTTT+FYV+CGC+GYAAFGN+APGNFLTGFGFYEPFW
Sbjct  267  IQDTLKSSPPENKVMKKASFIGVSTTTLFYVLCGCVGYAAFGNNAPGNFLTGFGFYEPFW  326

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN+CIAIHL+GAYQVF
Sbjct  327  LIDFANVCIAIHLIGAYQVF  346



>ref|XP_009127448.1| PREDICTED: amino acid permease 6 [Brassica rapa]
Length=481

 Score =   513 bits (1322),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 256/342 (75%), Positives = 297/342 (87%), Gaps = 7/342 (2%)
 Frame = -1

Query  1005  VSQNPMYVEEG------REILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIA  844
             + +  M++E+        ++ KNFDDDG +KRTGT +T SAHIITAVIGSGVLSL+WAIA
Sbjct  1     MEKKSMFIEQSFTDHKSGDMNKNFDDDGRQKRTGTWMTGSAHIITAVIGSGVLSLAWAIA  60

Query  843   QLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCG  664
             QLGW AGPAVL AFS IT+FTS +LADCYRSP PVTG RNYTYM+VVRS+LGG KV LCG
Sbjct  61    QLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVMLCG  120

Query  663   LSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQ  484
             L+QY NL+GI+IGYTITASISMVAVK+SNCFHKNGH+  CS  + PFM+IFA IQ+VLSQ
Sbjct  121   LAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHNVKCSTSNTPFMIIFACIQIVLSQ  180

Query  483   IPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIW  304
             IPNFH LSWLSI+AAVMSF+Y+SIG+GLSIAKVAG G  A + LTGV VGVDVTG+DK+W
Sbjct  181   IPNFHNLSWLSILAAVMSFSYASIGVGLSIAKVAGGGVHARTALTGVTVGVDVTGSDKVW  240

Query  303   RCFQAIGNIAFAYAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGY  127
             R FQA+G+IAFAYAYSTVLIEIQDTL++ PP EN  MK+AS +GVSTTT FY++CGC+GY
Sbjct  241   RTFQAVGDIAFAYAYSTVLIEIQDTLKASPPSENKAMKRASLVGVSTTTFFYMLCGCVGY  300

Query  126   AAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             AAFGN+APGNFLTGFGFYEPFWLID AN+CIA+HLVGAYQVF
Sbjct  301   AAFGNNAPGNFLTGFGFYEPFWLIDFANVCIAVHLVGAYQVF  342



>ref|XP_010440833.1| PREDICTED: amino acid permease 6-like [Camelina sativa]
Length=481

 Score =   513 bits (1320),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 257/341 (75%), Positives = 292/341 (86%), Gaps = 7/341 (2%)
 Frame = -1

Query  1002  SQNPMYVEEG---REI---LKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQ  841
              +  M+VE+G    EI    KNFDDDG EKRTGT +T SAHIITAVIGSGVLSL+WAIAQ
Sbjct  3     KKKTMFVEQGITDHEIGNTNKNFDDDGREKRTGTWMTGSAHIITAVIGSGVLSLAWAIAQ  62

Query  840   LGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGL  661
             LGW AGPAVL AFS IT+FTS +LADCYRSP PVTG RNYTYM+VVRS+LGG KVQLCGL
Sbjct  63    LGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCGL  122

Query  660   SQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQI  481
             +QY NL+GI+IGYTITASISMVAVK+SNCFHKNGH   C+  + PFM++FA IQ++LSQI
Sbjct  123   AQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHKVKCATSNTPFMIVFAIIQIILSQI  182

Query  480   PNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWR  301
             PNFH LSWLSI+AAVMSF Y+SIGIGLSIAK AG G    + LTGV VGVDV+ ++K+WR
Sbjct  183   PNFHNLSWLSILAAVMSFCYASIGIGLSIAKAAGGGEHVRTALTGVTVGVDVSDSEKVWR  242

Query  300   CFQAIGNIAFAYAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYA  124
              FQAIG+IAFAYAYSTVLIEIQDTL+  PP EN  MK+AS +GVSTTT FY++CGC+GYA
Sbjct  243   TFQAIGDIAFAYAYSTVLIEIQDTLKVGPPSENKAMKRASLVGVSTTTFFYMLCGCVGYA  302

Query  123   AFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             AFGNDAPGNFLTGFGFYEPFWLID AN+CIA+HLVGAYQVF
Sbjct  303   AFGNDAPGNFLTGFGFYEPFWLIDFANVCIAVHLVGAYQVF  343



>emb|CAD92450.1| amino acid permease 6 [Brassica napus]
Length=481

 Score =   512 bits (1319),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 256/342 (75%), Positives = 297/342 (87%), Gaps = 7/342 (2%)
 Frame = -1

Query  1005  VSQNPMYVEEG------REILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIA  844
             + +  M++E+        ++ KNFDDDG +KRTGT +T SAHIITAVIGSGVLSL+WAIA
Sbjct  1     MEKKSMFIEQSFTDHKSGDMNKNFDDDGRQKRTGTWMTGSAHIITAVIGSGVLSLAWAIA  60

Query  843   QLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCG  664
             QLGW AGPAVL AFS IT+FTS +LADCYRSP PVTG RNYTYM+VVRS+LGG KV LCG
Sbjct  61    QLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVMLCG  120

Query  663   LSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQ  484
             L+QY NL+GI+IGYTITASISMVAVK+SNCFHKNGH+  CS  + PFM+IFA IQ+VLSQ
Sbjct  121   LAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHNVKCSTSNTPFMIIFACIQIVLSQ  180

Query  483   IPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIW  304
             IPNFH LSWLSI+AAVMSF+Y+SIGIGLSIAKVAG G  A + LTGV VGVDVTG++K+W
Sbjct  181   IPNFHNLSWLSILAAVMSFSYASIGIGLSIAKVAGGGVHARTALTGVTVGVDVTGSEKVW  240

Query  303   RCFQAIGNIAFAYAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGY  127
             R FQA+G+IAFAYAYSTVLIEIQDTL++ PP EN  MK+AS +GVSTTT FY++CGC+GY
Sbjct  241   RTFQAVGDIAFAYAYSTVLIEIQDTLKASPPSENKAMKRASLVGVSTTTFFYMLCGCVGY  300

Query  126   AAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             AAFGN+APGNFLTGFGFYEPFWLID AN+CIA+HLVGAYQVF
Sbjct  301   AAFGNNAPGNFLTGFGFYEPFWLIDFANVCIAVHLVGAYQVF  342



>ref|XP_007018375.1| Amino acid permease 6 [Theobroma cacao]
 gb|EOY15600.1| Amino acid permease 6 [Theobroma cacao]
Length=483

 Score =   512 bits (1319),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 256/344 (74%), Positives = 296/344 (86%), Gaps = 2/344 (1%)
 Frame = -1

Query  1032  RKHPRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSW  853
             R+  +  M + QNP   E G +  KN DDDG  KRTGT +TASAHIITAVIGSGVLSL+W
Sbjct  3     REMQKTSMFIEQNPGDYENG-DFQKNLDDDGRVKRTGTWLTASAHIITAVIGSGVLSLAW  61

Query  852   AIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQ  673
             AIAQLGW AGPAVL AFS IT+FTS LL DCYR+P PV G RNYTYMDVVR++LGG KVQ
Sbjct  62    AIAQLGWVAGPAVLMAFSFITYFTSTLLVDCYRAPDPVHGKRNYTYMDVVRAYLGGRKVQ  121

Query  672   LCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLV  493
             LCGL+QY NL+G++IGYTITASISMVAVK+SNCFHK+GH   C   +YPFM+IFA IQ+V
Sbjct  122   LCGLAQYGNLIGVTIGYTITASISMVAVKRSNCFHKHGHHVKCQTSNYPFMVIFACIQIV  181

Query  492   LSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGAD  313
             LSQIPNFH+LSWLSI+AA+MSFAYSSIG+GLSIA VAG G    S LTGV VGVDV+G++
Sbjct  182   LSQIPNFHKLSWLSILAAIMSFAYSSIGLGLSIATVAGGGHVRTS-LTGVTVGVDVSGSE  240

Query  312   KIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCI  133
             K+WR FQAIG+IAFAYAYSTVLIEIQDT++S PPEN  MK+A++IGVSTTT+FYV+CG +
Sbjct  241   KVWRTFQAIGDIAFAYAYSTVLIEIQDTIKSSPPENKSMKRATSIGVSTTTLFYVLCGLV  300

Query  132   GYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GYAAFGNDAPGNFLTGFGFYEPFW+ID AN+CIA+HL+GAYQVF
Sbjct  301   GYAAFGNDAPGNFLTGFGFYEPFWMIDFANVCIAVHLIGAYQVF  344



>gb|KDP41551.1| hypothetical protein JCGZ_15958 [Jatropha curcas]
Length=484

 Score =   512 bits (1318),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 258/342 (75%), Positives = 292/342 (85%), Gaps = 8/342 (2%)
 Frame = -1

Query  1005  VSQNPMYVE----EGRE---ILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAI  847
             +  + MY+E    EG E   I KN DDDG  KRTGT +TASAHIITAVIGSGVLSL+WAI
Sbjct  5     MQHSSMYLEQVDIEGYENGGIRKNLDDDGRAKRTGTWITASAHIITAVIGSGVLSLAWAI  64

Query  846   AQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLC  667
             AQLGW AGP +L AFS ITFFTS LLADCYRSP PVTG RNYTYMD VR++LGG KV +C
Sbjct  65    AQLGWVAGPVILMAFSFITFFTSTLLADCYRSPDPVTGKRNYTYMDAVRANLGGWKVTMC  124

Query  666   GLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLS  487
             GL+QYANLVGI++GYTITASISMVAVK+SNCFH +GH   C+  + P+M+IFA IQ+VLS
Sbjct  125   GLAQYANLVGITVGYTITASISMVAVKRSNCFHNHGHHVKCNTSNNPYMIIFACIQIVLS  184

Query  486   QIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKI  307
             QIPNFH+LSWLS+VAAVMSFAYSSIG+GLSIAKVAG G A  S LTG  V VDVT A K+
Sbjct  185   QIPNFHKLSWLSLVAAVMSFAYSSIGLGLSIAKVAGGGHARTS-LTGTTVRVDVTPAQKV  243

Query  306   WRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGY  127
             WR FQAIG+IAFAYA+STVLIEIQDT+RS PPEN  MK+AS IG+ TTT+FYV+CGC+GY
Sbjct  244   WRAFQAIGDIAFAYAFSTVLIEIQDTVRSSPPENKAMKRASFIGILTTTLFYVLCGCLGY  303

Query  126   AAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             AAFGNDAPGNFLTGFGFYEPFWLID+AN+CIAIHL+GAYQVF
Sbjct  304   AAFGNDAPGNFLTGFGFYEPFWLIDLANVCIAIHLIGAYQVF  345



>ref|XP_010442428.1| PREDICTED: amino acid permease 6 [Camelina sativa]
Length=481

 Score =   512 bits (1318),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 256/341 (75%), Positives = 292/341 (86%), Gaps = 7/341 (2%)
 Frame = -1

Query  1002  SQNPMYVEEGR------EILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQ  841
              +  M+VE+        +  KNFDDDG EKRTGT +T SAHIITAVIGSGVLSL+WAIAQ
Sbjct  3     KKKTMFVEQSLTDHEIGDTNKNFDDDGREKRTGTWMTGSAHIITAVIGSGVLSLAWAIAQ  62

Query  840   LGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGL  661
             LGW AGPAVL AFS IT+FTS +LADCYRSP PVTG RNYTYM+VVRS+LGG KVQLCGL
Sbjct  63    LGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCGL  122

Query  660   SQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQI  481
             +QY NL+GI+IGYTITASISMVAVK+SNCFHKNGH   C+  + PFM++FA IQ++LSQI
Sbjct  123   AQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHKVKCATSNTPFMIVFAIIQIILSQI  182

Query  480   PNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWR  301
             PNFH LSWLSI+AAVMSF Y+SIGIGLSIAK AG G  A + LTGV VGVDV+G++K+WR
Sbjct  183   PNFHNLSWLSILAAVMSFCYASIGIGLSIAKAAGGGEHARTALTGVTVGVDVSGSEKVWR  242

Query  300   CFQAIGNIAFAYAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYA  124
              FQAIG+IAFAYAYSTVLIEIQDTL+  PP EN  MK+AS +GVSTTT FY++CGC+GYA
Sbjct  243   TFQAIGDIAFAYAYSTVLIEIQDTLKVGPPSENKAMKRASLVGVSTTTFFYMLCGCVGYA  302

Query  123   AFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             AFGNDAPGNFLTGFGFYEPFWLID AN+CIA+HLVGAYQVF
Sbjct  303   AFGNDAPGNFLTGFGFYEPFWLIDFANVCIAVHLVGAYQVF  343



>ref|XP_011078457.1| PREDICTED: amino acid permease 6-like [Sesamum indicum]
Length=485

 Score =   511 bits (1317),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 261/342 (76%), Positives = 288/342 (84%), Gaps = 9/342 (3%)
 Frame = -1

Query  1002  SQNPMYVE--------EGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAI  847
              +  MY+E        E  E  KNFD+DG  KRTGT++TASAHI+TAVIGSGVLSL+WA+
Sbjct  7     KRRSMYIEPATTRDELESGEASKNFDEDGRAKRTGTMLTASAHIVTAVIGSGVLSLAWAL  66

Query  846   AQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLC  667
             AQLGW AGPAVL  FS IT+FTS LLAD YR PGPV GTRNYTYMDVVRSHLGG KVQLC
Sbjct  67    AQLGWVAGPAVLLTFSFITYFTSTLLADTYRFPGPVHGTRNYTYMDVVRSHLGGYKVQLC  126

Query  666   GLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLS  487
             GL+QY NLVG+ IGYTITA+ISMVAV +SNCFHK+GH   C   +YP M IFA IQ+VLS
Sbjct  127   GLAQYGNLVGVGIGYTITAAISMVAVLRSNCFHKHGHHVKCLKSNYPSMAIFAGIQIVLS  186

Query  486   QIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKI  307
             QIPNFHELSWLSIVAA+MSF YS IG+GLSIAK+ G G A  S LTG  VGVDVTG++K+
Sbjct  187   QIPNFHELSWLSIVAAIMSFTYSFIGLGLSIAKLIGDGHAKTS-LTGTTVGVDVTGSEKL  245

Query  306   WRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGY  127
             WR FQAIG+IAFAYAYSTVLIEIQDTL+S PPEN VMKKAS +GV TTTVFYV+CGCIGY
Sbjct  246   WRSFQAIGDIAFAYAYSTVLIEIQDTLKSAPPENKVMKKASLVGVVTTTVFYVLCGCIGY  305

Query  126   AAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             AAFGNDAPGNFLTGFGFYEPFWLID ANICIA+HLVGAYQVF
Sbjct  306   AAFGNDAPGNFLTGFGFYEPFWLIDFANICIAVHLVGAYQVF  347



>ref|XP_010482241.1| PREDICTED: amino acid permease 6-like isoform X1 [Camelina sativa]
 ref|XP_010482242.1| PREDICTED: amino acid permease 6-like isoform X2 [Camelina sativa]
Length=481

 Score =   511 bits (1316),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 257/341 (75%), Positives = 293/341 (86%), Gaps = 7/341 (2%)
 Frame = -1

Query  1002  SQNPMYVEEG---REI---LKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQ  841
              +  M+VE+     EI    KNFDDDG EKRTGT +T SAHIITAVIGSGVLSL+WAIAQ
Sbjct  3     KKKTMFVEQSITDHEIGDSNKNFDDDGREKRTGTWMTGSAHIITAVIGSGVLSLAWAIAQ  62

Query  840   LGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGL  661
             LGW AGPAVL AFS IT+FTS +LADCYRSP PVTG RNYTYM+VVRS+LGG KVQLCGL
Sbjct  63    LGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCGL  122

Query  660   SQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQI  481
             +QY NL+GI+IGYTITASISMVAVK+SNCFHKNGH   C+  + PFM++FA IQ++LSQI
Sbjct  123   AQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHKVKCATSNTPFMIVFAIIQIILSQI  182

Query  480   PNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWR  301
             PNFH LSWLSI+AAVMSF Y+SIGIGLSIAK AG G    + LTGV VGVDV+G++K+WR
Sbjct  183   PNFHNLSWLSILAAVMSFCYASIGIGLSIAKAAGGGEHVRTALTGVTVGVDVSGSEKVWR  242

Query  300   CFQAIGNIAFAYAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYA  124
              FQAIG+IAFAYAYSTVLIEIQDTL++ PP EN  MK+AS +GVSTTT FY++CGC+GYA
Sbjct  243   TFQAIGDIAFAYAYSTVLIEIQDTLKAGPPSENKAMKRASLVGVSTTTFFYMLCGCVGYA  302

Query  123   AFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             AFGNDAPGNFLTGFGFYEPFWLID AN+CIA+HLVGAYQVF
Sbjct  303   AFGNDAPGNFLTGFGFYEPFWLIDFANVCIAVHLVGAYQVF  343



>ref|NP_001242816.1| uncharacterized protein LOC100777963 [Glycine max]
 gb|ACU21356.1| unknown [Glycine max]
Length=479

 Score =   511 bits (1316),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 258/334 (77%), Positives = 290/334 (87%), Gaps = 0/334 (0%)
 Frame = -1

Query  1002  SQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAG  823
              +N M+VE   +  KNFDDDG  +RTGT +TASAHIITAVIGSGVLSL+WAIAQ+GW AG
Sbjct  7     QKNSMFVETPEDGGKNFDDDGRVRRTGTWITASAHIITAVIGSGVLSLAWAIAQMGWVAG  66

Query  822   PAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANL  643
             PAVL AFS IT+FTS LLADCYRSP PV G RNYTY DVVRS LGG K QLCGL+QY NL
Sbjct  67    PAVLFAFSFITYFTSTLLADCYRSPDPVHGKRNYTYSDVVRSVLGGRKFQLCGLAQYINL  126

Query  642   VGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHEL  463
             VG++IGYTITASISMVAVK+SNCFHK+GH   C   + PFM++FA IQ+VLSQIPNFH+L
Sbjct  127   VGVTIGYTITASISMVAVKRSNCFHKHGHHVKCYTSNNPFMILFACIQIVLSQIPNFHKL  186

Query  462   SWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIG  283
              WLSIVAAVMSFAYSSIG+GLS+AKVAG G    +TLTGV VGVDVTG++K+WR FQAIG
Sbjct  187   WWLSIVAAVMSFAYSSIGLGLSVAKVAGGGEPVRTTLTGVQVGVDVTGSEKVWRTFQAIG  246

Query  282   NIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAP  103
             +IAFAYAYS VLIEIQDTL+S PPEN VMK+AS IG+ TTT+FYV+CGC+GYAAFGNDAP
Sbjct  247   DIAFAYAYSNVLIEIQDTLKSSPPENKVMKRASLIGILTTTLFYVLCGCLGYAAFGNDAP  306

Query  102   GNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GNFLTGFGFYEPFWLID ANICIA+HLVGAYQVF
Sbjct  307   GNFLTGFGFYEPFWLIDFANICIAVHLVGAYQVF  340



>gb|KHN08198.1| Amino acid permease 6 [Glycine soja]
Length=479

 Score =   511 bits (1316),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 258/334 (77%), Positives = 290/334 (87%), Gaps = 0/334 (0%)
 Frame = -1

Query  1002  SQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAG  823
              +N M+VE   +  KNFDDDG  +RTGT +TASAHIITAVIGSGVLSL+WAIAQ+GW AG
Sbjct  7     QKNSMFVETPEDGGKNFDDDGRVRRTGTWITASAHIITAVIGSGVLSLAWAIAQMGWVAG  66

Query  822   PAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANL  643
             PAVL AFS IT+FTS LLADCYRSP PV G RNYTY DVVRS LGG K QLCGL+QY NL
Sbjct  67    PAVLFAFSFITYFTSTLLADCYRSPDPVHGKRNYTYSDVVRSVLGGRKFQLCGLAQYINL  126

Query  642   VGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHEL  463
             VG++IGYTITASISMVAVK+SNCFHK+GH   C   + PFM++FA IQ+VLSQIPNFH+L
Sbjct  127   VGVTIGYTITASISMVAVKRSNCFHKHGHHVKCYTSNNPFMILFACIQIVLSQIPNFHKL  186

Query  462   SWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIG  283
              WLSIVAAVMSFAYSSIG+GLS+AKVAG G    +TLTGV VGVDVTG++K+WR FQAIG
Sbjct  187   WWLSIVAAVMSFAYSSIGLGLSVAKVAGGGEPVRTTLTGVQVGVDVTGSEKVWRTFQAIG  246

Query  282   NIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAP  103
             +IAFAYAYS VLIEIQDTL+S PPEN VMK+AS IG+ TTT+FYV+CGC+GYAAFGNDAP
Sbjct  247   DIAFAYAYSNVLIEIQDTLKSSPPENKVMKRASLIGILTTTLFYVLCGCLGYAAFGNDAP  306

Query  102   GNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GNFLTGFGFYEPFWLID ANICIA+HLVGAYQVF
Sbjct  307   GNFLTGFGFYEPFWLIDFANICIAVHLVGAYQVF  340



>ref|XP_003526513.1| PREDICTED: amino acid permease 6-like [Glycine max]
Length=479

 Score =   511 bits (1316),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 259/334 (78%), Positives = 290/334 (87%), Gaps = 0/334 (0%)
 Frame = -1

Query  1002  SQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAG  823
              +N M+VE   +  KNFDDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQ+GW AG
Sbjct  7     QKNSMFVETPEDGGKNFDDDGRVKRTGTWITASAHIITAVIGSGVLSLAWAIAQMGWVAG  66

Query  822   PAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANL  643
             PAVL AFS IT+FTS LLADCYRSP PV G RNYTY DVVRS LGG K QLCGL+QY NL
Sbjct  67    PAVLFAFSFITYFTSTLLADCYRSPDPVHGKRNYTYSDVVRSVLGGRKFQLCGLAQYINL  126

Query  642   VGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHEL  463
             VG++IGYTITASISMVAVK+SNCFHK+GH   C   + PFM++FA IQ+VLSQIPNFH+L
Sbjct  127   VGVTIGYTITASISMVAVKRSNCFHKHGHHDKCYTSNNPFMILFACIQIVLSQIPNFHKL  186

Query  462   SWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIG  283
              WLSIVAAVMSFAYSSIG+GLS+AKVAG G    +TLTGV VGVDVTG++K+WR FQAIG
Sbjct  187   WWLSIVAAVMSFAYSSIGLGLSVAKVAGGGEPVRTTLTGVQVGVDVTGSEKVWRTFQAIG  246

Query  282   NIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAP  103
             +IAFAYAYS VLIEIQDTL+S PPEN VMK+AS IG+ TTT+FYV+CGC+GYAAFGNDAP
Sbjct  247   DIAFAYAYSNVLIEIQDTLKSSPPENKVMKRASLIGILTTTLFYVLCGCLGYAAFGNDAP  306

Query  102   GNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GNFLTGFGFYEPFWLID ANICIA+HLVGAYQVF
Sbjct  307   GNFLTGFGFYEPFWLIDFANICIAVHLVGAYQVF  340



>ref|XP_007222665.1| hypothetical protein PRUPE_ppa004980mg [Prunus persica]
 gb|EMJ23864.1| hypothetical protein PRUPE_ppa004980mg [Prunus persica]
Length=483

 Score =   511 bits (1315),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 253/337 (75%), Positives = 294/337 (87%), Gaps = 2/337 (1%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M +  NP  VE G +  KN DDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  10    MYMEHNPGIVENG-DFRKNLDDDGRPKRTGTWMTASAHIITAVIGSGVLSLAWAIAQLGW  68

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS IT+FTS LLADCYRSP PV G RNYTYMDVVR++LGG KVQLCGL+QY
Sbjct  69    VAGPAVLMAFSFITYFTSTLLADCYRSPDPVHGKRNYTYMDVVRANLGGRKVQLCGLAQY  128

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+G++IGYTITASISMVAVK+SNCFHK+GH   C   + PFM+IFA IQ++LSQIPNF
Sbjct  129   GNLIGVTIGYTITASISMVAVKRSNCFHKHGHHVKCRTSNNPFMIIFACIQILLSQIPNF  188

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSI+AAVMSFAYSSIG+GLS+AKV  +G  A +TLTG  VG+DV+ +DK+W+ FQ
Sbjct  189   HKLSWLSIIAAVMSFAYSSIGLGLSVAKVI-AGPHARTTLTGGTVGIDVSASDKVWKTFQ  247

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYSTVL+EIQDTL+S P EN  MK+A++IG++TTTVFYV+CGC+GYAAFGN
Sbjct  248   AIGDIAFAYAYSTVLVEIQDTLKSPPAENKAMKRATSIGIATTTVFYVLCGCVGYAAFGN  307

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             DAPGNFLTGFGFYEPFWL+D+ANICIAIHL+GAYQVF
Sbjct  308   DAPGNFLTGFGFYEPFWLVDLANICIAIHLIGAYQVF  344



>ref|XP_008219153.1| PREDICTED: amino acid permease 6-like [Prunus mume]
Length=483

 Score =   510 bits (1313),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 252/337 (75%), Positives = 294/337 (87%), Gaps = 2/337 (1%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M +  NP  VE G +  KN DDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  10    MYMEHNPGIVENG-DFRKNLDDDGRPKRTGTWMTASAHIITAVIGSGVLSLAWAIAQLGW  68

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS IT+FTS LLADCYRSP PV G RNYTYMDVVR++LGG KVQLCGL+QY
Sbjct  69    VAGPAVLMAFSFITYFTSTLLADCYRSPDPVHGKRNYTYMDVVRANLGGRKVQLCGLAQY  128

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+G++IGYTITASISMVAVK+SNCFHK+GH   C   + PFM+IFA IQ++LSQIPNF
Sbjct  129   GNLIGVTIGYTITASISMVAVKRSNCFHKHGHHVKCRTSNNPFMIIFACIQILLSQIPNF  188

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSI+AAVMSFAYSSIG+GLS+AKV  +G  A +TLTG  VG+DV+ ++K+W+ FQ
Sbjct  189   HKLSWLSIIAAVMSFAYSSIGLGLSVAKVI-AGPHARTTLTGATVGIDVSASEKVWKTFQ  247

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYSTVL+EIQDTL+S P EN  MK+A++IG++TTTVFYV+CGC+GYAAFGN
Sbjct  248   AIGDIAFAYAYSTVLVEIQDTLKSPPAENKAMKRATSIGIATTTVFYVLCGCVGYAAFGN  307

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             DAPGNFLTGFGFYEPFWL+D+ANICIAIHL+GAYQVF
Sbjct  308   DAPGNFLTGFGFYEPFWLVDLANICIAIHLIGAYQVF  344



>ref|XP_006280391.1| hypothetical protein CARUB_v10026318mg [Capsella rubella]
 gb|EOA13289.1| hypothetical protein CARUB_v10026318mg [Capsella rubella]
Length=481

 Score =   509 bits (1312),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 256/343 (75%), Positives = 295/343 (86%), Gaps = 2/343 (1%)
 Frame = -1

Query  1026  HPRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAI  847
               +  M+V Q+    E G +  KNFD+DG EKR+GT VT SAHIITAVIGSGVLSL+WAI
Sbjct  2     EKKKTMSVEQSFTDHEIG-DTNKNFDEDGREKRSGTWVTGSAHIITAVIGSGVLSLAWAI  60

Query  846   AQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLC  667
             AQLGW AGPAVL AFS IT+FTS +LADCYRSP PVTG RNYTYM+VVRS+LGG KVQLC
Sbjct  61    AQLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLC  120

Query  666   GLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLS  487
             GL+QY NLVGI+IGYTITASISMVAVK+SNCFHKNGH   C+  + PFM++FA IQ++LS
Sbjct  121   GLAQYGNLVGITIGYTITASISMVAVKRSNCFHKNGHHVKCATSNTPFMIVFAIIQIILS  180

Query  486   QIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKI  307
             QIPNFH LSWLSI+AAVMSF Y+SIGIGLSIAK AG G    ++LTGV VG+DV+G++K+
Sbjct  181   QIPNFHNLSWLSILAAVMSFCYASIGIGLSIAKAAGGGEHVRTSLTGVTVGIDVSGSEKV  240

Query  306   WRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIG  130
             WR FQAIG+IAFAYAYSTVLIEIQDTL++ PP EN  MK+AS +GVSTTT FY++CGC+G
Sbjct  241   WRTFQAIGDIAFAYAYSTVLIEIQDTLKAGPPSENKAMKRASLVGVSTTTFFYMLCGCVG  300

Query  129   YAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             YAAFGNDAPGNFLTGFGFYEPFWLID AN+CIA+HLVGAYQVF
Sbjct  301   YAAFGNDAPGNFLTGFGFYEPFWLIDFANVCIAVHLVGAYQVF  343



>gb|KEH36106.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=384

 Score =   505 bits (1301),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 256/336 (76%), Positives = 289/336 (86%), Gaps = 3/336 (1%)
 Frame = -1

Query  1002  SQNPMYVEEGREIL---KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
              +N MY+E         KNFDDDG  KRTGT VTASAHIITAVIGSGVLSL+WAIAQ+GW
Sbjct  7     QKNSMYIETPEAFTDGSKNFDDDGRAKRTGTWVTASAHIITAVIGSGVLSLAWAIAQMGW  66

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS IT+FTS LLAD YRSP PV G RNYTY +VVRS LGG K QLCGL+QY
Sbjct  67    IAGPAVLLAFSFITYFTSTLLADSYRSPDPVHGKRNYTYSEVVRSVLGGRKFQLCGLAQY  126

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+G++IGYTITASISMVAVK+SNC+HK GHD  C + + PFM+IFA IQ+VLSQIPNF
Sbjct  127   INLIGVTIGYTITASISMVAVKRSNCYHKQGHDAKCYISNNPFMIIFACIQIVLSQIPNF  186

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSIVAAVMSFAYSSIG+GLSIAKVAG G A  ++LTGV VGVDVTG +K+WR FQ
Sbjct  187   HKLSWLSIVAAVMSFAYSSIGLGLSIAKVAGRGPAVRTSLTGVQVGVDVTGTEKVWRMFQ  246

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYS VLIEIQDTL+S PPEN VMK+AS IG+ TTT+FY++CGC+GYAAFGN
Sbjct  247   AIGDIAFAYAYSNVLIEIQDTLKSSPPENQVMKRASLIGILTTTMFYMLCGCLGYAAFGN  306

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQV  4
             DAPGNFLTGFGFYEPFWLID+ANI IA+HL+GAYQV
Sbjct  307   DAPGNFLTGFGFYEPFWLIDLANIFIAVHLIGAYQV  342



>ref|XP_009335480.1| PREDICTED: amino acid permease 6-like [Pyrus x bretschneideri]
Length=483

 Score =   509 bits (1310),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 253/343 (74%), Positives = 296/343 (86%), Gaps = 2/343 (1%)
 Frame = -1

Query  1029  KHPRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWA  850
             K  +  M + QNP  +E G +  KN DDDG  KRTGT +TASAHIITAVIGSGVLSL+WA
Sbjct  4     KFQKTSMYIDQNPAIIENG-DFRKNVDDDGRPKRTGTWMTASAHIITAVIGSGVLSLAWA  62

Query  849   IAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQL  670
             IAQLGW AGPAVL AFS IT+FT+ LLADCYRSP PV+G RNYTYMDVVR++LGG KVQL
Sbjct  63    IAQLGWVAGPAVLMAFSFITYFTATLLADCYRSPDPVSGKRNYTYMDVVRANLGGRKVQL  122

Query  669   CGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVL  490
             CGL+QY+NLVG++IGYTITASISMVAVK+SNCFHK+GH   C   + PFM+IFA IQL L
Sbjct  123   CGLAQYSNLVGVTIGYTITASISMVAVKRSNCFHKHGHHVKCHTSNNPFMIIFACIQLFL  182

Query  489   SQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADK  310
             SQI NFH+L WLSIVAA+MSFAYSSIG+GLS+AKV  SG  A ++LTG  VG+DV+ ++K
Sbjct  183   SQIQNFHKLWWLSIVAAIMSFAYSSIGLGLSLAKVI-SGPHARTSLTGGTVGIDVSASEK  241

Query  309   IWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIG  130
             +W+ FQAIG+IAFAYAYSTVL+EIQDTL+S P EN  MK+A++IG++TTTVFYV+CGC+G
Sbjct  242   VWKTFQAIGDIAFAYAYSTVLVEIQDTLKSPPAENKAMKRATSIGIATTTVFYVLCGCVG  301

Query  129   YAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             YAAFGNDAPGNFLTGFGFYEPFWL+DVANICIAIHL+GAYQVF
Sbjct  302   YAAFGNDAPGNFLTGFGFYEPFWLVDVANICIAIHLIGAYQVF  344



>gb|KHN37208.1| Amino acid permease 6 [Glycine soja]
Length=469

 Score =   508 bits (1308),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 258/330 (78%), Positives = 288/330 (87%), Gaps = 0/330 (0%)
 Frame = -1

Query  990  MYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVL  811
            M+VE   +  KNFDDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQ+GW AGPAVL
Sbjct  1    MFVETPEDGGKNFDDDGRVKRTGTWITASAHIITAVIGSGVLSLAWAIAQMGWVAGPAVL  60

Query  810  AAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGIS  631
             AFS IT+FTS LLADCYRSP PV G RNYTY DVVRS LGG K QLCGL+QY NLVG++
Sbjct  61   FAFSFITYFTSTLLADCYRSPDPVHGKRNYTYSDVVRSVLGGRKFQLCGLAQYINLVGVT  120

Query  630  IGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLS  451
            IGYTITASISMVAVK+SNCFHK+GH   C   + PFM++FA IQ+VLSQIPNFH+L WLS
Sbjct  121  IGYTITASISMVAVKRSNCFHKHGHHDKCYTSNNPFMILFACIQIVLSQIPNFHKLWWLS  180

Query  450  IVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAF  271
            IVAAVMSFAYSSIG+GLS+AKVAG G    +TLTGV VGVDVTG++K+WR FQAIG+IAF
Sbjct  181  IVAAVMSFAYSSIGLGLSVAKVAGGGEPVRTTLTGVQVGVDVTGSEKVWRTFQAIGDIAF  240

Query  270  AYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFL  91
            AYAYS VLIEIQDTL+S PPEN VMK+AS IG+ TTT+FYV+CGC+GYAAFGNDAPGNFL
Sbjct  241  AYAYSNVLIEIQDTLKSSPPENKVMKRASLIGILTTTLFYVLCGCLGYAAFGNDAPGNFL  300

Query  90   TGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            TGFGFYEPFWLID ANICIA+HLVGAYQVF
Sbjct  301  TGFGFYEPFWLIDFANICIAVHLVGAYQVF  330



>ref|XP_010556498.1| PREDICTED: amino acid permease 6 [Tarenaya hassleriana]
Length=478

 Score =   508 bits (1307),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 257/338 (76%), Positives = 295/338 (87%), Gaps = 3/338 (1%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNF-DDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLG  835
             M V QN    E G ++ K+F DDDG EKRTGT +TASAHIITAVIGSGVLSL+WA AQLG
Sbjct  4     MFVEQNIGAYESG-DVNKSFVDDDGREKRTGTWMTASAHIITAVIGSGVLSLAWANAQLG  62

Query  834   WAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQ  655
             W AGPAVL AFS+IT+FTS +LADCYRSP PVTG RNYTYM+VVRS+LGG KVQLCGL+Q
Sbjct  63    WIAGPAVLMAFSIITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCGLAQ  122

Query  654   YANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPN  475
             Y NL+GI+IGYTITASISMVAVK+SNCFHK+GH   C   + PFM+IFA IQ+VLSQIPN
Sbjct  123   YGNLIGITIGYTITASISMVAVKRSNCFHKHGHHVKCQTSNNPFMIIFACIQIVLSQIPN  182

Query  474   FHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCF  295
             FH+LSWLSI+AAVMSFAY+SIG+GLSIAKV G G  + + LTGV +GVDVT ++K+WR F
Sbjct  183   FHKLSWLSILAAVMSFAYASIGVGLSIAKVVG-GAHSRTALTGVTIGVDVTSSEKVWRTF  241

Query  294   QAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFG  115
             QAIG+IAFAYAYSTVLIEIQDTL+S P EN  MK+AS +GVSTTT+FY++CGC+GYAAFG
Sbjct  242   QAIGDIAFAYAYSTVLIEIQDTLKSSPAENKAMKRASLVGVSTTTMFYMLCGCVGYAAFG  301

Query  114   NDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             NDAPGNFLTGFGFYEPFWLID AN+CIAIHL+GAYQVF
Sbjct  302   NDAPGNFLTGFGFYEPFWLIDFANVCIAIHLIGAYQVF  339



>ref|XP_003603665.1| Amino acid permease [Medicago truncatula]
 gb|AES73916.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=482

 Score =   508 bits (1307),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 257/337 (76%), Positives = 290/337 (86%), Gaps = 3/337 (1%)
 Frame = -1

Query  1002  SQNPMYVEEGREIL---KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
              +N MY+E         KNFDDDG  KRTGT VTASAHIITAVIGSGVLSL+WAIAQ+GW
Sbjct  7     QKNSMYIETPEAFTDGSKNFDDDGRAKRTGTWVTASAHIITAVIGSGVLSLAWAIAQMGW  66

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS IT+FTS LLAD YRSP PV G RNYTY +VVRS LGG K QLCGL+QY
Sbjct  67    IAGPAVLLAFSFITYFTSTLLADSYRSPDPVHGKRNYTYSEVVRSVLGGRKFQLCGLAQY  126

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+G++IGYTITASISMVAVK+SNC+HK GHD  C + + PFM+IFA IQ+VLSQIPNF
Sbjct  127   INLIGVTIGYTITASISMVAVKRSNCYHKQGHDAKCYISNNPFMIIFACIQIVLSQIPNF  186

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSIVAAVMSFAYSSIG+GLSIAKVAG G A  ++LTGV VGVDVTG +K+WR FQ
Sbjct  187   HKLSWLSIVAAVMSFAYSSIGLGLSIAKVAGRGPAVRTSLTGVQVGVDVTGTEKVWRMFQ  246

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYS VLIEIQDTL+S PPEN VMK+AS IG+ TTT+FY++CGC+GYAAFGN
Sbjct  247   AIGDIAFAYAYSNVLIEIQDTLKSSPPENQVMKRASLIGILTTTMFYMLCGCLGYAAFGN  306

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             DAPGNFLTGFGFYEPFWLID+ANI IA+HL+GAYQVF
Sbjct  307   DAPGNFLTGFGFYEPFWLIDLANIFIAVHLIGAYQVF  343



>gb|AFK42490.1| unknown [Medicago truncatula]
Length=482

 Score =   507 bits (1306),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 257/337 (76%), Positives = 290/337 (86%), Gaps = 3/337 (1%)
 Frame = -1

Query  1002  SQNPMYVEEGREIL---KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
              +N MY+E         KNFDDDG  KRTGT VTASAHIITAVIGSGVLSL+WAIAQ+GW
Sbjct  7     QKNSMYIETPEAFTDGSKNFDDDGRAKRTGTWVTASAHIITAVIGSGVLSLAWAIAQMGW  66

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS IT+FTS LLAD YRSP PV G RNYTY +VVRS LGG K QLCGL+QY
Sbjct  67    IAGPAVLLAFSFITYFTSTLLADSYRSPDPVHGKRNYTYSEVVRSVLGGRKFQLCGLAQY  126

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+G++IGYTITASISMVAVK+SNC+HK GHD  C + + PFM+IFA IQ+VLSQIPNF
Sbjct  127   INLIGVTIGYTITASISMVAVKRSNCYHKQGHDAKCYISNNPFMIIFACIQIVLSQIPNF  186

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSIVAAVMSFAYSSIG+GLSIAKVAG G A  ++LTGV VGVDVTG +K+WR FQ
Sbjct  187   HKLSWLSIVAAVMSFAYSSIGLGLSIAKVAGRGPAVRTSLTGVQVGVDVTGTEKVWRMFQ  246

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYS VLIEIQDTL+S PPEN VMK+AS IG+ TTT+FY++CGC+GYAAFGN
Sbjct  247   AIGDIAFAYAYSNVLIEIQDTLKSSPPENQVMKRASLIGILTTTMFYMLCGCLGYAAFGN  306

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             DAPGNFLTGFGFYEPFWLID+ANI IA+HL+GAYQVF
Sbjct  307   DAPGNFLTGFGFYEPFWLIDLANIFIAVHLIGAYQVF  343



>ref|XP_002285557.1| PREDICTED: amino acid permease 6 [Vitis vinifera]
 emb|CBI19332.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   506 bits (1303),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 247/335 (74%), Positives = 297/335 (89%), Gaps = 2/335 (1%)
 Frame = -1

Query  1005  VSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAA  826
             V Q P  +E+G +I KN DDDG  KRTGTL+TASAHIITAVIGSGVLSL+W+I+QLGW A
Sbjct  12    VEQAPETIEKG-DIGKNLDDDGRFKRTGTLLTASAHIITAVIGSGVLSLAWSISQLGWIA  70

Query  825   GPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYAN  646
             GP VL  FS IT+FTS LLADCYRSP P+TG RNYTYMDVVR++LGG+KVQLCG++QY N
Sbjct  71    GPVVLVVFSFITYFTSTLLADCYRSPDPITGKRNYTYMDVVRANLGGMKVQLCGIAQYGN  130

Query  645   LVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHE  466
             L+G++IGYTITASISMVAV++SNC+HK+GH   C+   YP+M+IFA IQ+VLSQIPNFH+
Sbjct  131   LIGVTIGYTITASISMVAVRRSNCYHKHGHQAKCNPSDYPYMIIFACIQIVLSQIPNFHK  190

Query  465   LSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAI  286
             LSWLSI+AAVMSF+Y+SIGIGLSIA+VAG G  A +TLTG  VGVD++ ++K+WR F++I
Sbjct  191   LSWLSILAAVMSFSYASIGIGLSIARVAG-GAHARTTLTGRTVGVDLSSSEKVWRTFESI  249

Query  285   GNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDA  106
             GNIAFAYAYSTVL+EIQDTL+S PPEN VMKKA+  G+STT++FYV+CGC+GYAAFGNDA
Sbjct  250   GNIAFAYAYSTVLVEIQDTLKSSPPENKVMKKATFAGISTTSLFYVLCGCVGYAAFGNDA  309

Query  105   PGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             PGNFLTGFGF+EPFWLID+AN+ IAIHL+GAYQVF
Sbjct  310   PGNFLTGFGFFEPFWLIDLANVFIAIHLIGAYQVF  344



>ref|XP_010667459.1| PREDICTED: amino acid permease 6-like [Beta vulgaris subsp. vulgaris]
Length=491

 Score =   505 bits (1300),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 254/336 (76%), Positives = 287/336 (85%), Gaps = 7/336 (2%)
 Frame = -1

Query  990  MYVEEG------REILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWA  829
            MY+E+G       +  KN DDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQLGWA
Sbjct  17   MYIEQGGHGGNVHDFDKNLDDDGRHKRTGTALTASAHIITAVIGSGVLSLAWAIAQLGWA  76

Query  828  AGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYA  649
             GPAVL AFS IT+ TS  LAD YRSP PVTG RNYTYM+VVR++LGG KVQLCGL+QY 
Sbjct  77   VGPAVLVAFSFITYMTSTFLADGYRSPDPVTGKRNYTYMEVVRANLGGRKVQLCGLAQYV  136

Query  648  NLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFH  469
            NLVG+SIGYTITASISMVAVK+SNCFHK GH   C+  + PFM+IF  IQ++LSQIPNFH
Sbjct  137  NLVGVSIGYTITASISMVAVKRSNCFHKYGHHVKCNTSNNPFMIIFGCIQILLSQIPNFH  196

Query  468  ELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQA  289
            ELSWLS+VAA+MSF Y+SIG+ LSIAKV G G A  S LTGV VGVDVT ADK+WRCFQA
Sbjct  197  ELSWLSMVAAIMSFTYASIGLALSIAKVVGGGIARTS-LTGVTVGVDVTAADKVWRCFQA  255

Query  288  IGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGND  109
            IG+IAFAYAYS VLIEIQDTL+S PPEN VMKKAS +GVSTT++FY++CGC GYAAFGN+
Sbjct  256  IGDIAFAYAYSNVLIEIQDTLKSSPPENKVMKKASLVGVSTTSLFYILCGCFGYAAFGNE  315

Query  108  APGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            APGNFLTGFGFYEPFWL+D AN+CIA+HLVGAYQVF
Sbjct  316  APGNFLTGFGFYEPFWLVDFANVCIAVHLVGAYQVF  351



>ref|XP_002510013.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF52200.1| amino acid transporter, putative [Ricinus communis]
Length=484

 Score =   504 bits (1298),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 255/346 (74%), Positives = 292/346 (84%), Gaps = 10/346 (3%)
 Frame = -1

Query  1011  MAVSQNP--MYVE----EGRE---ILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSL  859
             MA    P  MY+E    EG E   + KN DDDG  KRTGT +TASAHIITAVIGSGVLSL
Sbjct  1     MAKEMQPSSMYLEQVDVEGYENGGVRKNVDDDGRPKRTGTWLTASAHIITAVIGSGVLSL  60

Query  858   SWAIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVK  679
             +WAIAQLGW AGP +L AFS ITFFTS LLAD YRSP PVTG RNYTYMD VR++LGG K
Sbjct  61    AWAIAQLGWVAGPVILMAFSFITFFTSTLLADSYRSPDPVTGKRNYTYMDAVRANLGGWK  120

Query  678   VQLCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQ  499
             V  CG+SQYANLVGI++GYTITASISMVAVK+SNCFH++GH   C   + P+M+IFA IQ
Sbjct  121   VTFCGISQYANLVGITVGYTITASISMVAVKRSNCFHRHGHAAKCHTSNNPYMIIFACIQ  180

Query  498   LVLSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtG  319
             ++LSQIPNFH+LSWLS++AAVMSFAYSSIG+GLSIAKVAG G    +++TG  VGVDVT 
Sbjct  181   IILSQIPNFHKLSWLSVLAAVMSFAYSSIGLGLSIAKVAG-GEHVRTSITGTTVGVDVTA  239

Query  318   ADKIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCG  139
             A KIWR FQ+IG+IAFAYAYSTVLIEIQDT++S PPEN  MKKAS +G+ TTT+FY++CG
Sbjct  240   AQKIWRAFQSIGDIAFAYAYSTVLIEIQDTIKSGPPENKAMKKASFVGIVTTTMFYILCG  299

Query  138   CIGYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             CIGYAAFGNDAPGNFLTGFGFYEPFWLID+AN+CIAIHL+GAYQVF
Sbjct  300   CIGYAAFGNDAPGNFLTGFGFYEPFWLIDIANVCIAIHLIGAYQVF  345



>ref|XP_004136237.1| PREDICTED: amino acid permease 6-like [Cucumis sativus]
 ref|XP_004168126.1| PREDICTED: amino acid permease 6-like [Cucumis sativus]
Length=477

 Score =   503 bits (1294),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 249/341 (73%), Positives = 294/341 (86%), Gaps = 7/341 (2%)
 Frame = -1

Query  1023  PRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIA  844
             P+  M + QNP         LKNFDDDG +KRTGT VTASAHIITAVIGSGVLSL+WAIA
Sbjct  7     PKSSMYLDQNP------EAALKNFDDDGRQKRTGTWVTASAHIITAVIGSGVLSLAWAIA  60

Query  843   QLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCG  664
             QLGW AGPAVL AFS+IT+ T+ LLADCYRSP PVTG RNYTYMDVV++HLGG  V+ CG
Sbjct  61    QLGWVAGPAVLVAFSMITYLTATLLADCYRSPDPVTGKRNYTYMDVVKAHLGGNNVKFCG  120

Query  663   LSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQ  484
             L+QY NLVG+SIGYTITASISMVAVK+SNCFHK GH+ DC+   YPFM+I+AAIQL+LSQ
Sbjct  121   LAQYGNLVGVSIGYTITASISMVAVKRSNCFHKYGHEADCNPSQYPFMIIYAAIQLILSQ  180

Query  483   IPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIW  304
             IPNFH+LS+LSI+AAVMSFAY++IG+GLSIA+V G G  A +TLTG  +GVDVTG +KI+
Sbjct  181   IPNFHKLSFLSIIAAVMSFAYAAIGVGLSIARVVGDGH-ARTTLTGATIGVDVTGQEKIF  239

Query  303   RCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYA  124
             + FQA+G+IAFAY+YS VL+EIQDTLRS P EN  MKKAS +G++TT++FY++CGC+GYA
Sbjct  240   KAFQALGDIAFAYSYSMVLVEIQDTLRSSPAENKAMKKASFVGITTTSLFYILCGCVGYA  299

Query  123   AFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             AFGNDAPGNFLTGFGFYEPFWLID AN+CI +HL+GAYQVF
Sbjct  300   AFGNDAPGNFLTGFGFYEPFWLIDFANVCIVVHLIGAYQVF  340



>ref|XP_004501076.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=481

 Score =   503 bits (1294),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 255/337 (76%), Positives = 289/337 (86%), Gaps = 4/337 (1%)
 Frame = -1

Query  1002  SQNPMYVEEGREIL---KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
              +N MY+E     +   KNFD+DG  KRTGT VTASAHIITAVIGSGVLSL+WAIAQ+GW
Sbjct  7     QKNSMYIETPESFVDGGKNFDEDGRPKRTGTWVTASAHIITAVIGSGVLSLAWAIAQMGW  66

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS IT+FTS LLAD YRSP PV G RNYTY +VVRS LGG K QLCGL+QY
Sbjct  67    VAGPAVLLAFSFITYFTSTLLADSYRSPDPVHGKRNYTYSEVVRSVLGGRKFQLCGLAQY  126

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+G++IGYTITASISMVAVK+SNC+HK+GH   C + + PFM+IFA IQ+VLSQIPNF
Sbjct  127   INLIGVTIGYTITASISMVAVKRSNCYHKHGHHAKCYISNNPFMIIFACIQIVLSQIPNF  186

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSIVAAVMSFAYSSIG+GLSIAKVAG G    S LTGV VGVDVT  +K+WR FQ
Sbjct  187   HKLSWLSIVAAVMSFAYSSIGLGLSIAKVAGGGPVRTS-LTGVQVGVDVTATEKVWRMFQ  245

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYS VLIEIQDTL+S PPEN VMK+AS IG+ TTT+FY++CGC+GYAAFGN
Sbjct  246   AIGDIAFAYAYSNVLIEIQDTLKSSPPENQVMKRASLIGILTTTMFYMLCGCLGYAAFGN  305

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             DAPGNFLTGFGFYEP+WLIDVANICIA+HL+GAYQVF
Sbjct  306   DAPGNFLTGFGFYEPYWLIDVANICIAVHLIGAYQVF  342



>ref|XP_009357221.1| PREDICTED: amino acid permease 6-like [Pyrus x bretschneideri]
Length=483

 Score =   502 bits (1293),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 248/337 (74%), Positives = 291/337 (86%), Gaps = 2/337 (1%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M +  NP  +E G +  KN DDDG  KRTGT VTASAHIITAVIGSGVLSL+W IAQLGW
Sbjct  10    MYIEHNPAIIENG-DFRKNVDDDGRPKRTGTWVTASAHIITAVIGSGVLSLAWTIAQLGW  68

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPA+L AFS ITFFTS LLADCYRSP PV+G RNYTYMDVV+++LGG KVQLCGL+QY
Sbjct  69    VAGPAILIAFSFITFFTSTLLADCYRSPDPVSGKRNYTYMDVVQANLGGRKVQLCGLAQY  128

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+G++IGYTITASISMVAVK+SNCFHK+GH   C   + PFM+IFA IQL LSQI NF
Sbjct  129   GNLIGVTIGYTITASISMVAVKRSNCFHKHGHHVKCHTSNNPFMIIFACIQLFLSQIQNF  188

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSI+AAVMSFAYSSIG+GLS+AKV G G  A +TLTG  VG+DV+ ++K+W+ FQ
Sbjct  189   HKLSWLSILAAVMSFAYSSIGLGLSVAKVIG-GPHARTTLTGTTVGIDVSASEKVWKTFQ  247

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYSTVL+EIQDTL+S P EN  MK+A+++G++TTT+FYV+CG +GYAAFGN
Sbjct  248   AIGDIAFAYAYSTVLVEIQDTLKSPPAENKAMKRATSVGIATTTLFYVLCGSVGYAAFGN  307

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             DAPGNFLTGFGFYEPFWL+D+ANICIAIHL+GAYQVF
Sbjct  308   DAPGNFLTGFGFYEPFWLVDIANICIAIHLIGAYQVF  344



>ref|XP_003588450.1| Amino acid transporter [Medicago truncatula]
 gb|AES58701.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=472

 Score =   500 bits (1287),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 248/320 (78%), Positives = 282/320 (88%), Gaps = 0/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KNFDDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQ+GW AGPAVL AFS IT+FT
Sbjct  14   KNFDDDGRAKRTGTWLTASAHIITAVIGSGVLSLAWAIAQMGWVAGPAVLFAFSFITYFT  73

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYRSP PV G RNYTY +VVR++LGG K QLCGL+QY NLVG++IGYTITASIS
Sbjct  74   STLLADCYRSPDPVHGKRNYTYTEVVRANLGGRKFQLCGLAQYINLVGVTIGYTITASIS  133

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            MVAV++SNCFHK+GH   C V + PFM+IFA IQ+VL QIPNFHELSWLSIVAAVMSFAY
Sbjct  134  MVAVQRSNCFHKHGHQDKCYVSNNPFMIIFACIQIVLCQIPNFHELSWLSIVAAVMSFAY  193

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GLS+AKVAG G    ++LTGV +GVDVT  +K+WR FQAIG+IAFAYA+S VLIE
Sbjct  194  SSIGLGLSVAKVAGGGNHVTTSLTGVQIGVDVTATEKVWRMFQAIGDIAFAYAFSNVLIE  253

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S PPEN VMK+AS IG+ TTT+FYV+CG +GYAAFGNDAPGNFLTGFGFYEPFW
Sbjct  254  IQDTLKSSPPENRVMKRASLIGILTTTLFYVLCGTLGYAAFGNDAPGNFLTGFGFYEPFW  313

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN+CIA+HL+GAYQVF
Sbjct  314  LIDFANVCIAVHLIGAYQVF  333



>ref|XP_010104540.1| hypothetical protein L484_025514 [Morus notabilis]
 gb|EXC01141.1| hypothetical protein L484_025514 [Morus notabilis]
Length=484

 Score =   500 bits (1288),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 260/345 (75%), Positives = 299/345 (87%), Gaps = 2/345 (1%)
 Frame = -1

Query  1032  RKHPRLLMAVSQNPMY-VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLS  856
             +++ +  M + QNP   V E  +  KN D+DG  KRTGT VTASAHIITAVIGSGVLSL+
Sbjct  3     KEYQKNSMFIEQNPQSAVLENGDFRKNVDEDGRAKRTGTWVTASAHIITAVIGSGVLSLA  62

Query  855   WAIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKV  676
             WA AQLGWAAGPAVL AFS IT+FTS LLADCYR+P PVTG RNYTYMD V+++LGG KV
Sbjct  63    WANAQLGWAAGPAVLMAFSFITYFTSTLLADCYRAPDPVTGKRNYTYMDAVKAYLGGRKV  122

Query  675   QLCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQL  496
             QLCGL+QY NLVGI++GYTITASISMVAVK+SNCFHKNGH   CS+ +YPFM+IF  IQ+
Sbjct  123   QLCGLAQYGNLVGITVGYTITASISMVAVKRSNCFHKNGHSAKCSISNYPFMIIFGCIQI  182

Query  495   VLSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGA  316
             VLSQIPNFH+LSWLSI+AAVMSFAYSSIG+GLSIAKV G G  A +TLTGV VGVDVTG+
Sbjct  183   VLSQIPNFHDLSWLSILAAVMSFAYSSIGVGLSIAKVIG-GTHARTTLTGVTVGVDVTGS  241

Query  315   DKIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGC  136
             +K+WR FQAIG+IAFAYA+STVLIEIQDTLR+ PPEN  MKKA+  G++TTT FYV+CGC
Sbjct  242   EKVWRTFQAIGDIAFAYAFSTVLIEIQDTLRASPPENKSMKKATFTGIATTTTFYVLCGC  301

Query  135   IGYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             +GYAAFGN+APGNFLTGFGFYEPFWLID AN+CIAIHL+GAYQVF
Sbjct  302   VGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVCIAIHLIGAYQVF  346



>ref|XP_008339056.1| PREDICTED: amino acid permease 6 [Malus domestica]
Length=483

 Score =   498 bits (1282),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 248/337 (74%), Positives = 289/337 (86%), Gaps = 2/337 (1%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M +  NP  +E G +  KN DDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  10    MYIEHNPAIIENG-DFRKNVDDDGRPKRTGTWMTASAHIITAVIGSGVLSLAWAIAQLGW  68

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS IT+FTS LLADCYRSP PV+G RNYTYMDVVR++LGG KV LCGL+QY
Sbjct  69    VAGPAVLMAFSFITYFTSTLLADCYRSPDPVSGKRNYTYMDVVRANLGGXKVLLCGLAQY  128

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+G++IGYTITASISMVAVK+SNCFHK+GH   C   + PFM+IFA IQL LSQI NF
Sbjct  129   GNLIGVTIGYTITASISMVAVKRSNCFHKHGHHVKCHTSNNPFMIIFACIQLFLSQIQNF  188

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSI+AAVMSFAYS IG+GLSIAKV G G  A +TLTG  VG+DV+ ++K+W+ FQ
Sbjct  189   HKLSWLSILAAVMSFAYSLIGLGLSIAKVIG-GPHARTTLTGTTVGIDVSASEKVWKTFQ  247

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYSTVL+EIQDTL+S P EN  MK+A++IG++TTT+FYV+CGC+GYAAFGN
Sbjct  248   AIGDIAFAYAYSTVLVEIQDTLKSPPAENKAMKRATSIGIATTTLFYVLCGCVGYAAFGN  307

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
              APGNFLTGFGFYEPFWL+D+ANICIAIHL+ AYQVF
Sbjct  308   XAPGNFLTGFGFYEPFWLVDIANICIAIHLIXAYQVF  344



>ref|XP_002865746.1| hypothetical protein ARALYDRAFT_495022 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42005.1| hypothetical protein ARALYDRAFT_495022 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   498 bits (1282),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 256/364 (70%), Positives = 296/364 (81%), Gaps = 28/364 (8%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M+V Q+    E G +I KNFDDDG EKR+GT +T SAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  7     MSVEQSYTDHEIG-DINKNFDDDGREKRSGTWMTGSAHIITAVIGSGVLSLAWAIAQLGW  65

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS IT+FTS +LADCYRSP PVTG RNYTYM+VVRS+LGG KVQLCGL+QY
Sbjct  66    VAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCGLAQY  125

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+GI+IGYTITASISMVAVK+SNCFHKNGH+  C+  + PFM++FA IQ++LSQIPNF
Sbjct  126   GNLIGITIGYTITASISMVAVKRSNCFHKNGHNVKCATSNTPFMIVFAIIQIILSQIPNF  185

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H LSWLSI+AAVMSF Y+SIG+GLSIAK AG G    +TLTGV VG+DV+G++K+WR FQ
Sbjct  186   HNLSWLSILAAVMSFCYASIGVGLSIAKAAGGGEHVRTTLTGVTVGIDVSGSEKVWRTFQ  245

Query  291   AIGNIAFAYAYSTVLIEIQ--------------------------DTLRSHPP-ENMVMK  193
             AIG+IAFAYAYSTVLIEIQ                          DTL++ PP EN  MK
Sbjct  246   AIGDIAFAYAYSTVLIEIQATTLIFLSNIQIFVRSYKLIIFCKTFDTLKAGPPSENKAMK  305

Query  192   KASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGA  13
             +AS +GVSTTT FY++CGC+GYAAFGNDAPGNFLTGFGFYEPFWLID AN+CIA+HLVGA
Sbjct  306   RASLVGVSTTTFFYMLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVCIAVHLVGA  365

Query  12    YQVF  1
             YQVF
Sbjct  366   YQVF  369



>ref|XP_004299846.1| PREDICTED: amino acid permease 6-like [Fragaria vesca subsp. 
vesca]
Length=482

 Score =   497 bits (1279),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 252/337 (75%), Positives = 290/337 (86%), Gaps = 2/337 (1%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M +  NP  +E G +  KN DDDG  KRTGT VTASAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  9     MYIDHNPSTIENG-DFRKNVDDDGRPKRTGTWVTASAHIITAVIGSGVLSLAWAIAQLGW  67

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGP VL  FS IT+FTS LLAD YRSP PV+G RNYTYMDVV+++LGG KVQLCGL+QY
Sbjct  68    VAGPIVLMIFSFITYFTSTLLADSYRSPDPVSGKRNYTYMDVVQANLGGRKVQLCGLAQY  127

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+G++IGYTITASISMVAVK+SNCFHK+GH   C   + PFM+IFA  Q++LSQIPNF
Sbjct  128   GNLIGVTIGYTITASISMVAVKRSNCFHKHGHHVKCHTSNNPFMIIFACFQILLSQIPNF  187

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSI+AAVMSFAYSSIG+GLS+AKV   G  A +TLTGV VGVDV+G++K+WR FQ
Sbjct  188   HKLSWLSILAAVMSFAYSSIGLGLSVAKVI-DGPTARTTLTGVTVGVDVSGSEKVWRTFQ  246

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYSTVL+EIQDTL S P EN  MKKA++IG+STTTVFYV+CG +GYAAFGN
Sbjct  247   AIGDIAFAYAYSTVLVEIQDTLGSPPAENKSMKKATSIGISTTTVFYVLCGTVGYAAFGN  306

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             DAPGNFLTGFGFYEPFWL+D+ANICIAIHL+GAYQVF
Sbjct  307   DAPGNFLTGFGFYEPFWLVDIANICIAIHLIGAYQVF  343



>ref|XP_007161529.1| hypothetical protein PHAVU_001G077000g [Phaseolus vulgaris]
 gb|ESW33523.1| hypothetical protein PHAVU_001G077000g [Phaseolus vulgaris]
Length=474

 Score =   496 bits (1278),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 249/333 (75%), Positives = 292/333 (88%), Gaps = 4/333 (1%)
 Frame = -1

Query  999  QNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGP  820
            + P  + +G    KNFD+DG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQ+GW AGP
Sbjct  7    ETPETLADGN---KNFDEDGRAKRTGTWITASAHIITAVIGSGVLSLAWAIAQMGWVAGP  63

Query  819  AVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLV  640
            AVL AFS IT+FTS LLAD YRSP PV G RNYTY +VV+++LGG K QLCGL+QY NLV
Sbjct  64   AVLFAFSFITYFTSTLLADSYRSPDPVHGKRNYTYSEVVKANLGGRKFQLCGLAQYINLV  123

Query  639  GISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELS  460
            G++IGYTITASISMVAVK+SNCFHK+GH+  C++ +YP+M++FA IQ+VLSQIPNFH+LS
Sbjct  124  GVTIGYTITASISMVAVKRSNCFHKHGHEAKCNINNYPYMIVFACIQIVLSQIPNFHKLS  183

Query  459  WLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGN  280
            WLSIVAAVMSFAYSSIG+GLS+AKV G G  A +++TGV VGVDVTG +K+WR FQAIG+
Sbjct  184  WLSIVAAVMSFAYSSIGLGLSLAKVIG-GAHARTSITGVQVGVDVTGTEKVWRMFQAIGD  242

Query  279  IAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPG  100
            IAFAYA+S VLIEIQDTL+S PPEN +MK+AS IG+ TTT+FYV+CGC+GYAAFGNDAPG
Sbjct  243  IAFAYAFSNVLIEIQDTLKSGPPENRMMKRASLIGIMTTTLFYVLCGCLGYAAFGNDAPG  302

Query  99   NFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            NFLTGFGFYEPFWLID ANICIA+HLVGAYQVF
Sbjct  303  NFLTGFGFYEPFWLIDFANICIAVHLVGAYQVF  335



>gb|ADB92670.1| amino acid permease 6 [Populus tremula x Populus alba]
Length=483

 Score =   496 bits (1278),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 246/337 (73%), Positives = 286/337 (85%), Gaps = 2/337 (1%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             + +++ P   E G  + KN DDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  10    LHIARGPEGSESG-GMSKNLDDDGRPKRTGTWITASAHIITAVIGSGVLSLAWAIAQLGW  68

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
               GP VL  FS ITFFTS LLAD YRSP P+TG RNYTYMD VR+HLGG KVQLCGL+QY
Sbjct  69    VVGPLVLMVFSFITFFTSTLLADSYRSPDPITGNRNYTYMDAVRAHLGGRKVQLCGLAQY  128

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+GI++GYTITASISMVAV++SNCFHK+GH   C   + P+M+IFA IQ++LSQIPNF
Sbjct  129   VNLIGITVGYTITASISMVAVRRSNCFHKHGHAVKCQTSNNPYMIIFACIQIMLSQIPNF  188

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSI+AAVMSFAYSSIG+GLS+AKV G G  A ++LTGV VGVDV+   K+WR FQ
Sbjct  189   HKLSWLSILAAVMSFAYSSIGLGLSLAKVIG-GAHARTSLTGVTVGVDVSAEQKVWRTFQ  247

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             A+G+IAFAYAYSTVLIEIQDTL+S PPEN  MK+AS +G+ TTT FY++CGC+GYAAFGN
Sbjct  248   ALGDIAFAYAYSTVLIEIQDTLKSSPPENKAMKRASFVGILTTTTFYILCGCLGYAAFGN  307

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             DAPGNFLTGFGFYEPFWLID+AN CIAIHL+GAYQVF
Sbjct  308   DAPGNFLTGFGFYEPFWLIDLANACIAIHLIGAYQVF  344



>emb|CDY46779.1| BnaCnng14480D [Brassica napus]
Length=479

 Score =   496 bits (1276),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 250/342 (73%), Positives = 291/342 (85%), Gaps = 13/342 (4%)
 Frame = -1

Query  1005  VSQNPMYVEEG------REILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIA  844
             + +  M++E+        ++ KNFDDDG +KRTGT +T SAHIITAVIGSGVLSL+WAIA
Sbjct  1     MEKKSMFIEQSFTDHKSGDMNKNFDDDGRQKRTGTWMTGSAHIITAVIGSGVLSLAWAIA  60

Query  843   QLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCG  664
             QLGW AGPAVL AFS IT+FTS +LADCYRSP PVTG RNYTYM+VVRS+LGG KV LCG
Sbjct  61    QLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVMLCG  120

Query  663   LSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQ  484
             L+QY NL+GI+IGYTITASISMVAVK+SNCFHKNGH+  CS  + PFM+IFA IQ+VLSQ
Sbjct  121   LAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHNVKCSTSNTPFMIIFACIQIVLSQ  180

Query  483   IPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIW  304
             IPNFH LSWLSI+AAVMSF+Y+SIG+GLSIAKVAG G  A + LTGV VGVDVTG+DK+W
Sbjct  181   IPNFHNLSWLSILAAVMSFSYASIGVGLSIAKVAGGGVHARTALTGVTVGVDVTGSDKVW  240

Query  303   RCFQAIGNIAFAYAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGY  127
             R FQA+G+IAFAYAYST      DTL++ PP EN  MK+AS +GVSTTT FY++CGC+GY
Sbjct  241   RTFQAVGDIAFAYAYST------DTLKASPPSENKAMKRASLVGVSTTTFFYMLCGCVGY  294

Query  126   AAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             AAFGN+APGNFLTGFGFYEPFWLID AN+CIA+HLVGAYQVF
Sbjct  295   AAFGNNAPGNFLTGFGFYEPFWLIDFANVCIAVHLVGAYQVF  336



>ref|XP_004498452.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=471

 Score =   495 bits (1275),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 248/320 (78%), Positives = 280/320 (88%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KNFD+DG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQ+GW AGPAVL AFS IT+FT
Sbjct  14   KNFDEDGRTKRTGTWLTASAHIITAVIGSGVLSLAWAIAQMGWVAGPAVLFAFSFITYFT  73

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYRSP PV G RNYTY +VVR++LGG K QLCGL+QY NLVG++IGYTITASIS
Sbjct  74   STLLADCYRSPDPVHGKRNYTYSEVVRANLGGRKFQLCGLAQYINLVGVTIGYTITASIS  133

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            MVAVK+SNCFHK+GH   C V + PFM+IFA IQ+VL QIPNFHELSWLSIVAAVMSF Y
Sbjct  134  MVAVKRSNCFHKHGHADKCHVSNNPFMIIFACIQIVLCQIPNFHELSWLSIVAAVMSFTY  193

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GLSIAKVAG G    S +TGV +GVDVT  +K+WR FQAIG+IAFAYA+S VLIE
Sbjct  194  SSIGLGLSIAKVAGGGHVRTS-ITGVEIGVDVTATEKVWRMFQAIGDIAFAYAFSNVLIE  252

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S PPEN VMK+AS IG+ TTT+FYV+CG +GYAAFGNDAPGNFLTGFGFYEPFW
Sbjct  253  IQDTLKSSPPENRVMKRASLIGILTTTLFYVLCGTLGYAAFGNDAPGNFLTGFGFYEPFW  312

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN+CIA+HL+GAYQVF
Sbjct  313  LIDFANVCIAVHLIGAYQVF  332



>ref|XP_011017028.1| PREDICTED: amino acid permease 6-like [Populus euphratica]
Length=483

 Score =   496 bits (1276),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 245/327 (75%), Positives = 282/327 (86%), Gaps = 1/327 (0%)
 Frame = -1

Query  981  EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAF  802
             EG  I KN DDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW  GP VL  F
Sbjct  19   SEGSGISKNLDDDGRPKRTGTWITASAHIITAVIGSGVLSLAWAIAQLGWLVGPLVLVVF  78

Query  801  SLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGY  622
            S ITFFTS LLAD YRSP P+TG+RNYTYMD VR++LGG KVQLCGL+QY NL+GI++GY
Sbjct  79   SFITFFTSTLLADSYRSPDPITGSRNYTYMDAVRANLGGRKVQLCGLAQYVNLIGITVGY  138

Query  621  TITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVA  442
            TITASISMVAV++SNCFHK+GH   C   + P+M+IFA IQ++LSQIPNFH+LSWLSI+A
Sbjct  139  TITASISMVAVRRSNCFHKHGHAVKCQTSNNPYMIIFACIQIMLSQIPNFHKLSWLSILA  198

Query  441  AVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYA  262
            AVMSFAYSSIG+GLS+AKV G G  A ++LTGV VGVDV+   K+WR FQA+G+IAFAYA
Sbjct  199  AVMSFAYSSIGLGLSLAKVIG-GAHARTSLTGVTVGVDVSAEQKVWRTFQALGDIAFAYA  257

Query  261  YSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGF  82
            YSTVLIEIQDTLRS PPEN  MK+AS +G+ TTT FY++CGC+GYAAFGNDAPGNFLTGF
Sbjct  258  YSTVLIEIQDTLRSSPPENKAMKRASFVGILTTTTFYILCGCLGYAAFGNDAPGNFLTGF  317

Query  81   GFYEPFWLIDVANICIAIHLVGAYQVF  1
            GFYEPF LID+AN+CIAIHL+GAYQVF
Sbjct  318  GFYEPFVLIDLANVCIAIHLIGAYQVF  344



>ref|NP_199774.1| amino acid permease 6 [Arabidopsis thaliana]
 sp|P92934.1|AAP6_ARATH RecName: Full=Amino acid permease 6; AltName: Full=Amino acid 
transporter AAP6 [Arabidopsis thaliana]
 emb|CAA65051.1| amino acid permease 6 [Arabidopsis thaliana]
 dbj|BAA97227.1| amino acid permease 6 [Arabidopsis thaliana]
 dbj|BAF00980.1| amino acid permease 6 [Arabidopsis thaliana]
 gb|AED95838.1| amino acid permease 6 [Arabidopsis thaliana]
Length=481

 Score =   495 bits (1274),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 256/341 (75%), Positives = 295/341 (87%), Gaps = 7/341 (2%)
 Frame = -1

Query  1002  SQNPMYVEEG---REI---LKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQ  841
              +  M+VE+     EI    KNFD+DG +KRTGT +T SAHIITAVIGSGVLSL+WAIAQ
Sbjct  3     KKKSMFVEQSFPEHEIGDTNKNFDEDGRDKRTGTWMTGSAHIITAVIGSGVLSLAWAIAQ  62

Query  840   LGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGL  661
             LGW AGPAVL AFS IT+FTS +LADCYRSP PVTG RNYTYM+VVRS+LGG KVQLCGL
Sbjct  63    LGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCGL  122

Query  660   SQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQI  481
             +QY NL+GI+IGYTITASISMVAVK+SNCFHKNGH+  C+  + PFM+IFA IQ++LSQI
Sbjct  123   AQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHNVKCATSNTPFMIIFAIIQIILSQI  182

Query  480   PNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWR  301
             PNFH LSWLSI+AAVMSF Y+SIG+GLSIAK AG G    +TLTGV VG+DV+GA+KIWR
Sbjct  183   PNFHNLSWLSILAAVMSFCYASIGVGLSIAKAAGGGEHVRTTLTGVTVGIDVSGAEKIWR  242

Query  300   CFQAIGNIAFAYAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYA  124
              FQAIG+IAFAYAYSTVLIEIQDTL++ PP EN  MK+AS +GVSTTT FY++CGC+GYA
Sbjct  243   TFQAIGDIAFAYAYSTVLIEIQDTLKAGPPSENKAMKRASLVGVSTTTFFYMLCGCVGYA  302

Query  123   AFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             AFGNDAPGNFLTGFGFYEPFWLID AN+CIA+HL+GAYQVF
Sbjct  303   AFGNDAPGNFLTGFGFYEPFWLIDFANVCIAVHLIGAYQVF  343



>ref|XP_007137276.1| hypothetical protein PHAVU_009G113800g [Phaseolus vulgaris]
 gb|ESW09270.1| hypothetical protein PHAVU_009G113800g [Phaseolus vulgaris]
Length=482

 Score =   493 bits (1269),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 254/337 (75%), Positives = 285/337 (85%), Gaps = 3/337 (1%)
 Frame = -1

Query  1002  SQNPMYVEEGR---EILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
              +N MYVE      E  KNFDDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQ+GW
Sbjct  7     QKNNMYVETPEAFGEGGKNFDDDGRVKRTGTWITASAHIITAVIGSGVLSLAWAIAQMGW  66

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGPAVL AFS IT+FTS LLADCYR+P PV G RNYTY  VV+S LGG K QLCGL+QY
Sbjct  67    VAGPAVLLAFSCITYFTSTLLADCYRTPDPVHGKRNYTYSAVVKSVLGGRKFQLCGLAQY  126

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NLVG++IGYTITASISMVAVK+SNCFHK+GH   C   + PFM+ FA IQ+VLSQIPNF
Sbjct  127   INLVGVTIGYTITASISMVAVKRSNCFHKHGHHVKCFTSNNPFMIFFACIQIVLSQIPNF  186

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
              +L WLSIVAAVMSFAYSSIG+GLS AKVAG G    ++LTGV VGVDVTG++K+WR FQ
Sbjct  187   SKLWWLSIVAAVMSFAYSSIGLGLSFAKVAGGGDPVRTSLTGVQVGVDVTGSEKVWRTFQ  246

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAFAYAYS VLIEIQDTL+S P EN VMK+AS IG+ TTT+FY++CGC+GYAAFGN
Sbjct  247   AIGDIAFAYAYSNVLIEIQDTLKSSPAENKVMKRASLIGIMTTTLFYMLCGCLGYAAFGN  306

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             DAPGNFLTGFGFYEPFWLID ANICIA+HLVGAYQVF
Sbjct  307   DAPGNFLTGFGFYEPFWLIDFANICIAVHLVGAYQVF  343



>gb|KHG24473.1| Amino acid permease 6 -like protein [Gossypium arboreum]
Length=480

 Score =   492 bits (1266),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 247/344 (72%), Positives = 289/344 (84%), Gaps = 7/344 (2%)
 Frame = -1

Query  1032  RKHPRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSW  853
             R+  +  M + QN    E G ++ KN DDDG EKRTGT VTASAHIITAVIGSGVLSL+W
Sbjct  3     REMQKNTMFIEQNTGDYENG-DLQKNLDDDGREKRTGTWVTASAHIITAVIGSGVLSLAW  61

Query  852   AIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQ  673
             AIAQLGW  GPAVL AFS IT+FTS LLADCYR+P PV G RNYTYMDVVR++LGG KVQ
Sbjct  62    AIAQLGWVVGPAVLIAFSFITYFTSTLLADCYRAPDPVHGKRNYTYMDVVRAYLGGRKVQ  121

Query  672   LCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLV  493
             LCGL+QYANL+G++IGYTITASISMVAVK+SNCFHK+GH   C   + PFM+IFA IQ+V
Sbjct  122   LCGLAQYANLLGVTIGYTITASISMVAVKRSNCFHKHGHHVKCQTSNNPFMIIFACIQIV  181

Query  492   LSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGAD  313
             LSQIPNFH+LSWLSI+AAVMSF Y+SIG+GLSIAK A  G    ++LTGV VGVDV+G++
Sbjct  182   LSQIPNFHKLSWLSILAAVMSFTYASIGLGLSIAKAASGGEHVRTSLTGVQVGVDVSGSE  241

Query  312   KIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCI  133
             K+WR FQAIG+IAFAYAYST      DT+++ PPEN  MK+AS +GV+TTT+FYV+CG +
Sbjct  242   KVWRTFQAIGDIAFAYAYST------DTIKASPPENKSMKRASGVGVTTTTLFYVLCGIV  295

Query  132   GYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GYAAFGNDAPGNFLTGFGFYEPFWLID AN+CIA+HL+GAYQVF
Sbjct  296   GYAAFGNDAPGNFLTGFGFYEPFWLIDFANVCIAVHLIGAYQVF  339



>gb|KDO81357.1| hypothetical protein CISIN_1g011548mg [Citrus sinensis]
Length=346

 Score =   482 bits (1241),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 249/342 (73%), Positives = 293/342 (86%), Gaps = 5/342 (1%)
 Frame = -1

Query  1017  LLMAVSQNPMYVEEGR---EILKNF-DDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWA  850
             + M + +N MY+E+     +I K+F DDDG  KRTGT VTASAHIITAVIGSGVLSL+WA
Sbjct  1     MAMEMQKNSMYIEQNDPEGDIRKDFLDDDGRAKRTGTWVTASAHIITAVIGSGVLSLAWA  60

Query  849   IAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQL  670
             IAQLGW AGPAVL AFS IT++TS LL+DCYRSP PVTG RNYTYMDVVR+ LGG  VQL
Sbjct  61    IAQLGWVAGPAVLMAFSFITYYTSTLLSDCYRSPDPVTGKRNYTYMDVVRASLGGRSVQL  120

Query  669   CGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVL  490
             CGL+QY NL+G++IGYTITASISMVAVK+SNCFH++GH   C   + P M+IFA IQ+VL
Sbjct  121   CGLAQYGNLIGVTIGYTITASISMVAVKRSNCFHRHGHHVKCYTSNNPLMIIFACIQIVL  180

Query  489   SQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADK  310
             SQIPNFH+LSWLSI+AAVMSFAYSSIGIGLSIAKV G G  A +TLTG  VGVDV+ ++K
Sbjct  181   SQIPNFHKLSWLSILAAVMSFAYSSIGIGLSIAKVIGDGPHA-TTLTGTTVGVDVSASEK  239

Query  309   IWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIG  130
             +WR FQAIG++AFAYA+STVL+EIQDTL+S PPEN  MK+A+A+GV+TTT+FY+MCG +G
Sbjct  240   VWRAFQAIGDVAFAYAFSTVLVEIQDTLKSSPPENKSMKRATAVGVTTTTLFYIMCGVMG  299

Query  129   YAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQV  4
             Y AFGNDAPGNFLTGFGFYEPFWL+D AN CIA+HL+GAYQV
Sbjct  300   YLAFGNDAPGNFLTGFGFYEPFWLVDFANACIAVHLIGAYQV  341



>ref|XP_010064702.1| PREDICTED: LOW QUALITY PROTEIN: amino acid permease 6-like [Eucalyptus 
grandis]
Length=485

 Score =   488 bits (1255),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 247/339 (73%), Positives = 283/339 (83%), Gaps = 9/339 (3%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M V Q+P     G  + KN DDDG  +RTGT+VTASAHIITA+IGSGVLSL+W IAQLGW
Sbjct  6     MRVEQDPEAFRSG-GVQKNLDDDGRVERTGTVVTASAHIITALIGSGVLSLAWTIAQLGW  64

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
               G +VL   S IT+FTS LLADCYRSP P+TG RNYTYMDVVR+HLGG KVQLCGL+QY
Sbjct  65    VVGSSVLVTLSFITYFTSTLLADCYRSPDPITGKRNYTYMDVVRAHLGGRKVQLCGLAQY  124

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFD--CSVPSYPFMMIFAAIQLVLSQIP  478
              NLVGI+IGYTITASISMVAVKKSNCFHKNGH+    C   +YPFM+IFA IQ+VLSQIP
Sbjct  125   GNLVGITIGYTITASISMVAVKKSNCFHKNGHEVKSVCETSNYPFMIIFACIQIVLSQIP  184

Query  477   NFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRC  298
             +FH+LSWLSIV AVMS AY+SIG+GLSIAKVAG G  A +TLTG  VGVDV+G++K+WR 
Sbjct  185   DFHKLSWLSIVFAVMSLAYASIGVGLSIAKVAGGGHHARTTLTGTTVGVDVSGSEKVWRV  244

Query  297   FQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAF  118
             FQA+GNI      STVL+EIQDTL+S PPEN VMK+AS IG+STTT+FY +CGCIGYAAF
Sbjct  245   FQAVGNI------STVLVEIQDTLKSSPPENKVMKRASLIGISTTTMFYALCGCIGYAAF  298

Query  117   GNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GNDAP +FLTGFGFYEPFW+ID AN CIA+HL+GAYQVF
Sbjct  299   GNDAPXDFLTGFGFYEPFWVIDFANACIAVHLIGAYQVF  337



>ref|XP_003550117.1| PREDICTED: amino acid permease 6 [Glycine max]
Length=470

 Score =   486 bits (1252),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 237/320 (74%), Positives = 274/320 (86%), Gaps = 5/320 (2%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KNFDDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQ+GW AGPAVL  FSLIT+FT
Sbjct  17   KNFDDDGRAKRTGTWITASAHIITAVIGSGVLSLAWAIAQMGWVAGPAVLFVFSLITYFT  76

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYRSP PV G RNYTY +VV+++LGG K QLCGL+QY NLVG++IGYTITAS+S
Sbjct  77   STLLADCYRSPDPVHGKRNYTYSEVVKANLGGRKFQLCGLAQYINLVGVTIGYTITASLS  136

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M AVKKSNC HK+GH  +C V    FM+ FA IQ++LSQIPNFH+LSWLSIVAAVMSFAY
Sbjct  137  MGAVKKSNCLHKHGHQDECKVKDNAFMIAFACIQILLSQIPNFHKLSWLSIVAAVMSFAY  196

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GLSIAK+ G G    +     + GV+V+G +K+W+ FQAIG+IAFAYA+S VLIE
Sbjct  197  SSIGLGLSIAKIIGGGHVRTT-----LTGVEVSGTEKVWKMFQAIGDIAFAYAFSNVLIE  251

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S PPEN VMK+AS IG+ TTT+FYV+CGC+GYAAFGNDAP NFLTGFGFYEPFW
Sbjct  252  IQDTLKSSPPENKVMKRASLIGIMTTTLFYVLCGCLGYAAFGNDAPSNFLTGFGFYEPFW  311

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN+CIA+HLVGAYQVF
Sbjct  312  LIDFANVCIAVHLVGAYQVF  331



>ref|XP_009148321.1| PREDICTED: amino acid permease 8 [Brassica rapa]
Length=486

 Score =   486 bits (1250),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 235/333 (71%), Positives = 287/333 (86%), Gaps = 1/333 (0%)
 Frame = -1

Query  999  QNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGP  820
             NP  VE G   +KN DDDG EKRTGT +TASAHIITAVIGSGVLSL+WA+AQLGW AG 
Sbjct  16   HNPSAVESGNAAVKNVDDDGREKRTGTFLTASAHIITAVIGSGVLSLAWALAQLGWVAGT  75

Query  819  AVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLV  640
             +L  F++IT++TS LLADCYR+P P+TGTRNYTYM VVR++LGG KVQLCG +QY NLV
Sbjct  76   MILVIFAIITYYTSTLLADCYRAPDPITGTRNYTYMGVVRAYLGGKKVQLCGRAQYGNLV  135

Query  639  GISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELS  460
            G+SIGYTITASIS+VA+ ++NCFH  GH   C+  +YP+M+ F  +Q++LSQIPNFH+LS
Sbjct  136  GVSIGYTITASISLVAIGRANCFHDKGHGAKCTASNYPYMVAFGGLQILLSQIPNFHKLS  195

Query  459  WLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGN  280
            +LSI+AAVMSF+Y+SIGIGL+IAKVA SG+   +TLTG V+GVDV+ +DK+W+ FQA+G+
Sbjct  196  FLSIIAAVMSFSYASIGIGLAIAKVA-SGKVGKTTLTGTVIGVDVSASDKVWKAFQAVGD  254

Query  279  IAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPG  100
            IAF+YAY+T+LIEIQDTLRS PPEN VMKKAS IGVSTTTVFY++CGCIGYAAFGN +PG
Sbjct  255  IAFSYAYTTILIEIQDTLRSSPPENKVMKKASLIGVSTTTVFYLLCGCIGYAAFGNLSPG  314

Query  99   NFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            +FLT FGFYEPFWL+  AN+CIA+HLVGAYQV+
Sbjct  315  DFLTDFGFYEPFWLVIFANVCIAVHLVGAYQVY  347



>ref|XP_006417504.1| hypothetical protein EUTSA_v10007516mg [Eutrema salsugineum]
 gb|ESQ35857.1| hypothetical protein EUTSA_v10007516mg [Eutrema salsugineum]
Length=478

 Score =   485 bits (1248),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 239/328 (73%), Positives = 282/328 (86%), Gaps = 1/328 (0%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G   +K+ DDDG EKRTGT +TASAHIITAVIGSGVLSL+WA+AQLGW AG  +L  
Sbjct  13   VETGDAAVKSVDDDGREKRTGTFITASAHIITAVIGSGVLSLAWALAQLGWVAGTVILVT  72

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F++IT++TS LLADCYRSP  VTGTRNYTYM VVR++LGG KVQLCGL+QY NLVG++IG
Sbjct  73   FAIITYYTSTLLADCYRSPDSVTGTRNYTYMGVVRAYLGGKKVQLCGLAQYGNLVGVTIG  132

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS+VA+ K+NCFH  GH   CSV +YP+M  F  +Q++LSQI NFHELS+LSI+
Sbjct  133  YTITASISLVAIGKANCFHNKGHGAKCSVSNYPYMAAFGIVQIILSQISNFHELSFLSII  192

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            AAVMSF+Y+SIGIGL+IA VA SG+   + LTG VVGVDVT ++K+WR FQAIG+IAFAY
Sbjct  193  AAVMSFSYASIGIGLAIATVA-SGKIGKTDLTGTVVGVDVTASEKLWRSFQAIGDIAFAY  251

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
            AYST+LIEIQDTLRS PPEN VMKKAS +GVSTTTVFY++CGCIGYAAFGN APG+FLT 
Sbjct  252  AYSTILIEIQDTLRSSPPENKVMKKASLVGVSTTTVFYILCGCIGYAAFGNQAPGDFLTD  311

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQVF  1
            FGFYEP+WLID AN CIA+HL+GAYQV+
Sbjct  312  FGFYEPYWLIDFANACIALHLIGAYQVY  339



>ref|XP_010553668.1| PREDICTED: amino acid permease 1-like [Tarenaya hassleriana]
Length=488

 Score =   484 bits (1245),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 237/339 (70%), Positives = 285/339 (84%), Gaps = 6/339 (2%)
 Frame = -1

Query  1002  SQNPMYVEEGREIL-----KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQL  838
             +QNP   E G +       K  DDDG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQL
Sbjct  11    NQNPSAAESGDKSAVFSAGKLVDDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQL  70

Query  837   GWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLS  658
             GW AGP +L  FS+IT+FTS +LADCYRSP PVTG RNYTYM+VVRS+LGG KVQLCG++
Sbjct  71    GWVAGPVILMIFSVITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCGMA  130

Query  657   QYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIP  478
             QY NL+GI+IGYTITASIS+VA+++SNC+H  GH  DCS   YP+M +F  IQ++LSQIP
Sbjct  131   QYGNLIGITIGYTITASISLVAIQRSNCYHDKGHKADCSTSHYPYMAVFGCIQILLSQIP  190

Query  477   NFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRC  298
             NFH+LS+LSI+AA+MSFAY+SIG+GLSIA VAG G+   ++LTGV VG  +T ++K+W+ 
Sbjct  191   NFHKLSFLSILAAIMSFAYASIGVGLSIAAVAG-GQTGKTSLTGVQVGEGITASEKVWKT  249

Query  297   FQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAF  118
             FQA+G+IAFAYA+STVLIEIQDTLRS P EN  MK+AS +GVSTTT+FYV+CGC+GYAAF
Sbjct  250   FQAVGDIAFAYAFSTVLIEIQDTLRSSPAENKAMKRASLVGVSTTTLFYVLCGCVGYAAF  309

Query  117   GNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GN+APG+FLT FGFYEPFWLID AN CIA HL+GAYQVF
Sbjct  310   GNEAPGDFLTDFGFYEPFWLIDFANACIAFHLIGAYQVF  348



>ref|XP_010458325.1| PREDICTED: amino acid permease 8 [Camelina sativa]
Length=476

 Score =   483 bits (1244),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 235/338 (70%), Positives = 283/338 (84%), Gaps = 1/338 (0%)
 Frame = -1

Query  1014  LMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLG  835
             +M    NP  VE     +K  DDDG EKRTGT  TASAHIITAVIGSGVLSL+WA+AQLG
Sbjct  1     MMDTYHNPSAVELDDTAVKGVDDDGREKRTGTFFTASAHIITAVIGSGVLSLAWALAQLG  60

Query  834   WAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQ  655
             W AG  +L  F++IT++TS  LADCYRSP P+TGTRNY+YMDVVR++LGG KVQLCGL+Q
Sbjct  61    WVAGTIILVTFAVITYYTSTFLADCYRSPDPITGTRNYSYMDVVRAYLGGKKVQLCGLAQ  120

Query  654   YANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPN  475
             Y NLVG++IGYTITASIS+VA+ KSNCFH  GH+  CSV +YP+M  F  +Q++LSQIPN
Sbjct  121   YVNLVGVTIGYTITASISLVAIGKSNCFHDKGHEAKCSVSNYPYMAAFGVVQIILSQIPN  180

Query  474   FHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCF  295
             FHELS+LS +AAVMSF+YSSIGIGL+IAKVA SG+   + LTG V+GVDVT ++K+WR F
Sbjct  181   FHELSFLSFIAAVMSFSYSSIGIGLAIAKVA-SGKVGKTELTGTVIGVDVTSSEKVWRMF  239

Query  294   QAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFG  115
             QAIG+IAF+YA++T+LIEIQDTLRS PPEN VMK+AS  GVSTTT FY++CGC GYAAFG
Sbjct  240   QAIGDIAFSYAFTTILIEIQDTLRSSPPENKVMKRASLAGVSTTTFFYILCGCFGYAAFG  299

Query  114   NDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             N APG+FLT FGFY+P+WLID AN CIA+HL+GAYQV+
Sbjct  300   NKAPGDFLTEFGFYDPYWLIDFANACIALHLIGAYQVY  337



>ref|XP_006433701.1| hypothetical protein CICLE_v10000981mg [Citrus clementina]
 gb|ESR46941.1| hypothetical protein CICLE_v10000981mg [Citrus clementina]
Length=483

 Score =   483 bits (1243),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 251/343 (73%), Positives = 294/343 (86%), Gaps = 5/343 (1%)
 Frame = -1

Query  1017  LLMAVSQNPMYVEEGR---EILKNF-DDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWA  850
             + M + +N MY+E+     +I K+F DDDG  KRTGT VTASAHIITAVIGSGVLSL+WA
Sbjct  1     MAMEMQKNSMYIEQNDPEGDIRKDFLDDDGRAKRTGTWVTASAHIITAVIGSGVLSLAWA  60

Query  849   IAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQL  670
             IAQLGW AGPAVL AFS IT++TS LL+DCYRSP PVTG RNYTYMDVVR+ LGG  VQL
Sbjct  61    IAQLGWVAGPAVLMAFSFITYYTSTLLSDCYRSPDPVTGKRNYTYMDVVRASLGGRSVQL  120

Query  669   CGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVL  490
             CGL+QY NL+G++IGYTITASISMVAVK+SNCFH++GH   C   + P M+IFA IQ+VL
Sbjct  121   CGLAQYGNLIGVTIGYTITASISMVAVKRSNCFHRHGHHVKCYTSNNPLMIIFACIQIVL  180

Query  489   SQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADK  310
             SQIPNFH+LSWLSI+AAVMSFAYSSIGIGLSIAKV G G  A +TLTG  VGVDV+ ++K
Sbjct  181   SQIPNFHKLSWLSILAAVMSFAYSSIGIGLSIAKVIGDGPHA-TTLTGTTVGVDVSASEK  239

Query  309   IWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIG  130
             +WR FQAIG++AFAYA+STVL+EIQDTL+S PPEN  MK+A+A+GV+TTT+FY+MCG +G
Sbjct  240   VWRAFQAIGDVAFAYAFSTVLVEIQDTLKSSPPENKSMKRATAVGVTTTTLFYIMCGVMG  299

Query  129   YAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             Y AFGNDAPGNFLTGFGFYEPFWLID AN CIA+HL+GAYQVF
Sbjct  300   YLAFGNDAPGNFLTGFGFYEPFWLIDFANACIAVHLIGAYQVF  342



>ref|NP_172472.1| amino acid permease 8 [Arabidopsis thaliana]
 sp|O80592.1|AAP8_ARATH RecName: Full=Amino acid permease 8; AltName: Full=Amino acid 
transporter AAP8 [Arabidopsis thaliana]
 gb|AAC34329.1| putative amino acid permease [Arabidopsis thaliana]
 gb|AEE28528.1| amino acid permease 8 [Arabidopsis thaliana]
Length=475

 Score =   483 bits (1242),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 236/337 (70%), Positives = 285/337 (85%), Gaps = 1/337 (0%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M    NP  VE G   +K+ DDDG EKRTGT  TASAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  1     MDAYNNPSAVESGDAAVKSVDDDGREKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGW  60

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AG  VL AF++IT++TS LLADCYRSP  +TGTRNY YM VVRS+LGG KVQLCG++QY
Sbjct  61    VAGTTVLVAFAIITYYTSTLLADCYRSPDSITGTRNYNYMGVVRSYLGGKKVQLCGVAQY  120

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NLVG++IGYTITASIS+VA+ KSNC+H  GH   CSV +YP+M  F  +Q++LSQ+PNF
Sbjct  121   VNLVGVTIGYTITASISLVAIGKSNCYHDKGHKAKCSVSNYPYMAAFGIVQIILSQLPNF  180

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LS+LSI+AAVMSF+Y+SIGIGL+IA VA SG+   + LTG V+GVDVT ++K+W+ FQ
Sbjct  181   HKLSFLSIIAAVMSFSYASIGIGLAIATVA-SGKIGKTELTGTVIGVDVTASEKVWKLFQ  239

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG+IAF+YA++T+LIEIQDTLRS PPEN VMK+AS +GVSTTTVFY++CGCIGYAAFGN
Sbjct  240   AIGDIAFSYAFTTILIEIQDTLRSSPPENKVMKRASLVGVSTTTVFYILCGCIGYAAFGN  299

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
              APG+FLT FGFYEP+WLID AN CIA+HL+GAYQV+
Sbjct  300   QAPGDFLTDFGFYEPYWLIDFANACIALHLIGAYQVY  336



>gb|KDO81356.1| hypothetical protein CISIN_1g011548mg [Citrus sinensis]
Length=483

 Score =   482 bits (1241),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 250/343 (73%), Positives = 294/343 (86%), Gaps = 5/343 (1%)
 Frame = -1

Query  1017  LLMAVSQNPMYVEEGR---EILKNF-DDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWA  850
             + M + +N MY+E+     +I K+F DDDG  KRTGT VTASAHIITAVIGSGVLSL+WA
Sbjct  1     MAMEMQKNSMYIEQNDPEGDIRKDFLDDDGRAKRTGTWVTASAHIITAVIGSGVLSLAWA  60

Query  849   IAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQL  670
             IAQLGW AGPAVL AFS IT++TS LL+DCYRSP PVTG RNYTYMDVVR+ LGG  VQL
Sbjct  61    IAQLGWVAGPAVLMAFSFITYYTSTLLSDCYRSPDPVTGKRNYTYMDVVRASLGGRSVQL  120

Query  669   CGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVL  490
             CGL+QY NL+G++IGYTITASISMVAVK+SNCFH++GH   C   + P M+IFA IQ+VL
Sbjct  121   CGLAQYGNLIGVTIGYTITASISMVAVKRSNCFHRHGHHVKCYTSNNPLMIIFACIQIVL  180

Query  489   SQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADK  310
             SQIPNFH+LSWLSI+AAVMSFAYSSIGIGLSIAKV G G  A +TLTG  VGVDV+ ++K
Sbjct  181   SQIPNFHKLSWLSILAAVMSFAYSSIGIGLSIAKVIGDGPHA-TTLTGTTVGVDVSASEK  239

Query  309   IWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIG  130
             +WR FQAIG++AFAYA+STVL+EIQDTL+S PPEN  MK+A+A+GV+TTT+FY+MCG +G
Sbjct  240   VWRAFQAIGDVAFAYAFSTVLVEIQDTLKSSPPENKSMKRATAVGVTTTTLFYIMCGVMG  299

Query  129   YAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             Y AFGNDAPGNFLTGFGFYEPFWL+D AN CIA+HL+GAYQVF
Sbjct  300   YLAFGNDAPGNFLTGFGFYEPFWLVDFANACIAVHLIGAYQVF  342



>ref|XP_010314596.1| PREDICTED: LOW QUALITY PROTEIN: amino acid permease 6-like [Solanum 
lycopersicum]
Length=469

 Score =   481 bits (1238),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 243/337 (72%), Positives = 289/337 (86%), Gaps = 1/337 (0%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M V Q+P  +E G ++ +N DDDG EKRTGT++TASAHIITAVIGSGVLSL+WA+AQLGW
Sbjct  12    MYVEQSPKGLENG-QVQRNIDDDGREKRTGTVLTASAHIITAVIGSGVLSLAWAMAQLGW  70

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGP +L  FS IT+FTS LL DCYR PGP +G RNY+YM+VVRSHLGG KVQLCG++QY
Sbjct  71    VAGPVILFLFSFITYFTSTLLTDCYRFPGPDSGKRNYSYMEVVRSHLGGFKVQLCGIAQY  130

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NLVGI+IGYTITASISM AV +SNCFHK GH   C V +YP+M+IFA IQ++LSQI NF
Sbjct  131   GNLVGITIGYTITASISMKAVVRSNCFHKEGHQASCIVSNYPYMVIFAIIQIILSQIQNF  190

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLS++AAVMSFAYS IG+GLSIAKVAG G    ++LTG +VGVDV+ + K+WRC Q
Sbjct  191   HKLSWLSMLAAVMSFAYSLIGLGLSIAKVAGVGHHVKTSLTGTIVGVDVSASQKVWRCLQ  250

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             +IG+IAFAYA++T+LI+IQDTLRS PPEN  MK+AS +GV TTT+FYV+CG IGYAAFGN
Sbjct  251   SIGDIAFAYAFATILIDIQDTLRSPPPENKAMKRASLVGVFTTTLFYVLCGTIGYAAFGN  310

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             +APGNFLTGFGFYEPFWLID AN+CIAIHL+GAYQVF
Sbjct  311   NAPGNFLTGFGFYEPFWLIDFANVCIAIHLIGAYQVF  347



>ref|NP_176132.1| amino acid permease 1 [Arabidopsis thaliana]
 sp|Q42400.1|AAP1_ARATH RecName: Full=Amino acid permease 1; AltName: Full=Amino acid 
transporter AAP1; AltName: Full=Neutral amino acid transporter 
II [Arabidopsis thaliana]
 gb|AAF82252.1|AC008051_3 Identical to the amino acid permease I (AAP1) gb|X67124 and neutral 
amino acid transport system II (NAT2) gb|AF031649 from 
Arabidopsis thaliana and contains a transmembrane amino acid 
transporter protein PF|01490 domain. EST gb|AI995511, gb|Z18061 
comes from this gene [Arabidopsis thaliana]
 emb|CAA47603.1| amino acid permease I [Arabidopsis thaliana]
 gb|AAA32726.1| amino acid transporter [Arabidopsis thaliana]
 dbj|BAB83868.1| amino acid permease I [Arabidopsis thaliana]
 gb|AEE33541.1| amino acid permease 1 [Arabidopsis thaliana]
Length=485

 Score =   481 bits (1239),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 233/320 (73%), Positives = 278/320 (87%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN D+DG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG ++L  FS IT+FT
Sbjct  27   KNVDEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTSILLIFSFITYFT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P PVTG RNYTYMDVVRS+LGG KVQLCG++QY NL+G+++GYTITASIS
Sbjct  87   STMLADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGVTVGYTITASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VAV KSNCFH  GH  DC++ +YP+M +F  IQ++LSQIPNFH+LS+LSI+AAVMSF Y
Sbjct  147  LVAVGKSNCFHDKGHTADCTISNYPYMAVFGIIQVILSQIPNFHKLSFLSIMAAVMSFTY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            ++IGIGL+IA VAG G+   +++TG  VGVDVT A KIWR FQA+G+IAFAYAY+TVLIE
Sbjct  207  ATIGIGLAIATVAG-GKVGKTSMTGTAVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIE  265

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS P EN  MK+AS +GVSTTT FY++CGCIGYAAFGN+APG+FLT FGF+EPFW
Sbjct  266  IQDTLRSSPAENKAMKRASLVGVSTTTFFYILCGCIGYAAFGNNAPGDFLTDFGFFEPFW  325

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA+HL+GAYQVF
Sbjct  326  LIDFANACIAVHLIGAYQVF  345



>ref|XP_002888218.1| hypothetical protein ARALYDRAFT_893658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64477.1| hypothetical protein ARALYDRAFT_893658 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   480 bits (1236),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 233/320 (73%), Positives = 276/320 (86%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN D+DG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG A+L  FS IT+FT
Sbjct  27   KNVDEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTAILLIFSFITYFT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P PVTG RNYTYMDVVRS+LGG KVQLCG++QY NL+G+++GYTITASIS
Sbjct  87   STMLADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGVTVGYTITASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VAV KSNCFH  GH  DC++ +YP+M +F  IQ++LSQIPNFH+LS+LSI+AAVMSF Y
Sbjct  147  LVAVGKSNCFHDKGHKADCTISNYPYMAVFGIIQVILSQIPNFHKLSFLSIMAAVMSFTY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            ++IGIGL+IA VAG G+   +++TG  VGVDVT   KIWR FQA+G+IAFAYAY+TVLIE
Sbjct  207  ATIGIGLAIATVAG-GKVGKTSMTGTAVGVDVTATQKIWRSFQAVGDIAFAYAYATVLIE  265

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS P EN  MK+AS +GVSTTT FY++CGCIGYAAFGN APG+FLT FGF+EPFW
Sbjct  266  IQDTLRSSPAENKAMKRASLVGVSTTTFFYILCGCIGYAAFGNKAPGDFLTDFGFFEPFW  325

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA+HL+GAYQVF
Sbjct  326  LIDFANACIAVHLIGAYQVF  345



>ref|XP_002301129.2| amino acid transport protein AAP2 [Populus trichocarpa]
 gb|EEE80402.2| amino acid transport protein AAP2 [Populus trichocarpa]
Length=487

 Score =   480 bits (1236),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 239/340 (70%), Positives = 284/340 (84%), Gaps = 4/340 (1%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             + +S+ P   E G  I KN DDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW
Sbjct  10    LYISRGPEGSESGGIISKNLDDDGRPKRTGTWITASAHIITAVIGSGVLSLAWAIAQLGW  69

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
               GP VL  FS ITFFTS LLAD YRSP P+TG RNYTYMD VR++LGG KVQLCGL+QY
Sbjct  70    VVGPLVLVVFSFITFFTSTLLADSYRSPDPITGNRNYTYMDAVRANLGGRKVQLCGLAQY  129

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL+GI++GYTITASISMVAV++SNCFHK+GH   C   + P+M+IFA IQ++LSQIPNF
Sbjct  130   VNLIGITVGYTITASISMVAVRRSNCFHKHGHAVKCQTSNNPYMIIFACIQIMLSQIPNF  189

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LSWLSI+AAVMSFAY+SIG+GLS+AKV G G  A ++LTGV VGVDV+   K+WR FQ
Sbjct  190   HKLSWLSILAAVMSFAYASIGLGLSLAKVIG-GAHARTSLTGVTVGVDVSAQQKVWRTFQ  248

Query  291   AIGNIAFAYAYSTVLIEIQ---DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAA  121
             A+G+IAFAYAYST+ + ++   DTL+S PPEN  MK+AS +G+ TTT FY++CGC+GYAA
Sbjct  249   ALGDIAFAYAYSTLNLTVELRDDTLKSSPPENKAMKRASFVGILTTTTFYILCGCLGYAA  308

Query  120   FGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             FGNDAPGNFLTGFGFYEPF LID+AN+CIAIHL+GAYQVF
Sbjct  309   FGNDAPGNFLTGFGFYEPFVLIDIANVCIAIHLIGAYQVF  348



>gb|AAB87674.1| neutral amino acid transport system II [Arabidopsis thaliana]
Length=485

 Score =   480 bits (1235),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 233/320 (73%), Positives = 277/320 (87%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN D+DG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG ++L  FS IT+FT
Sbjct  27   KNVDEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTSILLIFSFITYFT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P PVTG RNYTYMDVVRS+LGG KVQLCG++QY NL+G+++GYTITASIS
Sbjct  87   STMLADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGVTVGYTITASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VAV KSNCFH  GH  DC++ +YP+M +F  IQ++LSQIPNFH+LS+LSI+AAVMSF Y
Sbjct  147  LVAVGKSNCFHDKGHTADCTISNYPYMAVFGIIQVILSQIPNFHKLSFLSIMAAVMSFTY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            ++IGIGL+IA VAG G+   +++TG  VGVDVT A KIWR FQA+G IAFAYAY+TVLIE
Sbjct  207  ATIGIGLAIATVAG-GKVGKTSMTGTAVGVDVTAAQKIWRSFQAVGYIAFAYAYATVLIE  265

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS P EN  MK+AS +GVSTTT FY++CGCIGYAAFGN+APG+FLT FGF+EPFW
Sbjct  266  IQDTLRSSPAENKAMKRASLVGVSTTTFFYILCGCIGYAAFGNNAPGDFLTDFGFFEPFW  325

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA+HL+GAYQVF
Sbjct  326  LIDFANACIAVHLIGAYQVF  345



>ref|XP_009102845.1| PREDICTED: amino acid permease 1 [Brassica rapa]
Length=484

 Score =   480 bits (1235),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 277/320 (87%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN DDDG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L  FS IT+FT
Sbjct  26   KNVDDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILVIFSFITYFT  85

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P PVTG RNYTYMDVVRS+LGG KVQLCG++QY NL+GI++GYTITASIS
Sbjct  86   STMLADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASIS  145

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VAV K+NCFHK GH+ DC++ +YP+M +F  IQ++LSQIPNFH+LS+LS++AAVMSF Y
Sbjct  146  LVAVGKANCFHKKGHEADCTISNYPYMAVFGIIQIILSQIPNFHKLSFLSLMAAVMSFTY  205

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            ++IGIGL+IA VAG G+   + +TG VVGVDVT A KIWR FQA+G+IAFAYAY+TVLIE
Sbjct  206  ATIGIGLAIATVAG-GKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIE  264

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P EN  MK+AS +GVSTTT FY++CGC+GYAAFGN APG+FLT FGFYEPFW
Sbjct  265  IQDTLKSSPAENKSMKRASLVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTDFGFYEPFW  324

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA HL+GAYQVF
Sbjct  325  LIDFANACIAFHLIGAYQVF  344



>ref|XP_010490519.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
 ref|XP_010490528.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
 ref|XP_010490536.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
Length=476

 Score =   479 bits (1234),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 234/338 (69%), Positives = 283/338 (84%), Gaps = 1/338 (0%)
 Frame = -1

Query  1014  LMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLG  835
             +M    NP  VE G   +K  D+DG EKRTGT  TASAHIITAVIGSGVLSL+WA+AQL 
Sbjct  1     MMDTYHNPSAVELGDTPVKGVDEDGREKRTGTFFTASAHIITAVIGSGVLSLAWALAQLS  60

Query  834   WAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQ  655
             W AG  +L  F++IT++TS  LADCYRSP P+TGTRNY+YMDVVR++LGG KVQLCGL+Q
Sbjct  61    WVAGTIILVTFAVITYYTSTFLADCYRSPDPITGTRNYSYMDVVRAYLGGKKVQLCGLAQ  120

Query  654   YANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPN  475
             Y NLVG++IGYTITASIS+VA+ KSNC+H  G    CSV +YPFM  F  +Q++LSQIPN
Sbjct  121   YVNLVGVTIGYTITASISLVAIGKSNCYHDKGKSAKCSVSNYPFMAAFGVVQIILSQIPN  180

Query  474   FHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCF  295
             FHELS+LS +AAVMSF+Y+SIGIGL+IAKVA SG+   + LTG V+GVDVT ++K+WR F
Sbjct  181   FHELSFLSFIAAVMSFSYASIGIGLAIAKVA-SGKVGKTELTGTVIGVDVTSSEKVWRMF  239

Query  294   QAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFG  115
             QAIG+IAF+YA++T+LIEIQDTLRS PPEN VMK+AS  GVSTTTVFY++CGCIGYAAFG
Sbjct  240   QAIGDIAFSYAFTTILIEIQDTLRSSPPENKVMKRASLAGVSTTTVFYILCGCIGYAAFG  299

Query  114   NDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             N APG+FLT FGFY+P+WLID AN CIA+HL+GAYQV+
Sbjct  300   NAAPGDFLTEFGFYDPYWLIDFANACIALHLIGAYQVY  337



>ref|XP_006472367.1| PREDICTED: amino acid permease 6-like [Citrus sinensis]
Length=483

 Score =   479 bits (1234),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 249/339 (73%), Positives = 292/339 (86%), Gaps = 5/339 (1%)
 Frame = -1

Query  1005  VSQNPMYVEEGR---EILKNF-DDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQL  838
             + +N MY+E+     +I K+F DDDG  KRTGT VTASAHIITAVIGSGVLSL+WAIAQL
Sbjct  5     MQKNSMYIEQNDPEGDIRKDFLDDDGRAKRTGTWVTASAHIITAVIGSGVLSLAWAIAQL  64

Query  837   GWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLS  658
             GW AGPAVL AFS IT++TS LL+DCYRSP PVTG RNYTYMDVVR+ LGG  VQLCGL+
Sbjct  65    GWVAGPAVLMAFSFITYYTSTLLSDCYRSPDPVTGKRNYTYMDVVRASLGGRSVQLCGLA  124

Query  657   QYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIP  478
             QY NL+G++IGYTITASISMVAVK+SNCFH++GH   C   + P M+IFA IQ+VLSQIP
Sbjct  125   QYGNLIGVTIGYTITASISMVAVKRSNCFHRHGHHVKCYTSNNPLMIIFACIQIVLSQIP  184

Query  477   NFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRC  298
             NFH+LSWLSI+AAVMSFAYSSIGIGLSIAKV G G  A +TLTG  VGVDV+ ++K+WR 
Sbjct  185   NFHKLSWLSILAAVMSFAYSSIGIGLSIAKVIGDGPHA-TTLTGTTVGVDVSASEKVWRA  243

Query  297   FQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAF  118
             FQAIG++AFAYA+STVL+EIQDTL+S PPEN  MK+A+A+GV+TTT+FY+MCG +GY AF
Sbjct  244   FQAIGDVAFAYAFSTVLVEIQDTLKSSPPENKSMKRATAVGVTTTTLFYIMCGVMGYLAF  303

Query  117   GNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GNDAPGNFLTGFGFYEPFWL+D AN CIA+HL+GAYQVF
Sbjct  304   GNDAPGNFLTGFGFYEPFWLVDFANACIAVHLIGAYQVF  342



>ref|XP_010943299.1| PREDICTED: amino acid permease 6 [Elaeis guineensis]
Length=473

 Score =   475 bits (1222),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 236/328 (72%), Positives = 281/328 (86%), Gaps = 1/328 (0%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            V +G E + +FDDDG  KRTGTL+TASAHIITAVIGSGVLSL+W++AQLGW AGP VL A
Sbjct  9    VAKGSEAMVDFDDDGRVKRTGTLLTASAHIITAVIGSGVLSLAWSVAQLGWVAGPTVLLA  68

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            FSLIT+F + LL DCYRSP P  G RNYTY D VRS+LGG+  +LCG++QYANLVG +IG
Sbjct  69   FSLITWFCARLLVDCYRSPNPTYGKRNYTYRDAVRSYLGGMNYKLCGVAQYANLVGAAIG  128

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTIT +ISM A+K+SNCFHK+GHD  C   +   M+IFA+IQ++LSQIPNFH++ WLSI+
Sbjct  129  YTITTAISMGAIKRSNCFHKHGHDAICEASNNKNMIIFASIQIILSQIPNFHKIWWLSIL  188

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            AA+MSFAYSSIG+GLSIAK+A  G AA +TLTGV VGVDV+ ++K+WR FQA+GNIAFA+
Sbjct  189  AAIMSFAYSSIGLGLSIAKIA-EGIAARTTLTGVTVGVDVSASEKVWRAFQALGNIAFAF  247

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
             YS VLIEI+DTL+S PPEN VMKKAS IGVS TTVFY++CG +GYAAFGNDAPGNFLTG
Sbjct  248  TYSNVLIEIEDTLKSDPPENQVMKKASNIGVSITTVFYMLCGVLGYAAFGNDAPGNFLTG  307

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQVF  1
            FGFYEPFWL+DV NIC+AIHL+GAYQVF
Sbjct  308  FGFYEPFWLVDVGNICVAIHLIGAYQVF  335



>ref|XP_010268969.1| PREDICTED: amino acid permease 6-like isoform X2 [Nelumbo nucifera]
Length=365

 Score =   471 bits (1211),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 229/320 (72%), Positives = 270/320 (84%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN DDDG E+RTGT++TASAH+IT VIGSGVLSL+W IAQLGWAAGPA L  FS+IT+FT
Sbjct  11   KNLDDDGRERRTGTMMTASAHVITTVIGSGVLSLAWVIAQLGWAAGPAALVLFSVITWFT  70

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYRSP  VTG RNYTYMDVVR++LGGVK++LCG++QY   +G +IG+TITAS+S
Sbjct  71   STLLADCYRSP--VTGNRNYTYMDVVRANLGGVKIKLCGIAQYGCFIGATIGFTITASLS  128

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M AVK+SNCFH NGH   C V + PFM+IFA IQ+VLSQIPN H+LSWLSIVAA+MSF+Y
Sbjct  129  MAAVKRSNCFHMNGHHAQCKVSNVPFMIIFACIQIVLSQIPNIHKLSWLSIVAALMSFSY  188

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S IGIGLS AKVA       ++  GV VGVDVT  +K+WR FQAIG+IAFAY ++ VL+E
Sbjct  189  SLIGIGLSAAKVAEGSHEVRTSWRGVEVGVDVTETEKVWRIFQAIGDIAFAYTFAPVLVE  248

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            +QDTL+S PPEN VMK+ S IGVSTT +FYV+CGCIGYAAFGNDAPGNFLTGFGFYEPFW
Sbjct  249  VQDTLKSSPPENKVMKRVSFIGVSTTAMFYVLCGCIGYAAFGNDAPGNFLTGFGFYEPFW  308

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN+CIA+HL+G YQ+ 
Sbjct  309  LIDFANVCIALHLIGVYQLL  328



>emb|CAD92449.1| amino acid permease 1 [Brassica napus]
Length=485

 Score =   475 bits (1223),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 233/320 (73%), Positives = 275/320 (86%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN DDDG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L  FS IT+FT
Sbjct  27   KNVDDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILIIFSFITYFT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P P+TG RNYTYMDVVRS+LGG KVQLCG++QY NL+GI++GYTITASIS
Sbjct  87   STMLADCYRAPDPLTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VA+ K+NC+H  GH  DC++ +YP+M  F  IQ++LSQIPNFH+LS+LS++AAVMSFAY
Sbjct  147  LVAIGKANCYHNKGHHADCTISNYPYMAAFGIIQILLSQIPNFHKLSFLSLMAAVMSFAY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            +SIGIGL+IA VAG G+   + +TG VVGVDVT A KIWR FQA+G+IAFAYAY+TVLIE
Sbjct  207  ASIGIGLAIATVAG-GKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIE  265

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS P EN  MK+AS +GVSTTT FY++CGC+GYAAFGN APG+FLT FGFYEPFW
Sbjct  266  IQDTLRSSPAENKAMKRASFVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTNFGFYEPFW  325

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA HL+GAYQVF
Sbjct  326  LIDFANACIAFHLIGAYQVF  345



>ref|XP_006392303.1| hypothetical protein EUTSA_v10023431mg [Eutrema salsugineum]
 gb|ESQ29589.1| hypothetical protein EUTSA_v10023431mg [Eutrema salsugineum]
Length=484

 Score =   474 bits (1221),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 233/320 (73%), Positives = 275/320 (86%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN D+DG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L  FS IT+FT
Sbjct  26   KNVDEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILIIFSFITYFT  85

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P PVTG RNYTYMDVVRS+LGG KVQLCG++QY NLVGI++GYTITASIS
Sbjct  86   STMLADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLVGITVGYTITASIS  145

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VAV K+NCFH  GH  DC++ +YP+M +F  IQ++LSQIPNFH+LS+LS++AAVMSF Y
Sbjct  146  LVAVGKANCFHDKGHHADCALSNYPYMAVFGIIQIILSQIPNFHKLSFLSLMAAVMSFTY  205

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            ++IGIGL+IA VAG G+   + LTG VVGVDVT   KIWR FQA+G+IAFAYAY+TVLIE
Sbjct  206  ATIGIGLAIATVAG-GKVGKTNLTGTVVGVDVTATQKIWRSFQAVGDIAFAYAYATVLIE  264

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P EN  MK+AS +GVSTTT FY++CGC+GYAAFGN APG+FLT FGFYEPFW
Sbjct  265  IQDTLKSSPAENKAMKRASLVGVSTTTFFYILCGCLGYAAFGNQAPGDFLTDFGFYEPFW  324

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA+HL+GAYQVF
Sbjct  325  LIDFANACIAVHLIGAYQVF  344



>ref|XP_010269102.1| PREDICTED: amino acid permease 6-like [Nelumbo nucifera]
Length=465

 Score =   473 bits (1218),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 237/319 (74%), Positives = 267/319 (84%), Gaps = 0/319 (0%)
 Frame = -1

Query  957  NFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTS  778
            +FDDDG  KRTGTL+TAS+HIITAVIGSGVLSL W IAQLGW AGPA L  FS IT+FTS
Sbjct  9    DFDDDGRIKRTGTLITASSHIITAVIGSGVLSLPWVIAQLGWVAGPAALMVFSFITWFTS  68

Query  777  ALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISM  598
             LLADCYRSP PV+G RNYTY D VR+ LGG+KVQLCGL+QY N +G SIGYTITASISM
Sbjct  69   TLLADCYRSPDPVSGKRNYTYRDAVRTSLGGLKVQLCGLAQYGNFIGASIGYTITASISM  128

Query  597  VAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYS  418
             AV +SNCFHKNGH   C V + PFM+IFA IQ+VLSQIPNFH+LSWLSI+AA+MSF+YS
Sbjct  129  AAVIRSNCFHKNGHHVKCHVSNNPFMIIFACIQIVLSQIPNFHKLSWLSILAALMSFSYS  188

Query  417  SIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEI  238
             IGIGLS AKVA       ++LTGV VGVDVT  +K+WR FQAIG+IAFA+ +S VLIEI
Sbjct  189  LIGIGLSAAKVAERNHDVRTSLTGVQVGVDVTATEKVWRTFQAIGDIAFAFTFSPVLIEI  248

Query  237  QDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWL  58
            QDTL+S  PEN VMKKAS IGV TT +FYV+CGC+GYAAFGN APGNFLTGFG YEPFWL
Sbjct  249  QDTLKSSIPENQVMKKASFIGVLTTALFYVLCGCVGYAAFGNKAPGNFLTGFGLYEPFWL  308

Query  57   IDVANICIAIHLVGAYQVF  1
            ID AN+CI IHL+GAYQVF
Sbjct  309  IDFANVCIVIHLIGAYQVF  327



>ref|XP_009138576.1| PREDICTED: amino acid permease 1-like [Brassica rapa]
Length=484

 Score =   474 bits (1219),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 237/344 (69%), Positives = 280/344 (81%), Gaps = 7/344 (2%)
 Frame = -1

Query  1032  RKHPRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSW  853
             ++HP    A     +Y E      KN DDDG EKRTGT +TASAHIITAVIGSGVLSLSW
Sbjct  8     QEHP----AAESGDIYAESNPT--KNMDDDGREKRTGTWLTASAHIITAVIGSGVLSLSW  61

Query  852   AIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQ  673
             AIAQLGW AG  +L  FS IT+FTS +LADCYR+P PVTG RNYTYMDVVR++LGG KVQ
Sbjct  62    AIAQLGWIAGLLILVIFSFITYFTSTMLADCYRAPDPVTGKRNYTYMDVVRAYLGGRKVQ  121

Query  672   LCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLV  493
             LCG++QY NL+GI++GYTITASIS+VA+ K+NCFH  GH  DC++ SYP+M  F  IQ++
Sbjct  122   LCGVAQYGNLIGITVGYTITASISLVAIGKANCFHDKGHHADCTLSSYPYMAAFGIIQII  181

Query  492   LSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGAD  313
             LSQIPNFH+LS+LSI+AAVMSF Y++IGIGL++A VAG G+   + +TG VVGVDVT   
Sbjct  182   LSQIPNFHKLSFLSIMAAVMSFTYATIGIGLAMATVAG-GKVGKTNMTGTVVGVDVTATQ  240

Query  312   KIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCI  133
             KIWR FQA+G+IAFAYAY+TVLIEIQDTL+S P EN  MK+AS +GVSTTT FY++CGC 
Sbjct  241   KIWRSFQAVGDIAFAYAYATVLIEIQDTLKSSPAENKSMKRASLVGVSTTTFFYILCGCF  300

Query  132   GYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GYAAFGN APG+FLT FGFYEPFWLID AN CIA HL+GAYQVF
Sbjct  301   GYAAFGNKAPGDFLTDFGFYEPFWLIDFANACIAFHLIGAYQVF  344



>ref|XP_006302194.1| hypothetical protein CARUB_v10020203mg [Capsella rubella]
 gb|EOA35092.1| hypothetical protein CARUB_v10020203mg [Capsella rubella]
Length=486

 Score =   474 bits (1219),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 230/320 (72%), Positives = 275/320 (86%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN D+DG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L  FS IT+FT
Sbjct  28   KNVDEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTTILLIFSFITYFT  87

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P PVTG RNYTYM+VVR++LGG KVQLCG++QY NL+GI++GYTITASIS
Sbjct  88   STMLADCYRAPDPVTGKRNYTYMEVVRAYLGGRKVQLCGVAQYGNLIGITVGYTITASIS  147

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VAV K+NCFH  GHD DC+  +YP+M  F  IQ++LSQIPNFH+LS+LSI+AAVMSF Y
Sbjct  148  LVAVGKANCFHDKGHDADCAASNYPYMAAFGIIQVILSQIPNFHKLSFLSIMAAVMSFTY  207

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            ++IGIGL+IA VAG G+   +++TG  VGVDVT A KIWR FQA+G+IAFAYAY+TVLIE
Sbjct  208  ATIGIGLAIATVAG-GKVGKTSMTGTAVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIE  266

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS P EN  MK+AS +GVSTTT FY++CGC+GYAAFGN+APG+FLT FGF+EP+W
Sbjct  267  IQDTLRSSPAENKAMKRASLVGVSTTTFFYILCGCLGYAAFGNNAPGDFLTDFGFFEPYW  326

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA HL+GAYQVF
Sbjct  327  LIDFANACIAAHLIGAYQVF  346



>ref|XP_002889785.1| hypothetical protein ARALYDRAFT_471112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66044.1| hypothetical protein ARALYDRAFT_471112 [Arabidopsis lyrata subsp. 
lyrata]
Length=487

 Score =   473 bits (1216),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 232/349 (66%), Positives = 285/349 (82%), Gaps = 13/349 (4%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M    NP  VE G   +K+ DDDG EKRTGT +TASAHIITAVIGSGVLSL+WA+AQLGW
Sbjct  1     MEAYHNPSAVESGDAAVKSLDDDGREKRTGTFMTASAHIITAVIGSGVLSLAWALAQLGW  60

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AG  +L AF++IT++TS +LADCYRSP P+ GTRNY YM VVR++LGG KVQLCGL+QY
Sbjct  61    VAGTIILVAFAIITYYTSTMLADCYRSPDPINGTRNYNYMGVVRTYLGGKKVQLCGLAQY  120

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NLVG++IGYTITASIS+VA+ KSNC+H  GH   CSV +YP+M  F  +Q++LSQ+PNF
Sbjct  121   VNLVGVTIGYTITASISLVAIGKSNCYHDKGHKAKCSVSNYPYMAAFGIVQIILSQLPNF  180

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             H+LS+LSI+AAVMSF+Y+SIGIGL+IA VA SG+   + LTG V+GVDVT ++K+W+ FQ
Sbjct  181   HKLSFLSIIAAVMSFSYASIGIGLAIATVA-SGKIGKTELTGTVIGVDVTASEKVWKLFQ  239

Query  291   AIGNIAFAYAYSTVLIEIQ------------DTLRSHPPENMVMKKASAIGVSTTTVFYV  148
             AIG+IAF+YA++T+LIEIQ            DTLRS PPEN VMK+AS  GVSTTTVFY+
Sbjct  240   AIGDIAFSYAFTTILIEIQAYHFYYHFLQREDTLRSSPPENKVMKRASLAGVSTTTVFYI  299

Query  147   MCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             +CGCIGYAAFGN APG+FLT FGFYEP+WL+D AN CIA+HL+GAYQV+
Sbjct  300   LCGCIGYAAFGNQAPGDFLTDFGFYEPYWLVDFANACIALHLIGAYQVY  348



>ref|XP_010269103.1| PREDICTED: amino acid permease 6-like [Nelumbo nucifera]
Length=465

 Score =   472 bits (1214),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 228/320 (71%), Positives = 269/320 (84%), Gaps = 0/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K+ DDDG  KRTGTL+TASAHI T VIGSGVLSL+W +AQLGW AGP VL  F++IT+FT
Sbjct  8    KDLDDDGRIKRTGTLMTASAHIFTTVIGSGVLSLAWVVAQLGWIAGPVVLILFAVITWFT  67

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYRSP PVTG RNYTYMD V+++LGG+ +QLCGL+QY + +G +IGYTITASIS
Sbjct  68   SVLLADCYRSPDPVTGKRNYTYMDAVKANLGGIMIQLCGLAQYGSFIGATIGYTITASIS  127

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M AV+ SNCFHKNGH   C    YPFM+IFA IQ++LSQIPNFH+LSWLSI+AA+MSF+Y
Sbjct  128  MAAVQMSNCFHKNGHHAKCDASHYPFMIIFACIQIILSQIPNFHKLSWLSIIAAIMSFSY  187

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S IGIGLS+AKVA       ++L GV VG+DVT  +K+WR FQAIG+ AFAY ++ VL+E
Sbjct  188  SLIGIGLSVAKVAEKNHNVRTSLRGVEVGLDVTATEKMWRVFQAIGDTAFAYTFAPVLVE  247

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S+PPEN VMKKAS IGV  T++FYV+CGCIGYAAFGNDAPGNFLTGFGFYEPFW
Sbjct  248  IQDTLKSNPPENEVMKKASFIGVLITSMFYVLCGCIGYAAFGNDAPGNFLTGFGFYEPFW  307

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID +N CI +HLVGAYQVF
Sbjct  308  LIDFSNACIVVHLVGAYQVF  327



>emb|CDY04349.1| BnaC04g18440D [Brassica napus]
Length=484

 Score =   472 bits (1214),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 233/320 (73%), Positives = 271/320 (85%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN DDDG EKRTGT +TASAHIITAVIGSGVLSLSWAIAQLGW AG  +L  FS IT+FT
Sbjct  26   KNVDDDGREKRTGTWLTASAHIITAVIGSGVLSLSWAIAQLGWIAGLLILVIFSFITYFT  85

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P PVTG RNYTYMDVVRS+LGG KVQLCG++QY NL+GI++GYTITASIS
Sbjct  86   STMLADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASIS  145

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VA+ K+NCFH  GH  DC+  SYP+M  F  IQ++LSQIPNFH+LS+LSI+AAVMSF Y
Sbjct  146  LVAIGKANCFHDKGHHADCTFSSYPYMAAFGIIQIILSQIPNFHKLSFLSIMAAVMSFTY  205

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            ++IGIGL++A VAG G+   + +TG VVGVDVT   KIWR FQA+G+IAFAYAY+TVLIE
Sbjct  206  ATIGIGLAMATVAG-GKVGKTNMTGTVVGVDVTATQKIWRSFQAVGDIAFAYAYATVLIE  264

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P EN  MK+AS +GVSTTT FY++CGC GYAAFGN APG+FLT FGFYEPFW
Sbjct  265  IQDTLKSSPAENKSMKRASLLGVSTTTFFYILCGCFGYAAFGNKAPGDFLTDFGFYEPFW  324

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA HL+GAYQVF
Sbjct  325  LIDFANACIAFHLIGAYQVF  344



>ref|XP_006306441.1| hypothetical protein CARUB_v10012383mg [Capsella rubella]
 gb|EOA39339.1| hypothetical protein CARUB_v10012383mg [Capsella rubella]
Length=475

 Score =   471 bits (1213),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 225/337 (67%), Positives = 283/337 (84%), Gaps = 1/337 (0%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M    NP  VE G   +KN DDDG +KRTGT +TASAHIITAVIGSGVLSL+WA+AQLGW
Sbjct  1     MDTHHNPSAVEMGDTAVKNVDDDGRQKRTGTFLTASAHIITAVIGSGVLSLAWALAQLGW  60

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AG  VL +F++IT++TS  L+DCYR P  +TGTRNY+YM VVR++LGG KVQLCGL+QY
Sbjct  61    VAGTIVLVSFAVITYYTSTFLSDCYRGPDSITGTRNYSYMGVVRAYLGGRKVQLCGLAQY  120

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NLVG++IGYTITASIS+VA+ +SNC+H+ GH   CSV +YP+M  F  +Q++LSQIPNF
Sbjct  121   VNLVGVTIGYTITASISLVAIGRSNCYHEKGHKAKCSVSNYPYMASFGVVQIILSQIPNF  180

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             HE+S+LSI+AAVMSF+Y+SIGIGL+I+ VA SG    + +TG V+GVDVT  +K+W+ FQ
Sbjct  181   HEISFLSIIAAVMSFSYASIGIGLAISSVA-SGNVGKTEVTGTVIGVDVTATEKVWKSFQ  239

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIG++AF+YA++T+LIEIQDTLRS PPEN VMK+A+  GVSTTTVFY++CGC+GYAAFGN
Sbjct  240   AIGDMAFSYAFTTILIEIQDTLRSSPPENKVMKRATLAGVSTTTVFYILCGCLGYAAFGN  299

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
              APG+FLT FGFYEP+WL+D AN CIA+HL+GAYQV+
Sbjct  300   HAPGDFLTDFGFYEPYWLVDFANACIALHLIGAYQVY  336



>gb|KFK40897.1| hypothetical protein AALP_AA2G057600 [Arabis alpina]
Length=484

 Score =   471 bits (1212),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 235/323 (73%), Positives = 275/323 (85%), Gaps = 1/323 (0%)
 Frame = -1

Query  969  EILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLIT  790
            E  K+ D+DG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L  FS IT
Sbjct  23   EPTKDVDEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGVVILTIFSFIT  82

Query  789  FFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITA  610
            +FTS +LADCYR+P PVTG RNYTYMDVVRS+LGG KVQLCG++QY NL+GI++GYTITA
Sbjct  83   YFTSTMLADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITA  142

Query  609  SISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMS  430
            SIS+VA+ KSNCFH  GH  DC++  YP+M  F  IQ++LSQIPNFH+LS+LS++AAVMS
Sbjct  143  SISLVAIGKSNCFHGKGHHADCAISPYPYMAAFGIIQIILSQIPNFHKLSFLSLMAAVMS  202

Query  429  FAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTV  250
            F Y++IGIGL+IA VAG G+   +TLTG VVGVDVT A KIWR FQA+G+IAFAYAY+TV
Sbjct  203  FTYATIGIGLAIATVAG-GKVGKTTLTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYATV  261

Query  249  LIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYE  70
            LIEIQDTL+S P EN  MK+AS +GVSTTT FYV+CGCIGYAAFGN APG+FLT FGF+E
Sbjct  262  LIEIQDTLKSSPAENKAMKRASLVGVSTTTFFYVLCGCIGYAAFGNKAPGDFLTDFGFFE  321

Query  69   PFWLIDVANICIAIHLVGAYQVF  1
            PFWLID AN CIA HL+GAYQVF
Sbjct  322  PFWLIDFANACIAAHLIGAYQVF  344



>ref|XP_009113317.1| PREDICTED: amino acid permease 1 [Brassica rapa]
Length=515

 Score =   472 bits (1214),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 232/319 (73%), Positives = 274/319 (86%), Gaps = 1/319 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN DDDG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L  FS IT+FT
Sbjct  27   KNVDDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILIIFSFITYFT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P P+TG RNYTYMDVVRS+LGG KVQLCG++QY NL+GI++GYTITASIS
Sbjct  87   STMLADCYRAPDPLTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VA+ K+NC+H  GH  DC++ +YP+M  F  IQ++LSQIPNFH+LS+LS++AAVMSFAY
Sbjct  147  LVAIGKANCYHNKGHHADCTISNYPYMAAFGIIQILLSQIPNFHKLSFLSLMAAVMSFAY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            +SIGIGL+IA VAG G+   + +TG VVGVDVT A KIWR FQA+G+IAFAYAY+TVLIE
Sbjct  207  ASIGIGLAIATVAG-GKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIE  265

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS P EN  MK+AS +GVSTTT FY++CGC+GYAAFGN APG+FLT FGFYEPFW
Sbjct  266  IQDTLRSSPAENKAMKRASFVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTDFGFYEPFW  325

Query  60   LIDVANICIAIHLVGAYQV  4
            LID AN CIA HL+GAYQV
Sbjct  326  LIDFANACIAFHLIGAYQV  344



>gb|KFK43300.1| hypothetical protein AALP_AA1G106400 [Arabis alpina]
Length=392

 Score =   467 bits (1202),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 232/334 (69%), Positives = 279/334 (84%), Gaps = 2/334 (1%)
 Frame = -1

Query  999  QNPMYVEE-GREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAG  823
             NP  V+E G    K FDDDG EKRTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW AG
Sbjct  2    NNPSAVDESGDAAGKIFDDDGREKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWVAG  61

Query  822  PAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANL  643
              +L  F++I ++TS +LADCYRS     GTRNYTYMDVVR++LGG KVQLCGL+QY +L
Sbjct  62   TIILVIFAIINYYTSTMLADCYRSSDADPGTRNYTYMDVVRAYLGGKKVQLCGLAQYGSL  121

Query  642  VGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHEL  463
            +G++IGYTITASIS+VA+ K+NCFH+ GH   CS   YP+M  F  +Q++LSQIPNFH+L
Sbjct  122  IGVTIGYTITASISLVAIGKANCFHEKGHGEKCSASPYPYMAAFGIVQIILSQIPNFHKL  181

Query  462  SWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIG  283
            S+LS++AA+MSF+Y+SIG+GL+IA VA SG+   + LTG VVGVDVT +DKIW+ FQA+G
Sbjct  182  SFLSLIAALMSFSYASIGVGLAIATVA-SGKVGKTGLTGTVVGVDVTASDKIWKSFQAVG  240

Query  282  NIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAP  103
            +IAF+YAYS VLIEIQDTLRS PPEN VMKKAS  GVSTTTVFY++CGC+GYAAFGN AP
Sbjct  241  DIAFSYAYSVVLIEIQDTLRSSPPENKVMKKASLAGVSTTTVFYILCGCMGYAAFGNKAP  300

Query  102  GNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            G+ LT FGFYEP+WLID AN CIA+HL+GAYQVF
Sbjct  301  GDLLTDFGFYEPYWLIDFANACIALHLIGAYQVF  334



>ref|XP_010268968.1| PREDICTED: amino acid permease 6-like isoform X1 [Nelumbo nucifera]
Length=466

 Score =   470 bits (1209),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 229/320 (72%), Positives = 270/320 (84%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN DDDG E+RTGT++TASAH+IT VIGSGVLSL+W IAQLGWAAGPA L  FS+IT+FT
Sbjct  11   KNLDDDGRERRTGTMMTASAHVITTVIGSGVLSLAWVIAQLGWAAGPAALVLFSVITWFT  70

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYRSP  VTG RNYTYMDVVR++LGGVK++LCG++QY   +G +IG+TITAS+S
Sbjct  71   STLLADCYRSP--VTGNRNYTYMDVVRANLGGVKIKLCGIAQYGCFIGATIGFTITASLS  128

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M AVK+SNCFH NGH   C V + PFM+IFA IQ+VLSQIPN H+LSWLSIVAA+MSF+Y
Sbjct  129  MAAVKRSNCFHMNGHHAQCKVSNVPFMIIFACIQIVLSQIPNIHKLSWLSIVAALMSFSY  188

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S IGIGLS AKVA       ++  GV VGVDVT  +K+WR FQAIG+IAFAY ++ VL+E
Sbjct  189  SLIGIGLSAAKVAEGSHEVRTSWRGVEVGVDVTETEKVWRIFQAIGDIAFAYTFAPVLVE  248

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            +QDTL+S PPEN VMK+ S IGVSTT +FYV+CGCIGYAAFGNDAPGNFLTGFGFYEPFW
Sbjct  249  VQDTLKSSPPENKVMKRVSFIGVSTTAMFYVLCGCIGYAAFGNDAPGNFLTGFGFYEPFW  308

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN+CIA+HL+G YQ+ 
Sbjct  309  LIDFANVCIALHLIGVYQLL  328



>ref|XP_010268971.1| PREDICTED: amino acid permease 6-like [Nelumbo nucifera]
Length=469

 Score =   469 bits (1208),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 230/320 (72%), Positives = 271/320 (85%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN DDDG  KRTGTL+TASAH+IT VIGSGVLSL+W IAQLGW AGPA L  FS+I  FT
Sbjct  13   KNLDDDGRVKRTGTLMTASAHLITTVIGSGVLSLAWIIAQLGWVAGPAALVLFSVIACFT  72

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LLADCYRSP PVTG RNYTYMDVVR++LGG+KVQLCG++QY +  G +IG+TITAS+S
Sbjct  73   SSLLADCYRSPDPVTGNRNYTYMDVVRANLGGIKVQLCGIAQYGSFAGATIGFTITASLS  132

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M AVK+SNCFH NGH  +C V +YP+ +IFA IQ+VLSQIPN H+LSWLSIVAA+MSF+Y
Sbjct  133  MAAVKRSNCFHMNGHHANCKVSNYPYTIIFACIQIVLSQIPNIHKLSWLSIVAALMSFSY  192

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S IGIGL+ AK+AG     NS   GV VGVDVT  +K+WR FQAIG+IAF+Y+++ VL+E
Sbjct  193  SLIGIGLAAAKIAGCHEVRNS-WRGVEVGVDVTETEKVWRIFQAIGDIAFSYSFAPVLVE  251

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S PPEN VMK+AS IGVSTT +FY++CGCIGYAAFGNDAPGNFLTG GFYEPFW
Sbjct  252  IQDTLKSSPPENKVMKRASFIGVSTTAMFYILCGCIGYAAFGNDAPGNFLTGLGFYEPFW  311

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN+CIAIHL+G YQ+ 
Sbjct  312  LIDFANVCIAIHLIGVYQLL  331



>emb|CDY04448.1| BnaA03g59400D [Brassica napus]
Length=540

 Score =   470 bits (1209),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 235/344 (68%), Positives = 277/344 (81%), Gaps = 7/344 (2%)
 Frame = -1

Query  1032  RKHPRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSW  853
              +HP    A     +Y E      KN DDDG EKRTGT +TASAHIITAVIG GVLSLSW
Sbjct  8     HEHP----AAESGDIYAESNPT--KNMDDDGREKRTGTCLTASAHIITAVIGYGVLSLSW  61

Query  852   AIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQ  673
             AIAQLGW AG  +L  FS IT+ TS +LADCYR+P PVTG RNYTYMDVVR++LGG KVQ
Sbjct  62    AIAQLGWIAGLLILVIFSFITYLTSTMLADCYRAPDPVTGKRNYTYMDVVRAYLGGRKVQ  121

Query  672   LCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLV  493
             LCG++QY NL+GI++GYTITASIS+VA+ K+NCFH  GH  DC++ SYP+M  F  IQ++
Sbjct  122   LCGVAQYGNLIGITVGYTITASISLVAIGKANCFHDKGHHADCTLSSYPYMAAFGIIQII  181

Query  492   LSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGAD  313
             LSQIPNFH+LS+LSI+AAVMSF Y++IGIGL++A VAG G+   + +TG VVGVDVT   
Sbjct  182   LSQIPNFHKLSFLSIMAAVMSFTYATIGIGLAMATVAG-GKVRKTNMTGTVVGVDVTATQ  240

Query  312   KIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCI  133
             KIWR FQA+G+IAFAYAY+TVLIEIQDTL+S P EN  MK+AS +GVSTTT FY++CGC 
Sbjct  241   KIWRSFQAVGDIAFAYAYATVLIEIQDTLKSSPAENKSMKRASLVGVSTTTFFYILCGCF  300

Query  132   GYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GYAAFGN APG+FLT FGFYEPFWLID AN CIA HL+GAYQVF
Sbjct  301   GYAAFGNKAPGDFLTDFGFYEPFWLIDFANACIAFHLIGAYQVF  344



>emb|CDY60248.1| BnaC01g42990D [Brassica napus]
Length=507

 Score =   467 bits (1202),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 234/343 (68%), Positives = 277/343 (81%), Gaps = 24/343 (7%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN DDDG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L  FS IT+FT
Sbjct  26   KNVDDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILVIFSFITYFT  85

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P PVTG RNYTYMDVVRS+LGG KVQLCG++QY NL+GI++GYTITASIS
Sbjct  86   STMLADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASIS  145

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VAV K+NCFHK GH+ DC++ +YP+M +F  IQ++LSQIPNFH+LS+LS++AAVMSF Y
Sbjct  146  LVAVGKANCFHKKGHEADCTISNYPYMAVFGIIQIILSQIPNFHKLSFLSLMAAVMSFTY  205

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            ++IGIGL+IA VAG G+   + +TG VVGVDVT A KIWR FQA+G+IAFAYAY+TVLIE
Sbjct  206  ATIGIGLAIATVAG-GKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIE  264

Query  240  IQ-----------------------DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIG  130
            IQ                       DTL+S P EN  MK+AS +GVSTTT FY++CGC+G
Sbjct  265  IQASFHIKYLWNLVSFEYEPLDRIVDTLKSSPAENKSMKRASLVGVSTTTFFYILCGCLG  324

Query  129  YAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            YAAFGN APG+FLT FGFYEPFWLID AN CIA HL+GAYQVF
Sbjct  325  YAAFGNKAPGDFLTDFGFYEPFWLIDFANACIAFHLIGAYQVF  367



>emb|CDY44564.1| BnaA01g21750D [Brassica napus]
Length=507

 Score =   467 bits (1201),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 234/343 (68%), Positives = 277/343 (81%), Gaps = 24/343 (7%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN DDDG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L  FS IT+FT
Sbjct  26   KNVDDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILVIFSFITYFT  85

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P PVTG RNYTYMDVVRS+LGG KVQLCG++QY NL+GI++GYTITASIS
Sbjct  86   STMLADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASIS  145

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VAV K+NCFHK GH+ DC++ +YP+M +F  IQ++LSQIPNFH+LS+LS++AAVMSF Y
Sbjct  146  LVAVGKANCFHKKGHEADCTISNYPYMAVFGIIQIILSQIPNFHKLSFLSLMAAVMSFTY  205

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            ++IGIGL+IA VAG G+   + +TG VVGVDVT A KIWR FQA+G+IAFAYAY+TVLIE
Sbjct  206  ATIGIGLAIATVAG-GKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIE  264

Query  240  IQ-----------------------DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIG  130
            IQ                       DTL+S P EN  MK+AS +GVSTTT FY++CGC+G
Sbjct  265  IQASFHIKYLWNLVSFEYEPLDRIVDTLKSSPAENKSMKRASLVGVSTTTFFYILCGCLG  324

Query  129  YAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            YAAFGN APG+FLT FGFYEPFWLID AN CIA HL+GAYQVF
Sbjct  325  YAAFGNKAPGDFLTDFGFYEPFWLIDFANACIAFHLIGAYQVF  367



>ref|XP_004955421.1| PREDICTED: amino acid permease 6-like [Setaria italica]
Length=483

 Score =   466 bits (1198),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 234/327 (72%), Positives = 275/327 (84%), Gaps = 1/327 (0%)
 Frame = -1

Query  981  EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAF  802
            E G     + DDDG E+RTGTLVTASAHIITAVIGSGVLSL+WAIAQLGW  GP VL AF
Sbjct  20   EAGYGDRPDLDDDGRERRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPVVLVAF  79

Query  801  SLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGY  622
            S+IT+F S+LLADCYR+P PV G RNYTY   VR++LG  K +LC L+QY NLVG++IGY
Sbjct  80   SVITWFCSSLLADCYRAPDPVHGKRNYTYGQAVRAYLGVSKYRLCSLAQYINLVGVTIGY  139

Query  621  TITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVA  442
            TIT +ISM A+K+SNCFH+NGH  DC   +   M+IFA IQ++LSQ+PNFH+L WLSIVA
Sbjct  140  TITTAISMGAIKRSNCFHRNGHSADCEASNTTNMIIFAGIQILLSQLPNFHKLWWLSIVA  199

Query  441  AVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYA  262
            AVMS AYSSIG+GLSIAK+AG G  A +TLTG  VGVDV+  +KIW+ FQ++G+IAFAY+
Sbjct  200  AVMSLAYSSIGLGLSIAKIAG-GVHAKTTLTGATVGVDVSATEKIWKTFQSLGDIAFAYS  258

Query  261  YSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGF  82
            YS VLIEIQDTLRS PPEN+VMKKAS IGVSTTT+FY++CG +GYAAFGN APGNFLTGF
Sbjct  259  YSNVLIEIQDTLRSSPPENVVMKKASFIGVSTTTMFYMLCGVLGYAAFGNQAPGNFLTGF  318

Query  81   GFYEPFWLIDVANICIAIHLVGAYQVF  1
            GFY+PFWLIDV N+CIAIHL+GAYQVF
Sbjct  319  GFYDPFWLIDVGNVCIAIHLIGAYQVF  345



>ref|XP_008801682.1| PREDICTED: amino acid permease 6 [Phoenix dactylifera]
Length=480

 Score =   465 bits (1197),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 232/328 (71%), Positives = 274/328 (84%), Gaps = 1/328 (0%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            V +G E L +FDDDG  KRTGTL+TAS+HIITAVIGSGVLSL+W++AQLGW AGPAVL A
Sbjct  16   VAKGSEALVDFDDDGRAKRTGTLLTASSHIITAVIGSGVLSLAWSVAQLGWVAGPAVLFA  75

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            FSLIT+F + LL DCYRSP P  G RNYTY D V S+LGGV  +LCG +QYANLVG +IG
Sbjct  76   FSLITWFCARLLVDCYRSPNPTYGKRNYTYRDAVGSYLGGVNYKLCGAAQYANLVGTAIG  135

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTIT +ISM A+K+S+CFHKNGHD  C   +   M+IFA+IQ++LS IPNFH++ WLSI+
Sbjct  136  YTITTAISMGAIKRSDCFHKNGHDLICEASNNTNMIIFASIQIILSLIPNFHKIWWLSIL  195

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            AA+MSF YSSIG+GLSIAK+A  G    +TLTGV VGVDV+  +K+WR FQA+GNIAFA+
Sbjct  196  AAIMSFTYSSIGLGLSIAKIA-VGVQVRTTLTGVTVGVDVSATEKVWRTFQALGNIAFAF  254

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
             YS VLIEI+DTL+S+PPEN VMKKAS IGVS TTVFY +CG +GYAAFGNDAPGNFLTG
Sbjct  255  TYSNVLIEIEDTLKSNPPENQVMKKASNIGVSITTVFYALCGVLGYAAFGNDAPGNFLTG  314

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQVF  1
            FGFYEPFWL+DV NIC+ IHL+GAYQVF
Sbjct  315  FGFYEPFWLVDVGNICVTIHLIGAYQVF  342



>ref|XP_010470262.1| PREDICTED: amino acid permease 1 [Camelina sativa]
Length=485

 Score =   465 bits (1196),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 228/320 (71%), Positives = 274/320 (86%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN D+DG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG ++L  FS IT+FT
Sbjct  27   KNVDEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTSILLIFSFITYFT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P PVTG RNYTYM+VV+++LGG KVQLCGL+QY NL+GI++GYTITASIS
Sbjct  87   STMLADCYRAPDPVTGKRNYTYMEVVQAYLGGRKVQLCGLAQYGNLIGITVGYTITASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VAV K+NC+H  G   DCSV SYP+M +F  IQ++LSQIPNFH+LS+LSI+AAVMSF Y
Sbjct  147  LVAVGKANCYHDKGKQADCSVSSYPYMALFGIIQVILSQIPNFHKLSFLSIMAAVMSFTY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            ++IGIGL+I+ VA  GR   +++TG  VGVDVT A KIWR FQA+G+IAFAYAY+TVLIE
Sbjct  207  ATIGIGLAISYVA-VGRVGKTSITGTAVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIE  265

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS P EN  MK+AS +GVSTTT FY++CGC+GYAAFG+ APG+FLT FGF+EP+W
Sbjct  266  IQDTLRSSPAENKAMKRASLVGVSTTTFFYILCGCMGYAAFGSAAPGDFLTDFGFFEPYW  325

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA HL+GAYQVF
Sbjct  326  LIDFANACIAAHLIGAYQVF  345



>ref|XP_010414737.1| PREDICTED: amino acid permease 1-like [Camelina sativa]
Length=485

 Score =   464 bits (1193),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 227/320 (71%), Positives = 274/320 (86%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN D+DG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG ++L  FS IT+FT
Sbjct  27   KNVDEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGISILLIFSFITYFT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P PVTG RNYTYM+VV+++LGG KVQLCG++QY NL+GI++GYTITASIS
Sbjct  87   STMLADCYRAPDPVTGKRNYTYMEVVQAYLGGRKVQLCGVAQYGNLIGITVGYTITASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VAV K+NC+H  G   DCSV +YP+M +F  IQ++LSQIPNFH+LS+LSI+AAVMSF Y
Sbjct  147  LVAVGKANCYHDKGKQADCSVSNYPYMAVFGIIQVILSQIPNFHKLSFLSIMAAVMSFTY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            ++IGIGL+I+ VA  GR   +++TG  VGVDVT A KIWR FQA+G+IAFAYAY+TVLIE
Sbjct  207  ATIGIGLAISYVA-VGRVGKTSITGTAVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIE  265

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS P EN  MK+AS +GVSTTT FY++CGC+GYAAFG+ APG+FLT FGFYEP+W
Sbjct  266  IQDTLRSSPAENKAMKRASLVGVSTTTFFYILCGCMGYAAFGSAAPGDFLTDFGFYEPYW  325

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA HL+GAYQVF
Sbjct  326  LIDFANACIAAHLIGAYQVF  345



>ref|XP_006657428.1| PREDICTED: amino acid permease 6-like [Oryza brachyantha]
Length=484

 Score =   462 bits (1189),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 235/327 (72%), Positives = 273/327 (83%), Gaps = 1/327 (0%)
 Frame = -1

Query  981  EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAF  802
            E G     + DDDG EKRTGTLVTASAHIITAVIGSGVLSL+WAIAQLGW  GPAVL AF
Sbjct  19   ESGYGDRPDLDDDGREKRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPAVLVAF  78

Query  801  SLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGY  622
            S+IT+F S+LLADCYRSP PV G RNYTY   VR++LG  K +LC L+QY NLVG++IGY
Sbjct  79   SVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVAKYRLCSLAQYINLVGVTIGY  138

Query  621  TITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVA  442
            TIT +ISM A+K+SNCFH+NGHD  C       M+IFA IQ++LSQ+PNFH++ WLSIVA
Sbjct  139  TITTAISMGAIKRSNCFHQNGHDAACLASDTTNMIIFAGIQILLSQLPNFHKIWWLSIVA  198

Query  441  AVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYA  262
            AVMS AYS+IG+GLSIAK+AG G  A +TLTGV VGVDV+ ++KIWR FQ++G+IAFAY+
Sbjct  199  AVMSLAYSTIGLGLSIAKIAG-GAHAKTTLTGVTVGVDVSASEKIWRTFQSLGDIAFAYS  257

Query  261  YSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGF  82
            YS VLIEIQDTLRS P EN VMKKAS IGVSTTT FY++CG +GYAAFGN APGNFLTGF
Sbjct  258  YSNVLIEIQDTLRSSPAENEVMKKASFIGVSTTTTFYMLCGVLGYAAFGNRAPGNFLTGF  317

Query  81   GFYEPFWLIDVANICIAIHLVGAYQVF  1
            GFYEPFWL+DV N+CI +HLVGAYQVF
Sbjct  318  GFYEPFWLVDVGNVCIVVHLVGAYQVF  344



>ref|XP_006417505.1| hypothetical protein EUTSA_v10009701mg [Eutrema salsugineum]
 gb|ESQ35858.1| hypothetical protein EUTSA_v10009701mg [Eutrema salsugineum]
Length=469

 Score =   461 bits (1187),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 231/320 (72%), Positives = 272/320 (85%), Gaps = 3/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
             N DDDG EKRTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L  F++I ++T
Sbjct  14   NNVDDDGKEKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWVAGTVILVTFAIINYYT  73

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYRSP    GTRNYTYMDVVR++LGG KVQLCGL+QY +LVG++IG+TITASIS
Sbjct  74   STMLADCYRSPD--AGTRNYTYMDVVRAYLGGRKVQLCGLAQYGSLVGVTIGFTITASIS  131

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VA+ K+NCFH  GH   CSV +YP+M  F  IQ++LSQIPNFH+LS+LSI AA+MSF+Y
Sbjct  132  LVAIGKANCFHDKGHGAKCSVSNYPYMATFGIIQIILSQIPNFHKLSFLSIFAAIMSFSY  191

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            +SIGIGLSIA VA SG+   +TLTG VVGVDV  +DKIW+ FQA G+IA +YAYS VL+E
Sbjct  192  ASIGIGLSIATVA-SGKVGKTTLTGTVVGVDVNASDKIWKSFQATGDIASSYAYSIVLVE  250

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS PPEN VMKKAS  GVSTTTVFY++CGCIGYAAFGN+APG+FLT FGFYEP+W
Sbjct  251  IQDTLRSSPPENKVMKKASLAGVSTTTVFYILCGCIGYAAFGNNAPGDFLTDFGFYEPYW  310

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA+HL+ AYQVF
Sbjct  311  LIDFANACIALHLIAAYQVF  330



>gb|EEC81471.1| hypothetical protein OsI_24794 [Oryza sativa Indica Group]
Length=485

 Score =   461 bits (1187),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 233/327 (71%), Positives = 272/327 (83%), Gaps = 1/327 (0%)
 Frame = -1

Query  981  EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAF  802
            E G     + DDDG EKRTGTLVTASAHIITAVIGSGVLSL+WAIAQLGW  GPAVL AF
Sbjct  20   ESGYADRPDLDDDGREKRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPAVLVAF  79

Query  801  SLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGY  622
            S+IT+F S+LLADCYRSP PV G RNYTY   VR++LG  K +LC ++QY NLVG++IGY
Sbjct  80   SVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVAKYRLCSVAQYVNLVGVTIGY  139

Query  621  TITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVA  442
            TIT +ISM A+K+SNCFH+NGHD  C       M+IFA IQ++LSQ+PNFH++ WLSIVA
Sbjct  140  TITTAISMGAIKRSNCFHRNGHDAACLASDTTNMIIFAGIQILLSQLPNFHKIWWLSIVA  199

Query  441  AVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYA  262
            AVMS AYS+IG+GLSIAK+AG G    +TLTGV VGVDV+ ++KIWR FQ++G+IAFAY+
Sbjct  200  AVMSLAYSTIGLGLSIAKIAG-GAHPEATLTGVTVGVDVSASEKIWRTFQSLGDIAFAYS  258

Query  261  YSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGF  82
            YS VLIEIQDTLRS P EN VMKKAS IGVSTTT FY++CG +GYAAFGN APGNFLTGF
Sbjct  259  YSNVLIEIQDTLRSSPAENEVMKKASFIGVSTTTTFYMLCGVLGYAAFGNRAPGNFLTGF  318

Query  81   GFYEPFWLIDVANICIAIHLVGAYQVF  1
            GFYEPFWL+DV N+CI +HLVGAYQVF
Sbjct  319  GFYEPFWLVDVGNVCIVVHLVGAYQVF  345



>ref|XP_002889784.1| hypothetical protein ARALYDRAFT_888258 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66043.1| hypothetical protein ARALYDRAFT_888258 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   460 bits (1183),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 231/334 (69%), Positives = 270/334 (81%), Gaps = 5/334 (1%)
 Frame = -1

Query  1002  SQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAG  823
               NP  VE G      FDDDG EKRTGT +TASAHIITAVIGSGVLSLSWAIAQLGW AG
Sbjct  26    EHNPSAVESGNR----FDDDGREKRTGTFMTASAHIITAVIGSGVLSLSWAIAQLGWLAG  81

Query  822   PAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANL  643
               +L  F+ I ++TS +LADCYRSP    GTRNYTYMDVVR++LGG KVQLCGL+QY +L
Sbjct  82    TVILVTFASINYYTSTMLADCYRSPDTAPGTRNYTYMDVVRAYLGGRKVQLCGLAQYGSL  141

Query  642   VGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHEL  463
             VG++IGYTITASIS+VA+ K+NCFH  GHD  CS+ +YP M  F  +QL+LSQIPNFH+L
Sbjct  142   VGVTIGYTITASISLVAIGKANCFHDKGHDAKCSLSNYPSMAAFGIVQLMLSQIPNFHKL  201

Query  462   SWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIG  283
             S+LSI+A VMSF Y+SIGIGLSI  V  SG+   + LTG VVGVDVT ++K+WR FQA+G
Sbjct  202   SFLSIIATVMSFCYASIGIGLSITTVT-SGKVGKTGLTGTVVGVDVTASEKMWRSFQAVG  260

Query  282   NIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAP  103
             +IAF+YAYS VL+EIQDTL+S PPEN VMKKAS  GVSTTTVFY++CG IGYAAFGN AP
Sbjct  261   DIAFSYAYSIVLVEIQDTLKSTPPENKVMKKASLAGVSTTTVFYILCGGIGYAAFGNKAP  320

Query  102   GNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             G+ LT FGFYEP+WLID AN CI +HL+ AYQVF
Sbjct  321   GDLLTDFGFYEPYWLIDFANACIVLHLIAAYQVF  354



>ref|XP_006346279.1| PREDICTED: amino acid permease 6-like [Solanum tuberosum]
Length=464

 Score =   458 bits (1178),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 223/319 (70%), Positives = 269/319 (84%), Gaps = 3/319 (1%)
 Frame = -1

Query  957  NFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTS  778
             FDDDG  KRTGT++T SAHIITAVIGSGVLSL+WA AQLGW AGP  L AFS IT+FTS
Sbjct  10   KFDDDGRPKRTGTVMTTSAHIITAVIGSGVLSLAWATAQLGWIAGPVALIAFSAITWFTS  69

Query  777  ALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISM  598
             LLADCYR+P    G+R+YTYMD VR+HLGG KVQLCGL+QY+NL G++IGY IT SISM
Sbjct  70   LLLADCYRAP---DGSRSYTYMDAVRAHLGGRKVQLCGLAQYSNLFGVTIGYAITTSISM  126

Query  597  VAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYS  418
            VA+K+SNCFH+ GHD  C   + PF+++F  +Q++L QIPNFH+LS+LSI+AAVMSFAYS
Sbjct  127  VAIKRSNCFHRKGHDAGCHESNNPFIILFGIMQILLCQIPNFHKLSFLSIIAAVMSFAYS  186

Query  417  SIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEI  238
             IG+GLSIAK+A  G +AN++LTG  VG DV+G DK+W  F A+G+IAFAYA+STVLIEI
Sbjct  187  FIGLGLSIAKIAKDGVSANTSLTGTSVGKDVSGTDKMWNTFSALGDIAFAYAFSTVLIEI  246

Query  237  QDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWL  58
            QDTL+SHPPEN  MKKA+ +G+S +T+FY +CG +GYAAFGN APGNFLTGFGFYEPFWL
Sbjct  247  QDTLKSHPPENKSMKKAALVGISVSTIFYTLCGLLGYAAFGNKAPGNFLTGFGFYEPFWL  306

Query  57   IDVANICIAIHLVGAYQVF  1
            +D AN+CI +HLVGAYQVF
Sbjct  307  VDFANVCIVVHLVGAYQVF  325



>ref|XP_009118279.1| PREDICTED: amino acid permease 8-like [Brassica rapa]
Length=488

 Score =   459 bits (1180),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 234/336 (70%), Positives = 274/336 (82%), Gaps = 6/336 (2%)
 Frame = -1

Query  1008  AVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWA  829
             A   NP  VE       NFDDDG EKRTGTL+TA+AHIITAVIGSGVLSL+WAIAQLGW 
Sbjct  20    ATEYNPSAVETAGN---NFDDDGREKRTGTLMTATAHIITAVIGSGVLSLAWAIAQLGWV  76

Query  828   AGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYA  649
             AG  +L  F++I +FTS +LADCYRSP   TG RNY YMDVVR++LGG KV+LCGL+QY 
Sbjct  77    AGTVILVTFAVINYFTSTMLADCYRSPD--TGIRNYNYMDVVRAYLGGWKVKLCGLAQYG  134

Query  648   NLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFH  469
             +LVGI+IGYTITASIS+VA+ K+NCFH  GHD  CSV +YP M  F   Q+VLSQI NFH
Sbjct  135   SLVGITIGYTITASISLVAIGKANCFHDKGHDAKCSVSNYPLMAAFGITQIVLSQIHNFH  194

Query  468   ELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQA  289
             +LS+LSI+A VMSF+Y+SIGIGL++A +A SG+   + LTG VVGVDVT +DKIWR FQA
Sbjct  195   KLSFLSIIATVMSFSYASIGIGLALAALA-SGKVGKTDLTGTVVGVDVTASDKIWRSFQA  253

Query  288   IGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGND  109
              G+IAF+YA+S VL+EIQDTLRS PPEN VMKKAS  GVSTTT FY++CGCIGYAAFGN 
Sbjct  254   AGDIAFSYAFSVVLVEIQDTLRSSPPENKVMKKASLAGVSTTTGFYILCGCIGYAAFGNQ  313

Query  108   APGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             APG+FLT FGFYEP+WLID AN CIA+HL+ AYQVF
Sbjct  314   APGDFLTDFGFYEPYWLIDFANACIAVHLIAAYQVF  349



>dbj|BAJ85485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score =   458 bits (1178),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 233/327 (71%), Positives = 274/327 (84%), Gaps = 1/327 (0%)
 Frame = -1

Query  981  EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAF  802
            E G     + DDDG E+RTGTLVTASAHIITAVIGSGVLSL+WAIAQLGW  GPAVL AF
Sbjct  17   EAGFGDRTDIDDDGRERRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPAVLVAF  76

Query  801  SLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGY  622
            S+IT+F S+LLADCYRSP PV G RNYTY   VR++LG  K +LC L+QY NLVG++IGY
Sbjct  77   SVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVSKYRLCSLAQYLNLVGVTIGY  136

Query  621  TITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVA  442
            TIT +ISM A+ +SNCFH+NGH+  C   +   M+IFAAIQ++LSQ+PNFH++ WLSIVA
Sbjct  137  TITTAISMGAIGRSNCFHRNGHNAACEASNTTNMIIFAAIQILLSQLPNFHKVWWLSIVA  196

Query  441  AVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYA  262
            AVMS AYSSIG+GLSIAK+AG G  A +TLTGV VGVDV+ ++KIWR FQ++G+IAFAY+
Sbjct  197  AVMSLAYSSIGLGLSIAKIAG-GVHAKTTLTGVTVGVDVSASEKIWRTFQSLGDIAFAYS  255

Query  261  YSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGF  82
            YS VLIEIQDTLRS P EN VMKKAS IGVSTTT FY++CG +GYAAFG+ APGNFLTGF
Sbjct  256  YSNVLIEIQDTLRSSPAENTVMKKASLIGVSTTTTFYMLCGVLGYAAFGSSAPGNFLTGF  315

Query  81   GFYEPFWLIDVANICIAIHLVGAYQVF  1
            GFYEPFWL+DV N+CI +HLVGAYQVF
Sbjct  316  GFYEPFWLVDVGNVCIVVHLVGAYQVF  342



>ref|XP_002461426.1| hypothetical protein SORBIDRAFT_02g002440 [Sorghum bicolor]
 gb|EER97947.1| hypothetical protein SORBIDRAFT_02g002440 [Sorghum bicolor]
Length=480

 Score =   458 bits (1178),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/318 (72%), Positives = 268/318 (84%), Gaps = 1/318 (0%)
 Frame = -1

Query  954  FDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSA  775
             DDDG E+RTGTLVTASAHIITAVIGSGVLSL+WAIAQLGW  GP VL AFS IT+F S+
Sbjct  29   LDDDGRERRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPVVLLAFSAITWFCSS  88

Query  774  LLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMV  595
            LLADCYR+P PV G RNYTY   VR++LG  K +LC L+QY NLVG++IGYTIT +ISM 
Sbjct  89   LLADCYRAPDPVHGKRNYTYGQAVRAYLGVSKYRLCSLAQYINLVGVTIGYTITTAISMG  148

Query  594  AVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSS  415
            A+ +SNCFH  GH  DC   +   M+IFA IQ++LSQ+PNFH+L WLSIVAAVMS AYSS
Sbjct  149  AINRSNCFHSKGHSADCEASNTTNMIIFAGIQILLSQLPNFHKLWWLSIVAAVMSLAYSS  208

Query  414  IGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQ  235
            IG+GLSIAK+AG G    ++LTG  VGVDVT  +KIW+ FQ++G+IAFAY+YS VLIEIQ
Sbjct  209  IGLGLSIAKIAG-GVHVKTSLTGATVGVDVTATEKIWKTFQSLGDIAFAYSYSNVLIEIQ  267

Query  234  DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLI  55
            DTLRS PPEN+VMKKAS IGVSTTT+FY++CG +GYAAFGNDAPGNFLTGFGFY+PFWLI
Sbjct  268  DTLRSSPPENVVMKKASFIGVSTTTMFYMLCGVLGYAAFGNDAPGNFLTGFGFYDPFWLI  327

Query  54   DVANICIAIHLVGAYQVF  1
            DV N+CIA+HL+GAYQVF
Sbjct  328  DVGNVCIAVHLIGAYQVF  345



>ref|NP_001058839.1| Os07g0134000 [Oryza sativa Japonica Group]
 dbj|BAC82952.1| putative amino acid permease [Oryza sativa Japonica Group]
 dbj|BAD30612.1| putative amino acid permease [Oryza sativa Japonica Group]
 dbj|BAF20753.1| Os07g0134000 [Oryza sativa Japonica Group]
 dbj|BAG97575.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99938.1| unnamed protein product [Oryza sativa Japonica Group]
Length=487

 Score =   457 bits (1177),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 232/327 (71%), Positives = 271/327 (83%), Gaps = 1/327 (0%)
 Frame = -1

Query  981  EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAF  802
            E G     + DDDG EKRTGTLVTASAHIITAVIGSGVLSL+WAIAQLGW  GPAVL AF
Sbjct  22   ESGYADRPDLDDDGREKRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPAVLVAF  81

Query  801  SLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGY  622
            S+IT+F S+LLADCYRSP PV G RNYTY   VR++LG  K +LC ++QY NLVG++IGY
Sbjct  82   SVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVAKYRLCSVAQYVNLVGVTIGY  141

Query  621  TITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVA  442
            TIT +ISM A+K+SN FH+NGHD  C       M+IFA IQ++LSQ+PNFH++ WLSIVA
Sbjct  142  TITTAISMGAIKRSNWFHRNGHDAACLASDTTNMIIFAGIQILLSQLPNFHKIWWLSIVA  201

Query  441  AVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYA  262
            AVMS AYS+IG+GLSIAK+AG G    +TLTGV VGVDV+ ++KIWR FQ++G+IAFAY+
Sbjct  202  AVMSLAYSTIGLGLSIAKIAG-GAHPEATLTGVTVGVDVSASEKIWRTFQSLGDIAFAYS  260

Query  261  YSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGF  82
            YS VLIEIQDTLRS P EN VMKKAS IGVSTTT FY++CG +GYAAFGN APGNFLTGF
Sbjct  261  YSNVLIEIQDTLRSSPAENEVMKKASFIGVSTTTTFYMLCGVLGYAAFGNRAPGNFLTGF  320

Query  81   GFYEPFWLIDVANICIAIHLVGAYQVF  1
            GFYEPFWL+DV N+CI +HLVGAYQVF
Sbjct  321  GFYEPFWLVDVGNVCIVVHLVGAYQVF  347



>emb|CDY53793.1| BnaCnng25620D [Brassica napus]
Length=479

 Score =   457 bits (1176),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 227/320 (71%), Positives = 269/320 (84%), Gaps = 7/320 (2%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN DDDG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L  FS IT+FT
Sbjct  27   KNVDDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILIIFSFITYFT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P P+TG RNYTYMDVVRS+LGG KVQLCG++QY NL+GI++GYTITASIS
Sbjct  87   STMLADCYRAPDPLTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VA+ K+NC+H  GH  DC++ +YP+M  F  IQ++LSQIPNFH+LS+LS++AAVMSFAY
Sbjct  147  LVAIGKANCYHNKGHHADCTISNYPYMAAFGIIQILLSQIPNFHKLSFLSLMAAVMSFAY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            +SIGIGL+IA VAG G+   + +TG VVGVDVT A KIWR FQA+G+IAFAYAY+T    
Sbjct  207  ASIGIGLAIATVAG-GKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYAT----  261

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
              DTLRS P EN  MK+AS +GVSTTT FY++CGC+GYAAFGN APG+FLT FGFYEPFW
Sbjct  262  --DTLRSSPAENKAMKRASFVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTDFGFYEPFW  319

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA HL+GAYQVF
Sbjct  320  LIDFANACIAFHLIGAYQVF  339



>emb|CDY48843.1| BnaA09g14700D [Brassica napus]
Length=479

 Score =   457 bits (1176),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 227/320 (71%), Positives = 269/320 (84%), Gaps = 7/320 (2%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            KN DDDG EKRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L  FS IT+FT
Sbjct  27   KNVDDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILIIFSFITYFT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S +LADCYR+P P+TG RNYTYMDVVRS+LGG KVQLCG++QY NL+GI++GYTITASIS
Sbjct  87   STMLADCYRAPDPLTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            +VA+ K+NC+H  GH  DC++ +YP+M  F  IQ++LSQIPNFH+LS+LS++AAVMSFAY
Sbjct  147  LVAIGKANCYHNKGHHADCTISNYPYMAAFGIIQILLSQIPNFHKLSFLSLMAAVMSFAY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            +SIGIGL+IA VAG G+   + +TG VVGVDVT A KIWR FQA+G+IAFAYAY+T    
Sbjct  207  ASIGIGLAIATVAG-GKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYAT----  261

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
              DTLRS P EN  MK+AS +GVSTTT FY++CGC+GYAAFGN APG+FLT FGFYEPFW
Sbjct  262  --DTLRSSPAENKAMKRASFVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTDFGFYEPFW  319

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN CIA HL+GAYQVF
Sbjct  320  LIDFANACIAFHLIGAYQVF  339



>gb|EEE66520.1| hypothetical protein OsJ_22995 [Oryza sativa Japonica Group]
Length=485

 Score =   457 bits (1176),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 232/327 (71%), Positives = 271/327 (83%), Gaps = 1/327 (0%)
 Frame = -1

Query  981  EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAF  802
            E G     + DDDG EKRTGTLVTASAHIITAVIGSGVLSL+WAIAQLGW  GPAVL AF
Sbjct  20   ESGYADRPDLDDDGREKRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPAVLVAF  79

Query  801  SLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGY  622
            S+IT+F S+LLADCYRSP PV G RNYTY   VR++LG  K +LC ++QY NLVG++IGY
Sbjct  80   SVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVAKYRLCSVAQYVNLVGVTIGY  139

Query  621  TITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVA  442
            TIT +ISM A+K+SN FH+NGHD  C       M+IFA IQ++LSQ+PNFH++ WLSIVA
Sbjct  140  TITTAISMGAIKRSNWFHRNGHDAACLASDTTNMIIFAGIQILLSQLPNFHKIWWLSIVA  199

Query  441  AVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYA  262
            AVMS AYS+IG+GLSIAK+AG G    +TLTGV VGVDV+ ++KIWR FQ++G+IAFAY+
Sbjct  200  AVMSLAYSTIGLGLSIAKIAG-GAHPEATLTGVTVGVDVSASEKIWRTFQSLGDIAFAYS  258

Query  261  YSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGF  82
            YS VLIEIQDTLRS P EN VMKKAS IGVSTTT FY++CG +GYAAFGN APGNFLTGF
Sbjct  259  YSNVLIEIQDTLRSSPAENEVMKKASFIGVSTTTTFYMLCGVLGYAAFGNRAPGNFLTGF  318

Query  81   GFYEPFWLIDVANICIAIHLVGAYQVF  1
            GFYEPFWL+DV N+CI +HLVGAYQVF
Sbjct  319  GFYEPFWLVDVGNVCIVVHLVGAYQVF  345



>ref|XP_010490563.1| PREDICTED: amino acid permease 8-like isoform X2 [Camelina sativa]
Length=460

 Score =   456 bits (1173),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 227/330 (69%), Positives = 271/330 (82%), Gaps = 3/330 (1%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G      FDDDG EKRTGTL+TASAHIITAV+GSGVLSLSWAIAQLGW AG  +L  
Sbjct  2    VESGDVSGDRFDDDGREKRTGTLLTASAHIITAVVGSGVLSLSWAIAQLGWLAGTVILVT  61

Query  804  FSLITFFTSALLADCYRSPG--PVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGIS  631
            F++I ++TS +LADCYRSP    V GTRNYTYM VVR++LGG KVQLCGL+QYA+LVGI+
Sbjct  62   FAIINYYTSTMLADCYRSPDADDVPGTRNYTYMGVVRAYLGGRKVQLCGLAQYASLVGIT  121

Query  630  IGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLS  451
            +GYTITASIS+VA+ K+NC+H  GH   CS  +YP M  F  +Q++LSQIPNFH+LS+LS
Sbjct  122  VGYTITASISLVAIGKANCYHNKGHGAKCSSSNYPSMAAFGVVQILLSQIPNFHQLSFLS  181

Query  450  IVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAF  271
            I+A VMSF Y+SIGIGLSIAKV  SG+   + LTG +VGVDVT +DK+WR FQA+G+IAF
Sbjct  182  IIATVMSFCYASIGIGLSIAKVT-SGKVGKTALTGTLVGVDVTASDKLWRSFQAVGDIAF  240

Query  270  AYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFL  91
            +Y+YS VL+EIQDTL+S PPEN VMKKAS  GVSTTT FY++CGC+GYAAFGN APG+ L
Sbjct  241  SYSYSIVLVEIQDTLKSSPPENKVMKKASLAGVSTTTAFYILCGCMGYAAFGNKAPGDLL  300

Query  90   TGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            T FGFYEP+WL+D AN CI +HLV AYQVF
Sbjct  301  TEFGFYEPYWLVDFANACIVLHLVAAYQVF  330



>ref|NP_001233983.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13688.1|AF013279_1 amino acid transporter [Solanum lycopersicum]
Length=465

 Score =   456 bits (1172),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 223/319 (70%), Positives = 267/319 (84%), Gaps = 3/319 (1%)
 Frame = -1

Query  957  NFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTS  778
             FDDDG  KRTGT++T SAHIITAVIGSGVLSL+WA AQLGW AGP  L AFS IT+F S
Sbjct  11   KFDDDGRPKRTGTVLTTSAHIITAVIGSGVLSLAWATAQLGWIAGPVALIAFSAITWFAS  70

Query  777  ALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISM  598
             LLADCYR+P    G+R+YTYMD VR+HLGG KVQLCGL+QY+NL G++IGY IT SISM
Sbjct  71   ILLADCYRAP---DGSRSYTYMDAVRAHLGGRKVQLCGLAQYSNLFGVTIGYAITTSISM  127

Query  597  VAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYS  418
            VA+K+SNCFH+ GHD  C   + PF++IF  +Q++LSQIPNFH+LS+LSI+AA MSFAYS
Sbjct  128  VAIKRSNCFHRKGHDAGCHESNNPFIIIFGVMQILLSQIPNFHKLSFLSIIAAAMSFAYS  187

Query  417  SIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEI  238
             IG+GLSIAK+A  G +AN++LTG +VG DV+  DK+W  F A+G+IAFAYA+S VLIEI
Sbjct  188  FIGLGLSIAKIAKDGVSANTSLTGTIVGKDVSSRDKMWNTFSALGDIAFAYAFSIVLIEI  247

Query  237  QDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWL  58
            QDTL+SHPPEN  MKKA+  G+S +T+FY++CG +GYAAFGN APGNFLTGFGFYEPFWL
Sbjct  248  QDTLKSHPPENKSMKKATFTGISVSTIFYLLCGLLGYAAFGNKAPGNFLTGFGFYEPFWL  307

Query  57   IDVANICIAIHLVGAYQVF  1
            ID AN+CI IHLVGAYQVF
Sbjct  308  IDFANVCIVIHLVGAYQVF  326



>ref|XP_010490547.1| PREDICTED: amino acid permease 8-like isoform X1 [Camelina sativa]
 ref|XP_010490556.1| PREDICTED: amino acid permease 8-like isoform X1 [Camelina sativa]
Length=467

 Score =   455 bits (1171),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 227/330 (69%), Positives = 271/330 (82%), Gaps = 3/330 (1%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G      FDDDG EKRTGTL+TASAHIITAV+GSGVLSLSWAIAQLGW AG  +L  
Sbjct  2    VESGDVSGDRFDDDGREKRTGTLLTASAHIITAVVGSGVLSLSWAIAQLGWLAGTVILVT  61

Query  804  FSLITFFTSALLADCYRSPGP--VTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGIS  631
            F++I ++TS +LADCYRSP    V GTRNYTYM VVR++LGG KVQLCGL+QYA+LVGI+
Sbjct  62   FAIINYYTSTMLADCYRSPDADDVPGTRNYTYMGVVRAYLGGRKVQLCGLAQYASLVGIT  121

Query  630  IGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLS  451
            +GYTITASIS+VA+ K+NC+H  GH   CS  +YP M  F  +Q++LSQIPNFH+LS+LS
Sbjct  122  VGYTITASISLVAIGKANCYHNKGHGAKCSSSNYPSMAAFGVVQILLSQIPNFHQLSFLS  181

Query  450  IVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAF  271
            I+A VMSF Y+SIGIGLSIAKV  SG+   + LTG +VGVDVT +DK+WR FQA+G+IAF
Sbjct  182  IIATVMSFCYASIGIGLSIAKVT-SGKVGKTALTGTLVGVDVTASDKLWRSFQAVGDIAF  240

Query  270  AYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFL  91
            +Y+YS VL+EIQDTL+S PPEN VMKKAS  GVSTTT FY++CGC+GYAAFGN APG+ L
Sbjct  241  SYSYSIVLVEIQDTLKSSPPENKVMKKASLAGVSTTTAFYILCGCMGYAAFGNKAPGDLL  300

Query  90   TGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            T FGFYEP+WL+D AN CI +HLV AYQVF
Sbjct  301  TEFGFYEPYWLVDFANACIVLHLVAAYQVF  330



>ref|XP_003557617.1| PREDICTED: amino acid permease 6 [Brachypodium distachyon]
Length=473

 Score =   456 bits (1172),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 231/327 (71%), Positives = 274/327 (84%), Gaps = 1/327 (0%)
 Frame = -1

Query  981  EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAF  802
            E G     + DDDG E+RTGTLVTASAHIITAVIGSGVLSL+WAIAQLGW  GPAVL AF
Sbjct  15   EAGLVGRADVDDDGRERRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPAVLLAF  74

Query  801  SLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGY  622
            S+IT+F S+LLADCYRSP PV G RNYTY   VR++LG  K +LC L+QY NLVG++IGY
Sbjct  75   SVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVGKYRLCSLAQYINLVGVTIGY  134

Query  621  TITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVA  442
            TIT +ISM A+ +SNCFH+NGHD +C   +   M+IFAAIQ++LSQ+PNFH++ WLSIVA
Sbjct  135  TITTAISMGAIGRSNCFHRNGHDANCEASNTTNMIIFAAIQVMLSQLPNFHKIWWLSIVA  194

Query  441  AVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYA  262
            AVMS AYSSIG+GLSIA++ G G  A +TLTGV VGVDV+ ++KIWR FQ++G+IAFAY+
Sbjct  195  AVMSLAYSSIGLGLSIARIVG-GAHAKTTLTGVTVGVDVSSSEKIWRTFQSLGDIAFAYS  253

Query  261  YSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGF  82
            YS VLIEIQDTLRS+P EN VMKKAS IGVSTTT FY++CG +GYAAFG+ APGNFLTGF
Sbjct  254  YSNVLIEIQDTLRSNPAENKVMKKASLIGVSTTTTFYMLCGVLGYAAFGSGAPGNFLTGF  313

Query  81   GFYEPFWLIDVANICIAIHLVGAYQVF  1
            GFYEPFWL+D+ N CI +HLVGAYQVF
Sbjct  314  GFYEPFWLVDIGNACIVVHLVGAYQVF  340



>gb|KFK43301.1| hypothetical protein AALP_AA1G106500 [Arabis alpina]
Length=472

 Score =   456 bits (1172),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 221/318 (69%), Positives = 270/318 (85%), Gaps = 1/318 (0%)
 Frame = -1

Query  954  FDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSA  775
             DDDG EKRTGT  TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L  F++IT++TS 
Sbjct  17   LDDDGREKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGTVILVTFAVITYYTST  76

Query  774  LLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMV  595
            LLADCYRSP   TGTRNYTYM VVR++LGG +VQLCGL+QY NLVG++IGYTITASIS+V
Sbjct  77   LLADCYRSPNSDTGTRNYTYMGVVRAYLGGTQVQLCGLAQYVNLVGVTIGYTITASISLV  136

Query  594  AVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSS  415
            A+ ++NC+H  GH   CS   Y +M  F  +Q++LSQIP+FH+LS+LS++AA+MSF+Y+S
Sbjct  137  AIGRANCYHDKGHSAKCSASPYQYMGAFGIVQIILSQIPSFHKLSFLSLIAALMSFSYAS  196

Query  414  IGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQ  235
            IGIGL+IA VA SG+   + LTG V+GVDV+ +DK+WR FQAIG+IAF+YA++T+LIEIQ
Sbjct  197  IGIGLAIASVA-SGKIGKTELTGTVIGVDVSASDKVWRSFQAIGDIAFSYAFTTILIEIQ  255

Query  234  DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLI  55
            DTLRS PPEN VMKKAS  GVSTTTVFY++CGCIGYA FGN APG+FLT FGFYEP+WL+
Sbjct  256  DTLRSSPPENKVMKKASLAGVSTTTVFYILCGCIGYATFGNSAPGDFLTDFGFYEPYWLV  315

Query  54   DVANICIAIHLVGAYQVF  1
            D AN CIA+HL+GAYQV+
Sbjct  316  DFANACIALHLIGAYQVY  333



>ref|XP_010475859.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
Length=469

 Score =   455 bits (1171),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 274/330 (83%), Gaps = 3/330 (1%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G      FDDDG EKRTGT++TASAHII AVIGSGVLSLSWAIAQLGW AG  +L  
Sbjct  2    VESGNASGNRFDDDGREKRTGTVLTASAHIIAAVIGSGVLSLSWAIAQLGWLAGTVILVP  61

Query  804  FSLITFFTSALLADCYRSPGPV--TGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGIS  631
            F++I ++TS +LADCYRSP  V   GTRNYTYM VVR++LGG KVQLCGL+QYA+LVG++
Sbjct  62   FAIINYYTSTMLADCYRSPDSVGVPGTRNYTYMGVVRAYLGGRKVQLCGLAQYASLVGVT  121

Query  630  IGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLS  451
            IGYTITASIS+VA+ K+NC+H+ G+D  CS+ +YP M  F  +Q++LSQIPNFH+LS+LS
Sbjct  122  IGYTITASISLVAIGKANCYHRKGNDATCSLSNYPSMAAFGVVQILLSQIPNFHQLSFLS  181

Query  450  IVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAF  271
            I+A VMSF+Y+SIGIGLSIAKV  SG+   + LTG VVGVDVT +DK+WR FQA+G+IAF
Sbjct  182  IIATVMSFSYASIGIGLSIAKVI-SGKVGKTALTGTVVGVDVTASDKLWRSFQAVGDIAF  240

Query  270  AYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFL  91
            +Y+YS +L+EIQDTL+S PPEN VMKKAS  GVSTTT FY++CGC+GYAAFGN APG+ L
Sbjct  241  SYSYSIILVEIQDTLKSSPPENKVMKKASLAGVSTTTAFYILCGCMGYAAFGNRAPGDLL  300

Query  90   TGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            T FGFYEP+WL+D AN CI +HLV AYQVF
Sbjct  301  TDFGFYEPYWLVDFANACIVLHLVAAYQVF  330



>ref|XP_006487060.1| PREDICTED: amino acid permease 6-like [Citrus sinensis]
Length=475

 Score =   452 bits (1163),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 266/319 (83%), Gaps = 2/319 (1%)
 Frame = -1

Query  957  NFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTS  778
             FDDDG  KRTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW AGP  L  FS IT FTS
Sbjct  20   KFDDDGRPKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWIAGPMALMIFSFITGFTS  79

Query  777  ALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISM  598
            +LLADCYR     TG RNYTYM+VV+S+LG +K +LCGL+QY NLVG +IGYTITAS+SM
Sbjct  80   SLLADCYRCS--TTGRRNYTYMEVVKSNLGEMKCKLCGLAQYVNLVGTTIGYTITASLSM  137

Query  597  VAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYS  418
            VA+K+SNCFHK GHD  C   +  +M+IFA  +++LSQIPNFHELS LSI+AAVMSFAYS
Sbjct  138  VAIKRSNCFHKEGHDAGCHTSNNMYMIIFAIAEIILSQIPNFHELSGLSILAAVMSFAYS  197

Query  417  SIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEI  238
            SIG+GL+IAK+   G    ++LTGV +GVDVT  +KIW   QAIGNIAFAYAYS VL+EI
Sbjct  198  SIGLGLAIAKITERGNHVTTSLTGVAIGVDVTSTEKIWSSLQAIGNIAFAYAYSIVLVEI  257

Query  237  QDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWL  58
            QDTLRS PPEN VMK+AS +GVS TT+FY++CG +GYAAFG+ APGNFLTGFGFYEPFWL
Sbjct  258  QDTLRSSPPENKVMKRASFVGVSITTIFYMLCGTLGYAAFGDKAPGNFLTGFGFYEPFWL  317

Query  57   IDVANICIAIHLVGAYQVF  1
            +D AN+CI +HLVGAYQVF
Sbjct  318  VDFANMCIVVHLVGAYQVF  336



>gb|EYU39084.1| hypothetical protein MIMGU_mgv1a018317mg [Erythranthe guttata]
Length=466

 Score =   451 bits (1161),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 223/335 (67%), Positives = 276/335 (82%), Gaps = 3/335 (1%)
 Frame = -1

Query  1005  VSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAA  826
             + Q  + ++ G E    FDDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW A
Sbjct  1     MGQISLSIDSGNESSSKFDDDGRVKRTGTALTASAHIITAVIGSGVLSLAWAIAQLGWIA  60

Query  825   GPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYAN  646
             GP  L AFS IT+FTS LLADCYRS     G+RNYTY DVVRSHLGG+KVQLCG++Q +N
Sbjct  61    GPIALMAFSFITWFTSILLADCYRSN---DGSRNYTYKDVVRSHLGGLKVQLCGIAQSSN  117

Query  645   LVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHE  466
             LVG SIGY+ITASISMVA+ +SNCFHK+GH+  C + + P+++ F A+Q+++SQIPNFH+
Sbjct  118   LVGSSIGYSITASISMVAMIRSNCFHKHGHEAGCHMSNNPYIIGFGAMQIIISQIPNFHK  177

Query  465   LSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAI  286
             LSWLS VAA MSFAYSSIG+GL+IAK+AG+G    S+LTG+ +G +++  DK+W  + A+
Sbjct  178   LSWLSFVAAAMSFAYSSIGLGLAIAKIAGTGGKIESSLTGIPIGPNMSSMDKMWNTYNAL  237

Query  285   GNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDA  106
             GNIAFAY +S+VL+EIQDT++S  PEN VMKKA+  G+S +TVFY++CG +GYAAFGNDA
Sbjct  238   GNIAFAYVFSSVLVEIQDTIKSGVPENKVMKKATLAGISISTVFYMLCGVLGYAAFGNDA  297

Query  105   PGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             PGNFLTGFGFYEPFWL+  AN+CI IHLVGAYQVF
Sbjct  298   PGNFLTGFGFYEPFWLVSFANLCIVIHLVGAYQVF  332



>emb|CDY53831.1| BnaA09g57230D [Brassica napus]
Length=481

 Score =   451 bits (1160),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 234/344 (68%), Positives = 274/344 (80%), Gaps = 14/344 (4%)
 Frame = -1

Query  1008  AVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWA  829
             A   NP  VE       NFDDDG EKRTGTL+TA+AHIITAVIGSGVLSL+WAIAQLGW 
Sbjct  5     ATEYNPSAVETAGN---NFDDDGREKRTGTLMTATAHIITAVIGSGVLSLAWAIAQLGWV  61

Query  828   AGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYA  649
             AG  +L  F++I +FTS +LADCYRSP   TG RNY YMDVVR++LGG KV+LCGL+QY 
Sbjct  62    AGTVILVTFAVINYFTSTMLADCYRSPD--TGIRNYNYMDVVRAYLGGWKVKLCGLAQYG  119

Query  648   NLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFH  469
             +LVGI+IGYTITASIS+VA+ K+NCFH  GHD  CSV +YP M  F   Q+VLSQI NFH
Sbjct  120   SLVGITIGYTITASISLVAIGKANCFHDKGHDAKCSVSNYPLMAAFGITQIVLSQIHNFH  179

Query  468   ELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQA  289
             +LS+LSI+A VMSF+Y+SIGIGL++A +A SG+   + LTG VVGVDVT +DKIWR FQA
Sbjct  180   KLSFLSIIATVMSFSYASIGIGLALAALA-SGKVGKTDLTGTVVGVDVTASDKIWRSFQA  238

Query  288   IGNIAFAYAYSTVLIEIQ--------DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCI  133
              G+IAF+YA+S VL+EIQ        DTLRS PPEN VMKKAS  GVSTTT FY++CGCI
Sbjct  239   AGDIAFSYAFSVVLVEIQACILSIRDDTLRSSPPENKVMKKASLAGVSTTTGFYILCGCI  298

Query  132   GYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GYAAFGN APG+FLT FGFYEP+WLID AN CIA+HL+ AYQVF
Sbjct  299   GYAAFGNQAPGDFLTDFGFYEPYWLIDFANACIAVHLIAAYQVF  342



>gb|KEH43993.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=470

 Score =   451 bits (1159),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 219/337 (65%), Positives = 270/337 (80%), Gaps = 5/337 (1%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M ++Q+   +E+G+     +DDDG  KRTGT  T+SAHI+TAVIGSGVLSL+WA+AQLGW
Sbjct  1     MTITQSSFSIEDGK-----YDDDGRMKRTGTWFTSSAHIVTAVIGSGVLSLAWAVAQLGW  55

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
               G  VL  FSL+T FTS L+ADCYR P P+ GTRN TYM +V++ LGG++ + CGL+QY
Sbjct  56    IGGTIVLILFSLVTLFTSILMADCYRYPDPIHGTRNPTYMKMVQNILGGIQYKFCGLAQY  115

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NLVG +IGYTIT SISMVA+KKSNCFHK GH  DC + +Y FM IF  ++++LS IP+F
Sbjct  116   TNLVGCTIGYTITGSISMVAIKKSNCFHKEGHLADCKISNYKFMAIFGIVEILLSLIPDF  175

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
             HELSWLSI+AAVMSF Y+SIGIGLSIAKVA  G    +++TG+ VGVDVT  +K+W  FQ
Sbjct  176   HELSWLSILAAVMSFGYASIGIGLSIAKVAEKGHHVTTSVTGIAVGVDVTSTEKMWNTFQ  235

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             AIGNIAFAYA+S V++EIQDTL+S PPEN VMKK++  G++ TT FY +CG +GYAAFGN
Sbjct  236   AIGNIAFAYAFSNVIVEIQDTLKSSPPENQVMKKSNLTGITITTFFYALCGLVGYAAFGN  295

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
              APGNFLTGFGFYEPFWL+D+ N+ I IHLVGAYQVF
Sbjct  296   KAPGNFLTGFGFYEPFWLVDIGNLFIVIHLVGAYQVF  332



>ref|XP_009148319.1| PREDICTED: amino acid permease 8-like [Brassica rapa]
Length=466

 Score =   450 bits (1157),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 223/328 (68%), Positives = 272/328 (83%), Gaps = 5/328 (2%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G     NFDDDG EKRTGTL+TASAHIITAV+GSGVLSL+WAIAQLGW AG  +L  
Sbjct  7    VESGDATGNNFDDDGREKRTGTLMTASAHIITAVVGSGVLSLAWAIAQLGWVAGIVILVT  66

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F++I ++TS +LADCYRS    TGTRN TYMDVVR++LGG KVQLCGL+QY   +G++IG
Sbjct  67   FAVINYYTSTMLADCYRSD---TGTRNCTYMDVVRAYLGGRKVQLCGLAQYGCFIGVTIG  123

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS+VA+ K+NCFH  GH   CS+P+YPFM +F  ++++LSQIP+FH+LS+LSI+
Sbjct  124  YTITASISLVAIGKANCFHDKGHGEKCSMPNYPFMAVFGIVEIILSQIPSFHKLSFLSII  183

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            A VMSF+Y+SIGIGL++A VA SG+   +  TG VVGV+VT +DKIW+ FQA G+IAF+Y
Sbjct  184  ATVMSFSYASIGIGLAMAVVA-SGKVGKTGATGTVVGVEVTASDKIWKSFQATGDIAFSY  242

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
            AYS++L+EIQDTLRS PPEN VMKKAS  GVSTTT FY++CGCIGYAAFGN APG+FLT 
Sbjct  243  AYSSILVEIQDTLRSSPPENKVMKKASLAGVSTTTFFYMLCGCIGYAAFGNKAPGDFLTD  302

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQVF  1
            F FYEP+WLID AN CI +HL+ AYQVF
Sbjct  303  F-FYEPYWLIDFANACIVLHLIAAYQVF  329



>ref|XP_011002369.1| PREDICTED: amino acid permease 6-like [Populus euphratica]
Length=473

 Score =   450 bits (1157),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 225/323 (70%), Positives = 268/323 (83%), Gaps = 2/323 (1%)
 Frame = -1

Query  969  EILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLIT  790
            +I+K  DDDG  KR G L++ASAHIITAVIGSGVLSL+WA+AQLGW AGP  L  FSLIT
Sbjct  14   DIVKT-DDDGRLKRDGNLMSASAHIITAVIGSGVLSLAWAMAQLGWIAGPISLLIFSLIT  72

Query  789  FFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITA  610
            +F S LLADCYR PGP+ GTR YTYM  V++HLGG+K  LCG+SQY NLVG SIGYTITA
Sbjct  73   WFNSCLLADCYRFPGPLEGTRTYTYMGAVKAHLGGIKYTLCGISQYTNLVGTSIGYTITA  132

Query  609  SISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMS  430
            SISM A+K+SNCFH+ GHD +C   +  FM+IF  +Q+++SQIPNFHEL  LS +AA+MS
Sbjct  133  SISMAAIKRSNCFHREGHDAECHASTNMFMIIFGIVQVMMSQIPNFHELVGLSTLAAIMS  192

Query  429  FAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTV  250
            FAYS +GIGLSIA +AG G+   ++LTG VVGVDVT  +K W CFQAIGNIAFAY YS++
Sbjct  193  FAYSLVGIGLSIAAIAG-GKDVKTSLTGTVVGVDVTSTEKAWNCFQAIGNIAFAYTYSSI  251

Query  249  LIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYE  70
            L+EIQDTL+S  PEN VMKKAS +GV+TTTVFY++CG +GYAAFGN APGNFLTGFGFYE
Sbjct  252  LVEIQDTLKSSSPENQVMKKASLVGVATTTVFYMLCGTLGYAAFGNVAPGNFLTGFGFYE  311

Query  69   PFWLIDVANICIAIHLVGAYQVF  1
            P+WL+D AN+CI IHLVGAYQV+
Sbjct  312  PYWLVDFANLCIVIHLVGAYQVY  334



>ref|XP_010475860.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
Length=469

 Score =   450 bits (1157),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 227/330 (69%), Positives = 270/330 (82%), Gaps = 3/330 (1%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G      FDDDG EKRTGTLVTASAHIITAV+GSGVLSLSWAIAQLGW AG  +L  
Sbjct  2    VESGDVSGDRFDDDGREKRTGTLVTASAHIITAVVGSGVLSLSWAIAQLGWLAGTVILVT  61

Query  804  FSLITFFTSALLADCYRSPG--PVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGIS  631
            F++I ++TS +LADCYRSP    V GTRNYTYM VVR++LGG KVQL GL+QYA+LVGI+
Sbjct  62   FAIINYYTSTMLADCYRSPDADDVPGTRNYTYMGVVRAYLGGRKVQLYGLAQYASLVGIT  121

Query  630  IGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLS  451
            +GYTITASIS+VA+ K+NC+H  GH   CS  +YP M  F  +Q++LSQIPNFH+LS+LS
Sbjct  122  VGYTITASISLVAIGKANCYHNKGHGAKCSSSNYPSMAAFGVVQILLSQIPNFHQLSFLS  181

Query  450  IVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAF  271
            I+A VMSF Y+SIGIGLSIAKV  SG+   + LTG VVGVDVT +DK+WR FQA+G+IAF
Sbjct  182  IIATVMSFCYASIGIGLSIAKVI-SGKVGKTALTGTVVGVDVTASDKLWRSFQAVGDIAF  240

Query  270  AYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFL  91
            +Y+YS VL+EIQDTL+S PPEN VMKKAS  GVSTTT FY++CGC+GYAAFGN APG+ L
Sbjct  241  SYSYSIVLVEIQDTLKSSPPENKVMKKASLAGVSTTTAFYILCGCMGYAAFGNKAPGDLL  300

Query  90   TGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            T FGFY+P+WL+D AN CI +HLV AYQVF
Sbjct  301  TEFGFYDPYWLVDFANACIVLHLVAAYQVF  330



>ref|XP_009792204.1| PREDICTED: amino acid permease 6-like [Nicotiana sylvestris]
Length=472

 Score =   449 bits (1156),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 225/325 (69%), Positives = 273/325 (84%), Gaps = 3/325 (1%)
 Frame = -1

Query  975  GREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSL  796
            G +    FDDDG  KRTGT++T SAHIITAVIGSGVLSL+WA AQLGW AGP  L AFS+
Sbjct  12   GFDDTSKFDDDGRPKRTGTVLTTSAHIITAVIGSGVLSLAWATAQLGWIAGPVALVAFSV  71

Query  795  ITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTI  616
            IT+FTS LLADCYR+P    G+RNYTYMD VRSHLGG+KVQLCG++QY+NLVGI+IGY I
Sbjct  72   ITWFTSLLLADCYRAP---DGSRNYTYMDAVRSHLGGMKVQLCGIAQYSNLVGITIGYAI  128

Query  615  TASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAV  436
            T SISMVA+K+SNCFHK+GH   C   + PF++IF   Q++LSQIPNFH+LS+LS++AAV
Sbjct  129  TTSISMVAIKRSNCFHKHGHAAGCHESNNPFIIIFGIFQIILSQIPNFHKLSFLSLIAAV  188

Query  435  MSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYS  256
            MSFAYS IG+GLSIAK+A  G + N++LTG  +G +++G DK+W  F A+G+IAFAYA+S
Sbjct  189  MSFAYSFIGLGLSIAKIANDGVSGNTSLTGTRIGKELSGTDKMWNTFSALGDIAFAYAFS  248

Query  255  TVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGF  76
            TVLIEIQDTL+SHP EN  MK+AS IG+S +T+FY++CG IGYAAFGN APGNFLTGFGF
Sbjct  249  TVLIEIQDTLKSHPRENQYMKRASCIGISVSTIFYMLCGLIGYAAFGNKAPGNFLTGFGF  308

Query  75   YEPFWLIDVANICIAIHLVGAYQVF  1
            YEPFWL+D AN+CI +HLVGAYQVF
Sbjct  309  YEPFWLVDFANVCIVVHLVGAYQVF  333



>ref|XP_010243490.1| PREDICTED: amino acid permease 6-like [Nelumbo nucifera]
Length=462

 Score =   449 bits (1154),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 228/320 (71%), Positives = 271/320 (85%), Gaps = 0/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            ++ DDDG  KRTGTL+TAS HIITAVIGSGVLSL+W +AQLGW AGP  L AFS+IT+FT
Sbjct  6    ESLDDDGRVKRTGTLMTASVHIITAVIGSGVLSLAWVMAQLGWVAGPVSLVAFSVITWFT  65

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYRS  PV G RNYTY+D VR++LGG KV++CGL+Q  NL+G +IGYTITA IS
Sbjct  66   SILLADCYRSDDPVPGKRNYTYVDAVRTNLGGYKVRICGLAQIGNLIGATIGYTITAGIS  125

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M AV +SNCFHKNGH   C   +YPF++IF  IQ+VLSQIPNFH+LSWLS++AAVMSF+Y
Sbjct  126  MAAVIRSNCFHKNGHHAKCQASNYPFIIIFGGIQIVLSQIPNFHKLSWLSMIAAVMSFSY  185

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            + IGIGLSIA+VAG    A + LTGVVVG+DVT ++K+W+ FQAIGN+AFAY +S +LIE
Sbjct  186  TLIGIGLSIAQVAGGNNGARTGLTGVVVGLDVTVSEKVWKTFQAIGNVAFAYTFSPILIE  245

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S PPEN VMKKA++IGVST    Y++CG +GYAAFGNDAPGNFLTGFGFYEPFW
Sbjct  246  IQDTLKSSPPENKVMKKATSIGVSTIAFLYIVCGGVGYAAFGNDAPGNFLTGFGFYEPFW  305

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN+CIA+HLVGAYQVF
Sbjct  306  LIDFANLCIAVHLVGAYQVF  325



>ref|XP_002313926.2| hypothetical protein POPTR_0009s08840g [Populus trichocarpa]
 gb|EEE87881.2| hypothetical protein POPTR_0009s08840g [Populus trichocarpa]
Length=473

 Score =   449 bits (1155),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 225/323 (70%), Positives = 267/323 (83%), Gaps = 2/323 (1%)
 Frame = -1

Query  969  EILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLIT  790
            +I+K  DDDG  KR G L++ASAHIITAVIGSGVLSL+WA+AQLGW AGP  L  FS IT
Sbjct  14   DIVKT-DDDGRLKRDGNLMSASAHIITAVIGSGVLSLAWAMAQLGWIAGPISLLIFSFIT  72

Query  789  FFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITA  610
            +F S LLADCYR PGP+ GTR YTYM  V++HLGG+K  LCG+SQY NLVG SIGYTITA
Sbjct  73   WFNSCLLADCYRFPGPLGGTRTYTYMGAVKAHLGGIKYTLCGISQYTNLVGTSIGYTITA  132

Query  609  SISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMS  430
            SISM A+K+SNCFH+ GHD +C   +  FM+IF  +Q+++SQ+PNFHEL  LS +AA+MS
Sbjct  133  SISMAAIKRSNCFHREGHDAECHASTNMFMIIFGIVQVMMSQLPNFHELVGLSTLAAIMS  192

Query  429  FAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTV  250
            FAYS IGIGLSIA +AG G    ++LTG VVGVDVT  +K W CFQAIGNIAFAY YS++
Sbjct  193  FAYSLIGIGLSIAAIAG-GNDVKTSLTGTVVGVDVTSTEKAWNCFQAIGNIAFAYTYSSI  251

Query  249  LIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYE  70
            L+EIQDTL+S PPEN VMKKAS +GV+TTTVFY++CG +GYAAFGN APGNFLTGFGFYE
Sbjct  252  LVEIQDTLKSSPPENQVMKKASLVGVATTTVFYMLCGTLGYAAFGNVAPGNFLTGFGFYE  311

Query  69   PFWLIDVANICIAIHLVGAYQVF  1
            P+WL+D AN+CI IHLVGAYQV+
Sbjct  312  PYWLVDFANLCIVIHLVGAYQVY  334



>emb|CDY22609.1| BnaC08g42430D [Brassica napus]
Length=481

 Score =   449 bits (1154),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 233/340 (69%), Positives = 274/340 (81%), Gaps = 14/340 (4%)
 Frame = -1

Query  996  NPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPA  817
            NP  VE       NFDDDG EKRTGT++TASAHIITAVIGSGVLSL+WAIAQLGW AG  
Sbjct  9    NPSAVEAAGN---NFDDDGREKRTGTVMTASAHIITAVIGSGVLSLAWAIAQLGWVAGTV  65

Query  816  VLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVG  637
            +L  F++I +FTS +LADCYRSP   TG RNY YMDVVR++LGG KV+LCGL+QY +LVG
Sbjct  66   ILVTFAVINYFTSTMLADCYRSPD--TGIRNYNYMDVVRAYLGGWKVKLCGLAQYGSLVG  123

Query  636  ISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSW  457
            I+IGYTITASIS+VA+ K+NCFH+ GH   CSV +YP M  F  IQ+VLSQI NFH+LS+
Sbjct  124  ITIGYTITASISLVAIGKANCFHEKGHGAKCSVSNYPLMAAFGIIQIVLSQIHNFHKLSF  183

Query  456  LSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNI  277
            LSI+A VMSF+Y+SIGIGL++A +A SG+   + LTG VVGVDVT +DKIWR FQA G+I
Sbjct  184  LSIIATVMSFSYASIGIGLALAALA-SGKVGKTDLTGTVVGVDVTASDKIWRSFQAAGDI  242

Query  276  AFAYAYSTVLIEIQ--------DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAA  121
            AF+YA+S VL+EIQ        DTLRS PPEN VMKKAS  GVSTTT FY++CGCIGYAA
Sbjct  243  AFSYAFSVVLVEIQACILSIRDDTLRSSPPENKVMKKASLAGVSTTTGFYILCGCIGYAA  302

Query  120  FGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            FGN APG+FLT FGFYEP+WLID AN CIA+HL+ AYQVF
Sbjct  303  FGNQAPGDFLTDFGFYEPYWLIDFANACIAVHLIAAYQVF  342



>ref|XP_009627462.1| PREDICTED: amino acid permease 6-like [Nicotiana tomentosiformis]
Length=472

 Score =   447 bits (1151),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 223/325 (69%), Positives = 271/325 (83%), Gaps = 3/325 (1%)
 Frame = -1

Query  975  GREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSL  796
            G +    FDDDG  KRTGT++T SAHIITAVIGSGVLSL+WA AQLGW AGP  L AFS+
Sbjct  12   GFDDTSKFDDDGRPKRTGTVLTTSAHIITAVIGSGVLSLAWATAQLGWIAGPVALVAFSV  71

Query  795  ITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTI  616
            IT+FTS LLADCYR+P    G+RNYTYMD VRSHLGG+KVQLCG++QY+NLVGI+IGY I
Sbjct  72   ITWFTSLLLADCYRAP---DGSRNYTYMDAVRSHLGGMKVQLCGIAQYSNLVGITIGYAI  128

Query  615  TASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAV  436
            T SISMVA+K+SNCFHK+GH   C   + PF++IF   Q++LSQIPNFH+LS+LS++AAV
Sbjct  129  TTSISMVAIKRSNCFHKHGHAAGCHESNNPFIIIFGIFQIILSQIPNFHKLSFLSLIAAV  188

Query  435  MSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYS  256
            MSFAYS IG+GLSIAK+A  G   +++LTG  +  +++G DK+W  F A+G+IAFAYA+S
Sbjct  189  MSFAYSFIGLGLSIAKIANDGVNGDTSLTGTRIEKELSGTDKMWNTFSALGDIAFAYAFS  248

Query  255  TVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGF  76
            TVLIEIQDTL+SHP EN  MK+AS IG+S +T+FY++CG IGYAAFGN APGNFLTGFGF
Sbjct  249  TVLIEIQDTLKSHPRENQYMKRASCIGISVSTIFYMLCGLIGYAAFGNKAPGNFLTGFGF  308

Query  75   YEPFWLIDVANICIAIHLVGAYQVF  1
            YEPFWL+D AN+CI +HLVGAYQVF
Sbjct  309  YEPFWLVDFANVCIVVHLVGAYQVF  333



>emb|CDY62727.1| BnaC05g49200D [Brassica napus]
Length=469

 Score =   447 bits (1150),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 227/333 (68%), Positives = 274/333 (82%), Gaps = 7/333 (2%)
 Frame = -1

Query  999  QNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGP  820
             NP  VE       N DDDG EKRTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW AG 
Sbjct  8    HNPSAVESADA---NVDDDGREKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWVAGT  64

Query  819  AVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLV  640
             +L  F+++ ++TS +LADCYRS     G RNYTYMDVVRS+LGG KVQLCGL+QY  LV
Sbjct  65   LILVTFAIVNYYTSTMLADCYRSDA---GARNYTYMDVVRSYLGGRKVQLCGLAQYGCLV  121

Query  639  GISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELS  460
            GI+IGYTITASIS+VA+ K+ CFHK GH   CS+P+YPFM  F  +++ LSQ+PNFH+LS
Sbjct  122  GITIGYTITASISLVAIWKATCFHKKGHGAKCSIPNYPFMAAFGVVEIFLSQLPNFHKLS  181

Query  459  WLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGN  280
            +LSI+AAVMSF+Y+SIGIGL+IA VA SG+   + +TG VVGVDVT +DKIW+ FQA G+
Sbjct  182  FLSIIAAVMSFSYASIGIGLAIAVVA-SGKVGKTGVTGTVVGVDVTASDKIWKAFQATGD  240

Query  279  IAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPG  100
            IAF+Y++ST+L+EIQDTLRS PPEN VMKKA+  GVSTTTVFY++CGC+GYAAFGN APG
Sbjct  241  IAFSYSFSTILVEIQDTLRSSPPENKVMKKATLAGVSTTTVFYILCGCMGYAAFGNRAPG  300

Query  99   NFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            +FLT FGFYEP+WLI+ AN CI +HL+ AYQVF
Sbjct  301  DFLTDFGFYEPYWLINFANACIVLHLIAAYQVF  333



>gb|EMS56484.1| hypothetical protein TRIUR3_26560 [Triticum urartu]
Length=737

 Score =   455 bits (1171),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 231/327 (71%), Positives = 273/327 (83%), Gaps = 1/327 (0%)
 Frame = -1

Query  981  EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAF  802
            E G     + DDDG E+RTGTLVTASAHIITAVIGSGVLSL+WAIAQLGW  GPAVL AF
Sbjct  271  EAGFGDRTDIDDDGRERRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPAVLVAF  330

Query  801  SLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGY  622
            S+IT+F S+LLADCYRSP PV G RNYTY   VR++LG  K +LC L+QY NLVG++IGY
Sbjct  331  SVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVSKYRLCSLAQYVNLVGVTIGY  390

Query  621  TITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVA  442
            TIT +ISM A+ +SNCFH+NGH+  C   +   M+IFAAIQ++LSQ+PNFH++ WLSIVA
Sbjct  391  TITTAISMGAIGRSNCFHRNGHNAACEASNTTNMIIFAAIQILLSQLPNFHKIWWLSIVA  450

Query  441  AVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYA  262
            AVMS AYSSIG+GLSIAK+AG G  A + LTGV VGVDV+ ++KIWR FQ++G+IAFAY+
Sbjct  451  AVMSLAYSSIGLGLSIAKIAG-GVHAKTALTGVTVGVDVSASEKIWRTFQSLGDIAFAYS  509

Query  261  YSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGF  82
            YS VLIEIQDTLRS P EN VMKKAS IGVSTTT FY++CG +GYAAFG+ APGNFLTGF
Sbjct  510  YSNVLIEIQDTLRSSPAENKVMKKASLIGVSTTTTFYMLCGVLGYAAFGSSAPGNFLTGF  569

Query  81   GFYEPFWLIDVANICIAIHLVGAYQVF  1
            GFYEPFWL+D+ N+CI +HLVGAYQVF
Sbjct  570  GFYEPFWLVDIGNVCIIVHLVGAYQVF  596



>emb|CAA72006.1| amino acid carrier [Ricinus communis]
Length=284

 Score =   439 bits (1128),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 216/284 (76%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = -1

Query  852  AIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQ  673
            AIAQLGW AGP +L AFS ITFFTS LLAD YRSP PVTG RNYTYMD VR++LGG KV 
Sbjct  1    AIAQLGWVAGPVILMAFSFITFFTSTLLADSYRSPDPVTGKRNYTYMDAVRANLGGWKVT  60

Query  672  LCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLV  493
             CG+SQYANLVGI++GYTITASISMVAVK+SNCFH++GH   C   + P+M+IFA IQ++
Sbjct  61   FCGISQYANLVGITVGYTITASISMVAVKRSNCFHRHGHAAKCHTSNNPYMIIFACIQII  120

Query  492  LSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGAD  313
            LSQIPNFH+LSWLS++AAVMSFAYSSIG+GLSIAKVAG G    +++TG  VGVDVT A 
Sbjct  121  LSQIPNFHKLSWLSVLAAVMSFAYSSIGLGLSIAKVAG-GEHVRTSITGTTVGVDVTAAQ  179

Query  312  KIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCI  133
            KIWR FQ+IG+IAFAYAYSTVLIEIQDT++S PPEN  MKKAS +G+ TTT+FY++CGCI
Sbjct  180  KIWRAFQSIGDIAFAYAYSTVLIEIQDTIKSGPPENKAMKKASFVGIVTTTMFYILCGCI  239

Query  132  GYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            GYAAFGNDAPGNFLTGFGFYEPFWLID+AN+CIAIHL+GAYQVF
Sbjct  240  GYAAFGNDAPGNFLTGFGFYEPFWLIDIANVCIAIHLIGAYQVF  283



>ref|XP_009118276.1| PREDICTED: amino acid permease 8-like isoform X2 [Brassica rapa]
Length=472

 Score =   445 bits (1145),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 225/328 (69%), Positives = 265/328 (81%), Gaps = 4/328 (1%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G     N DDD  EKRTGTL+TASAHIIT VIGSGVLSL+WAIAQLGW  G  +L A
Sbjct  10   VESGAGAGNNVDDDCREKRTGTLITASAHIITTVIGSGVLSLAWAIAQLGWVVGTVILVA  69

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F++I  +TS +LAD YRSP    GTRNYTYMDVVR +LGG KVQLCGL+Q+ +LVG++IG
Sbjct  70   FAVIVNYTSRMLADSYRSP---EGTRNYTYMDVVRVYLGGRKVQLCGLAQFGSLVGVTIG  126

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS+VA+ K+NCFH  GH   CSV +YP M  F  +Q+ LSQIPNFH+LS+LSI+
Sbjct  127  YTITASISLVAIGKANCFHDKGHGAKCSVSNYPLMAAFGIVQIFLSQIPNFHKLSFLSII  186

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            A VMSF+Y+SIG GL++A +A SG+   + LTG VVGVDVT +DK+W+ FQA GNIAF+Y
Sbjct  187  ATVMSFSYASIGFGLALAALA-SGKVGKTGLTGTVVGVDVTASDKLWKSFQAAGNIAFSY  245

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
            AYS VL+EIQDTLRS PPEN VMKKAS   VSTTT FY++CGCIGYA FGN APG+FLT 
Sbjct  246  AYSVVLVEIQDTLRSSPPENKVMKKASLAAVSTTTAFYILCGCIGYATFGNQAPGDFLTD  305

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQVF  1
            FGFYEP+WLID AN CIA+HL+GAYQVF
Sbjct  306  FGFYEPYWLIDFANACIAVHLIGAYQVF  333



>tpg|DAA59488.1| TPA: hypothetical protein ZEAMMB73_156584 [Zea mays]
Length=483

 Score =   446 bits (1146),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 227/314 (72%), Positives = 264/314 (84%), Gaps = 2/314 (1%)
 Frame = -1

Query  939  HEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSALLADC  760
             E+RTGTLVTASAHIITAVIGSGVLSL+WAIAQLGW  GP VL AFS IT+F S+LLADC
Sbjct  34   RERRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPVVLLAFSAITWFCSSLLADC  93

Query  759  YRSP-GPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMVAVKK  583
            YR+P GP  G RNYTY   VRS+LG  K +LC L+QY NLVG++IGYTIT +ISM A+K+
Sbjct  94   YRAPPGPGQGKRNYTYGQAVRSYLGESKYRLCSLAQYVNLVGVTIGYTITTAISMGAIKR  153

Query  582  SNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSSIGIG  403
            SNCFH  GH  DC   +   M+IFA IQ++LSQ+PNFH+L WLSIVAAVMS AYSSIG+G
Sbjct  154  SNCFHSRGHGADCEASNTTNMIIFAGIQILLSQLPNFHKLWWLSIVAAVMSLAYSSIGLG  213

Query  402  LSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQDTLR  223
            LSIAK+AG G    ++LTG  VGVDVT A+K+W+ FQ++G+IAFAY YS VLIEIQDTLR
Sbjct  214  LSIAKIAG-GVHVKTSLTGAAVGVDVTAAEKVWKTFQSLGDIAFAYTYSNVLIEIQDTLR  272

Query  222  SHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDVAN  43
            S PPEN+VMKKAS IGVSTTT FY++CG +GYAAFG+DAPGNFLTGFGFY+PFWLIDV N
Sbjct  273  SSPPENVVMKKASFIGVSTTTAFYMLCGVLGYAAFGSDAPGNFLTGFGFYDPFWLIDVGN  332

Query  42   ICIAIHLVGAYQVF  1
            +CIA+HLVGAYQVF
Sbjct  333  VCIAVHLVGAYQVF  346



>ref|XP_009118275.1| PREDICTED: amino acid permease 8-like isoform X1 [Brassica rapa]
Length=480

 Score =   445 bits (1145),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 225/328 (69%), Positives = 265/328 (81%), Gaps = 4/328 (1%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G     N DDD  EKRTGTL+TASAHIIT VIGSGVLSL+WAIAQLGW  G  +L A
Sbjct  10   VESGAGAGNNVDDDCREKRTGTLITASAHIITTVIGSGVLSLAWAIAQLGWVVGTVILVA  69

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F++I  +TS +LAD YRSP    GTRNYTYMDVVR +LGG KVQLCGL+Q+ +LVG++IG
Sbjct  70   FAVIVNYTSRMLADSYRSP---EGTRNYTYMDVVRVYLGGRKVQLCGLAQFGSLVGVTIG  126

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS+VA+ K+NCFH  GH   CSV +YP M  F  +Q+ LSQIPNFH+LS+LSI+
Sbjct  127  YTITASISLVAIGKANCFHDKGHGAKCSVSNYPLMAAFGIVQIFLSQIPNFHKLSFLSII  186

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            A VMSF+Y+SIG GL++A +A SG+   + LTG VVGVDVT +DK+W+ FQA GNIAF+Y
Sbjct  187  ATVMSFSYASIGFGLALAALA-SGKVGKTGLTGTVVGVDVTASDKLWKSFQAAGNIAFSY  245

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
            AYS VL+EIQDTLRS PPEN VMKKAS   VSTTT FY++CGCIGYA FGN APG+FLT 
Sbjct  246  AYSVVLVEIQDTLRSSPPENKVMKKASLAAVSTTTAFYILCGCIGYATFGNQAPGDFLTD  305

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQVF  1
            FGFYEP+WLID AN CIA+HL+GAYQVF
Sbjct  306  FGFYEPYWLIDFANACIAVHLIGAYQVF  333



>ref|XP_006307429.1| hypothetical protein CARUB_v10009053mg [Capsella rubella]
 gb|EOA40327.1| hypothetical protein CARUB_v10009053mg [Capsella rubella]
Length=468

 Score =   444 bits (1142),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 224/328 (68%), Positives = 268/328 (82%), Gaps = 1/328 (0%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G      FDDDG EKRTGT++TASAHIITAVIGSGVLSLSWAIAQLGW AG  +L  
Sbjct  2    VESGDVSGNRFDDDGREKRTGTVLTASAHIITAVIGSGVLSLSWAIAQLGWLAGTLILVT  61

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F++I ++TS +LADCYRSP    G+RNYTYMDVVR++LGG KVQLCGL+QYA+LVGI+IG
Sbjct  62   FAIINYYTSTMLADCYRSPDDDPGSRNYTYMDVVRAYLGGRKVQLCGLAQYASLVGITIG  121

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS+VA+ K++C+H  GH   CS+ +YP M  F   Q++LSQIPNFH+LS+LSI+
Sbjct  122  YTITASISLVAIGKADCYHDKGHGAKCSLSNYPSMAAFGVAQIMLSQIPNFHKLSFLSII  181

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            A VMSF Y+SIGIGLSIA V  SG+   + LTG VVGVDVT  +K++R FQA+G+IAF+Y
Sbjct  182  ATVMSFCYASIGIGLSIATVT-SGKVGKTGLTGTVVGVDVTAFEKLYRSFQAVGDIAFSY  240

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
            +YS VL+EIQDTL+S PPEN VMKKAS  GVSTTT FY++CG +GYAAFGN APG+ LT 
Sbjct  241  SYSIVLVEIQDTLKSSPPENKVMKKASLAGVSTTTAFYILCGGMGYAAFGNQAPGDLLTD  300

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQVF  1
            FGFYEP+WLID AN CI +HLV AYQVF
Sbjct  301  FGFYEPYWLIDFANACIVLHLVAAYQVF  328



>gb|EYU39081.1| hypothetical protein MIMGU_mgv1a023099mg [Erythranthe guttata]
Length=465

 Score =   443 bits (1140),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 213/328 (65%), Positives = 262/328 (80%), Gaps = 4/328 (1%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            +E G      FDDDG  KRTGT +TASAHIITAVIGSGVLSL+WAIAQLGW AGP  LA+
Sbjct  8    IEGGDPSSHKFDDDGRPKRTGTALTASAHIITAVIGSGVLSLAWAIAQLGWVAGPIALAS  67

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            FS+IT+FTS LLADCYRS    TGTRNYTY DVV+S+LGG K  LCG++QY NLVG++IG
Sbjct  68   FSIITWFTSTLLADCYRS---TTGTRNYTYRDVVKSYLGGTKQTLCGIAQYTNLVGVTIG  124

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            Y+IT SISMVA+K+S+CFHK GH+  C + + P++M F  +Q+++SQIPNFHELS LSI+
Sbjct  125  YSITTSISMVAIKRSHCFHKYGHEAGCHMSNNPYIMGFGVLQIIISQIPNFHELSILSII  184

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            AAVMSFAYSSIGIGLSI K+A  G    S     +         K+W  + A+GNIAFAY
Sbjct  185  AAVMSFAYSSIGIGLSIGKIAEGGHVETSLTGIPIGPNMSKI-QKMWNTYSALGNIAFAY  243

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
            A+S VL+EIQDT++S  PEN+VMKKA+  G+S +T+FY++CG +GYAAFGN+APGNFLTG
Sbjct  244  AFSNVLVEIQDTIKSGQPENVVMKKATLAGISVSTMFYMLCGILGYAAFGNNAPGNFLTG  303

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQVF  1
            FGFYEPFWL+D+AN+CI +HL+GAYQVF
Sbjct  304  FGFYEPFWLVDIANVCIVVHLIGAYQVF  331



>ref|NP_001136620.1| uncharacterized protein LOC100216745 [Zea mays]
 gb|ACF82283.1| unknown [Zea mays]
Length=483

 Score =   443 bits (1140),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 226/314 (72%), Positives = 263/314 (84%), Gaps = 2/314 (1%)
 Frame = -1

Query  939  HEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSALLADC  760
             E+RTGTLVTASAHIITAVIGS VLSL+WAIAQLGW  GP VL AFS IT+F S+LLADC
Sbjct  34   RERRTGTLVTASAHIITAVIGSSVLSLAWAIAQLGWVIGPVVLLAFSAITWFCSSLLADC  93

Query  759  YRSP-GPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMVAVKK  583
            YR+P GP  G RNYTY   VRS+LG  K +LC L+QY NLVG++IGYTIT +ISM A+K+
Sbjct  94   YRAPPGPGQGKRNYTYGQAVRSYLGESKYRLCSLAQYVNLVGVTIGYTITTAISMGAIKR  153

Query  582  SNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSSIGIG  403
            SNCFH  GH  DC   +   M+IFA IQ++LSQ+PNFH+L WLSIVAAVMS AYSSIG+G
Sbjct  154  SNCFHSRGHGADCEASNTTNMIIFAGIQILLSQLPNFHKLWWLSIVAAVMSLAYSSIGLG  213

Query  402  LSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQDTLR  223
            LSIAK+AG G    ++LTG  VGVDVT A+K+W+ FQ++G+IAFAY YS VLIEIQDTLR
Sbjct  214  LSIAKIAG-GVHVKTSLTGAAVGVDVTAAEKVWKTFQSLGDIAFAYTYSNVLIEIQDTLR  272

Query  222  SHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDVAN  43
            S PPEN+VMKKAS IGVSTTT FY++CG +GYAAFG+DAPGNFLTGFGFY+PFWLIDV N
Sbjct  273  SSPPENVVMKKASFIGVSTTTAFYMLCGVLGYAAFGSDAPGNFLTGFGFYDPFWLIDVGN  332

Query  42   ICIAIHLVGAYQVF  1
            +CIA+HLVGAYQVF
Sbjct  333  VCIAVHLVGAYQVF  346



>ref|XP_004497265.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=467

 Score =   442 bits (1137),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 219/319 (69%), Positives = 256/319 (80%), Gaps = 0/319 (0%)
 Frame = -1

Query  957  NFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTS  778
             +DDDG  KRTGT VT SAHI+TAVIGSGVLSL+WAIAQLGW AG  VL  FSLIT  TS
Sbjct  12   KYDDDGRLKRTGTWVTGSAHIVTAVIGSGVLSLAWAIAQLGWIAGSIVLILFSLITLLTS  71

Query  777  ALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISM  598
             LLADCYR P PV GTRN+TYM +V++ LGG +   CGL+QY NL+G +IGYT+TASISM
Sbjct  72   FLLADCYRYPDPVHGTRNHTYMGMVKNILGGTQYMFCGLAQYTNLIGCTIGYTLTASISM  131

Query  597  VAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYS  418
            VA+KKSNCFHK GH+ +C   +YPFM IF   +++LSQIP+FHELSWLS VAAVMSF Y+
Sbjct  132  VAIKKSNCFHKYGHEANCKTSNYPFMAIFGVSEILLSQIPDFHELSWLSFVAAVMSFGYA  191

Query  417  SIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEI  238
            SIGIGLSIAK+A  G    + LTG+VVGVD T + K W  FQAIG+IAFAYA+STV++EI
Sbjct  192  SIGIGLSIAKIAEPGHHVETGLTGLVVGVDETSSQKYWNTFQAIGDIAFAYAFSTVIVEI  251

Query  237  QDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWL  58
            QDTL+S PPEN  MKK+   G++ TT FY +CG +GY AFGN APGNFLTGFGFYEPFWL
Sbjct  252  QDTLQSRPPENQAMKKSVFTGITVTTFFYALCGLLGYEAFGNKAPGNFLTGFGFYEPFWL  311

Query  57   IDVANICIAIHLVGAYQVF  1
            +D+ NI I IHLVGAYQVF
Sbjct  312  VDIGNIFIVIHLVGAYQVF  330



>ref|XP_009397328.1| PREDICTED: amino acid permease 6 [Musa acuminata subsp. malaccensis]
Length=481

 Score =   442 bits (1138),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 231/319 (72%), Positives = 269/319 (84%), Gaps = 4/319 (1%)
 Frame = -1

Query  957  NFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTS  778
            +FDDDG  KRTGTLVTASAHIITAVIGSGVLSL+WA+AQLGW AGP VL  FSLIT+F S
Sbjct  29   DFDDDGRVKRTGTLVTASAHIITAVIGSGVLSLAWALAQLGWIAGPTVLLIFSLITWFCS  88

Query  777  ALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISM  598
            +LLADCYRSP    G RNY Y D VR+HLGGV  +LC L+QY NLVG++IGYTIT +ISM
Sbjct  89   SLLADCYRSP---QGKRNYRYKDAVRTHLGGVSSKLCALAQYVNLVGVTIGYTITTAISM  145

Query  597  VAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYS  418
             AVK+SNCFH+NGHD  C   +   M IFA IQ+VLSQIPNFH++ WLSIVAA+MS AYS
Sbjct  146  GAVKRSNCFHRNGHDAACGESNTTNMTIFACIQIVLSQIPNFHKIWWLSIVAAIMSVAYS  205

Query  417  SIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEI  238
            SIG+GLSIAK+A  G  A ++LTGV VGVDV+G++K+WR FQA+G+IAFAYAYS VLIEI
Sbjct  206  SIGLGLSIAKIA-EGPHARTSLTGVTVGVDVSGSEKVWRTFQALGDIAFAYAYSNVLIEI  264

Query  237  QDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWL  58
            QDTLRS PPEN VMKKA+ IGV TTT FY++CG +GYAAFGN APGNFLTGFGFY+PFWL
Sbjct  265  QDTLRSSPPENQVMKKATTIGVLTTTTFYMLCGVLGYAAFGNTAPGNFLTGFGFYDPFWL  324

Query  57   IDVANICIAIHLVGAYQVF  1
            +D+ NICI +HL+GA+QVF
Sbjct  325  VDIGNICIVVHLIGAFQVF  343



>ref|XP_008789212.1| PREDICTED: amino acid permease 8-like [Phoenix dactylifera]
Length=485

 Score =   442 bits (1138),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 218/320 (68%), Positives = 262/320 (82%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            ++ DDDG  KRTGT+ TASAHIITAVIGSGVLSL+WA AQLGW AGPA L  FS ITF+T
Sbjct  28   EDLDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPATLLIFSFITFYT  87

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LLADCYR+  PV+G RNYTY++ V+S+LGG ++ LCGL QY NL G++IGY ITASIS
Sbjct  88   SSLLADCYRTSNPVSGKRNYTYIEAVKSNLGGAQLWLCGLCQYVNLFGVAIGYIITASIS  147

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
              AV+KSNCFHK GH  DCSV    +M+ F  +Q+ LSQ+PNFH+L WLSIVAAVMS AY
Sbjct  148  AAAVQKSNCFHKKGHQADCSVSDSLYMVAFGIVQIFLSQLPNFHKLWWLSIVAAVMSLAY  207

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S I +GLS A +  SG    +++TG  VGVDV+ + K+W+ FQA+G+IAFAY+YS +LIE
Sbjct  208  SFIAVGLSTASII-SGSTGRTSITGTEVGVDVSSSQKVWKVFQALGDIAFAYSYSIILIE  266

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS P EN VMKKAS IGVSTTT+FYV+CGC+GY+AFGN APGN LTGFGFY+PFW
Sbjct  267  IQDTLRSPPAENKVMKKASFIGVSTTTIFYVLCGCLGYSAFGNRAPGNMLTGFGFYDPFW  326

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID+AN+CI +HLVGAYQVF
Sbjct  327  LIDLANVCIVVHLVGAYQVF  346



>ref|XP_009118277.1| PREDICTED: amino acid permease 8-like isoform X3 [Brassica rapa]
Length=472

 Score =   441 bits (1134),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 223/326 (68%), Positives = 263/326 (81%), Gaps = 4/326 (1%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G     N DDD  EKRTGTL+TASAHIIT VIGSGVLSL+WAIAQLGW  G  +L A
Sbjct  10   VESGAGAGNNVDDDCREKRTGTLITASAHIITTVIGSGVLSLAWAIAQLGWVVGTVILVA  69

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F++I  +TS +LAD YRSP    GTRNYTYMDVVR +LGG KVQLCGL+Q+ +LVG++IG
Sbjct  70   FAVIVNYTSRMLADSYRSP---EGTRNYTYMDVVRVYLGGRKVQLCGLAQFGSLVGVTIG  126

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS+VA+ K+NCFH  GH   CSV +YP M  F  +Q+ LSQIPNFH+LS+LSI+
Sbjct  127  YTITASISLVAIGKANCFHDKGHGAKCSVSNYPLMAAFGIVQIFLSQIPNFHKLSFLSII  186

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            A VMSF+Y+SIG GL++A +A SG+   + LTG VVGVDVT +DK+W+ FQA GNIAF+Y
Sbjct  187  ATVMSFSYASIGFGLALAALA-SGKVGKTGLTGTVVGVDVTASDKLWKSFQAAGNIAFSY  245

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
            AYS VL+EIQDTLRS PPEN VMKKAS   VSTTT FY++CGCIGYA FGN APG+FLT 
Sbjct  246  AYSVVLVEIQDTLRSSPPENKVMKKASLAAVSTTTAFYILCGCIGYATFGNQAPGDFLTD  305

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQ  7
            FGFYEP+WLID AN CIA+HL+GAYQ
Sbjct  306  FGFYEPYWLIDFANACIAVHLIGAYQ  331



>ref|XP_009118278.1| PREDICTED: amino acid permease 8-like [Brassica rapa]
Length=489

 Score =   441 bits (1135),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/327 (68%), Positives = 267/327 (82%), Gaps = 3/327 (1%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G     N DDDG EKRTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L +
Sbjct  26   VESGTVAGNNVDDDGGEKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWVAGTVLLVS  85

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F+++  +TS +LADCYRSP    GTRN TYMDVVR++LGG KVQLCGL+QY +LVG++IG
Sbjct  86   FAVVVNYTSRMLADCYRSPD--AGTRNNTYMDVVRAYLGGRKVQLCGLAQYGSLVGMTIG  143

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS+VA+ K+NCFH  GH   C V +YP M  F  IQ+VLSQIPNFH+LS+LSI+
Sbjct  144  YTITASISLVAIGKANCFHDKGHGAKCLVSNYPAMAAFGIIQIVLSQIPNFHKLSFLSII  203

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            AAVMSF+YSSIG GL++A +A SG+   + LTG VVGVDVT +DK+W+ FQA GNIAF+Y
Sbjct  204  AAVMSFSYSSIGTGLALADLA-SGKVGKTELTGTVVGVDVTASDKLWKSFQAAGNIAFSY  262

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
            AYS VL+EIQDTL S PPEN+VMKKAS +GVST T FY++C C+GYA FG+ APG+ LT 
Sbjct  263  AYSVVLVEIQDTLSSSPPENIVMKKASLVGVSTATAFYILCACMGYATFGSQAPGDLLTD  322

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQV  4
            FGFYEP+WLID AN CIA+HL+G YQV
Sbjct  323  FGFYEPYWLIDFANACIAVHLIGVYQV  349



>emb|CDY57931.1| BnaA06g38000D [Brassica napus]
Length=466

 Score =   440 bits (1132),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 221/333 (66%), Positives = 273/333 (82%), Gaps = 11/333 (3%)
 Frame = -1

Query  999  QNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGP  820
             NP  VE       N DDDG EKRTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW AG 
Sbjct  8    HNPSAVESADA---NVDDDGREKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWVAGT  64

Query  819  AVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLV  640
             +L  F+++ ++TS +LADCYRS     G RNYTYMDVVRS+LGG KVQLCGL+QY  LV
Sbjct  65   LILVTFAVVNYYTSTMLADCYRSDA---GARNYTYMDVVRSYLGGRKVQLCGLAQYGCLV  121

Query  639  GISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELS  460
            G++IGYTITASIS+VA+ K+ CFHK GH   CS+P+YPFM+ F  +++ LSQ+PNFH+LS
Sbjct  122  GVTIGYTITASISLVAIWKATCFHKKGHGAKCSIPNYPFMVAFGVVEIFLSQLPNFHKLS  181

Query  459  WLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGN  280
            +LSI+AA+MSF+Y+SIGIGL+I+ VA SG+   +++TG VVGVDVT +DKIW+ FQA G+
Sbjct  182  FLSIIAAIMSFSYASIGIGLAISVVA-SGKVGKTSVTGTVVGVDVTASDKIWKAFQATGD  240

Query  279  IAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPG  100
            IAF+Y++ST+L    DTLRS+PPEN VMKKA+  GVSTTTVFY++CGC+GYAAFGN APG
Sbjct  241  IAFSYSFSTIL----DTLRSNPPENKVMKKATLAGVSTTTVFYILCGCMGYAAFGNRAPG  296

Query  99   NFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            +FLT FGFYEP+WLI+ AN CI +HL+ AYQVF
Sbjct  297  DFLTDFGFYEPYWLINFANACIVLHLIAAYQVF  329



>ref|XP_002522103.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF40303.1| amino acid transporter, putative [Ricinus communis]
Length=454

 Score =   439 bits (1130),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 214/316 (68%), Positives = 258/316 (82%), Gaps = 1/316 (0%)
 Frame = -1

Query  948  DDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSALL  769
            DD   KRTGTLVTASAHIITAVIGSGVLSL+WA AQLGW AGP  L  F++IT+F+S LL
Sbjct  5    DDDDRKRTGTLVTASAHIITAVIGSGVLSLAWATAQLGWIAGPVSLLVFAVITWFSSCLL  64

Query  768  ADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMVAV  589
            ADCYR PGP+ G+RN TY++ V++HLGG+K +LCG++QY N+VG+SIGYTITASISM A+
Sbjct  65   ADCYRFPGPLVGSRNPTYINAVKAHLGGMKQKLCGMAQYGNMVGVSIGYTITASISMAAI  124

Query  588  KKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSSIG  409
             +SNCFHK GH+  C   +  FM+IF   +++LSQ PNFHELS LSIVAA+MSFAYSSI 
Sbjct  125  ARSNCFHKEGHNSGCHTSNNMFMIIFGITEIILSQTPNFHELSGLSIVAAIMSFAYSSIA  184

Query  408  IGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQDT  229
            +GLSIAK+AG      S LTG   GV++   +KIW   QA+G+IAFA+AYS VLIEIQDT
Sbjct  185  LGLSIAKIAGENNVRTS-LTGATGGVNMASTEKIWNTLQALGDIAFAFAYSVVLIEIQDT  243

Query  228  LRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDV  49
            L+  PPEN VMKK+S +GV+TTT+FY++CG +GYAAFG  APGN LTGFGFYEPFWL+D+
Sbjct  244  LKPSPPENQVMKKSSLVGVTTTTIFYILCGTLGYAAFGEQAPGNLLTGFGFYEPFWLVDL  303

Query  48   ANICIAIHLVGAYQVF  1
            ANICI IHLVGAYQVF
Sbjct  304  ANICIVIHLVGAYQVF  319



>emb|CDO97307.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   437 bits (1124),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 219/336 (65%), Positives = 272/336 (81%), Gaps = 10/336 (3%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G +  K FD+DG  KRTGT+ TASAHIITAVIGSGVLSL+WA AQLGW AGP  + A
Sbjct  10   VERGYDDSK-FDEDGRVKRTGTVTTASAHIITAVIGSGVLSLAWATAQLGWIAGPVAMMA  68

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            FS IT+FTS LLADCYRSP  VTG RN TYM+VVR++LGG+KVQLCG++QY NLVGI+IG
Sbjct  69   FSCITWFTSILLADCYRSPDSVTGRRNRTYMEVVRANLGGLKVQLCGIAQYGNLVGITIG  128

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YT+T +ISMVA+K+S+CFH+N     C   +  F+++F  IQ++LSQIPNFH+LS LSI+
Sbjct  129  YTVTTAISMVAIKRSDCFHENHVRDGCHTSNNFFIILFGLIQVILSQIPNFHKLSLLSII  188

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            AAVMSF YSSIG+GLS+A++AG G    ++LTG   G  +T  DK+W  F A+G+IAFAY
Sbjct  189  AAVMSFCYSSIGLGLSVAQIAG-GAHPQTSLTGKPAGQSMTAMDKMWDTFSALGDIAFAY  247

Query  264  AYSTVLIEIQ--------DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGND  109
            A+STVL+EIQ        DTL+S PPEN VMK+A+ IG+S +TVFY++CG +GY+AFGND
Sbjct  248  AFSTVLVEIQASRPIFLEDTLKSTPPENQVMKRAAFIGISVSTVFYMLCGVLGYSAFGND  307

Query  108  APGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            +PGN LTGFGFYEPFWL+D+AN+CIA+HLVGAYQVF
Sbjct  308  SPGNLLTGFGFYEPFWLVDLANVCIAVHLVGAYQVF  343



>gb|KEH43994.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=470

 Score =   439 bits (1130),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 262/322 (81%), Gaps = 3/322 (1%)
 Frame = -1

Query  957  NFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTS  778
             +DDDGH KRTGT VTASAHI+TAVIGSGVLSL+WA+AQLGW AG  +L  FSLIT  TS
Sbjct  13   KYDDDGHIKRTGTWVTASAHIVTAVIGSGVLSLAWAVAQLGWIAGSFILILFSLITLLTS  72

Query  777  ALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISM  598
             LLADCYR P P+ GTRN+TYM++V++ LGGV+ +LCGL+QY NLVG +IGYT+T SISM
Sbjct  73   FLLADCYRYPDPIHGTRNHTYMEMVKNILGGVQYKLCGLAQYTNLVGCTIGYTLTGSISM  132

Query  597  VAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYS  418
            VA+ KSNCFHK GH  DC++ ++ FM IF + Q++LSQIP+FHELSWLSIVAA+MSF Y+
Sbjct  133  VAISKSNCFHKKGHLADCNISNFTFMAIFGSFQILLSQIPDFHELSWLSIVAAIMSFGYA  192

Query  417  SIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEI  238
            SIGIGLSIAK+A  G    + LTG++VGVD TG  K+W  FQAIGNIAFAYA+S V+ EI
Sbjct  193  SIGIGLSIAKIAERGHHVETGLTGLIVGVDETGMQKLWNTFQAIGNIAFAYAFSMVIAEI  252

Query  237  Q---DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEP  67
            Q   DT++S PPEN VMKK++  G+  TT FY +CG +GY AFGN APGNFLTGFGFYEP
Sbjct  253  QASNDTIKSSPPENKVMKKSAFTGILITTFFYALCGLLGYEAFGNKAPGNFLTGFGFYEP  312

Query  66   FWLIDVANICIAIHLVGAYQVF  1
            FWL+D+ N+ I IHLVGAYQVF
Sbjct  313  FWLVDIGNLFIIIHLVGAYQVF  334



>gb|KCW68582.1| hypothetical protein EUGRSUZ_F02192 [Eucalyptus grandis]
Length=466

 Score =   439 bits (1129),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 231/339 (68%), Positives = 266/339 (78%), Gaps = 28/339 (8%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M V Q+P     G  + KN DDDG  +RTGT+VTASAHIITA+IGSGVLSL+W IAQLGW
Sbjct  6     MRVEQDPEAFRSG-GVQKNLDDDGRVERTGTVVTASAHIITALIGSGVLSLAWTIAQLGW  64

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
               G +VL   S IT+FTS LLADCYRSP P+TG RNYTYMDVVR+HLGG KVQLCGL+QY
Sbjct  65    VVGSSVLVTLSFITYFTSTLLADCYRSPDPITGKRNYTYMDVVRAHLGGRKVQLCGLAQY  124

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFD--CSVPSYPFMMIFAAIQLVLSQIP  478
              NLVGI+IGYTITASISMVAVKKSNCFHKNGH+    C   +YPFM+IFA IQ+VLSQIP
Sbjct  125   GNLVGITIGYTITASISMVAVKKSNCFHKNGHEVKSVCETSNYPFMIIFACIQIVLSQIP  184

Query  477   NFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRC  298
             +FH+LSWLSIV AVMS AY+SIG+GLSIAKVAG G  A +TLTG  VGVDV+G++K+WR 
Sbjct  185   DFHKLSWLSIVFAVMSLAYASIGVGLSIAKVAGGGHHARTTLTGTTVGVDVSGSEKVWRV  244

Query  297   FQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAF  118
             FQA+GNI      STVL+EIQDTL+S PPEN VMK+AS IG+STTT+             
Sbjct  245   FQAVGNI------STVLVEIQDTLKSSPPENKVMKRASLIGISTTTM-------------  285

Query  117   GNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
                   +FLTGFGFYEPFW+ID AN CIA+HL+GAYQVF
Sbjct  286   ------DFLTGFGFYEPFWVIDFANACIAVHLIGAYQVF  318



>emb|CDY62728.1| BnaC05g49210D [Brassica napus]
Length=482

 Score =   439 bits (1129),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 225/344 (65%), Positives = 271/344 (79%), Gaps = 21/344 (6%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G     NFDDDG EKRTGTLVTASAHIITAV+GSGVLSL+WAIAQLGW AG  +L  
Sbjct  7    VESGDATGNNFDDDGREKRTGTLVTASAHIITAVVGSGVLSLAWAIAQLGWVAGIVILVT  66

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F++I ++TS +LADCYRS    TGTRN TYMDVVR++LGG KVQLCGL+QY   VG++IG
Sbjct  67   FAVINYYTSTMLADCYRSD---TGTRNCTYMDVVRAYLGGRKVQLCGLAQYGCFVGVTIG  123

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS+VA+ K+NCFH  GH   CS+P+YPFM  F  ++++LSQIP+FH+LS+LSI+
Sbjct  124  YTITASISLVAIGKANCFHDKGHGAKCSMPNYPFMAAFGIVEIILSQIPSFHKLSFLSII  183

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            A VMSF+Y+SIGIGL++A VA SG+   + +TG V GVDVT +DKIW+ FQA G+IAF+Y
Sbjct  184  ATVMSFSYASIGIGLAMAVVA-SGKVGKTGVTGTVAGVDVTASDKIWKSFQATGDIAFSY  242

Query  264  AYSTVLIEIQ----------------DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCI  133
            AYS++L+EIQ                DTLRS PPEN VMKKAS  GVSTTT FY++CGCI
Sbjct  243  AYSSILVEIQACILSSIDVLGVIIKIDTLRSSPPENKVMKKASLAGVSTTTFFYMLCGCI  302

Query  132  GYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            GYAAFGN APG+FLT F FYEP+WLID AN CI +HL+ AYQVF
Sbjct  303  GYAAFGNKAPGDFLTEF-FYEPYWLIDYANACIVLHLIAAYQVF  345



>gb|KEH43995.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=469

 Score =   437 bits (1125),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 220/320 (69%), Positives = 262/320 (82%), Gaps = 0/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            + +DDDG  KRTG+ VTASAHI+TAVIGSGVLSL+WA+AQLGW AG  VL  FSLIT  T
Sbjct  12   EKYDDDGLIKRTGSWVTASAHIVTAVIGSGVLSLAWAVAQLGWIAGCIVLILFSLITLLT  71

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYR P  V G RN TYM +V+S LGGV+ + C L+QYANLVG++IG+T+T SIS
Sbjct  72   SFLLADCYRYPDSVHGIRNPTYMAMVKSILGGVQYRYCALAQYANLVGVTIGFTLTGSIS  131

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            MVA++K NCFHK GH+ DCS  +Y FM IF   +++LSQIPNFHELSWLSIVAA+MSF Y
Sbjct  132  MVAIQKCNCFHKYGHEADCSTTNYQFMAIFGIFEILLSQIPNFHELSWLSIVAAIMSFGY  191

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            +SIGIGLSIAK+A  G   N+ LTG+VVGVDVTG +K+W  FQAIGNIAFAY +S V++E
Sbjct  192  ASIGIGLSIAKIAEEGYHINTGLTGLVVGVDVTGTEKLWNTFQAIGNIAFAYCFSMVIVE  251

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S PPEN VMKK+S +G+  TT FY +CG +GYAAFGN APGNFLTGFGFYEP+W
Sbjct  252  IQDTLKSSPPENQVMKKSSLVGIIITTFFYALCGLLGYAAFGNKAPGNFLTGFGFYEPYW  311

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+ N+ I IHLVGAYQVF
Sbjct  312  LVDIGNLFIIIHLVGAYQVF  331



>ref|XP_004515440.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=468

 Score =   437 bits (1123),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 215/332 (65%), Positives = 262/332 (79%), Gaps = 5/332 (2%)
 Frame = -1

Query  996  NPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPA  817
            N + + +G+     +DDDG  KRTGT +T SAHI+TAVIGSGVLSL+WAIAQLGW AG  
Sbjct  5    NSLPINDGK-----YDDDGRLKRTGTWITGSAHIVTAVIGSGVLSLAWAIAQLGWIAGSI  59

Query  816  VLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVG  637
            VL  FS+IT  TS LLADCYR P PV GTRN+TYM +V++ LGG +   CGL+QY NL+G
Sbjct  60   VLILFSVITLLTSFLLADCYRYPDPVHGTRNHTYMAMVKNILGGTQYMFCGLAQYTNLIG  119

Query  636  ISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSW  457
            I+IGYTIT SISMVA+KKSNCFHK GH+ +C   +YPFM +F   +++LSQIP+FHELSW
Sbjct  120  ITIGYTITTSISMVAIKKSNCFHKYGHEANCKTSNYPFMALFGVSEILLSQIPDFHELSW  179

Query  456  LSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNI  277
            LS VAAVMSF Y+SIGIGLSIAK+A  G    + LTG+VVGVD T + K W  FQAIG+I
Sbjct  180  LSFVAAVMSFGYASIGIGLSIAKIAEPGHHVETGLTGLVVGVDETSSQKYWNTFQAIGDI  239

Query  276  AFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGN  97
            AF+YA+  V+++IQDTL+S PPEN  MKK++ IG++ TT FY +CG +GY AFGN APGN
Sbjct  240  AFSYAFCAVIVDIQDTLKSSPPENQAMKKSNVIGITVTTFFYALCGLLGYEAFGNKAPGN  299

Query  96   FLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            FLTGFGFYEPFWL+D+ N+ I IHLVGAYQVF
Sbjct  300  FLTGFGFYEPFWLVDIGNLFIIIHLVGAYQVF  331



>ref|XP_010250334.1| PREDICTED: amino acid permease 4-like [Nelumbo nucifera]
Length=544

 Score =   438 bits (1127),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 218/324 (67%), Positives = 263/324 (81%), Gaps = 3/324 (1%)
 Frame = -1

Query  972  REILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLI  793
            R++ K  DDDG   RTGT+ TA+AHIITAVIGSGVLSL+WA+AQLGW AGPA L  FSLI
Sbjct  86   RDVRK--DDDGRPCRTGTVWTATAHIITAVIGSGVLSLAWAVAQLGWIAGPATLIVFSLI  143

Query  792  TFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTIT  613
            T +TS LLADCYRSP PV G RNYTYM+ VRS+LGG    +CG+ QY  LVG +IGYTIT
Sbjct  144  TLYTSYLLADCYRSPDPVLGKRNYTYMESVRSNLGGTMHLICGIVQYVYLVGTAIGYTIT  203

Query  612  ASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVM  433
             SIS+ A+ KSNCFHK GHD  C + + PF++ F  +Q++LSQIPNFH+LSWLS +AAVM
Sbjct  204  GSISIAAIYKSNCFHKRGHDAPCLISTDPFLITFGIVQIILSQIPNFHKLSWLSTLAAVM  263

Query  432  SFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYST  253
            SF Y++IGI LS+ KV  SG+   S+LTGV +GVDV+ A K+WR F+A+G+IAFAY YS 
Sbjct  264  SFGYAAIGIALSMVKVI-SGKIGKSSLTGVEIGVDVSEAQKVWRIFKALGDIAFAYVYSV  322

Query  252  VLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFY  73
            +L+EIQDTLRS P EN VMKKA+ I VS TTVFY++CGC+GYAAFGNDAPGN LTGFGFY
Sbjct  323  ILLEIQDTLRSTPAENKVMKKATMISVSITTVFYMLCGCMGYAAFGNDAPGNMLTGFGFY  382

Query  72   EPFWLIDVANICIAIHLVGAYQVF  1
            EP+WLID+AN+ I +HLVGA+QVF
Sbjct  383  EPYWLIDLANMFIVVHLVGAFQVF  406



>emb|CDY57932.1| BnaA06g38010D [Brassica napus]
Length=462

 Score =   434 bits (1117),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/328 (67%), Positives = 267/328 (81%), Gaps = 9/328 (3%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G     NFDDDG EKRTGTL+TASAHIITAV+GSGVLSL+WAIAQLGW AG  +L  
Sbjct  7    VESGDATGNNFDDDGREKRTGTLMTASAHIITAVVGSGVLSLAWAIAQLGWVAGIVILVT  66

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F++I ++TS +LADCYRS    TGTRN TYMDVVR++LGG KVQLCGL+QY   VG++IG
Sbjct  67   FAVINYYTSTMLADCYRSD---TGTRNCTYMDVVRAYLGGKKVQLCGLAQYGCFVGVTIG  123

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS+VA+ K+NCFH   H   CS+P+YPFM +F  ++++LSQIP+FH+LS+LSI+
Sbjct  124  YTITASISLVAIGKANCFHDKRHGAKCSMPNYPFMAVFGIVEIILSQIPSFHKLSFLSII  183

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            A VMSF+Y+SIGIGL++A VA SG+   +  TG VVGVDVT +DKIW+ FQA G+IAF+Y
Sbjct  184  ATVMSFSYASIGIGLAMAVVA-SGKVGKTGATGTVVGVDVTTSDKIWKSFQATGDIAFSY  242

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
            AYS++L    DTLRS PPEN VMKKAS  GVSTTT FY++CGCIGYAAFGN APG+FLT 
Sbjct  243  AYSSIL----DTLRSSPPENKVMKKASLAGVSTTTFFYMLCGCIGYAAFGNKAPGDFLTD  298

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQVF  1
            F FYEP+WLID AN CI +HL+ AYQVF
Sbjct  299  F-FYEPYWLIDFANACIVLHLIAAYQVF  325



>dbj|BAC82953.1| putative amino acid permease [Oryza sativa Japonica Group]
 dbj|BAD30613.1| putative amino acid permease [Oryza sativa Japonica Group]
Length=460

 Score =   434 bits (1115),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 222/308 (72%), Positives = 260/308 (84%), Gaps = 1/308 (0%)
 Frame = -1

Query  924  GTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPG  745
            GTLVTASAHIITAVIGSGVLSL+WAIAQLGW  GPAVL AFS+IT+F S+LLADCYRSP 
Sbjct  14   GTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPAVLVAFSVITWFCSSLLADCYRSPD  73

Query  744  PVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMVAVKKSNCFHK  565
            PV G RNYTY   VR++LG  K +LC ++QY NLVG++IGYTIT +ISM A+K+SN FH+
Sbjct  74   PVHGKRNYTYGQAVRANLGVAKYRLCSVAQYVNLVGVTIGYTITTAISMGAIKRSNWFHR  133

Query  564  NGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKV  385
            NGHD  C       M+IFA IQ++LSQ+PNFH++ WLSIVAAVMS AYS+IG+GLSIAK+
Sbjct  134  NGHDAACLASDTTNMIIFAGIQILLSQLPNFHKIWWLSIVAAVMSLAYSTIGLGLSIAKI  193

Query  384  AGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPEN  205
            AG G    +TLTGV VGVDV+ ++KIWR FQ++G+IAFAY+YS VLIEIQDTLRS P EN
Sbjct  194  AG-GAHPEATLTGVTVGVDVSASEKIWRTFQSLGDIAFAYSYSNVLIEIQDTLRSSPAEN  252

Query  204  MVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIH  25
             VMKKAS IGVSTTT FY++CG +GYAAFGN APGNFLTGFGFYEPFWL+DV N+CI +H
Sbjct  253  EVMKKASFIGVSTTTTFYMLCGVLGYAAFGNRAPGNFLTGFGFYEPFWLVDVGNVCIVVH  312

Query  24   LVGAYQVF  1
            LVGAYQVF
Sbjct  313  LVGAYQVF  320



>ref|XP_009148320.1| PREDICTED: amino acid permease 8-like [Brassica rapa]
Length=470

 Score =   434 bits (1115),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 215/333 (65%), Positives = 269/333 (81%), Gaps = 7/333 (2%)
 Frame = -1

Query  999  QNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGP  820
             NP  VE       N DDDG EKRTGTL+TASAHIITA +GSG L ++W I  LGW AG 
Sbjct  8    HNPSAVESADA---NVDDDGREKRTGTLMTASAHIITAGVGSGALLVAWGITPLGWVAGT  64

Query  819  AVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLV  640
             +L  F+++ ++TS +LADCYRS     G RNYTYMDVVRS+LGG KVQLCGL+QY  LV
Sbjct  65   LILVTFAVVNYYTSTMLADCYRSDA---GARNYTYMDVVRSYLGGRKVQLCGLAQYGCLV  121

Query  639  GISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELS  460
            G++IGYTITASIS+VA+ K+ CFHK GH   CS+P+YPFM+ F  +++ LSQ+PNFH+LS
Sbjct  122  GVTIGYTITASISLVAIWKATCFHKKGHGAKCSIPNYPFMVAFGVVEIFLSQLPNFHKLS  181

Query  459  WLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGN  280
            +LSI+AA+MSF+Y+SIGIGL+I+ VA SG+   +++TG VVGVDVT +DKIW+ FQA G+
Sbjct  182  FLSIIAAIMSFSYASIGIGLAISVVA-SGKVGKTSVTGTVVGVDVTASDKIWKAFQATGD  240

Query  279  IAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPG  100
            IAF+Y++ST+L+EIQDTLRS PPEN VMKKA+  GVSTTTVFY++CGC+GYAAFGN APG
Sbjct  241  IAFSYSFSTILVEIQDTLRSSPPENKVMKKATLAGVSTTTVFYILCGCMGYAAFGNRAPG  300

Query  99   NFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            +FLT FGFYEP+WLI+  N CI +HL+ AYQVF
Sbjct  301  DFLTDFGFYEPYWLINFDNACIDLHLMAAYQVF  333



>emb|CDY22607.1| BnaC08g42410D [Brassica napus]
Length=481

 Score =   434 bits (1116),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 263/334 (79%), Gaps = 12/334 (4%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G     N DDD  EKRTGTL+TASAHIIT VIGSGVLSL+WAIAQLGW  G  +L A
Sbjct  10   VESGAGAGNNVDDDCREKRTGTLITASAHIITTVIGSGVLSLAWAIAQLGWVVGTVILVA  69

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F++I  +TS +LAD YRSP    GTRNYTYMDVVR +LGG KVQLCGL+Q+ +LVG++IG
Sbjct  70   FAVIVNYTSRMLADSYRSP---EGTRNYTYMDVVRVYLGGRKVQLCGLAQFGSLVGVTIG  126

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS+VA+ K+NCFH  GH   CSV +YP M  F  +Q+ LSQIPNFH+LS+LSI+
Sbjct  127  YTITASISLVAIGKANCFHDKGHGAKCSVSNYPLMAAFGIVQIFLSQIPNFHKLSFLSII  186

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            A VMSF+Y+SIG GL++A +A SG+   + LTG VVGVDVT +DK+W+ FQA GNIAF+Y
Sbjct  187  ATVMSFSYASIGFGLALAALA-SGKVGKTGLTGTVVGVDVTASDKLWKSFQAAGNIAFSY  245

Query  264  AYSTVLIEIQ--------DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGND  109
            AYS VL+EIQ        DTLRS PPEN VMKKAS   VSTTT FY++CGCIGYA FGN 
Sbjct  246  AYSVVLVEIQACILSINDDTLRSSPPENKVMKKASLAAVSTTTAFYILCGCIGYATFGNQ  305

Query  108  APGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQ  7
            APG+FLT FGFYEP+WLID AN CIA+HL+GAYQ
Sbjct  306  APGDFLTDFGFYEPYWLIDFANACIAVHLIGAYQ  339



>ref|XP_010915382.1| PREDICTED: amino acid permease 1-like [Elaeis guineensis]
Length=485

 Score =   434 bits (1116),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 216/320 (68%), Positives = 255/320 (80%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            +  DDDG  KR+GT+ TASAHIITAVIGSGVLSL+WA AQLGW AGP  L  FS ITF+T
Sbjct  28   EELDDDGRPKRSGTVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPVTLLLFSFITFYT  87

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYR+  P++G RNYTYM  V+S+LGG +V LCGL QY NL G+ IGYTITASIS
Sbjct  88   SCLLADCYRTSDPISGKRNYTYMQAVKSNLGGTQVWLCGLCQYVNLFGVGIGYTITASIS  147

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
              AV KSNCFH  GH+ DCSV    + ++F  +Q+ LSQ+PNFH+L WLSIVAAVMS AY
Sbjct  148  AAAVHKSNCFHAKGHEADCSVSDSLYTVVFGIVQIFLSQLPNFHKLWWLSIVAAVMSLAY  207

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S I +GLS A +  SG  A +++TG  VGVDV  + K+W+  QA+G+IAFAY+YS +LIE
Sbjct  208  SFIAVGLSTASII-SGNTAKTSITGTEVGVDVDSSQKVWKACQALGDIAFAYSYSVILIE  266

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS P E  VMKKAS +GVSTTTVFYV+CGC+GYAAFGN APGN LTGFGF+EP+W
Sbjct  267  IQDTLRSPPAEVKVMKKASFMGVSTTTVFYVLCGCLGYAAFGNRAPGNLLTGFGFFEPYW  326

Query  60   LIDVANICIAIHLVGAYQVF  1
            LIDVAN+CI +HLVGAYQVF
Sbjct  327  LIDVANVCIVVHLVGAYQVF  346



>ref|XP_010322323.1| PREDICTED: amino acid transporter isoform X1 [Solanum lycopersicum]
Length=473

 Score =   433 bits (1114),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 206/337 (61%), Positives = 260/337 (77%), Gaps = 1/337 (0%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M ++  P  V E     K FDDDG  KRTG++ TASAHIITAVIGSGVLSL+WA AQLGW
Sbjct  1     MTMADKPHQVFEVYGESKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  60

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
              AGP VL  FS +T++TSALL+DCYR+  PVTG RNYTYMD VR++LGG +V++CG+ QY
Sbjct  61    VAGPTVLLLFSFVTYYTSALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQY  120

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
             ANL G++IGYTI +SISMVAV +SNCFHK GH   C+V S P+M++F  ++++ SQIP+F
Sbjct  121   ANLFGVAIGYTIASSISMVAVNRSNCFHKQGHHAACNVSSTPYMIMFGVMEIIFSQIPDF  180

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
              ++SWLSIVAAVMSF YS+IG+GL +A+VA +G+   S     +         KIWR FQ
Sbjct  181   DQISWLSIVAAVMSFTYSTIGLGLGVAQVAETGKIEGSLTGISIGTEVTEM-QKIWRSFQ  239

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGN  112
             A+G IAFAY+YS +LIEIQDTL+S P E   MK+A+ I V+ TTVFY++CGC GYAAFG+
Sbjct  240   ALGAIAFAYSYSLILIEIQDTLKSPPAEAKTMKRATLISVAVTTVFYMLCGCFGYAAFGD  299

Query  111   DAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
              +PGN LTGFGFY P+WL+D+ANI I +HLVGAYQV+
Sbjct  300   QSPGNLLTGFGFYNPYWLLDIANIAIVVHLVGAYQVY  336



>ref|XP_006365537.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=473

 Score =   433 bits (1113),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 254/320 (79%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTG++ TASAHIITAVIGSGVLSL+WA AQLGW AGP VL  FS +T++T
Sbjct  18   KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVLLLFSFVTYYT  77

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALL+DCYR+  PVTG RNYTYMD VR++LGG +V++CG+ QYANL G++IGYTI ASIS
Sbjct  78   SALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLFGVAIGYTIAASIS  137

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            MVAV +SNCFHK GH   C+V S P+M+IF  ++++ SQIP+F ++SWLSIVAAVMSF Y
Sbjct  138  MVAVNRSNCFHKQGHRAACNVSSTPYMIIFGVMEIIFSQIPDFDQISWLSIVAAVMSFTY  197

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL +A+VA +G+   S     +         KIWR FQA+G IAFAY+YS +LIE
Sbjct  198  STIGLGLGVAQVAETGKIEGSLTGISIGTEVTEM-QKIWRSFQALGAIAFAYSYSLILIE  256

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P E   MK+A+ I V+ TTVFY++CGC GYAAFG+ +PGN LTGFGFY P+W
Sbjct  257  IQDTLKSPPAEAKTMKRATLISVAVTTVFYMLCGCFGYAAFGDQSPGNLLTGFGFYNPYW  316

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN+ I +HLVGAYQV+
Sbjct  317  LLDIANVAIVVHLVGAYQVY  336



>ref|XP_004496860.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=468

 Score =   432 bits (1112),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 214/311 (69%), Positives = 253/311 (81%), Gaps = 0/311 (0%)
 Frame = -1

Query  933  KRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSALLADCYR  754
            KRTGT +T SAHI+TAVIGSGVLSL+WAIAQLGW AG  VL  FSLIT  TS LLADCYR
Sbjct  20   KRTGTWITGSAHIVTAVIGSGVLSLAWAIAQLGWIAGSIVLILFSLITLLTSFLLADCYR  79

Query  753  SPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMVAVKKSNC  574
             P PV G RN TYM +V++ LGG +  LCGL+QY NL+G +IGYT+TASISM A+KKSNC
Sbjct  80   YPDPVHGARNPTYMVMVKNILGGTQYMLCGLAQYTNLIGCTIGYTLTASISMTAIKKSNC  139

Query  573  FHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSI  394
            FHK GH+ +C+  +YPFM IF   Q++LSQIP+FHELSWLSIVAAVMSF Y+SIGIGLSI
Sbjct  140  FHKYGHEANCNTSNYPFMAIFGVSQILLSQIPDFHELSWLSIVAAVMSFGYASIGIGLSI  199

Query  393  AKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHP  214
            AK+A  G    + LTG+VVGVD T  +K+W  FQAIGNIAFAYA+S V++EIQDTL+S P
Sbjct  200  AKIAEPGHHVKTGLTGLVVGVDETSYEKLWNTFQAIGNIAFAYAFSMVIVEIQDTLKSSP  259

Query  213  PENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDVANICI  34
            PEN  MKK++ +G++ TT FY +CG +GY AFGN APGNFLTGFGFYEPFWL+D+ N+ I
Sbjct  260  PENQAMKKSNVVGITVTTFFYALCGLLGYEAFGNKAPGNFLTGFGFYEPFWLVDIGNLLI  319

Query  33   AIHLVGAYQVF  1
             IHLVGAYQVF
Sbjct  320  IIHLVGAYQVF  330



>ref|XP_003535676.1| PREDICTED: amino acid permease 6-like [Glycine max]
Length=462

 Score =   432 bits (1111),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 213/317 (67%), Positives = 262/317 (83%), Gaps = 1/317 (0%)
 Frame = -1

Query  951  DDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSAL  772
            DDDG  KR GT +TA++HI+TAVIGSGVLSL+WA+AQLGW AGPA+L  FS+IT FTS+L
Sbjct  16   DDDGRLKRRGTWLTATSHIVTAVIGSGVLSLAWAVAQLGWIAGPAILTIFSVITVFTSSL  75

Query  771  LADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMVA  592
            L+DCYR P  V GTRN+ Y ++V++ LGG K   CGL+Q+ANL+G  IGYT+TASISMVA
Sbjct  76   LSDCYRYPDSVHGTRNHNYREMVKNILGGRKYLFCGLAQFANLIGTGIGYTVTASISMVA  135

Query  591  VKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSSI  412
            V +SNCFHK GH+  C   +YP+M IFA IQ++LSQIP+F ELS LSI+AAVMSF YSSI
Sbjct  136  VIRSNCFHKYGHEAKCHTSNYPYMTIFAVIQILLSQIPDFQELSGLSIIAAVMSFGYSSI  195

Query  411  GIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQD  232
            GIGLSIAK+AG G  A ++LTG++VG DVT  +K+W  FQAIGNIAFAYA+S VL+EIQD
Sbjct  196  GIGLSIAKIAG-GNDAKTSLTGLIVGEDVTSQEKLWNTFQAIGNIAFAYAFSQVLVEIQD  254

Query  231  TLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLID  52
            TL+S PPEN  MKKA+  G S T++FY++CG +GYAAFGN APGNFLTGFGFYEP+WL+D
Sbjct  255  TLKSSPPENQAMKKATLAGCSITSLFYMLCGLLGYAAFGNKAPGNFLTGFGFYEPYWLVD  314

Query  51   VANICIAIHLVGAYQVF  1
            + N+ + +HLVGAYQVF
Sbjct  315  IGNVFVFVHLVGAYQVF  331



>ref|XP_007042690.1| Amino acid permease 1 [Theobroma cacao]
 gb|EOX98521.1| Amino acid permease 1 [Theobroma cacao]
Length=479

 Score =   431 bits (1109),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 218/317 (69%), Positives = 262/317 (83%), Gaps = 3/317 (1%)
 Frame = -1

Query  951  DDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSAL  772
            D D   KR GT VTA AHIITAVIGSGVLSLSWAIAQLGW AGP  L  FS IT+FTS L
Sbjct  27   DGDNSSKRKGTWVTAGAHIITAVIGSGVLSLSWAIAQLGWIAGPVTLLLFSAITWFTSTL  86

Query  771  LADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMVA  592
            LADC R P  ++G R  +YMD V+S+LGG+  +LCG +QY NLVGISIGY+IT++ISM A
Sbjct  87   LADCCRDP--ISGRRCSSYMDAVKSNLGGIHYKLCGFAQYGNLVGISIGYSITSAISMAA  144

Query  591  VKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSSI  412
            +K+S CFHKNGHD  C V +  FM+IF  I+++LSQIPN HELS LS+VAA+MSFAYS+I
Sbjct  145  IKRSGCFHKNGHDAGCHVKNNVFMIIFGFIEIILSQIPNLHELSGLSVVAAIMSFAYSTI  204

Query  411  GIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQD  232
            G+GLSIAK+A  G  A ++LTG  VGVDVT A KIW CF+A+G+IAFAYA+STVL+EIQD
Sbjct  205  GLGLSIAKLA-EGSHARTSLTGTTVGVDVTSAQKIWNCFEAMGDIAFAYAFSTVLVEIQD  263

Query  231  TLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLID  52
            T++S+PPEN  MKKA+++G+S TTVFY++CG +GYAA GN APGNFLTGFGFYEP+WLID
Sbjct  264  TVKSNPPENEAMKKATSVGISITTVFYMLCGVLGYAALGNKAPGNFLTGFGFYEPYWLID  323

Query  51   VANICIAIHLVGAYQVF  1
            VAN+CI +HLVGAYQVF
Sbjct  324  VANVCIIVHLVGAYQVF  340



>gb|AAD16013.1| amino acid transporter [Nepenthes alata]
Length=379

 Score =   427 bits (1098),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 222/297 (75%), Positives = 252/297 (85%), Gaps = 2/297 (1%)
 Frame = -1

Query  888  AVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMD  709
            AVIGSGVLSL+WAIAQLGW AGPAVL AFS IT+FTS +LADCYR+P PVTG RNYTYMD
Sbjct  1    AVIGSGVLSLAWAIAQLGWVAGPAVLIAFSAITYFTSTMLADCYRAPDPVTGKRNYTYMD  60

Query  708  VVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSY  529
            VV+++LGG KVQLCGL+QY NLVG++IGYTITASISMVAVK+SNCFHK+GH   C   + 
Sbjct  61   VVKAYLGGRKVQLCGLAQYGNLVGVTIGYTITASISMVAVKRSNCFHKHGHRDGCHTSNN  120

Query  528  PFMMIFAAIQLVLSQIPNFHELSWLS-IVAAVMSFAYSSIGIGLSIAKVAGSGRAANStl  352
            PFM+ FA IQ+V SQIPNFHEL   S IVAA MSFAYSSIGIGLSIAKVAG G  A ++L
Sbjct  121  PFMIAFACIQIVFSQIPNFHELFMASPIVAAAMSFAYSSIGIGLSIAKVAG-GAHARTSL  179

Query  351  tgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGV  172
            TGV VG+DVT  +K+WR  QAIG+IAFAYAY+ VL+EIQDTL+S PPEN VM++AS IG 
Sbjct  180  TGVAVGIDVTSTEKVWRTLQAIGDIAFAYAYANVLVEIQDTLKSSPPENKVMRRASLIGG  239

Query  171  STTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
                 FYV+CGC+GYAAF  DAPGNFLTGFGFYEPFWLID AN+CIAIHL+GAYQVF
Sbjct  240  RPPHSFYVLCGCMGYAAFVYDAPGNFLTGFGFYEPFWLIDFANVCIAIHLIGAYQVF  296



>ref|NP_001234606.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13689.1|AF013280_1 amino acid transporter [Solanum lycopersicum]
Length=471

 Score =   430 bits (1106),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 204/335 (61%), Positives = 259/335 (77%), Gaps = 1/335 (0%)
 Frame = -1

Query  1005  VSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAA  826
             ++  P  V E     K FDDDG  KRTG++ TASAHIITAVIGSGVLSL+WA AQLGW A
Sbjct  1     MADKPHQVFEVYGESKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVA  60

Query  825   GPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYAN  646
             GP VL  FS +T++TSALL+DCYR+  PVTG RNYTYMD VR++LGG +V++CG+ QYAN
Sbjct  61    GPTVLLLFSFVTYYTSALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYAN  120

Query  645   LVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHE  466
             L G++IGYTI +SISMVAV +SNCFHK GH   C+V S P+M++F  ++++ SQIP+F +
Sbjct  121   LFGVAIGYTIASSISMVAVNRSNCFHKQGHHAACNVSSTPYMIMFGVMEIIFSQIPDFDQ  180

Query  465   LSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAI  286
             +SWLSIVAAVMSF YS+IG+GL +A+VA +G+   S     +         KIWR FQA+
Sbjct  181   ISWLSIVAAVMSFTYSTIGLGLGVAQVAETGKIEGSLTGISIGTEVTEM-QKIWRSFQAL  239

Query  285   GNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDA  106
             G IAFAY+YS +LIEIQDTL+S P E   MK+A+ I V+ TTVFY++CGC GYAAFG+ +
Sbjct  240   GAIAFAYSYSLILIEIQDTLKSPPAEAKTMKRATLISVAVTTVFYMLCGCFGYAAFGDQS  299

Query  105   PGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             PGN LTGFGFY P+WL+D+ANI + +HLVGAYQV+
Sbjct  300   PGNLLTGFGFYNPYWLLDIANIAMVVHLVGAYQVY  334



>ref|XP_006852747.1| hypothetical protein AMTR_s00033p00113090 [Amborella trichopoda]
 gb|ERN14214.1| hypothetical protein AMTR_s00033p00113090 [Amborella trichopoda]
Length=482

 Score =   430 bits (1106),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 262/318 (82%), Gaps = 0/318 (0%)
 Frame = -1

Query  954  FDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSA  775
            FDDDG EKRTGT  TASAHIITAVIGSGVLSL+W +AQLGW AG  VL  FS IT++TS 
Sbjct  28   FDDDGVEKRTGTFWTASAHIITAVIGSGVLSLAWGMAQLGWIAGAFVLLLFSGITYYTSC  87

Query  774  LLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMV  595
            LLADCYRSP PV G RNYTY D V+++L   + +LCG++QY  L    +GYT+TA+ISM 
Sbjct  88   LLADCYRSPDPVHGKRNYTYTDAVKANLDERRTKLCGIAQYIYLFATCLGYTLTAAISMA  147

Query  594  AVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSS  415
            A+++SNCFHK+GHD  C   +  F++IF  IQL LSQIPN H+LSWLS++AAVMSF YS+
Sbjct  148  AIERSNCFHKHGHDAHCPPKTNRFLIIFGCIQLFLSQIPNLHKLSWLSVIAAVMSFTYST  207

Query  414  IGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQ  235
            IG+GLSIA+V+  G + N++LTGV VGVDVT  +KIW+  QA+G++AFAYA++++LIEIQ
Sbjct  208  IGVGLSIARVSSKGASHNTSLTGVAVGVDVTSTEKIWKVCQALGDVAFAYAFTSILIEIQ  267

Query  234  DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLI  55
            +TL+S PPEN VMKKAS +G+  TT++Y++CG IGYAAFGN APGNFLTGFGFYEPFWLI
Sbjct  268  NTLKSSPPENKVMKKASFLGILVTTMYYMLCGFIGYAAFGNKAPGNFLTGFGFYEPFWLI  327

Query  54   DVANICIAIHLVGAYQVF  1
            D+AN+CIAIHL G+YQVF
Sbjct  328  DLANVCIAIHLFGSYQVF  345



>gb|KHG12273.1| Amino acid permease 6 -like protein [Gossypium arboreum]
Length=452

 Score =   429 bits (1102),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 227/339 (67%), Positives = 262/339 (77%), Gaps = 28/339 (8%)
 Frame = -1

Query  1011  MAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGW  832
             M V + P   E G ++ KN DDDG  KRTGT VTASAHIITAVIGSGVLSL+WA+AQLGW
Sbjct  1     MFVEKIPGDYENG-DVNKNLDDDGRVKRTGTWVTASAHIITAVIGSGVLSLAWAVAQLGW  59

Query  831   AAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQY  652
               GPA L  FS IT+FTS LLAD YR+P PV G RNYTYMD VR++LGG KVQLCGL+QY
Sbjct  60    VGGPAALVVFSFITYFTSTLLADAYRAPDPVRGQRNYTYMDAVRAYLGGRKVQLCGLAQY  119

Query  651   ANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNF  472
              NL GI+IGYTIT+SISMVAVK+SNCFHK+GH   C   +YPFM+IF  IQ+VLSQIPNF
Sbjct  120   MNLTGITIGYTITSSISMVAVKRSNCFHKHGHQAKCETSNYPFMVIFGCIQIVLSQIPNF  179

Query  471   HELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQ  292
              +LSWLSI+A+VMSFAYS IG+GLSIAKVAG      +TLTGV+VGVDV+G++K      
Sbjct  180   AKLSWLSIIASVMSFAYSFIGLGLSIAKVAGGEEDVRTTLTGVIVGVDVSGSEK------  233

Query  291   AIGNIAFAYAYSTVLIEIQDTLRSHP--PENMVMKKASAIGVSTTTVFYVMCGCIGYAAF  118
                                DT++  P  PEN  MK+A+AIGVSTTT+FY++CG +GYAAF
Sbjct  234   -------------------DTIKWSPVVPENKSMKRATAIGVSTTTIFYLLCGLVGYAAF  274

Query  117   GNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GNDAPGNFLTGFGFYEPFWLID ANICIAIHL+GAYQVF
Sbjct  275   GNDAPGNFLTGFGFYEPFWLIDFANICIAIHLLGAYQVF  313



>emb|CDY22608.1| BnaC08g42420D [Brassica napus]
Length=504

 Score =   430 bits (1105),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 266/334 (80%), Gaps = 11/334 (3%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G     N DDDG EKRTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L +
Sbjct  32   VESGTVAGNNVDDDGGEKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWVAGTVLLVS  91

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F+++  +TS +LADCYRSP    GTRN TYMDVVR++LGG KVQLCGL+QY +LVG++IG
Sbjct  92   FAVVVNYTSRMLADCYRSPD--AGTRNNTYMDVVRAYLGGRKVQLCGLAQYGSLVGMTIG  149

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS VA+ K+NCFH  GH    SV +YP M  F  IQ+VLSQIPNFH+LS+LSI+
Sbjct  150  YTITASISFVAIGKANCFHDKGHGAKFSVSNYPAMAAFGIIQIVLSQIPNFHKLSFLSII  209

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            AAVMSF+YSSIG GL++A +A SG+   + LTG VVGVDVT +DK+W+ FQA GNIAF+Y
Sbjct  210  AAVMSFSYSSIGTGLALADLA-SGKVGKTELTGTVVGVDVTASDKLWKSFQAAGNIAFSY  268

Query  264  AYSTVLIEIQ--------DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGND  109
            AYS VL+EIQ        DTL S PPEN+VMKKAS +GVST T FY++C C+GYA FG+ 
Sbjct  269  AYSVVLVEIQACIFSTRNDTLSSSPPENIVMKKASIVGVSTATAFYILCACMGYATFGSQ  328

Query  108  APGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQ  7
            APG+ LT FGFYEP+WLID AN CIA+HL+GAYQ
Sbjct  329  APGDLLTDFGFYEPYWLIDFANACIAVHLIGAYQ  362



>ref|NP_001057853.1| Os06g0556000 [Oryza sativa Japonica Group]
 dbj|BAD53554.1| putative amino acid transporter [Oryza sativa Japonica Group]
 dbj|BAF19767.1| Os06g0556000 [Oryza sativa Japonica Group]
 gb|EAZ01325.1| hypothetical protein OsI_23356 [Oryza sativa Indica Group]
 gb|EAZ37338.1| hypothetical protein OsJ_21679 [Oryza sativa Japonica Group]
 dbj|BAG95706.1| unnamed protein product [Oryza sativa Japonica Group]
Length=487

 Score =   427 bits (1099),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 212/320 (66%), Positives = 258/320 (81%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            ++ DDDG ++RTG + TASAHIITAVIGSGVLSL+WA AQLGW  GP  L  F+LIT++T
Sbjct  32   EDVDDDGKQRRTGNVWTASAHIITAVIGSGVLSLAWATAQLGWVVGPVTLMLFALITYYT  91

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYR+  PV+G RNYTYMD V ++LGG +V  CG+ QY NLVG +IGYTITASIS
Sbjct  92   SGLLADCYRTGDPVSGKRNYTYMDAVAAYLGGWQVWSCGVFQYVNLVGTAIGYTITASIS  151

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
              AV K+NC+HKNGHD DC V    +M++F  +Q+  S +PNF +LSWLSI+AAVMSF+Y
Sbjct  152  AAAVHKANCYHKNGHDADCGVYDTTYMIVFGVVQIFFSMLPNFSDLSWLSILAAVMSFSY  211

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+I +GLS+A+   SG    +TLTGV VGVDVT A KIW  FQA+G+IAFAY+YS +LIE
Sbjct  212  STIAVGLSLARTI-SGATGKTTLTGVEVGVDVTSAQKIWLAFQALGDIAFAYSYSMILIE  270

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P EN  MKKA+ +GVSTTT FY++CGC+GYAAFGN APGN LTGFGFYEP+W
Sbjct  271  IQDTVKSPPAENKTMKKATLLGVSTTTAFYMLCGCLGYAAFGNAAPGNMLTGFGFYEPYW  330

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN+CI +HLVGAYQVF
Sbjct  331  LIDFANVCIVVHLVGAYQVF  350



>gb|EYU39082.1| hypothetical protein MIMGU_mgv1a020135mg [Erythranthe guttata]
Length=466

 Score =   427 bits (1097),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 217/328 (66%), Positives = 265/328 (81%), Gaps = 4/328 (1%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            +E   +    FDDDG  KRTGT+ TA+AHIITAVIGSGVLSL+WAIAQLGW AGP  L A
Sbjct  8    IEAENQESSKFDDDGQVKRTGTMFTATAHIITAVIGSGVLSLAWAIAQLGWIAGPIALLA  67

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F++IT+FTS LLADCYRS     GTRNYTY++VVRSHLGG+K QLCG++Q++NLVG  IG
Sbjct  68   FAVITWFTSILLADCYRS---TDGTRNYTYIEVVRSHLGGLKFQLCGIAQHSNLVGSCIG  124

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            Y+ITASISMVA+ +S CFHK GH+  C   + P++M F A+QLVLSQIPNFH+L+ LSIV
Sbjct  125  YSITASISMVAMGRSYCFHKYGHEAGCHRSNNPYIMSFGAMQLVLSQIPNFHKLTMLSIV  184

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            AAVMSFAYSSIGIGLSI K+A  G+   S LTGV +G D++  DK+W  + A+GNIAFAY
Sbjct  185  AAVMSFAYSSIGIGLSIGKIAEGGQ-IESGLTGVPIGKDMSSTDKMWNTYNALGNIAFAY  243

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
            A+S VL+EIQDT++S   EN  MK A+  G+S +T+FY++CG +GYAAFGNDAPGNFLTG
Sbjct  244  AFSNVLVEIQDTVKSGASENRTMKNATLAGISISTIFYMLCGVLGYAAFGNDAPGNFLTG  303

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQVF  1
            FGFYEPFWL+ +AN+ I IHLVGAYQV+
Sbjct  304  FGFYEPFWLVGLANLFIVIHLVGAYQVY  331



>emb|CDP08191.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   427 bits (1097),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 216/328 (66%), Positives = 262/328 (80%), Gaps = 5/328 (2%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            V++G  +L   DDDG  KRTGT+ TASAHIITA+IGSGVLSL+W +AQLGW  G   L  
Sbjct  20   VQKGTNLL--LDDDGKPKRTGTVWTASAHIITAIIGSGVLSLAWGVAQLGWIVGVTTLVV  77

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            FS IT +TS+LLADCYRSP   TG RNYTYM+ V+++LGG     CG+ QYANL G  IG
Sbjct  78   FSGITLYTSSLLADCYRSPE--TGKRNYTYMEAVKNNLGGKMYIACGMVQYANLYGTIIG  135

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASISM A++KS+CFHK GH+  CSV + P+M+    +++ LSQIPNFH+LS LSIV
Sbjct  136  YTITASISMAAIQKSDCFHKRGHEASCSVSNNPYMIGLGILEIFLSQIPNFHKLSMLSIV  195

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            AA+MSF+YSSIG+GL+ AKV  SG+   +TLTGV VG++++ A+K WR F+A G+IAFAY
Sbjct  196  AAIMSFSYSSIGMGLAFAKVI-SGKGERTTLTGVEVGINLSAAEKTWRMFRAFGDIAFAY  254

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
             YS +LIEIQDTLRS P EN VMKKA+ +GV TTT FY+MCGC GYAAFGN+APGN LTG
Sbjct  255  TYSQILIEIQDTLRSQPSENKVMKKANIMGVFTTTTFYMMCGCFGYAAFGNNAPGNLLTG  314

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQVF  1
            FGFYEPFWL+D+ANICI +HLVGAYQVF
Sbjct  315  FGFYEPFWLVDMANICIVVHLVGAYQVF  342



>gb|ABR18002.1| unknown [Picea sitchensis]
Length=492

 Score =   427 bits (1098),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 249/320 (78%), Gaps = 3/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            + FDDDG  +RTGTL TASAHIITAVIGSGVLSL+W++AQLGW AGPAVL AFS IT +T
Sbjct  37   EKFDDDGRPRRTGTLWTASAHIITAVIGSGVLSLAWSMAQLGWIAGPAVLIAFSFITLYT  96

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS  PV G RNY YM  V+++LGG++  LCG +QY+NL G +IGYTITAS S
Sbjct  97   SALLADCYRSLDPVNGKRNYNYMAAVKANLGGLQTWLCGFTQYSNLYGTAIGYTITASTS  156

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M A+ +S+CFH  G ++ C   + PFM++F  +QL+LSQIP+F +L WLSIVAAVMSF+Y
Sbjct  157  MAAINRSDCFHSKGKNYPCHPSNNPFMIMFGIVQLILSQIPDFDQLWWLSIVAAVMSFSY  216

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GLSI KVA             V    +TGA K+W+ FQA+G+IAFAY+YS +LIE
Sbjct  217  SSIGLGLSIGKVAEGNFHGT---LTGVTVGTITGAQKVWQTFQALGDIAFAYSYSMILIE  273

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS P EN  MKKA+ +GVS TT+FY + GC GYAAFGN APGN LTGFGFY PFW
Sbjct  274  IQDTLRSPPAENKTMKKATVLGVSVTTLFYTLSGCFGYAAFGNSAPGNLLTGFGFYNPFW  333

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D AN C+ +HLVGAYQVF
Sbjct  334  LVDFANACVVVHLVGAYQVF  353



>gb|KEH43996.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=472

 Score =   426 bits (1096),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 209/320 (65%), Positives = 259/320 (81%), Gaps = 9/320 (3%)
 Frame = -1

Query  933  KRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSALLADCYR  754
            KRTGT +TASAHI+T +IGSGVLSL+WA+AQLGW AG   L  FS IT  TS L+ADCYR
Sbjct  15   KRTGTWITASAHIVTTIIGSGVLSLAWAVAQLGWIAGTITLIIFSAITLLTSCLMADCYR  74

Query  753  SPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMVAVKKSNC  574
             P P+ G RN+TYM++V++ LGGV+ + CGL+QY NL+GI+IGYT+T SISMVA+KKSNC
Sbjct  75   YPDPIHGIRNHTYMEMVKNILGGVQYKFCGLAQYTNLIGITIGYTLTGSISMVAIKKSNC  134

Query  573  FHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSI  394
            FHK GH+ DC + +Y FM IF   +++LSQIP+FHELSWLSI+AAVMSF YSSIG+GLSI
Sbjct  135  FHKYGHEADCKISNYQFMAIFGVTEILLSQIPDFHELSWLSILAAVMSFGYSSIGVGLSI  194

Query  393  AKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQ-------  235
            AK+A  G    ++LTG+VVGVDVT ++K+W  FQAIGNIAFAY++STV+ EIQ       
Sbjct  195  AKIAEGGHHVKTSLTGLVVGVDVTISEKLWNTFQAIGNIAFAYSFSTVIAEIQASIKFKR  254

Query  234  --DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
              DTL+S PPEN VMKK+S IG++ +T+FY +CG +GY AFGN APGNFLTGFGFYEP+W
Sbjct  255  TKDTLKSSPPENQVMKKSSLIGITISTIFYSLCGLLGYGAFGNKAPGNFLTGFGFYEPYW  314

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+ N+ I IHLVGAYQVF
Sbjct  315  LVDIGNLFIIIHLVGAYQVF  334



>ref|XP_003568418.2| PREDICTED: amino acid permease 3-like isoform X1 [Brachypodium 
distachyon]
Length=488

 Score =   426 bits (1096),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 254/321 (79%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K +DDDG  KRTGT+ TASAHIITAVIGSGVLSL WAIAQLGW AGPAV+  FSL+T++T
Sbjct  35   KCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPAVMLLFSLVTYYT  94

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALL+DCYRS    TG RNYTYMD V ++L G+KVQ+CG  QYAN+VG++IGYTI ASIS
Sbjct  95   SALLSDCYRSGDETTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAIGYTIAASIS  154

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K++NCFH  GH   C + S P+M+IF A Q+  SQIP+F ++SWLSIVAA+MSF Y
Sbjct  155  MLAIKRANCFHAKGHVNPCHISSTPYMIIFGAAQIFFSQIPDFDQISWLSIVAAIMSFTY  214

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL I +V  +     S     +  V     DK+WR  QA G+IAFAY+YS +LIE
Sbjct  215  STIGLGLGIVQVVANRGVKGSLTGISIGVVTPM--DKVWRSLQAFGDIAFAYSYSLILIE  272

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+R+ PP E+ VM++A+ + V+TTT+FY++CGC+GYAAFG++APGN LTGFGFYEPF
Sbjct  273  IQDTIRAPPPSESKVMRRATVVSVATTTLFYMLCGCMGYAAFGDEAPGNLLTGFGFYEPF  332

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+DVAN  I +HLVGAYQV+
Sbjct  333  WLLDVANAAIVVHLVGAYQVY  353



>ref|XP_010231354.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010231355.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
Length=482

 Score =   426 bits (1096),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 254/321 (79%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K +DDDG  KRTGT+ TASAHIITAVIGSGVLSL WAIAQLGW AGPAV+  FSL+T++T
Sbjct  29   KCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPAVMLLFSLVTYYT  88

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALL+DCYRS    TG RNYTYMD V ++L G+KVQ+CG  QYAN+VG++IGYTI ASIS
Sbjct  89   SALLSDCYRSGDETTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAIGYTIAASIS  148

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K++NCFH  GH   C + S P+M+IF A Q+  SQIP+F ++SWLSIVAA+MSF Y
Sbjct  149  MLAIKRANCFHAKGHVNPCHISSTPYMIIFGAAQIFFSQIPDFDQISWLSIVAAIMSFTY  208

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL I +V  +     S     +  V     DK+WR  QA G+IAFAY+YS +LIE
Sbjct  209  STIGLGLGIVQVVANRGVKGSLTGISIGVVTPM--DKVWRSLQAFGDIAFAYSYSLILIE  266

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+R+ PP E+ VM++A+ + V+TTT+FY++CGC+GYAAFG++APGN LTGFGFYEPF
Sbjct  267  IQDTIRAPPPSESKVMRRATVVSVATTTLFYMLCGCMGYAAFGDEAPGNLLTGFGFYEPF  326

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+DVAN  I +HLVGAYQV+
Sbjct  327  WLLDVANAAIVVHLVGAYQVY  347



>ref|XP_002307053.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
 gb|EEE94049.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
Length=494

 Score =   426 bits (1096),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 252/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGTL TAS+HIITAVIGSGVLSL+WAIAQLGW AGPAV+  FSL+T++T
Sbjct  38   KCFDDDGRLKRTGTLWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYT  97

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LL DCYR+  P TG RNYTYMD V+S LGGVKV LCGL QY  L GI+IGYTI +SIS
Sbjct  98   SSLLTDCYRTGDPDTGKRNYTYMDAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSIS  157

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH++G    C + S P+M+IF   +++LSQIP+F +L WLSIVAAVMSF Y
Sbjct  158  MMAIKRSNCFHQSGGQNPCHISSNPYMIIFGITEILLSQIPDFDQLWWLSIVAAVMSFTY  217

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL I KVA +G    S     +    VT  +KIWR FQA+G IAFAY+YS +LIE
Sbjct  218  STIGLGLGIGKVAANGTFKGS--LTGISIGTVTETEKIWRSFQALGAIAFAYSYSVILIE  275

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E+  MKKA+ I +  TT FY++CGC+GYAAFG+ APGN LTGFGFY P+W
Sbjct  276  IQDTIKSPPAESKTMKKAAKISIVVTTTFYMLCGCMGYAAFGDQAPGNLLTGFGFYNPYW  335

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID+AN+ I IHL+GAYQVF
Sbjct  336  LIDIANVAIVIHLIGAYQVF  355



>ref|XP_006382883.1| amino acid permease AAP1 family protein [Populus trichocarpa]
 gb|ERP60680.1| amino acid permease AAP1 family protein [Populus trichocarpa]
Length=492

 Score =   426 bits (1095),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 252/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGTL TAS+HIITAVIGSGVLSL+WAIAQLGW AGPAV+  FSL+T++T
Sbjct  36   KCFDDDGRLKRTGTLWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYT  95

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LL DCYR+  P TG RNYTYMD V+S LGGVKV LCGL QY  L GI+IGYTI +SIS
Sbjct  96   SSLLTDCYRTGDPDTGKRNYTYMDAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSIS  155

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH++G    C + S P+M+IF   +++LSQIP+F +L WLSIVAAVMSF Y
Sbjct  156  MMAIKRSNCFHQSGGQNPCHISSNPYMIIFGITEILLSQIPDFDQLWWLSIVAAVMSFTY  215

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL I KVA +G    S     +    VT  +KIWR FQA+G IAFAY+YS +LIE
Sbjct  216  STIGLGLGIGKVAANGTFKGS--LTGISIGTVTETEKIWRSFQALGAIAFAYSYSVILIE  273

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E+  MKKA+ I +  TT FY++CGC+GYAAFG+ APGN LTGFGFY P+W
Sbjct  274  IQDTIKSPPAESKTMKKAAKISIVVTTTFYMLCGCMGYAAFGDQAPGNLLTGFGFYNPYW  333

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID+AN+ I IHL+GAYQVF
Sbjct  334  LIDIANVAIVIHLIGAYQVF  353



>ref|XP_010270272.1| PREDICTED: amino acid permease 3 [Nelumbo nucifera]
Length=483

 Score =   426 bits (1094),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 206/320 (64%), Positives = 254/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FS + ++T
Sbjct  27   KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSFVIYYT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LL DCYRS  PV+G RNYTY D VRS+LGGVKV++CG+ QY NL G++IGYTI ASIS
Sbjct  87   SSLLTDCYRSGDPVSGKRNYTYTDAVRSNLGGVKVKICGIIQYLNLFGVAIGYTIAASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH++G D  C + S P+M+IF   +++ SQIP+F ++ WLSIVAAVMSF Y
Sbjct  147  MMAIKRSNCFHESGGDNPCHISSNPYMIIFGVTEILFSQIPDFDQIWWLSIVAAVMSFTY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GL IAKVA +G    S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  207  SSIGLGLGIAKVAETGSFKGS--LTGISIGAVTETQKIWRSFQALGDIAFAYSYSIILIE  264

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E   MKKA+ + V+ TT+FY++CGC+GYAAFG+ APGN LTGFGFY PFW
Sbjct  265  IQDTIKSPPSEAKTMKKATLLSVAVTTLFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPFW  324

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I IHLVGAYQV+
Sbjct  325  LLDIANAAIVIHLVGAYQVY  344



>dbj|BAJ95327.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   426 bits (1094),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 207/335 (62%), Positives = 256/335 (76%), Gaps = 6/335 (2%)
 Frame = -1

Query  993  PMYV---EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAG  823
            PM V   E G+      DDDG  KRTGT+ TAS+HIITAVIGSGVLSL WAIAQLGW AG
Sbjct  13   PMEVAAAELGQTAGSKLDDDGRNKRTGTMWTASSHIITAVIGSGVLSLGWAIAQLGWVAG  72

Query  822  PAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANL  643
            PAV+  FSL+T+FTS+LLADCYRS    TG RNYTYMD V ++L G+KVQ+CG+ QYAN+
Sbjct  73   PAVMLLFSLVTYFTSSLLADCYRSGDQSTGKRNYTYMDAVNANLSGIKVQICGVLQYANI  132

Query  642  VGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHEL  463
            VG++IGYTI ASISM+A+K++NCFH NGH   C V S P+M+IF   Q+  SQIP+F ++
Sbjct  133  VGVAIGYTIAASISMLAIKRANCFHGNGHADPCKVSSVPYMIIFGVAQVFFSQIPDFDQI  192

Query  462  SWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIG  283
            SWLS++AA MSF YSSIG+GL I +V  +G    S     +  V      K+WR  QA G
Sbjct  193  SWLSMLAAAMSFTYSSIGLGLGIVQVIANGGMKGSLTGISIGTVTPM--QKVWRSLQAFG  250

Query  282  NIAFAYAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDA  106
            +IAFAY+YS +LIEIQDT+R+ PP E+ VMK+A+ + V+ TTVFY++CGC+GYAAFG+ A
Sbjct  251  DIAFAYSYSLILIEIQDTIRAPPPSESTVMKRATMVSVAVTTVFYMLCGCMGYAAFGDAA  310

Query  105  PGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            PGN LTGFGFYEPFWL+DVAN  I +HLVGAYQV+
Sbjct  311  PGNLLTGFGFYEPFWLLDVANAAIVVHLVGAYQVY  345



>emb|CDM85443.1| unnamed protein product [Triticum aestivum]
Length=480

 Score =   426 bits (1094),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/335 (62%), Positives = 256/335 (76%), Gaps = 6/335 (2%)
 Frame = -1

Query  993  PMYV---EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAG  823
            PM V   E G+      DDDG  KRTGT+ TAS+HIITAVIGSGVLSL WAIAQLGW AG
Sbjct  13   PMEVAAAELGQTAGSKLDDDGRNKRTGTMWTASSHIITAVIGSGVLSLGWAIAQLGWVAG  72

Query  822  PAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANL  643
            PAV+  FSL+T+FTS+LLADCYRS    TG RNYTYMD V ++L G+KVQ+CG+ QYAN+
Sbjct  73   PAVMLLFSLVTYFTSSLLADCYRSGDQSTGKRNYTYMDAVNANLSGIKVQICGVLQYANI  132

Query  642  VGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHEL  463
            VG+SIGYTI ASISM+A+K++NCFH NGH   C V S P+M+IF   Q+  SQIP+F ++
Sbjct  133  VGVSIGYTIAASISMLAIKRANCFHGNGHADPCKVSSVPYMIIFGVAQVFFSQIPDFDQI  192

Query  462  SWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIG  283
            SWLS++AA MSF YSSIG+GL I +V  +G    S     +  V      K+WR  QA G
Sbjct  193  SWLSMLAAAMSFTYSSIGLGLGIVQVIANGGIKGSLTGISIGTVTPM--QKVWRSTQAFG  250

Query  282  NIAFAYAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDA  106
            +IAFAY+YS +LIEIQDT+R+ PP E+ VMK+A+ + V+ TTVFY++CGC+GYAAFG+ A
Sbjct  251  DIAFAYSYSLILIEIQDTIRAPPPSESTVMKRATMVSVAVTTVFYMLCGCMGYAAFGDAA  310

Query  105  PGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            PGN LTGFGFYEPFWL+D+AN  I IHLVGAYQV+
Sbjct  311  PGNLLTGFGFYEPFWLLDIANAAIVIHLVGAYQVY  345



>gb|EYU20407.1| hypothetical protein MIMGU_mgv1a018639mg [Erythranthe guttata]
Length=480

 Score =   425 bits (1092),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 213/331 (64%), Positives = 260/331 (79%), Gaps = 7/331 (2%)
 Frame = -1

Query  981  EEGREILK----NFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAV  814
            E G EI K      DDDG   RTG L TASAHIITA+IGSGVLSL+W +AQLGW AG A 
Sbjct  12   ESGLEIQKAANAELDDDGKPSRTGNLWTASAHIITAIIGSGVLSLAWGVAQLGWIAGVAT  71

Query  813  LAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGI  634
            L  FS IT +TS+LLADCYRSP  +TG RNYTY DVV+++LG      C + QYANL G+
Sbjct  72   LVIFSAITLYTSSLLADCYRSP--LTGKRNYTYKDVVKNNLGQTMYVACAMVQYANLCGM  129

Query  633  SIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWL  454
             +GYTITASISM A++KS+CFH+ GH+  CSV   P+M+    +++ LSQIPNFH+LS L
Sbjct  130  VVGYTITASISMAAIQKSDCFHRRGHENSCSVSHNPYMIGMGILEIFLSQIPNFHKLSML  189

Query  453  SIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIA  274
            S+VAA+MSFAYSSIG+GL++AKV  SG+   +TLTGV VG+ ++ A+K WR F+A G+IA
Sbjct  190  SVVAAIMSFAYSSIGVGLALAKVI-SGQGERTTLTGVEVGIGLSAAEKTWRMFRAFGDIA  248

Query  273  FAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNF  94
            FAY YS +L+EIQDTL++ PPEN VMKKA+ + VSTTT FY+MCGC GYAAFGN+APGN 
Sbjct  249  FAYTYSQILVEIQDTLKATPPENQVMKKANIVAVSTTTAFYMMCGCFGYAAFGNNAPGNL  308

Query  93   LTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            LTGFGFYEPFWL+D+AN CI +HLVGAYQVF
Sbjct  309  LTGFGFYEPFWLVDLANACIVLHLVGAYQVF  339



>ref|XP_002439825.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
 gb|EES18255.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
Length=485

 Score =   425 bits (1092),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 254/321 (79%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K +DDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FS +T++T
Sbjct  24   KCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFSFVTYYT  83

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS  P TG RNYTYMD V ++L G+KVQLCG  QYAN+VG++IGYTI ASIS
Sbjct  84   SALLADCYRSGDPCTGKRNYTYMDAVNANLSGIKVQLCGFLQYANIVGVAIGYTIAASIS  143

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K++NCFH  GH   C++ S P+M+IF   ++  SQIP+F ++SWLSI+AAVMSF Y
Sbjct  144  MLAIKRANCFHVEGHGDPCNISSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSFTY  203

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL I +V  +     S     V  V     DK+WR  QA G+IAFAY+YS +LIE
Sbjct  204  STIGLGLGIVQVVANKGVQGSLTGISVGAVTPL--DKVWRSLQAFGDIAFAYSYSLILIE  261

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+R+ PP E+ VM++A+ + V+ TT+FY++CGC+GYAAFG++APGN LTGFGFYEPF
Sbjct  262  IQDTIRAPPPSESKVMRRATIVSVAVTTLFYMLCGCMGYAAFGDNAPGNLLTGFGFYEPF  321

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+DVAN  I +HLVGAYQV+
Sbjct  322  WLLDVANAAIVVHLVGAYQVY  342



>emb|CDM85442.1| unnamed protein product [Triticum aestivum]
Length=480

 Score =   424 bits (1091),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/335 (62%), Positives = 255/335 (76%), Gaps = 6/335 (2%)
 Frame = -1

Query  993  PMYV---EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAG  823
            PM V   E G       DDDG  KRTGT+ TAS+HIITAVIGSGVLSL WAIAQLGW AG
Sbjct  13   PMEVAAAELGHTAGSKLDDDGRNKRTGTMWTASSHIITAVIGSGVLSLGWAIAQLGWVAG  72

Query  822  PAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANL  643
            PAV+  FSL+T+FTS+LLADCYRS    TG RNYTYMD V ++L G+KVQ+CG+ QYAN+
Sbjct  73   PAVMLLFSLVTYFTSSLLADCYRSGDQSTGKRNYTYMDAVNANLSGIKVQICGVLQYANI  132

Query  642  VGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHEL  463
            VG+SIGYTI ASISM+A+K++NCFH NGH   C V S P+M+IF   Q+  SQIP+F ++
Sbjct  133  VGVSIGYTIAASISMLAIKRANCFHGNGHADPCKVSSVPYMIIFGVAQVFFSQIPDFDQI  192

Query  462  SWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIG  283
            SWLS++AA MSF YSSIG+GL I +V  +G    S     +  V      K+WR  QA G
Sbjct  193  SWLSMLAAAMSFTYSSIGLGLGIVQVIANGGIKGSLTGISIGTVTPM--QKVWRSTQAFG  250

Query  282  NIAFAYAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDA  106
            +IAFAY+YS +LIEIQDT+R+ PP E+ VMK+A+ + V+ TTVFY++CGC+GYAAFG+ A
Sbjct  251  DIAFAYSYSLILIEIQDTIRAPPPSESTVMKRATMVSVAVTTVFYMLCGCMGYAAFGDAA  310

Query  105  PGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            PGN LTGFGFYEPFWL+D+AN  I IHLVGAYQV+
Sbjct  311  PGNLLTGFGFYEPFWLLDIANAAIVIHLVGAYQVY  345



>dbj|BAK03421.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   424 bits (1091),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/335 (62%), Positives = 256/335 (76%), Gaps = 6/335 (2%)
 Frame = -1

Query  993  PMYV---EEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAG  823
            PM V   E G+      DDDG  KRTGT+ TAS+HIITAVIGSGVLSL WAIAQLGW AG
Sbjct  13   PMEVAAAELGQIAGSKLDDDGRNKRTGTMWTASSHIITAVIGSGVLSLGWAIAQLGWVAG  72

Query  822  PAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANL  643
            PAV+  FSL+T+FTS+LLADCYRS    TG RNYTYMD V ++L G+KVQ+CG+ QYAN+
Sbjct  73   PAVMLLFSLVTYFTSSLLADCYRSGDQSTGKRNYTYMDAVNANLSGIKVQICGVLQYANI  132

Query  642  VGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHEL  463
            VG++IGYTI ASISM+A+K++NCFH NGH   C V S P+M+IF   Q+  SQIP+F ++
Sbjct  133  VGVAIGYTIAASISMLAIKRANCFHGNGHADPCKVSSVPYMIIFGVAQVFFSQIPDFDQI  192

Query  462  SWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIG  283
            SWLS++AA MSF YSSIG+GL I +V  +G    S     +  V      K+WR  QA G
Sbjct  193  SWLSMLAAAMSFTYSSIGLGLGIVQVIANGGMKGSLTGISIGTVTPM--QKVWRSLQAFG  250

Query  282  NIAFAYAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDA  106
            +IAFAY+YS +LIEIQDT+R+ PP E+ VMK+A+ + V+ TTVFY++CGC+GYAAFG+ A
Sbjct  251  DIAFAYSYSLILIEIQDTIRAPPPSESTVMKRATMVSVAVTTVFYMLCGCMGYAAFGDAA  310

Query  105  PGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            PGN LTGFGFYEPFWL+DVAN  I +HLVGAYQV+
Sbjct  311  PGNLLTGFGFYEPFWLLDVANAAIVVHLVGAYQVY  345



>ref|XP_004962032.1| PREDICTED: amino acid permease 3-like isoform X1 [Setaria italica]
 ref|XP_004962033.1| PREDICTED: amino acid permease 3-like isoform X2 [Setaria italica]
Length=494

 Score =   425 bits (1092),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 201/321 (63%), Positives = 253/321 (79%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K +DDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGP V+  FS +T++T
Sbjct  33   KCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPTVMLLFSFVTYYT  92

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS  P TG RNYTYMD V ++L G+KVQ+CG  QYAN+VG++IGYTI ASIS
Sbjct  93   SALLADCYRSGDPCTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAIGYTIAASIS  152

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+KK+NCFH  GH   CS+ S P+M+IF   ++  SQIP+F ++SWLSI+AAVMSF Y
Sbjct  153  MLAIKKANCFHVEGHGDPCSISSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSFTY  212

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL I +V  +     S     +  V     DK+WR  QA G+IAFAY+YS +LIE
Sbjct  213  STIGLGLGIVQVVANKGVQGSLTGISIGAVTPI--DKVWRSLQAFGDIAFAYSYSLILIE  270

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+R+ PP E+ VM++A+ + V+ TT+FY++CGC+GYAAFG++APGN LTGFGFYEPF
Sbjct  271  IQDTIRAPPPSESKVMRRATVVSVAVTTLFYMLCGCMGYAAFGDNAPGNLLTGFGFYEPF  330

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+DVAN  I +HLVGAYQV+
Sbjct  331  WLLDVANAAIVVHLVGAYQVY  351



>ref|XP_010691537.1| PREDICTED: amino acid permease 6-like [Beta vulgaris subsp. vulgaris]
Length=511

 Score =   424 bits (1091),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 227/388 (59%), Positives = 284/388 (73%), Gaps = 23/388 (6%)
 Frame = -1

Query  1143  LLVFLNSPPLTSPKKILFFSCFAPL*VCFPLPLTIHTR-KHPRLLMAV------SQNPMY  985
             +++  N   LT PKK +F    +            HT  K P  +  V        N M 
Sbjct  1     MILIFNQKKLTHPKKPIFNQKNS------------HTHPKKPNQVFLVFYIDINHHNKMD  48

Query  984   VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
             VE G   + + DDDG  KRTG ++TASAHIITAVIGSGVLSL+WA+AQ+GW AGP VL  
Sbjct  49    VEHGNNTI-DVDDDGRNKRTGNVLTASAHIITAVIGSGVLSLAWAVAQMGWIAGPVVLLI  107

Query  804   FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
             FS +T+F S L ADCYR+P  VTG R+YTY + VRS LGG K +LC L+QY+N VG+SIG
Sbjct  108   FSFVTWFASTLQADCYRNP--VTGKRHYTYREAVRSILGGRKYKLCALAQYSNFVGVSIG  165

Query  624   YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
             YTITASISM AVK++ CFH +GH+  C   + P+++IF  +Q++LSQ+PNFH+LSWLSIV
Sbjct  166   YTITASISMAAVKRAICFHYHGHEAGCHTQNNPYIIIFGVLQIILSQLPNFHKLSWLSIV  225

Query  444   AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
             +A MSF YS IGIGL++AKVA +G    ++LTGV VG DVTG+ K W    A+GN+AFAY
Sbjct  226   SAAMSFGYSFIGIGLAVAKVA-TGSKPRTSLTGVEVGRDVTGSQKTWNIMTAMGNMAFAY  284

Query  264   AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
             A+S VLIEIQDTL+ +PPEN+VMKKA + GV  TT FY++CG +GYAAFGNDAPGNFLTG
Sbjct  285   AFSMVLIEIQDTLKPNPPENVVMKKAISFGVWITTFFYMLCGVVGYAAFGNDAPGNFLTG  344

Query  84    FGFYEPFWLIDVANICIAIHLVGAYQVF  1
             FGFYEP+WL+ +AN+ IA+HLVGAYQVF
Sbjct  345   FGFYEPYWLVALANVFIAVHLVGAYQVF  372



>ref|XP_011031113.1| PREDICTED: amino acid permease 4-like isoform X1 [Populus euphratica]
Length=494

 Score =   424 bits (1089),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 206/320 (64%), Positives = 251/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K +DDDG  KRTGTL TAS+HIITAVIGSGVLSL+WAIAQLGW AGPAV+  FSL+T++T
Sbjct  38   KCYDDDGRLKRTGTLWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYT  97

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LL DCYR+  P TG RNYTYMD V+S LGGVKV LCGL QY  L GI+IGYTI +SIS
Sbjct  98   SSLLTDCYRTGDPYTGERNYTYMDAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSIS  157

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH++G    C + S P+M++F   +++LSQIP+F +L WLSIVAAVMSF Y
Sbjct  158  MMAIKRSNCFHQSGGQNPCHISSNPYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTY  217

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GL I KVA +G    S     +    VT  +KIWR FQA+G IAFAY+YS +LIE
Sbjct  218  SSIGLGLGIGKVAVNGTFKGS--LTGISIGTVTETEKIWRSFQALGAIAFAYSYSVILIE  275

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E+  MKKA+ I +  TT FY++CGC+GYAAFG  APGN LTGFGFY P+W
Sbjct  276  IQDTIKSPPAESKTMKKAAKISIVVTTTFYMLCGCMGYAAFGEQAPGNLLTGFGFYNPYW  335

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID+AN+ I IHL+GAYQVF
Sbjct  336  LIDIANVAIVIHLIGAYQVF  355



>ref|XP_009801366.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=481

 Score =   423 bits (1088),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 254/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTG++ TASAHIITAVIGSGVLSL+WA+AQLGW AGP V+  FS +T++T
Sbjct  26   KCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAVAQLGWIAGPIVMILFSFVTYYT  85

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS   V+G RNYTYMD V+++LGG++V++CG  QYANL G++IGYTI +SIS
Sbjct  86   SALLADCYRSGDSVSGKRNYTYMDAVQANLGGLQVKICGWIQYANLFGVAIGYTIASSIS  145

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFHK+G    C V S P+M++F  I+++ SQIP+F ++ WLSIVAAVMSF Y
Sbjct  146  MIAIKRSNCFHKHGDQAPCQVSSTPYMIMFGIIEIIFSQIPDFDQIWWLSIVAAVMSFTY  205

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL +AKVA +G+   S     +  V      KIW+ FQA+G IAFAY+YS +LIE
Sbjct  206  STIGLGLGVAKVAETGKIGGSLTGISIGTVTEM--QKIWKSFQALGAIAFAYSYSLILIE  263

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P E+  MK A+ I V+ TTVFY++CGC GYAAFG+ APGN LTGFGFY P+W
Sbjct  264  IQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGCFGYAAFGDLAPGNLLTGFGFYNPYW  323

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+ANI I +HLVGAYQV+
Sbjct  324  LLDIANIAIVVHLVGAYQVY  343



>ref|XP_009388107.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=471

 Score =   423 bits (1087),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 204/321 (64%), Positives = 249/321 (78%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGTL TASAHIITAVIGSGVLSL+WAI QLGW AGP  +  FS +T++T
Sbjct  15   KCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPIAMLLFSFVTYYT  74

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS  P TG RNYTYMD VR++L G KV+LCG  QY N+VG++IGYTI ASIS
Sbjct  75   SALLADCYRSGDPNTGKRNYTYMDTVRANLDGFKVKLCGYLQYLNIVGVAIGYTIAASIS  134

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            MVA+++SNCFHKNG D  C V S P+M++F   +++ SQIP+F ++ WLSIVAAVMSF Y
Sbjct  135  MVAIERSNCFHKNGDDSPCQVNSNPYMIMFGVAEIIFSQIPDFDQIWWLSIVAAVMSFTY  194

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+ L I +V  +G    S     +  V     DKIWR  QA G+IAFAY+YS +LIE
Sbjct  195  SSIGLSLGIVQVIKNGGVRGSLTGISIGTVSEM--DKIWRSLQAFGDIAFAYSYSIILIE  252

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+R+ PP E  VMK+A+ I V+ TTVFY++CGC+GYAAFG+ APGN LTGFGFY P+
Sbjct  253  IQDTIRAPPPSEAKVMKRATLISVAVTTVFYMLCGCMGYAAFGDMAPGNLLTGFGFYNPY  312

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+D+AN+ I +HLVGAYQV+
Sbjct  313  WLLDIANVAIVVHLVGAYQVY  333



>ref|XP_009609434.1| PREDICTED: amino acid permease 3-like [Nicotiana tomentosiformis]
Length=482

 Score =   423 bits (1087),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 254/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTG++ TASAHIITAVIGSGVLSL+WA+AQLGW AGP V+  FS +T++T
Sbjct  26   KCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAVAQLGWIAGPIVMILFSFVTYYT  85

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS   V+G RNYTYMD V+++LGG++V++CG  QYANL G++IGYTI +SIS
Sbjct  86   SALLADCYRSGDSVSGKRNYTYMDAVQANLGGLQVKICGWIQYANLFGVAIGYTIASSIS  145

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFHK+G    C V S P+M++F  ++++ SQIP+F ++ WLSIVAAVMSF Y
Sbjct  146  MIAIKRSNCFHKHGDQAPCQVSSTPYMIMFGIVEIIFSQIPDFDQIWWLSIVAAVMSFTY  205

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL +AKVA +G+   S     +  V      KIW+ FQA+G IAFAY+YS +LIE
Sbjct  206  STIGLGLGVAKVAETGKIGGSLTGISIGTVSEM--QKIWKSFQALGAIAFAYSYSLILIE  263

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P E+  MK A+ I V+ TTVFY++CGC GYAAFG+ APGN LTGFGFY P+W
Sbjct  264  IQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGCFGYAAFGDLAPGNLLTGFGFYNPYW  323

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+ANI I +HLVGAYQV+
Sbjct  324  LLDIANIAIVVHLVGAYQVY  343



>ref|XP_009411898.1| PREDICTED: amino acid permease 3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   422 bits (1086),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/321 (64%), Positives = 250/321 (78%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAI QLGW AGPAV+  FS +T++T
Sbjct  15   KCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVMILFSFVTYYT  74

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS  PV G RNYTYMD VR++L G KV+LCG  QY N+VG++IGYTI ASIS
Sbjct  75   SALLADCYRSGDPVAGKRNYTYMDAVRANLNGFKVELCGYLQYLNIVGVAIGYTIAASIS  134

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            MVA+K+SNCFH+NG D  C V S P++++F   ++V SQIP+F ++ WLSIVAAVMSF Y
Sbjct  135  MVAIKRSNCFHENGDDSPCQVNSNPYIIMFGVAEIVFSQIPDFDQIWWLSIVAAVMSFTY  194

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+ L I +V  +G    S     +  V     +K+WR  QA G+IAFAY+YS +LIE
Sbjct  195  SSIGLALGIVQVIKNGGMRGSLTGISIGTVSQM--EKVWRSLQAFGDIAFAYSYSIILIE  252

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+R+ PP E  VMKKA+ I V+ TT FY++CGC+GYAAFG+ APGN LTGFGFY P+
Sbjct  253  IQDTIRAPPPSEAKVMKKATLISVAVTTTFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPY  312

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+D+AN+ I IHLVGAYQV+
Sbjct  313  WLLDIANVAIVIHLVGAYQVY  333



>ref|XP_006656161.1| PREDICTED: amino acid permease 1-like [Oryza brachyantha]
Length=468

 Score =   422 bits (1085),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/319 (66%), Positives = 254/319 (80%), Gaps = 1/319 (0%)
 Frame = -1

Query  957  NFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTS  778
            + DDDG E+RTGT+ TASAHIITAVIGSGVL L+WA AQLGW  GP  L  F+LIT++TS
Sbjct  11   DVDDDGKERRTGTVWTASAHIITAVIGSGVLPLAWATAQLGWGVGPVTLMLFALITYYTS  70

Query  777  ALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISM  598
             LLADCYR+  P TG RNYTYMD V S+LGG +V  CG+ QY NLVG +IGYTITASIS 
Sbjct  71   GLLADCYRTGDPATGKRNYTYMDAVGSYLGGWQVWSCGIFQYVNLVGTAIGYTITASISA  130

Query  597  VAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYS  418
             AV K+NCFH  GH+ DC V    +M++F  +Q+  SQ+PNF +LSWLSI+AAVMSF+YS
Sbjct  131  AAVHKANCFHNRGHEADCGVYDTMYMVVFGIVQIFFSQLPNFSDLSWLSILAAVMSFSYS  190

Query  417  SIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEI  238
            +I +GLS+A+   SG    +TLTGV VGVDVT A KIW  FQA+G+IAFAY+YS +L EI
Sbjct  191  TIAVGLSLARTI-SGPTGKATLTGVEVGVDVTSAQKIWLAFQALGDIAFAYSYSMILTEI  249

Query  237  QDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWL  58
            QDT++S P EN  MK+A+ +GVSTTT FY++CGC+GYAAFGN APGN LTGFGFYEP+WL
Sbjct  250  QDTVKSPPAENKTMKRATLLGVSTTTAFYMLCGCLGYAAFGNAAPGNMLTGFGFYEPYWL  309

Query  57   IDVANICIAIHLVGAYQVF  1
            ID AN+CI IHLVGAYQVF
Sbjct  310  IDFANVCIVIHLVGAYQVF  328



>ref|XP_007048506.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007048507.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92663.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92664.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=485

 Score =   422 bits (1086),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/318 (65%), Positives = 250/318 (79%), Gaps = 2/318 (1%)
 Frame = -1

Query  954  FDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSA  775
            FDDDG  KRTGTL TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FSL+T +TS+
Sbjct  31   FDDDGRIKRTGTLWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTCYTSS  90

Query  774  LLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMV  595
            LL DCYR+  PV+G RNYTYMD VRS LGG KV+ CGL QY NL GIS+GYTI AS+SM+
Sbjct  91   LLTDCYRTGDPVSGKRNYTYMDAVRSILGGYKVKACGLIQYLNLCGISVGYTIAASVSMM  150

Query  594  AVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSS  415
            A+K+SNCFH++G    C + S P+M++F   +++LSQIP+F ++ WLSIVAAVMSF YS 
Sbjct  151  AIKRSNCFHESGGKNPCHMSSTPYMIMFGVTEILLSQIPDFDQIWWLSIVAAVMSFTYSG  210

Query  414  IGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQ  235
            IG+GL IAKVA +G    S     +     T A KIWR FQA+G+IAFAY+YS VLIEIQ
Sbjct  211  IGLGLGIAKVAATGTFKGS--LTGISVGTETQAQKIWRSFQALGDIAFAYSYSIVLIEIQ  268

Query  234  DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLI  55
            DT++S P E   MKKA+ + ++ TT FY++CGC+GYA+FG+ APGN LTGFGFY PFWL+
Sbjct  269  DTVKSPPAEAKTMKKATKLSIAITTAFYMLCGCMGYASFGDFAPGNLLTGFGFYNPFWLL  328

Query  54   DVANICIAIHLVGAYQVF  1
            DVAN  I IHLVGAYQVF
Sbjct  329  DVANAAIVIHLVGAYQVF  346



>ref|XP_009411897.1| PREDICTED: amino acid permease 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=478

 Score =   422 bits (1084),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 204/321 (64%), Positives = 250/321 (78%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAI QLGW AGPAV+  FS +T++T
Sbjct  22   KCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVMILFSFVTYYT  81

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS  PV G RNYTYMD VR++L G KV+LCG  QY N+VG++IGYTI ASIS
Sbjct  82   SALLADCYRSGDPVAGKRNYTYMDAVRANLNGFKVELCGYLQYLNIVGVAIGYTIAASIS  141

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            MVA+K+SNCFH+NG D  C V S P++++F   ++V SQIP+F ++ WLSIVAAVMSF Y
Sbjct  142  MVAIKRSNCFHENGDDSPCQVNSNPYIIMFGVAEIVFSQIPDFDQIWWLSIVAAVMSFTY  201

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+ L I +V  +G    S     +  V     +K+WR  QA G+IAFAY+YS +LIE
Sbjct  202  SSIGLALGIVQVIKNGGMRGSLTGISIGTVSQM--EKVWRSLQAFGDIAFAYSYSIILIE  259

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+R+ PP E  VMKKA+ I V+ TT FY++CGC+GYAAFG+ APGN LTGFGFY P+
Sbjct  260  IQDTIRAPPPSEAKVMKKATLISVAVTTTFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPY  319

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+D+AN+ I IHLVGAYQV+
Sbjct  320  WLLDIANVAIVIHLVGAYQVY  340



>ref|XP_002520323.1| amino acid transporter, putative [Ricinus communis]
 emb|CAA07563.1| amino acid carrier [Ricinus communis]
 gb|EEF42109.1| amino acid transporter, putative [Ricinus communis]
Length=486

 Score =   422 bits (1085),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/344 (61%), Positives = 267/344 (78%), Gaps = 4/344 (1%)
 Frame = -1

Query  1032  RKHPRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSW  853
             + HP  +  VS N      G + L   DDDG  KRTGT+ TASAHIITAVIGSGVLSL+W
Sbjct  8     KNHPHQVFDVSINMQTQVVGSKWL---DDDGRTKRTGTVWTASAHIITAVIGSGVLSLAW  64

Query  852   AIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQ  673
             AIAQLGW AGPAV+  FSL+T++TS LL+ CYRS  PV G RNYTYMD VR++LGG KV+
Sbjct  65    AIAQLGWIAGPAVMFLFSLVTYYTSTLLSACYRSGDPVNGKRNYTYMDAVRTNLGGAKVK  124

Query  672   LCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLV  493
             LCG  QY NL G++IGYTI +SISM+A+K+SNCFHK+G    C + + P+M+ F   +++
Sbjct  125   LCGFVQYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNPCHINANPYMIAFGIAEII  184

Query  492   LSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGAD  313
              SQIP+F +L WLSI+AAVMSF YS+IG+GL IA+V  +G+A  S +TG+ +G +VT   
Sbjct  185   FSQIPDFDQLWWLSILAAVMSFTYSTIGLGLGIAQVVENGKAMGS-VTGISIGANVTPTQ  243

Query  312   KIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCI  133
             KIWR FQA+G+IAFAY+YS +LIEIQDT+RS P E+  MKKA+ I V+ TT+FY++CGC 
Sbjct  244   KIWRSFQALGDIAFAYSYSIILIEIQDTVRSPPSESKTMKKATLISVAVTTLFYMLCGCF  303

Query  132   GYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GYAAFG+ +PGN LTGFGFY P+WL+D+AN+ I +HLVGAYQV+
Sbjct  304   GYAAFGDMSPGNLLTGFGFYNPYWLLDIANVAIVVHLVGAYQVY  347



>ref|XP_002458869.1| hypothetical protein SORBIDRAFT_03g041840 [Sorghum bicolor]
 gb|EES03989.1| hypothetical protein SORBIDRAFT_03g041840 [Sorghum bicolor]
Length=491

 Score =   422 bits (1085),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/321 (62%), Positives = 251/321 (78%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KR GT+ TAS+HIITAVIGSGVLSL WAIAQLGW AGPA +  FSL+T++T
Sbjct  33   KCFDDDGRPKRNGTMWTASSHIITAVIGSGVLSLGWAIAQLGWVAGPAAMLLFSLVTYYT  92

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LLADCYRS  P TG RNYTYMD V ++L G+KVQ+CG  QYAN+VG++IGYTI ASIS
Sbjct  93   SSLLADCYRSGDPSTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAIGYTIAASIS  152

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A++++NCFH+ GH   C V S P+M+IF   ++  SQIP+F ++SWLSI+AAVMSF Y
Sbjct  153  MLAIRRANCFHQKGHGNPCKVSSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSFTY  212

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GL I +V  +     S     +  V     DK+WR  QA G+IAFAY+YS +LIE
Sbjct  213  SSIGLGLGIVQVIANRGVQGSLTGISIGVVTPM--DKVWRSLQAFGDIAFAYSYSLILIE  270

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+R+ PP E+ VMK+A+ + V+ TT+FY++CGC+GYAAFG+ APGN LTGFGFYEPF
Sbjct  271  IQDTIRAPPPSESTVMKRATVVSVAVTTLFYMLCGCMGYAAFGDGAPGNLLTGFGFYEPF  330

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+DVAN  I +HLVGAYQV+
Sbjct  331  WLLDVANAAIVVHLVGAYQVY  351



>gb|AII99817.1| amino acid transporter [Nicotiana tabacum]
Length=479

 Score =   421 bits (1083),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 255/320 (80%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KR+G++ TASAHIITAVIGSGVLSL+WA AQLGW AGP VL  FS +T++T
Sbjct  23   KCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPTVLLLFSFVTYYT  82

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS   V+G RNYTYMD VR++LGG++V++CG+ QY NL G+++GYTI +SIS
Sbjct  83   SALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQYVNLFGVAVGYTIASSIS  142

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+AVK+S+CFHK+GH   C+V S P+M++F  I+++ SQIP+F ++ WLSIVAAVMSF Y
Sbjct  143  MMAVKRSDCFHKHGHRAACNVSSTPYMIMFGIIEIIFSQIPDFDQIWWLSIVAAVMSFTY  202

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL +AKVA +G+   S     +  V      KIW+ FQA+G IAFAY+YS +LIE
Sbjct  203  STIGLGLGVAKVAETGKIGGSLTGISIGTVTEM--QKIWKSFQALGAIAFAYSYSLILIE  260

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P E+  MK A+ I V+ TTVFY++CGC GYAAFG+ APGN LTGFGFY P+W
Sbjct  261  IQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGCFGYAAFGDLAPGNLLTGFGFYNPYW  320

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+ANI I +HLVGAYQV+
Sbjct  321  LLDIANIAIVVHLVGAYQVY  340



>ref|XP_002437146.1| hypothetical protein SORBIDRAFT_10g021980 [Sorghum bicolor]
 gb|EER88513.1| hypothetical protein SORBIDRAFT_10g021980 [Sorghum bicolor]
Length=491

 Score =   422 bits (1084),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/331 (63%), Positives = 257/331 (78%), Gaps = 1/331 (0%)
 Frame = -1

Query  993  PMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAV  814
            P    +G    +  DDDG +KRTGT+ TASAHIITAVIGSGVLSL+W+ AQLGW  GP  
Sbjct  26   PQQPRDGGAGGQELDDDGRKKRTGTVWTASAHIITAVIGSGVLSLAWSTAQLGWVVGPLT  85

Query  813  LAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGI  634
            L  F+LIT++TS+LL+DCYRS   +TG RNYTYMD V ++LG  +V  CG+ QY NLVG 
Sbjct  86   LMIFALITYYTSSLLSDCYRSGDQLTGKRNYTYMDAVAAYLGRWQVLSCGVFQYVNLVGT  145

Query  633  SIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWL  454
            ++GYTITASIS  AV K+NCFHK GHD DCS     +M++F  +Q+  SQ+PNF +LSWL
Sbjct  146  AVGYTITASISAAAVHKANCFHKKGHDADCSTYDTMYMVVFGIVQIFFSQLPNFSDLSWL  205

Query  453  SIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIA  274
            SIVAA+MSF+YS+I +GLS+A+   SGR   STLTG  +GVDV  A K+W   QA+GNIA
Sbjct  206  SIVAAIMSFSYSTIAVGLSLARTI-SGRTGKSTLTGTEIGVDVDSAQKVWLALQALGNIA  264

Query  273  FAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNF  94
            FAY+YS +LIEIQDT++S P EN  MKKA+ +GV+TTT FY++ GC+GY+AFGN APGN 
Sbjct  265  FAYSYSMILIEIQDTVKSPPAENKTMKKATLMGVTTTTAFYMLAGCLGYSAFGNAAPGNI  324

Query  93   LTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            LTGFGFYEP+WLID AN+CI +HLVGAYQVF
Sbjct  325  LTGFGFYEPYWLIDFANVCIVVHLVGAYQVF  355



>ref|XP_009767545.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=480

 Score =   421 bits (1083),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 255/320 (80%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KR+G++ TASAHIITAVIGSGVLSL+WA AQLGW AGPAVL  FS +T++T
Sbjct  23   KCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPAVLLLFSFVTYYT  82

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS   V+G RNYTYMD VR++LGG++V++CG+ QY NL G+++GYTI +SIS
Sbjct  83   SALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQYVNLFGVAVGYTIASSIS  142

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+AVK+S+CFHK+GH   C+V S P+M++F  ++++ SQIP+F ++ WLSIVAAVMSF Y
Sbjct  143  MMAVKRSDCFHKHGHRAACNVSSTPYMIMFGVMEILFSQIPDFDQIWWLSIVAAVMSFTY  202

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL +A+VA +G+   S     +         KIWR FQA+G IAFAY+YS +LIE
Sbjct  203  STIGLGLGVAQVAETGKIQGSLTGISIGTEVTEM-QKIWRSFQALGAIAFAYSYSLILIE  261

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL++ P E   MKKA+ + V+ TTVFY++CGC GYAAFG+ +PGN LTGFGFY P+W
Sbjct  262  IQDTLKAPPSEAKTMKKATLLSVAVTTVFYMLCGCFGYAAFGDQSPGNLLTGFGFYNPYW  321

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN+ I +HLVGAYQV+
Sbjct  322  LLDIANVAIVVHLVGAYQVY  341



>ref|XP_009381189.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=471

 Score =   421 bits (1081),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 208/320 (65%), Positives = 256/320 (80%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            +  DDDG  +RTGT+ TAS+HI+TAVIGSGVLSL+WA+AQLGW AGP  LA F+LIT +T
Sbjct  14   EELDDDGRPRRTGTVWTASSHIVTAVIGSGVLSLAWAMAQLGWIAGPLALALFALITVYT  73

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LLADCYR+  P++G RN TYM  V+S+LGG K+ LCGL QY NL G+SIGYTITA +S
Sbjct  74   SSLLADCYRTDDPISGMRNVTYMRAVKSNLGGNKIWLCGLCQYVNLFGVSIGYTITAGLS  133

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
              AV KSNCFHK G +  CS+ +  FM+ +  IQ+ LSQ+PNFH+L WLSIVAAVMSFAY
Sbjct  134  AAAVSKSNCFHKKGQEAACSISTNVFMVGYGIIQIFLSQLPNFHKLWWLSIVAAVMSFAY  193

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S I +GLS A++  SG    +++TG +VGVDV+ + K+W  FQA+G+IAF+Y+YS +LIE
Sbjct  194  SFIAVGLSAARII-SGNTRKTSITGTIVGVDVSASQKVWSTFQALGDIAFSYSYSMILIE  252

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTLRS P EN  MKKAS IGV TTT FY++CGC+GY+AFGN APGN LTGFGFYEP+W
Sbjct  253  IQDTLRSPPAENKEMKKASLIGVVTTTTFYMLCGCLGYSAFGNQAPGNILTGFGFYEPYW  312

Query  60   LIDVANICIAIHLVGAYQVF  1
            LIDV N+CI  HLVGAYQV+
Sbjct  313  LIDVGNVCIVAHLVGAYQVY  332



>ref|XP_010095435.1| hypothetical protein L484_013392 [Morus notabilis]
 gb|EXB60127.1| hypothetical protein L484_013392 [Morus notabilis]
Length=482

 Score =   421 bits (1082),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 255/321 (79%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WA AQLGW AGPAV+  FS +T++T
Sbjct  25   KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPAVMFLFSFVTYYT  84

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LL+ CYR+  PVTG RNYTYMD VRS+LGG++V++CGL QY NL G++IGYTI ++IS
Sbjct  85   STLLSACYRTGDPVTGKRNYTYMDAVRSNLGGLRVRICGLFQYLNLFGVAIGYTIASAIS  144

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFHK+G    C + S P+M+ F   +++ SQIPNF +L WLS+VAAVMSF Y
Sbjct  145  MMAIKRSNCFHKSGRKDPCHMSSNPYMIAFGVTEIIFSQIPNFDQLWWLSLVAAVMSFTY  204

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IA+VA +G+ A S     +    VT  +KIWR FQA+G+IAFAY+YS +LIE
Sbjct  205  STIGLGLGIAQVAANGKVAGS--LTGISIGTVTQTEKIWRSFQALGDIAFAYSYSIILIE  262

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT++  PP E   MKKA+ I VS TT+FY++CGC+GYAAFG+ +PGN LTGFGFY P+
Sbjct  263  IQDTIKCPPPSEAKTMKKATLISVSVTTLFYMLCGCMGYAAFGDMSPGNLLTGFGFYNPY  322

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+D+AN  I IHLVGAYQV+
Sbjct  323  WLLDIANAAIVIHLVGAYQVY  343



>emb|CDY21569.1| BnaC09g47230D [Brassica napus]
Length=485

 Score =   421 bits (1083),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 206/346 (60%), Positives = 259/346 (75%), Gaps = 10/346 (3%)
 Frame = -1

Query  1038  HTRKHPRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSL  859
             H + H    MAV Q P +        K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL
Sbjct  10    HHQHHQVFDMAVPQQPAF--------KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSL  61

Query  858   SWAIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVK  679
             +WAIAQLGW AGPAV+  FSL+T ++S LL+DCYR+   V+G RNYTYMD VRS LGG K
Sbjct  62    AWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGFK  121

Query  678   VQLCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQ  499
              ++CGL QY NL G++IGYTI ASISM+A+K+SNCFHK+G    C + S P+M+IF   +
Sbjct  122   FKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVTE  181

Query  498   LVLSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtG  319
             ++LSQ+P+F ++ W+SIVAAVMSF YS+IG+ L I +VA +G    S     +    VT 
Sbjct  182   ILLSQVPDFDQIWWISIVAAVMSFTYSAIGLSLGIVQVAANGVFKGS--LTGISIGAVTQ  239

Query  318   ADKIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCG  139
               KIWR FQA+G+IAFAY+YS VLIEIQDT+RS P E+  MKKA+ + ++ TT+FY++CG
Sbjct  240   TQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESKTMKKATKLSIAITTIFYMLCG  299

Query  138   CIGYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
              +GYAAFG+ APGN LTGFGFY PFWL+D+AN  I +HL+GAYQVF
Sbjct  300   SMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLIGAYQVF  345



>ref|NP_001142349.1| hypothetical protein [Zea mays]
 ref|XP_008672537.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672538.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672539.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF88256.1| unknown [Zea mays]
 tpg|DAA56510.1| TPA: hypothetical protein ZEAMMB73_220445 [Zea mays]
Length=494

 Score =   421 bits (1083),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 198/321 (62%), Positives = 251/321 (78%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KR GT+ TASAHIITAVIGSGVLSL WAIAQLGW AGP V+  FSL+T++T
Sbjct  34   KCFDDDGRPKRNGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPVVMLLFSLVTYYT  93

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LLADCYRS  P TG RNYTYMD V ++L G+KVQ+CG  QYAN+VG++IGYTI ASIS
Sbjct  94   SSLLADCYRSGDPSTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAIGYTIAASIS  153

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A++++NCFH+ GH   C + S P+M+IF   ++  SQIP+F ++SWLSI+AAVMSF Y
Sbjct  154  MLAIRRANCFHQKGHGNPCKISSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSFTY  213

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GL + +V  +     S     +  V     DK+WR  QA G++AFAY+YS +LIE
Sbjct  214  SSIGLGLGVVQVIANRGVQGSLTGITIGVVTPM--DKVWRSLQAFGDVAFAYSYSLILIE  271

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+R+ PP E+ VMK+A+ + V+ TT+FY++CGC+GYAAFG+ APGN LTGFGFYEPF
Sbjct  272  IQDTIRAPPPSESTVMKRATVVSVAVTTLFYMLCGCMGYAAFGDGAPGNLLTGFGFYEPF  331

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+DVAN  I +HLVGAYQV+
Sbjct  332  WLLDVANAAIVVHLVGAYQVY  352



>ref|XP_008654977.1| PREDICTED: amino acid carrier isoform X1 [Zea mays]
 gb|AFW81885.1| amino acid carrier [Zea mays]
Length=478

 Score =   421 bits (1081),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 253/321 (79%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGP V+  FS +T++T
Sbjct  17   KCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPTVMLLFSFVTYYT  76

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS    TG RNYTYMD V ++L GVKV  CG  QYAN+VG++IGYTI ASIS
Sbjct  77   SALLADCYRSGDACTGKRNYTYMDAVNANLSGVKVWFCGFLQYANIVGVAIGYTIAASIS  136

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A++++NCFH  GH   C++ S P+M+IF  +Q+  SQIP+F ++SWLSI+AAVMSF Y
Sbjct  137  MLAIQRANCFHVEGHGDPCNISSTPYMIIFGVVQIFFSQIPDFDQISWLSILAAVMSFTY  196

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IA+V  +     S     +    VT  DK+WR  QA G+IAFAY+YS +LIE
Sbjct  197  STIGLGLGIAQVVSNKGVQGS--LTGISVGLVTPVDKMWRSLQAFGDIAFAYSYSLILIE  254

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+R+ PP E+ VM++A+ + V+ TT FY++CGC+GYAAFG++APGN LTGFGFYEPF
Sbjct  255  IQDTIRAPPPSESKVMRRATVVSVAVTTFFYMLCGCMGYAAFGDNAPGNLLTGFGFYEPF  314

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+DVAN  IA+HLVGAYQV+
Sbjct  315  WLLDVANAAIAVHLVGAYQVY  335



>ref|XP_006380397.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
 gb|ERP58194.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
Length=492

 Score =   421 bits (1082),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 250/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGTL TASAHIITAVIGSGVLSL+WA+AQLGW AGPAV+  FSL+T++T
Sbjct  36   KCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYT  95

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LL DCYR+  P TG RNYTYMD V S LGGVKV+LCG  QY  L GI+IGYTI +SIS
Sbjct  96   SSLLTDCYRTGDPDTGKRNYTYMDAVESILGGVKVKLCGFIQYLGLFGIAIGYTIASSIS  155

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH++G    C + S P+M++F   +++LSQIP+F +L WLSIVAAVMSF Y
Sbjct  156  MMAIKRSNCFHQSGGQNPCHLSSNPYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTY  215

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GL I KVA +G    S     +    VT  +KIWR FQA+G IAFAY+YS +LIE
Sbjct  216  SSIGLGLGIGKVAVNGTFKGS--LTGISIGTVTETEKIWRSFQALGAIAFAYSYSVILIE  273

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E+  MKKA+ I +  TT FY++CGC+GYAAFG+ APGN LTGFGFY P+W
Sbjct  274  IQDTVKSPPAESKTMKKAARISIVVTTTFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYW  333

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID+AN  I IHLVGAYQVF
Sbjct  334  LIDIANAAIVIHLVGAYQVF  353



>ref|XP_009377726.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009343981.1| PREDICTED: amino acid permease 3 [Pyrus x bretschneideri]
Length=484

 Score =   421 bits (1081),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 207/331 (63%), Positives = 254/331 (77%), Gaps = 5/331 (2%)
 Frame = -1

Query  993  PMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAV  814
            PM  E G    K +DDDG  KRTGT+ TASAHIITAVIGSGVLSL+WA+AQLGW AGPAV
Sbjct  20   PMPPEVGS---KCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAVAQLGWVAGPAV  76

Query  813  LAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGI  634
            +  FS +T++TS LL+ CYRS  PVTG RNYTY + VRS+LGG KV++CG  QY NL G+
Sbjct  77   MLLFSFVTYYTSTLLSACYRSGDPVTGKRNYTYTNAVRSNLGGFKVKICGFVQYLNLFGV  136

Query  633  SIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWL  454
            +IGYTI +SISMVA+K+SNCF+KNG    C V S P+M+ F   +++ SQIP+F +L WL
Sbjct  137  AIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGVAEIIFSQIPDFDQLWWL  196

Query  453  SIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIA  274
            SIVAAVMSF YSSIG+GL IAKV  +G    S     +    VT   KIWR FQA+G+IA
Sbjct  197  SIVAAVMSFTYSSIGLGLGIAKVVETGTIKGS--MTGIDIGAVTETQKIWRSFQALGDIA  254

Query  273  FAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNF  94
            FAY+YS +LIEIQDT++S P E   MKKA+ + V+TTT+FY++CGC+GYAAFG+ +PGN 
Sbjct  255  FAYSYSLILIEIQDTVKSPPSEAKTMKKATLVSVATTTLFYMLCGCMGYAAFGDSSPGNL  314

Query  93   LTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            LTGFGF+ P+WLID+AN  I IHLVGAYQVF
Sbjct  315  LTGFGFFNPYWLIDIANAAIVIHLVGAYQVF  345



>ref|XP_010546306.1| PREDICTED: amino acid permease 4 isoform X1 [Tarenaya hassleriana]
Length=472

 Score =   420 bits (1079),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 207/332 (62%), Positives = 256/332 (77%), Gaps = 7/332 (2%)
 Frame = -1

Query  981  EEGREIL-----KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPA  817
            E G  +L     K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPA
Sbjct  3    ESGANVLPQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPA  62

Query  816  VLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVG  637
            V+  FS +T+++S LL+DCYR+  PV+G RNYTYMD VRS LGG K ++CGL QY NL G
Sbjct  63   VMLLFSFVTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFG  122

Query  636  ISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSW  457
            I++GYTI ASISM+A+K+SNCFHK+G    C + S P+M++F   +++LSQIP+F ++ W
Sbjct  123  IAVGYTIAASISMMAIKRSNCFHKSGGKNPCHMSSNPYMIMFGLTEILLSQIPDFDQIWW  182

Query  456  LSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNI  277
            LSIVAAVMSF YS+IG+ L I +V  +G    S     +    VT   KIWR FQA+G+I
Sbjct  183  LSIVAAVMSFTYSAIGLSLGILQVTANGFFKGS--LTGISIGTVTETQKIWRSFQALGDI  240

Query  276  AFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGN  97
            AFAY+YS VLIEIQDT+RS P E+  MKKA+ I ++ TT+FY++CGC+GYAAFG+ APGN
Sbjct  241  AFAYSYSVVLIEIQDTVRSPPAESKTMKKATRISIAVTTMFYMLCGCMGYAAFGDFAPGN  300

Query  96   FLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             LTGFG+YEPFWL+DVAN  I IHLVGAYQVF
Sbjct  301  LLTGFGYYEPFWLLDVANAAIVIHLVGAYQVF  332



>emb|CBI21586.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   417 bits (1073),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/318 (63%), Positives = 251/318 (79%), Gaps = 2/318 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FS + ++T
Sbjct  31   KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSFVIYYT  90

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LLADCYRS   V+G RNYTYMD VRS+LGGVKV++CGL QY N+ G++IGYTI ASIS
Sbjct  91   SSLLADCYRSGDRVSGKRNYTYMDAVRSNLGGVKVKVCGLIQYLNIFGVAIGYTIAASIS  150

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+AVK+SNCFH++G    C + SYP+M++F   ++  SQIP+F ++ WLSIVAAVMSF Y
Sbjct  151  MMAVKRSNCFHESGRKNPCHISSYPYMIMFGIAEIAFSQIPDFDQIWWLSIVAAVMSFTY  210

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+ L +AKV  +G    S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  211  SSIGLALGVAKVVAAGGFKGS--LTGISIGTVTQTQKIWRSFQALGDIAFAYSYSIILIE  268

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P E+  MKKA+ + ++ TT FY++CGC+GYAAFG+ APGN LTGFGFY P+W
Sbjct  269  IQDTLKSPPSESKTMKKATLVSIAVTTAFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYW  328

Query  60   LIDVANICIAIHLVGAYQ  7
            L+D+AN+ I +HLVGAYQ
Sbjct  329  LLDIANVAIVVHLVGAYQ  346



>ref|XP_010652912.1| PREDICTED: amino acid permease 3 isoform X1 [Vitis vinifera]
Length=489

 Score =   421 bits (1081),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 253/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FS + ++T
Sbjct  33   KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSFVIYYT  92

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LLADCYRS   V+G RNYTYMD VRS+LGGVKV++CGL QY N+ G++IGYTI ASIS
Sbjct  93   SSLLADCYRSGDRVSGKRNYTYMDAVRSNLGGVKVKVCGLIQYLNIFGVAIGYTIAASIS  152

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+AVK+SNCFH++G    C + SYP+M++F   ++  SQIP+F ++ WLSIVAAVMSF Y
Sbjct  153  MMAVKRSNCFHESGRKNPCHISSYPYMIMFGIAEIAFSQIPDFDQIWWLSIVAAVMSFTY  212

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+ L +AKV  +G    S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  213  SSIGLALGVAKVVAAGGFKGS--LTGISIGTVTQTQKIWRSFQALGDIAFAYSYSIILIE  270

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P E+  MKKA+ + ++ TT FY++CGC+GYAAFG+ APGN LTGFGFY P+W
Sbjct  271  IQDTLKSPPSESKTMKKATLVSIAVTTAFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYW  330

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN+ I +HLVGAYQV+
Sbjct  331  LLDIANVAIVVHLVGAYQVY  350



>ref|XP_002275881.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
 ref|XP_010652913.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
Length=487

 Score =   420 bits (1080),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 253/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FS + ++T
Sbjct  31   KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSFVIYYT  90

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LLADCYRS   V+G RNYTYMD VRS+LGGVKV++CGL QY N+ G++IGYTI ASIS
Sbjct  91   SSLLADCYRSGDRVSGKRNYTYMDAVRSNLGGVKVKVCGLIQYLNIFGVAIGYTIAASIS  150

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+AVK+SNCFH++G    C + SYP+M++F   ++  SQIP+F ++ WLSIVAAVMSF Y
Sbjct  151  MMAVKRSNCFHESGRKNPCHISSYPYMIMFGIAEIAFSQIPDFDQIWWLSIVAAVMSFTY  210

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+ L +AKV  +G    S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  211  SSIGLALGVAKVVAAGGFKGS--LTGISIGTVTQTQKIWRSFQALGDIAFAYSYSIILIE  268

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P E+  MKKA+ + ++ TT FY++CGC+GYAAFG+ APGN LTGFGFY P+W
Sbjct  269  IQDTLKSPPSESKTMKKATLVSIAVTTAFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYW  328

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN+ I +HLVGAYQV+
Sbjct  329  LLDIANVAIVVHLVGAYQVY  348



>ref|XP_006351135.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=479

 Score =   420 bits (1079),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 197/320 (62%), Positives = 253/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTG++ TASAHIITAVIGSGVLSL+WA+AQLGW AGP V+  FS +T++T
Sbjct  24   KRFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWAVAQLGWIAGPIVMLLFSFVTYYT  83

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LL+DCYRS  P++G RNYTYMD V+++LGG++V++CG  QY NL G++IGYTI +SIS
Sbjct  84   SSLLSDCYRSGDPLSGKRNYTYMDAVQANLGGLQVKICGWIQYVNLFGVAIGYTIASSIS  143

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+AVK+S+CFHK+GH   C  P+ P+M+IF  I++V SQIP+F ++ WLSIVAAVMSF Y
Sbjct  144  MMAVKRSDCFHKHGHKAPCLEPNTPYMIIFGVIEIVFSQIPDFDQIWWLSIVAAVMSFTY  203

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IA+VA + +   S     +  V      K+WR FQA+G IAFAY+YS +LIE
Sbjct  204  STIGLGLGIAQVAETRKIGGSLTGVSIGTVTEM--QKVWRTFQALGAIAFAYSYSLILIE  261

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E   MK A+ I VS TTVFY++CGC GYAAFG+ AP N LTGFGFY+P+W
Sbjct  262  IQDTIKSPPSEAKTMKNATLISVSVTTVFYMLCGCFGYAAFGDHAPDNLLTGFGFYDPYW  321

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+ANI I +HLVGAYQV+
Sbjct  322  LLDIANIAIVVHLVGAYQVY  341



>ref|XP_006434261.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
 gb|ESR47501.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
Length=480

 Score =   420 bits (1079),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/320 (64%), Positives = 251/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGTL TASAHIITAVIGSGVLSL+WA AQLGW AGP+V+  FS +T++T
Sbjct  24   KCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWATAQLGWIAGPSVMFLFSFVTYYT  83

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLA CYRS  PVTG RNYTY+D VRS+LGG +V++CGL QY NL G++IGYTI +SIS
Sbjct  84   STLLAACYRSGDPVTGKRNYTYVDAVRSNLGGFQVKICGLVQYLNLFGVAIGYTIASSIS  143

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+++SNCFH  G    C + S P+M+ F  +++VLSQIP+F +L WLSIVAAVMSF Y
Sbjct  144  MMAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQIPDFDQLWWLSIVAAVMSFTY  203

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IAKVA +G+   S     +    V+   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  204  STIGLGLGIAKVAETGKFRGS--LTGISIGTVSETQKIWRSFQALGDIAFAYSYSIILIE  261

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E+  MKKAS I V  TT+FY++CGC GYAAFG+ +PGN LTGFGFY P+W
Sbjct  262  IQDTVKSPPSESKTMKKASLISVGVTTLFYMLCGCFGYAAFGDLSPGNLLTGFGFYNPYW  321

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I IHLVGAYQVF
Sbjct  322  LLDIANAAIVIHLVGAYQVF  341



>ref|XP_002520322.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF42108.1| amino acid transporter, putative [Ricinus communis]
Length=485

 Score =   420 bits (1079),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 198/320 (62%), Positives = 254/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K +DDDG  KRTGT+ TASAHIITAVIGSGVLSL+WA+AQLGW AGPAV+  FSL+T++T
Sbjct  29   KWYDDDGKLKRTGTVWTASAHIITAVIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYT  88

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LL+ CYR+  PV G RNYTYMD VRS+LGG K ++CG  QY NL+G++IGYTI +SIS
Sbjct  89   STLLSACYRTGDPVNGKRNYTYMDAVRSNLGGAKFKICGYVQYVNLIGVAIGYTIASSIS  148

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+AVK+SNCFHK+G    C + + P+M+ F  ++++ SQIP+F +L WLSIVAA+MSF Y
Sbjct  149  MMAVKRSNCFHKSGGKNPCHMNANPYMIAFGVVEIIFSQIPDFDQLWWLSIVAAIMSFTY  208

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IA+V  +G+A  S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  209  STIGLGLGIAEVTKNGKAMGS--MTGISIGTVTETQKIWRSFQALGDIAFAYSYSLILIE  266

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT+RS P E+  M+KA+ I VS TT+FY++CGC GYAAFG+ +PGN LTGFGFY P+W
Sbjct  267  IQDTIRSPPAESKTMRKATLISVSVTTLFYMLCGCFGYAAFGDMSPGNLLTGFGFYNPYW  326

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN+ I +HLVGAYQV+
Sbjct  327  LLDIANVAIVVHLVGAYQVY  346



>ref|XP_011022870.1| PREDICTED: amino acid permease 4-like [Populus euphratica]
Length=493

 Score =   420 bits (1080),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 251/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FD+DG  KRTGTL TASAHIITAVIGSGVLSL+WA+AQLGW AGPAV+  FSL+T++T
Sbjct  37   KCFDEDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYT  96

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LL DCYR+  P TG RNYTYMD VRS LGGVKV+LCG  QY  L GI+IGYTI +SIS
Sbjct  97   SSLLTDCYRTGDPDTGKRNYTYMDAVRSILGGVKVKLCGFIQYLGLFGIAIGYTIASSIS  156

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH++G    C + S P+M++F   +++LSQIP+F +L WLSIVAAVMSF Y
Sbjct  157  MMAIKRSNCFHQSGGQNPCHLSSNPYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTY  216

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GL I KVA +G    S     +    VT  +KIWR FQA+G IAFAY+YS +LIE
Sbjct  217  SSIGLGLGIGKVAVNGTFKGS--LTGISIGTVTETEKIWRSFQALGAIAFAYSYSVILIE  274

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E+  MKKA+ I +  TT FY++CGC+GYAAFG+ APGN LTGFGFY P+W
Sbjct  275  IQDTVKSPPAESKTMKKAARISIVVTTTFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYW  334

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID+AN  I IHLVGAYQVF
Sbjct  335  LIDIANAAIVIHLVGAYQVF  354



>emb|CDX69918.1| BnaA10g22670D [Brassica napus]
Length=485

 Score =   420 bits (1079),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/346 (60%), Positives = 258/346 (75%), Gaps = 10/346 (3%)
 Frame = -1

Query  1038  HTRKHPRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSL  859
             H   H    MAV Q P +        K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL
Sbjct  10    HHHGHQVFDMAVPQQPAF--------KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSL  61

Query  858   SWAIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVK  679
             +WAIAQLGW AGPAV+  FSL+T ++S LL+DCYR+   V+G RNYTYMD VRS LGG K
Sbjct  62    AWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGFK  121

Query  678   VQLCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQ  499
              ++CGL QY NL G++IGYTI ASISM+A+K+SNCFHK+G    C + S P+M+IF   +
Sbjct  122   FKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVTE  181

Query  498   LVLSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtG  319
             ++LSQ+P+F ++ W+SIVAAVMSF YS+IG+ L I +VA +G    S     +    VT 
Sbjct  182   ILLSQVPDFDQIWWISIVAAVMSFTYSAIGLSLGIVQVAANGVFKGS--LTGISIGAVTQ  239

Query  318   ADKIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCG  139
               KIWR FQA+G+IAFAY+YS VLIEIQDT+RS P E+  MKKA+ + ++ TT+FY++CG
Sbjct  240   TQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESKTMKKATKLSIAITTIFYMLCG  299

Query  138   CIGYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
              +GYAAFG+ APGN LTGFGFY PFWL+D+AN  I +HL+GAYQVF
Sbjct  300   SMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLIGAYQVF  345



>ref|XP_010684694.1| PREDICTED: amino acid permease 3-like [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   420 bits (1080),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 250/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KR GT+ TASAHIITAVIGSGVLSL+WA AQLGW AGP V+  FS++T++T
Sbjct  37   KLFDDDGRLKRRGTMWTASAHIITAVIGSGVLSLAWATAQLGWVAGPIVMLLFSIVTYYT  96

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYRS  PV+G RNYTYMD V+++LGG++V++CGL QY NL G++IGYTI ASIS
Sbjct  97   SVLLADCYRSGDPVSGKRNYTYMDAVQANLGGLQVKICGLIQYLNLFGVAIGYTIAASIS  156

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M A+K+SNCFH+ G    C + + P+M+ F   +++ SQIP+F ++ WLSIVAAVMSF Y
Sbjct  157  MTAIKRSNCFHEKGEKSKCDISTNPYMIAFGVAEIIFSQIPDFDQIWWLSIVAAVMSFTY  216

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IAKVA +G+   S     +    VT  DKIWR FQA+G+IAFAY+YS +LIE
Sbjct  217  STIGLGLGIAKVAVNGQVKGS--LTGISIGVVTQTDKIWRSFQALGDIAFAYSYSMILIE  274

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT+RS P E+  M+KA+ I V  TT FY++CGC GYAAFG+ +PGN LTGFGFY PFW
Sbjct  275  IQDTVRSPPSESKTMRKATLISVVVTTFFYMLCGCFGYAAFGDLSPGNLLTGFGFYNPFW  334

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I IHL+GAYQV+
Sbjct  335  LVDIANAAIVIHLIGAYQVY  354



>ref|XP_008338672.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   419 bits (1078),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 207/331 (63%), Positives = 252/331 (76%), Gaps = 5/331 (2%)
 Frame = -1

Query  993  PMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAV  814
            PM  E G    K +DDDG  KRTGT+ TASAHIITAVIGSGVLSL+WA+AQLGW AGPAV
Sbjct  20   PMPPEVGS---KCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAVAQLGWVAGPAV  76

Query  813  LAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGI  634
            +  FS +T +TS LL+ CYRS  PV G RNYTY D VRS+LGG KV++CG  QY NL G+
Sbjct  77   MLLFSFVTXYTSTLLSACYRSGDPVIGKRNYTYTDAVRSNLGGFKVKICGFVQYLNLFGV  136

Query  633  SIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWL  454
            +IGYTI +SISMVA+K+SNCF+KNG    C V S P+M+ F   +++ SQIP+F +L WL
Sbjct  137  AIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGVAEIIFSQIPDFDQLWWL  196

Query  453  SIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIA  274
            SIVAAVMSF YSSIG+GL IAKV  +G    S     +    VT   KIWR FQA+G+IA
Sbjct  197  SIVAAVMSFTYSSIGLGLGIAKVVETGTIKGS--MTGIDIGAVTETQKIWRSFQALGDIA  254

Query  273  FAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNF  94
            FAY+YS +LIEIQDT++S P E   MKKA+ + V+TTT+FY++CGC+GYAAFG+ +PGN 
Sbjct  255  FAYSYSLILIEIQDTIKSPPSEAKTMKKATLVSVATTTLFYMLCGCMGYAAFGDSSPGNL  314

Query  93   LTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            LTGFGF+ P+WLID+AN  I IHLVGAYQVF
Sbjct  315  LTGFGFFNPYWLIDIANAAIVIHLVGAYQVF  345



>ref|NP_001055592.1| Os05g0424000 [Oryza sativa Japonica Group]
 gb|AAV24773.1| putative amino acid transporter [Oryza sativa Japonica Group]
 dbj|BAF17506.1| Os05g0424000 [Oryza sativa Japonica Group]
 gb|EAY98107.1| hypothetical protein OsI_20024 [Oryza sativa Indica Group]
 gb|EEE63778.1| hypothetical protein OsJ_18601 [Oryza sativa Japonica Group]
Length=496

 Score =   420 bits (1079),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/321 (62%), Positives = 251/321 (78%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K +DDDG  KRTGT+ TASAHIITAVIGSGVLSL WAIAQLGW AGPAV+  FS +T++T
Sbjct  32   KLYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPAVMLLFSFVTYYT  91

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS    TG RNYTYMD V ++L G+KVQ+CG  QYAN+VG++IGYTI ASIS
Sbjct  92   SALLADCYRSGDESTGKRNYTYMDAVNANLSGIKVQVCGFLQYANIVGVAIGYTIAASIS  151

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K++NCFH  GH   C++ S P+M+IF   ++  SQIP+F ++SWLSI+AAVMSF Y
Sbjct  152  MLAIKRANCFHVEGHGDPCNISSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSFTY  211

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL + +V  +G    S     +  V     DK+WR  QA G+IAFAY+YS +LIE
Sbjct  212  STIGLGLGVVQVVANGGVKGSLTGISIGVVTPM--DKVWRSLQAFGDIAFAYSYSLILIE  269

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+R+ PP E+ VM++A+ + V+ TT+FY++CGC GYAAFG+ APGN LTGFGFYEPF
Sbjct  270  IQDTIRAPPPSESRVMRRATVVSVAVTTLFYMLCGCTGYAAFGDAAPGNLLTGFGFYEPF  329

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+DVAN  I +HLVGAYQV+
Sbjct  330  WLLDVANAAIVVHLVGAYQVY  350



>ref|XP_008799058.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=492

 Score =   419 bits (1078),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 201/321 (63%), Positives = 251/321 (78%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K +DDDG  KRTGTL TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FS + F+T
Sbjct  35   KCYDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMFLFSFVIFYT  94

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLADCYRS  P+TG RNYTYMD V ++LGG+KV++CG  QYANL G++IGYTI ASIS
Sbjct  95   STLLADCYRSGDPITGKRNYTYMDAVHAYLGGLKVKMCGYIQYANLFGVAIGYTIAASIS  154

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+++SNCFH+ GH   C V S P+M+ F  ++++ SQIP+F ++ WLSIVAAVMSF Y
Sbjct  155  MMAIRRSNCFHEKGHKSPCHVSSNPYMIAFGVLEIIFSQIPDFDQIWWLSIVAAVMSFTY  214

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+ L I +  G+ R   S     +    VT   KIWR  QA+G+IAFAY++S +LIE
Sbjct  215  SSIGLILGIVQTIGNKRFKGS--LTGISIGAVTETQKIWRTLQALGDIAFAYSFSIILIE  272

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+++ PP E  VMKKA+ + ++ TT FY++CGC+GYAAFG++APGN LTGFGFY PF
Sbjct  273  IQDTVKAPPPSEAKVMKKAAVLSIAVTTFFYMLCGCMGYAAFGDEAPGNLLTGFGFYNPF  332

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+D+AN  I IHLVGAYQVF
Sbjct  333  WLLDIANAAIVIHLVGAYQVF  353



>ref|XP_010063933.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW71231.1| hypothetical protein EUGRSUZ_F04329 [Eucalyptus grandis]
Length=478

 Score =   419 bits (1077),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 249/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TAS+HIITAVIGSGVLSL+WA AQLGW AGPAV+  FS +T++T
Sbjct  22   KCFDDDGRLKRTGTVWTASSHIITAVIGSGVLSLAWATAQLGWIAGPAVMFLFSFVTYYT  81

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LLA CYRS  PVTG RNYTYMD V S+LGG KV+LCG+ QY NL G++IGYTI +SIS
Sbjct  82   SSLLAACYRSGDPVTGKRNYTYMDAVHSNLGGAKVKLCGMVQYLNLFGVAIGYTIASSIS  141

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+ +SNCFHKNG D  C   S P+M+ F  I++ LSQIP+F +L WLSIVAAVMSF Y
Sbjct  142  MMAIARSNCFHKNGDDSPCHTSSNPYMIAFGVIEIFLSQIPDFDQLWWLSIVAAVMSFTY  201

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S IG+ L IAKVA +G+   S     +    V+   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  202  SIIGLALGIAKVAENGKVGGS--LTGISINTVSQTQKIWRSFQALGDIAFAYSYSIILIE  259

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P E+  MKKA+ + V  TT+FY++CG +GYAAFG+ APGN LTGFGF+ P+W
Sbjct  260  IQDTLKSPPSESKTMKKATLVSVGVTTLFYMLCGTMGYAAFGDMAPGNLLTGFGFFNPYW  319

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID+AN  I IHL+GAYQV+
Sbjct  320  LIDIANAAIVIHLIGAYQVY  339



>gb|AIL30502.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   419 bits (1077),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 252/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTG++ TASAHIITAVIGSGVLSL+WA+AQLGW AGP V+  FS +T++T
Sbjct  24   KCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAVAQLGWIAGPIVMILFSFVTYYT  83

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS   V+G RNYTYMD V+++LGG++V++CG  QYANL G++IGYTI +SIS
Sbjct  84   SALLADCYRSGDSVSGKRNYTYMDAVQANLGGLQVKICGWIQYANLFGVAIGYTIASSIS  143

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFHK+G    C V S P+M++F  I ++ SQIP+F ++ WLSIVAAVMSF Y
Sbjct  144  MIAIKRSNCFHKHGDQAPCQVSSTPYMVMFGIIAIIFSQIPDFDQIWWLSIVAAVMSFTY  203

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL +AKVA +GR   S     +  V      KIW+ FQA+G IAFAY+YS +LIE
Sbjct  204  STIGLGLGVAKVAETGRIGGSLTGISIGTVTEM--QKIWKSFQALGAIAFAYSYSLILIE  261

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P E+  MK A+ I V+ TTVFY++CGC  YAAFG+ APGN LTGFGFY P+W
Sbjct  262  IQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGCFXYAAFGDLAPGNLLTGFGFYNPYW  321

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+ANI I +HLVGAYQV+
Sbjct  322  LLDIANIAIVVHLVGAYQVY  341



>ref|XP_009122500.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=485

 Score =   419 bits (1077),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 205/346 (59%), Positives = 258/346 (75%), Gaps = 10/346 (3%)
 Frame = -1

Query  1038  HTRKHPRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSL  859
             H   H    MAV Q P +        K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL
Sbjct  10    HHHGHQVFDMAVPQQPAF--------KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSL  61

Query  858   SWAIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVK  679
             +WAIAQLGW AGPAV+  FSL+T ++S LL+DCYR+   ++G RNYTYMD VRS LGG K
Sbjct  62    AWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAISGKRNYTYMDAVRSILGGFK  121

Query  678   VQLCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQ  499
              ++CGL QY NL G++IGYTI ASISM+A+K+SNCFHK+G    C + S P+M+IF   +
Sbjct  122   FKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVTE  181

Query  498   LVLSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtG  319
             ++LSQ+P+F ++ W+SIVAAVMSF YS+IG+ L I +VA +G    S     +    VT 
Sbjct  182   ILLSQVPDFDQIWWISIVAAVMSFTYSAIGLSLGIVQVAANGVFKGS--LTGISIGAVTQ  239

Query  318   ADKIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCG  139
               KIWR FQA+G+IAFAY+YS VLIEIQDT+RS P E+  MKKA+ + ++ TT+FY++CG
Sbjct  240   TQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESKTMKKATKLSIAITTIFYMLCG  299

Query  138   CIGYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
              +GYAAFG+ APGN LTGFGFY PFWL+D+AN  I +HL+GAYQVF
Sbjct  300   SMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVVHLIGAYQVF  345



>gb|AIS71894.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   419 bits (1076),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 252/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTG++ TASAHIITAVIGSGVLSL+WA+AQLGW AGP V+  FS +T++T
Sbjct  24   KCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAVAQLGWIAGPIVMILFSFVTYYT  83

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS   V+G RNYTYMD V+++LGG++V++CG  QYANL G++IGYTI +SIS
Sbjct  84   SALLADCYRSGDSVSGKRNYTYMDAVQANLGGLQVKICGWIQYANLFGVAIGYTIASSIS  143

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFHK+G    C V S P+M++F  I ++ SQIP+F ++ WLSIVAAVMSF Y
Sbjct  144  MIAIKRSNCFHKHGDQAPCQVSSTPYMVMFGIIAIIFSQIPDFDQIWWLSIVAAVMSFTY  203

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL +AKVA +GR   S     +  V      KIW+ FQA+G IAFAY+YS +LIE
Sbjct  204  STIGLGLGVAKVAETGRIGGSLTGISIGTVTEM--QKIWKSFQALGAIAFAYSYSLILIE  261

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P E+  MK A+ I V+ TTVFY++CGC  YAAFG+ APGN LTGFGFY P+W
Sbjct  262  IQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGCFXYAAFGDLAPGNLLTGFGFYNPYW  321

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+ANI I +HLVGAYQV+
Sbjct  322  LLDIANIAIVVHLVGAYQVY  341



>ref|XP_004290907.1| PREDICTED: amino acid permease 3-like [Fragaria vesca subsp. 
vesca]
Length=484

 Score =   419 bits (1077),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/320 (63%), Positives = 254/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FSL+T++T
Sbjct  28   KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMFLFSLVTYYT  87

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LL+ CYRS    TG RNYTYMD V+S+LGGVKV++CG  QY NL G++IGYTI ++IS
Sbjct  88   STLLSACYRSGDSDTGKRNYTYMDAVQSNLGGVKVKICGYVQYLNLFGVAIGYTIASAIS  147

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFHK+G    C + S P+M+ F  ++++ SQIP+F +L WLSIVAAVMSF Y
Sbjct  148  MMAIKRSNCFHKSGGKDPCHINSNPYMIAFGIVEIIFSQIPDFDQLWWLSIVAAVMSFTY  207

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IAKVA +G    S     +    V+  +K+WR FQA+G+IAFAY+YS +LIE
Sbjct  208  STIGLGLGIAKVAETGTIMGS--MTGISIGTVSETEKMWRSFQALGDIAFAYSYSLILIE  265

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT+RS P E   MKKA+ I V+ TT+FY++CGC+GYAAFG+ APGN LTGFGFY P+W
Sbjct  266  IQDTVRSPPSEAKTMKKATTISVAVTTLFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYW  325

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN+ I +HLVGAYQV+
Sbjct  326  LLDIANVAIVVHLVGAYQVY  345



>ref|XP_009596720.1| PREDICTED: amino acid permease 3-like isoform X1 [Nicotiana tomentosiformis]
Length=480

 Score =   419 bits (1076),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/320 (61%), Positives = 254/320 (79%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KR+G++ TASAHIITAVIGSGVLSL+WA AQLGW AGP VL  FS +T++T
Sbjct  23   KCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPTVLLLFSFVTYYT  82

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS   V+G RNYTYMD VR++LGG++V++CG+ QY NL G+++GYTI +SIS
Sbjct  83   SALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQYVNLFGVAVGYTIASSIS  142

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+AVK+S+CFHK+GH   C+V S P+M++F  ++++ SQIP+F ++ WLSIVAAVMSF Y
Sbjct  143  MMAVKRSDCFHKHGHRAACNVSSTPYMIMFGIMEILFSQIPDFDQIWWLSIVAAVMSFTY  202

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL +A+VA +G+   S     +         KIWR FQA+G IAFAY+YS +LIE
Sbjct  203  STIGLGLGVAQVAETGKIQGSLTGISIGAEVTEM-QKIWRSFQALGAIAFAYSYSLILIE  261

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL++ P E   MKKA+ + V+ TTVFY++CGC GYAAFG+ +PGN LTGFGFY P+W
Sbjct  262  IQDTLKAPPSEAKTMKKATLLSVAVTTVFYMLCGCFGYAAFGDQSPGNLLTGFGFYNPYW  321

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN+ I +HLVGAYQV+
Sbjct  322  LLDIANVAIVVHLVGAYQVY  341



>ref|XP_007143143.1| hypothetical protein PHAVU_007G047400g [Phaseolus vulgaris]
 gb|ESW15137.1| hypothetical protein PHAVU_007G047400g [Phaseolus vulgaris]
Length=466

 Score =   418 bits (1075),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/319 (66%), Positives = 255/319 (80%), Gaps = 1/319 (0%)
 Frame = -1

Query  957  NFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTS  778
             FDDDG  KR GT +TASAHI+TAVIGSGVLSL+WA+AQLGW AGP +L  FSLIT +T 
Sbjct  13   KFDDDGRLKRKGTWITASAHIVTAVIGSGVLSLAWAVAQLGWIAGPVILTLFSLITLYTC  72

Query  777  ALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISM  598
             LL DCYR P  V GTRN TYM++V++ LGG +  LCG++Q+ANLVG  IGYTITASISM
Sbjct  73   FLLCDCYRYPDSVHGTRNITYMNMVKTILGGRQYHLCGVAQFANLVGSCIGYTITASISM  132

Query  597  VAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYS  418
            VA+++SNCFHK GH+  C V +Y +M IF A+++++SQIP+FH LS LS VAAVMSF YS
Sbjct  133  VAIRRSNCFHKYGHEAKCQVSNYAYMSIFGAVEILISQIPDFHNLSGLSFVAAVMSFGYS  192

Query  417  SIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEI  238
            +IGIGLSI K+AG G    +++TG+VVG DVTG  KIW  FQAIGNIAFAY +S V++EI
Sbjct  193  AIGIGLSIVKIAG-GSHVETSITGLVVGEDVTGTQKIWSSFQAIGNIAFAYCFSQVMVEI  251

Query  237  QDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWL  58
            QDTL+S P E   MKKA+  G+S TT FY++CG +GY AFGN APGNFLTGFGFYEP+WL
Sbjct  252  QDTLKSVPSERGAMKKATVTGISITTFFYLLCGLLGYEAFGNKAPGNFLTGFGFYEPYWL  311

Query  57   IDVANICIAIHLVGAYQVF  1
            +D+ N+ I +HLVGAYQVF
Sbjct  312  VDIGNVFIVVHLVGAYQVF  330



>ref|XP_009596721.1| PREDICTED: amino acid permease 3-like isoform X2 [Nicotiana tomentosiformis]
Length=478

 Score =   418 bits (1075),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 195/320 (61%), Positives = 254/320 (79%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KR+G++ TASAHIITAVIGSGVLSL+WA AQLGW AGP VL  FS +T++T
Sbjct  21   KCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPTVLLLFSFVTYYT  80

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS   V+G RNYTYMD VR++LGG++V++CG+ QY NL G+++GYTI +SIS
Sbjct  81   SALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQYVNLFGVAVGYTIASSIS  140

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+AVK+S+CFHK+GH   C+V S P+M++F  ++++ SQIP+F ++ WLSIVAAVMSF Y
Sbjct  141  MMAVKRSDCFHKHGHRAACNVSSTPYMIMFGIMEILFSQIPDFDQIWWLSIVAAVMSFTY  200

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL +A+VA +G+   S     +         KIWR FQA+G IAFAY+YS +LIE
Sbjct  201  STIGLGLGVAQVAETGKIQGSLTGISIGAEVTEM-QKIWRSFQALGAIAFAYSYSLILIE  259

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL++ P E   MKKA+ + V+ TTVFY++CGC GYAAFG+ +PGN LTGFGFY P+W
Sbjct  260  IQDTLKAPPSEAKTMKKATLLSVAVTTVFYMLCGCFGYAAFGDQSPGNLLTGFGFYNPYW  319

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN+ I +HLVGAYQV+
Sbjct  320  LLDIANVAIVVHLVGAYQVY  339



>emb|CAN61092.1| hypothetical protein VITISV_005276 [Vitis vinifera]
 emb|CBI18979.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   418 bits (1075),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 251/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT  TASAHIITAVIGSGVLSL+WA AQLGW AGPAVL  FS +T++T
Sbjct  25   KCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAWATAQLGWIAGPAVLFLFSFVTYYT  84

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LL+ CYR+   VTG RNYTYMD VRS+LGG K+++CGL QY NL G++IGYTI ASIS
Sbjct  85   SVLLSSCYRTGDSVTGKRNYTYMDAVRSNLGGAKMKICGLIQYLNLFGVAIGYTIAASIS  144

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH++     C + S P+M++F   +++LSQIP+F ++ WLSIVAA+MSFAY
Sbjct  145  MMAIKRSNCFHESHDKNPCHISSNPYMIMFGIFEIILSQIPDFDQIWWLSIVAAIMSFAY  204

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL +AKVA SG+   S     +    VT   KIWR FQA+GNIAFAY+YS +LIE
Sbjct  205  STIGLGLGVAKVAESGKFRGS--LTGISIGTVTQTQKIWRSFQALGNIAFAYSYSIILIE  262

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E   MKKA+ + V  TT+FY++CGC+GYAAFG+ APGN LTGFGFY P+W
Sbjct  263  IQDTIKSPPSEKKTMKKATLLSVIVTTLFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYW  322

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I IHLVGAYQV+
Sbjct  323  LLDIANAAIVIHLVGAYQVY  342



>ref|XP_003634405.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
Length=483

 Score =   418 bits (1075),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 251/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT  TASAHIITAVIGSGVLSL+WA AQLGW AGPAVL  FS +T++T
Sbjct  27   KCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAWATAQLGWIAGPAVLFLFSFVTYYT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LL+ CYR+   VTG RNYTYMD VRS+LGG K+++CGL QY NL G++IGYTI ASIS
Sbjct  87   SVLLSSCYRTGDSVTGKRNYTYMDAVRSNLGGAKMKICGLIQYLNLFGVAIGYTIAASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH++     C + S P+M++F   +++LSQIP+F ++ WLSIVAA+MSFAY
Sbjct  147  MMAIKRSNCFHESHDKNPCHISSNPYMIMFGIFEIILSQIPDFDQIWWLSIVAAIMSFAY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL +AKVA SG+   S     +    VT   KIWR FQA+GNIAFAY+YS +LIE
Sbjct  207  STIGLGLGVAKVAESGKFRGS--LTGISIGTVTQTQKIWRSFQALGNIAFAYSYSIILIE  264

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E   MKKA+ + V  TT+FY++CGC+GYAAFG+ APGN LTGFGFY P+W
Sbjct  265  IQDTIKSPPSEKKTMKKATLLSVIVTTLFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYW  324

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I IHLVGAYQV+
Sbjct  325  LLDIANAAIVIHLVGAYQVY  344



>ref|NP_001149036.1| amino acid carrier [Zea mays]
 gb|ACG33909.1| amino acid carrier [Zea mays]
Length=478

 Score =   418 bits (1075),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 201/321 (63%), Positives = 252/321 (79%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGP V+  FS +T++T
Sbjct  17   KCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPTVMLLFSFVTYYT  76

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS    TG RNYTYMD V ++L GVKV  CG  QYAN+VG++IGYTI ASIS
Sbjct  77   SALLADCYRSGDACTGKRNYTYMDAVNANLSGVKVWFCGFLQYANIVGVAIGYTIAASIS  136

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A++++NCFH  GH   C++ S P+M+IF  +Q+  SQIP+F ++SWLSI+AAVMSF Y
Sbjct  137  MLAIQRANCFHVEGHGDPCNISSTPYMIIFGVVQIFFSQIPDFDQISWLSILAAVMSFTY  196

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IA+V  +     S     +    VT  DK+WR  QA G+IAFAY+YS +LIE
Sbjct  197  STIGLGLGIAQVVSNKGVQGS--LTGISVGAVTPVDKMWRSLQAFGDIAFAYSYSLILIE  254

Query  240  IQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT+R+ PP E+ VM++A+ + V+ TT  Y++CGC+GYAAFG++APGN LTGFGFYEPF
Sbjct  255  IQDTIRAPPPSESKVMRRATVVSVAVTTFXYMLCGCMGYAAFGDNAPGNLLTGFGFYEPF  314

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+DVAN  IA+HLVGAYQV+
Sbjct  315  WLLDVANAAIAVHLVGAYQVY  335



>gb|KFK42132.1| hypothetical protein AALP_AA2G215300 [Arabis alpina]
Length=476

 Score =   418 bits (1074),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 197/320 (62%), Positives = 251/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K +DDDG  KRTG++ TASAHIITAVIGSGVLSL+WA AQLGW AGP V+  FS++T+FT
Sbjct  20   KCYDDDGRTKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLAGPVVMLLFSIVTYFT  79

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLA CYRS  P++G RNYTYMD VRS+LGGVKV+LCG+ QY NL G++IGYTI ++IS
Sbjct  80   STLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQYLNLFGVAIGYTIASAIS  139

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFHK+G    C + S P+M+ F  +Q++ SQIP+F +LSWLSIVAAVMSF Y
Sbjct  140  MMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDFDQLSWLSIVAAVMSFTY  199

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SS G+ L IA+V  +G+   S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  200  SSAGLALGIAQVVANGKVKGS--LTGISIGTVTETQKIWRSFQALGDIAFAYSYSIILIE  257

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E   MKKA+ + V  TT+FY++CGC+GYAAFG+ +PGN LTGFGFY P+W
Sbjct  258  IQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDLSPGNLLTGFGFYNPYW  317

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I +HL+GAYQV+
Sbjct  318  LLDIANAAIVVHLIGAYQVY  337



>ref|XP_007222611.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
 gb|EMJ23810.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
Length=484

 Score =   418 bits (1075),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 204/320 (64%), Positives = 249/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WA AQLGW AGP+V+  FS +T++T
Sbjct  28   KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPSVMLLFSFVTYYT  87

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLA CYR+  PVTG RNYTY D VRS+LGG K ++CG  QY NL G++IGYTI +SIS
Sbjct  88   STLLAACYRTGDPVTGKRNYTYTDAVRSNLGGFKEKICGFVQYLNLFGVAIGYTIASSIS  147

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            MVA+K+SNCF+KNG    C V S P+M+ F   +++ SQIPNF +L WLSIVAAVMSF Y
Sbjct  148  MVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGIAEIIFSQIPNFDQLWWLSIVAAVMSFTY  207

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GL IAKV  +G    S     +   +VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  208  SSIGLGLGIAKVVETGTIRGS--MTGISIGNVTETQKIWRSFQALGDIAFAYSYSLILIE  265

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E   MKKA+ + V+TTT+FY++CGC+GYAAFG+ +PGN LTGFGF+ P+W
Sbjct  266  IQDTVKSPPSEAKTMKKATIVSVATTTLFYMLCGCMGYAAFGDSSPGNLLTGFGFFNPYW  325

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID+AN  I IHLVGAYQVF
Sbjct  326  LIDIANAAIVIHLVGAYQVF  345



>ref|XP_006432100.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
 gb|ESR45340.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
Length=483

 Score =   418 bits (1074),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 251/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG   RTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FS +T++T
Sbjct  27   KCFDDDGRLNRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMFLFSFLTYYT  86

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LL DCYR+  PV+G RNYTYMD VRS LGG KV+ CGL QY NL GI+IGYTI ASIS
Sbjct  87   SSLLTDCYRTADPVSGKRNYTYMDAVRSILGGAKVKACGLIQYLNLFGIAIGYTIAASIS  146

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH++G +  C + S P+M++F  +++ LSQIP+F ++ WLSIVAAVMSF Y
Sbjct  147  MMAIKRSNCFHESGGNNPCHMSSNPYMILFGVMEIFLSQIPDFDQIWWLSIVAAVMSFTY  206

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+ L I +VA +G    S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  207  SAIGLALGIVQVAANGAFKGS--LTGISIGTVTQTQKIWRSFQALGDIAFAYSYSVILIE  264

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P E+  MKKA+ + ++ TT FY++CGC+GYAAFG+ APGN LTGFGFY PFW
Sbjct  265  IQDTLKSPPAESKTMKKAAKLSIAVTTAFYMLCGCMGYAAFGDFAPGNLLTGFGFYNPFW  324

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I +HLVGAYQVF
Sbjct  325  LLDIANSAIVVHLVGAYQVF  344



>ref|XP_006464914.1| PREDICTED: amino acid permease 2-like [Citrus sinensis]
Length=485

 Score =   418 bits (1074),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 251/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG   RTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FS +T++T
Sbjct  29   KCFDDDGRLNRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMFLFSFLTYYT  88

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LL DCYR+  PV+G RNYTYMD VRS LGG KV+ CGL QY NL GI+IGYTI ASIS
Sbjct  89   SSLLTDCYRTADPVSGKRNYTYMDAVRSILGGAKVKACGLIQYLNLFGIAIGYTIAASIS  148

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH++G +  C + S P+M++F  +++ LSQIP+F ++ WLSIVAAVMSF Y
Sbjct  149  MMAIKRSNCFHESGGNNPCHMSSNPYMILFGVMEIFLSQIPDFDQIWWLSIVAAVMSFTY  208

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+ L I +VA +G    S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  209  SAIGLALGIVQVAANGAFKGS--LTGISIGTVTQTQKIWRSFQALGDIAFAYSYSVILIE  266

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL+S P E+  MKKA+ + ++ TT FY++CGC+GYAAFG+ APGN LTGFGFY PFW
Sbjct  267  IQDTLKSPPAESKTMKKAAKLSIAVTTAFYMLCGCMGYAAFGDFAPGNLLTGFGFYNPFW  326

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I +HLVGAYQVF
Sbjct  327  LLDIANSAIVVHLVGAYQVF  346



>ref|XP_007019168.1| Amino acid permease isoform 2 [Theobroma cacao]
 gb|EOY16393.1| Amino acid permease isoform 2 [Theobroma cacao]
Length=488

 Score =   418 bits (1074),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 250/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FD+DG  KRTGT+ TASAHIITAVIGSGVLSL+WA AQLGW AGPAV+  FS +T++T
Sbjct  32   KCFDEDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPAVMFLFSFVTYYT  91

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLA CYRS  P+ G RNYTYMD VRS+LGG KV++CG  QY NL G++IGYTI +SIS
Sbjct  92   STLLAACYRSGDPINGKRNYTYMDAVRSNLGGFKVKICGWVQYLNLFGVAIGYTIASSIS  151

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH +G    C + S P+M+ F  ++++ SQIP F +L WLSIVAAVMSF Y
Sbjct  152  MMAIKRSNCFHASGGKNPCHLNSNPYMIAFGIVEIIFSQIPGFDQLWWLSIVAAVMSFTY  211

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IAKVA +G+   S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  212  STIGLGLGIAKVAETGKVRGS--LTGISVGTVTQTQKIWRSFQALGDIAFAYSYSLILIE  269

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL++ P E+  MKKAS I V+ TT+FY++CGC+GYAAFG+ +PGN LTGFGFY PFW
Sbjct  270  IQDTLKAPPSESKTMKKASLISVAVTTLFYMLCGCMGYAAFGDLSPGNLLTGFGFYNPFW  329

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I IHLVGAYQV+
Sbjct  330  LLDIANAAIVIHLVGAYQVY  349



>dbj|BAK03497.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CCI51007.2| amino acid permease [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   418 bits (1074),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 200/330 (61%), Positives = 255/330 (77%), Gaps = 4/330 (1%)
 Frame = -1

Query  984  VEEGREIL-KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLA  808
            VE G+    K +DDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAI QLGW AGPAV+ 
Sbjct  24   VEHGQAAASKCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVML  83

Query  807  AFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISI  628
             FSL+T++TS+LL+DCYRS    TG RNYTYMD V ++L G+KVQLCG  QYAN+VG++I
Sbjct  84   LFSLVTYYTSSLLSDCYRSGDETTGKRNYTYMDAVNANLSGIKVQLCGFLQYANIVGVAI  143

Query  627  GYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSI  448
            GYTI ASISM+A+KK+NCFH  GH   C + S P+M+IF   ++  SQIP+F ++SWLSI
Sbjct  144  GYTIAASISMLAIKKANCFHVKGHVNPCHISSTPYMIIFGVAEIFFSQIPDFDQISWLSI  203

Query  447  VAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFA  268
            +AA+MSF YS IG+ L I +V  +     S     +  V     DK+WR  QA G+IAFA
Sbjct  204  LAAIMSFTYSIIGLSLGIVQVVANKGVKGSLTGISIGVVTPM--DKVWRSLQAFGDIAFA  261

Query  267  YAYSTVLIEIQDTLRSHPP-ENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFL  91
            Y+YS +LIEIQDT+R+ PP E+ VM++A+ + V+TTT+FY++CGC+GYAAFG++APGN L
Sbjct  262  YSYSLILIEIQDTIRAPPPSESKVMRRATVVSVATTTLFYMLCGCMGYAAFGDNAPGNLL  321

Query  90   TGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
            TGFGFYEPFWL+D+AN  I +HLVGAYQV+
Sbjct  322  TGFGFYEPFWLLDIANAAIVVHLVGAYQVY  351



>ref|XP_011074825.1| PREDICTED: amino acid permease 3-like [Sesamum indicum]
Length=484

 Score =   418 bits (1074),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 250/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KR+GTL TASAHIITAVIGSGVLSL+WA AQLGW AGP+V+  FS++T++T
Sbjct  28   KCFDDDGRLKRSGTLWTASAHIITAVIGSGVLSLAWATAQLGWVAGPSVMFMFSIVTYYT  87

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLA CYRS  P TG RNYTYMD VR++LGG +V+LCG  QY NL G++IGYTI +SIS
Sbjct  88   STLLAACYRSGDPDTGKRNYTYMDAVRANLGGFQVKLCGAIQYLNLFGVAIGYTIASSIS  147

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+++SNCFH  G D  C V S P+M+ F  ++++LSQIP+F ++ WLSIVAAVMSF Y
Sbjct  148  MMAIERSNCFHSKGDDSPCRVSSNPYMIAFGVVEIILSQIPDFDQIWWLSIVAAVMSFTY  207

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IAKVA +G+   S     +    VT   KIWR FQA+G IAFAY+YS +LIE
Sbjct  208  STIGLGLGIAKVAENGKIMGS--LTGISIGKVTETQKIWRSFQALGAIAFAYSYSLILIE  265

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E   MKKA+ + V+ TT+FY+ CGC GYAAFG+ +PGN LTGFGFY P+W
Sbjct  266  IQDTIKSPPSEYKTMKKATLLSVAVTTIFYMSCGCFGYAAFGDMSPGNLLTGFGFYNPYW  325

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN+ I IHL+GAYQVF
Sbjct  326  LLDIANVAIVIHLIGAYQVF  345



>ref|XP_009414606.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   418 bits (1074),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/321 (63%), Positives = 251/321 (78%), Gaps = 3/321 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAI QLGW AGPAV+  FS +TF+T
Sbjct  35   KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVMLLFSFVTFYT  94

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            SALLADCYRS  PVTG RNYTYMD V+++L G+KV++CG  QY N+VG++IGYTI ASIS
Sbjct  95   SALLADCYRSGDPVTGRRNYTYMDAVQANLNGIKVKICGYLQYLNIVGVAIGYTIAASIS  154

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            MVA+K+SNCF+K G D  C V S P+M++F   ++VLSQIP+F ++SWLSI+AA+MSF Y
Sbjct  155  MVAIKRSNCFNKEGDDSPCHVNSNPYMIMFGVAEIVLSQIPDFDQISWLSILAAIMSFTY  214

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+ L I +V  +G    S     +  V     DKIWR  QA G+IAFAY+YS +LIE
Sbjct  215  SSIGLVLGIVQVIQNGGIKGSLTGISIGTVSQM--DKIWRSLQAFGDIAFAYSYSIILIE  272

Query  240  IQDTLRSHP-PENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            IQDT++S P  E  VMKKA+   V+ TT+FY++CGC+GYAAFG+ APGN LTGFGFY P+
Sbjct  273  IQDTIKSSPSSEAKVMKKATLTSVTVTTIFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPY  332

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+D+AN  I +HLVGAYQV+
Sbjct  333  WLLDIANAAIVVHLVGAYQVY  353



>ref|XP_007019167.1| Amino acid permease isoform 1 [Theobroma cacao]
 gb|EOY16392.1| Amino acid permease isoform 1 [Theobroma cacao]
Length=486

 Score =   417 bits (1073),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 250/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FD+DG  KRTGT+ TASAHIITAVIGSGVLSL+WA AQLGW AGPAV+  FS +T++T
Sbjct  30   KCFDEDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPAVMFLFSFVTYYT  89

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLA CYRS  P+ G RNYTYMD VRS+LGG KV++CG  QY NL G++IGYTI +SIS
Sbjct  90   STLLAACYRSGDPINGKRNYTYMDAVRSNLGGFKVKICGWVQYLNLFGVAIGYTIASSIS  149

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH +G    C + S P+M+ F  ++++ SQIP F +L WLSIVAAVMSF Y
Sbjct  150  MMAIKRSNCFHASGGKNPCHLNSNPYMIAFGIVEIIFSQIPGFDQLWWLSIVAAVMSFTY  209

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IAKVA +G+   S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  210  STIGLGLGIAKVAETGKVRGS--LTGISVGTVTQTQKIWRSFQALGDIAFAYSYSLILIE  267

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDTL++ P E+  MKKAS I V+ TT+FY++CGC+GYAAFG+ +PGN LTGFGFY PFW
Sbjct  268  IQDTLKAPPSESKTMKKASLISVAVTTLFYMLCGCMGYAAFGDLSPGNLLTGFGFYNPFW  327

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I IHLVGAYQV+
Sbjct  328  LLDIANAAIVIHLVGAYQVY  347



>ref|XP_008219594.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=484

 Score =   417 bits (1072),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 249/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WA AQLGW AGP+V+  FS +T++T
Sbjct  28   KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPSVMLLFSFVTYYT  87

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLA CYR+  P+TG RNYTY D VRS+LGG K ++CG  QY NL G++IGYTI +SIS
Sbjct  88   STLLAACYRTGDPLTGKRNYTYTDAVRSNLGGFKEKICGFVQYLNLFGVAIGYTIASSIS  147

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            MVA+K+SNCF+KNG    C V S P+M+ F   +++ SQIPNF +L WLSIVAAVMSF Y
Sbjct  148  MVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGIAEIIFSQIPNFDQLWWLSIVAAVMSFTY  207

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GL IAKV  +G    S     +   +VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  208  SSIGLGLGIAKVVETGTIRGS--MTGISIGNVTETQKIWRSFQALGDIAFAYSYSLILIE  265

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E   MKKA+ + V+TTT+FY++CGC+GYAAFG+ +PGN LTGFGF+ P+W
Sbjct  266  IQDTVKSPPSEAKTMKKATIVSVATTTLFYMLCGCMGYAAFGDSSPGNLLTGFGFFNPYW  325

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID+AN  I IHLVGAYQVF
Sbjct  326  LIDIANAAIVIHLVGAYQVF  345



>ref|XP_010444306.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   416 bits (1070),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 200/328 (61%), Positives = 252/328 (77%), Gaps = 2/328 (1%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            +E  R   K FDDDG  KR+GT+ TASAHIITAVIGSGVLSL+WAI QLGW AGPAV+  
Sbjct  1    MEAPRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFL  60

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            FS +T+++S LL+DCYR+  PV+G RNYTYMD VRS LGG + ++CGL QY NL G++IG
Sbjct  61   FSFVTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGVTIG  120

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTI ASISM+A+K+SNCFH++G    C + S P+M++F   +++LSQI +F ++ WLSIV
Sbjct  121  YTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIV  180

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            AA+MSF YS+IG+ L I +VA +G    S     +    VT   KIWR FQA+G+IAFAY
Sbjct  181  AAIMSFTYSAIGLALGIIQVAANGVVKGS--LTGISIGAVTQTQKIWRTFQALGDIAFAY  238

Query  264  AYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTG  85
            +YS VLIEIQDT+RS P E+  MK A+ I ++ TT FY++CGC+GYAAFG+ APGN LTG
Sbjct  239  SYSVVLIEIQDTIRSPPAESKTMKNATKISIAVTTTFYLLCGCMGYAAFGDAAPGNLLTG  298

Query  84   FGFYEPFWLIDVANICIAIHLVGAYQVF  1
            FGFY PFWL+DVAN+ I IHLVGAYQVF
Sbjct  299  FGFYNPFWLLDVANVAIVIHLVGAYQVF  326



>ref|XP_008658969.1| PREDICTED: uncharacterized protein LOC100501686 isoform X1 [Zea 
mays]
 gb|AFW86931.1| hypothetical protein ZEAMMB73_950309 [Zea mays]
Length=486

 Score =   417 bits (1072),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 253/320 (79%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            +  DDDG +KRTGT+ TASAHIITAVIGSGVLSL+W+ AQLGW  GP  L  F+LIT++T
Sbjct  32   ETLDDDGKKKRTGTVWTASAHIITAVIGSGVLSLAWSTAQLGWVVGPLTLMIFALITYYT  91

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LLADCYRS   +TG RNYTYMD V ++LG  +V  CG+ QY NLVG ++GYTITASIS
Sbjct  92   SSLLADCYRSGDQLTGKRNYTYMDAVAAYLGRWQVLSCGVFQYVNLVGTAVGYTITASIS  151

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
              AV K+NCFH  GH  DCS     +M++F  +Q+  SQ+PNF +LSWLSIVAA+MSF+Y
Sbjct  152  AAAVHKANCFHNKGHAADCSTYDTMYMVVFGIVQIFFSQLPNFSDLSWLSIVAAIMSFSY  211

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSI +GLS+A+   SGR+  +TLTG  +GVDV  A K+W   QA+GNIAFAY+YS +LIE
Sbjct  212  SSIAVGLSLARTI-SGRSGTTTLTGTEIGVDVDSAQKVWLALQALGNIAFAYSYSMILIE  270

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P EN  MKKA+ +GV+TTT FY++ GC+GY+AFGN APGN LTGFGFYEP+W
Sbjct  271  IQDTVKSPPAENKTMKKATLMGVTTTTAFYMLAGCLGYSAFGNAAPGNILTGFGFYEPYW  330

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN+CI +HLVGAYQVF
Sbjct  331  LIDFANVCIVVHLVGAYQVF  350



>ref|XP_009339426.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009339427.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009342935.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=489

 Score =   417 bits (1072),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 251/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTGT+ T+SAHIITAVIGSGVLSL+WA AQLGW AGP+V+  FS +T++T
Sbjct  33   KCFDDDGRLKRTGTVWTSSAHIITAVIGSGVLSLAWATAQLGWVAGPSVMLLFSFVTYYT  92

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LL+ CYRS   +TG RNYTYMD VRS+LGG KV++CG  QY NL G+SIGYTI +SIS
Sbjct  93   STLLSACYRSGDSITGKRNYTYMDAVRSNLGGAKVKICGYVQYLNLFGVSIGYTIASSIS  152

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFHK+G    C + S P+M+ F   +++ SQIP+F +L WLSIVAAVMSF Y
Sbjct  153  MMAIKRSNCFHKSGGKNPCRINSNPYMIAFGVTEIIFSQIPDFDQLWWLSIVAAVMSFTY  212

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IA+VA +G+   S     +    VT   K+WR FQA+G+IAFAY+YS +LIE
Sbjct  213  STIGLGLGIAQVAENGKIMGS--MTGISIGTVTATQKMWRSFQALGDIAFAYSYSLILIE  270

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT+RS P E+  MKKA+ I V+ TT+FY++CGC+GYAAFG+ +PGN LTGFGFY P+W
Sbjct  271  IQDTIRSPPSESKTMKKATQISVAVTTLFYMLCGCMGYAAFGDLSPGNLLTGFGFYNPYW  330

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I IHLVGAYQV+
Sbjct  331  LLDIANAAIVIHLVGAYQVY  350



>emb|CDY53832.1| BnaA09g57240D [Brassica napus]
Length=1054

 Score =   434 bits (1115),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 263/334 (79%), Gaps = 12/334 (4%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G     N DDD  EKRTGTL+TASAHIIT VIGSGVLSL+WAIAQLGW  G  +L A
Sbjct  583  VESGAGAGNNVDDDCREKRTGTLITASAHIITTVIGSGVLSLAWAIAQLGWVVGTVILVA  642

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F++I  +TS +LAD YRSP    GTRNYTYMDVVR +LGG KVQLCGL+Q+ +LVG++IG
Sbjct  643  FAVIVNYTSRMLADSYRSP---EGTRNYTYMDVVRVYLGGRKVQLCGLAQFGSLVGVTIG  699

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS+VA+ K+NCFH  GH   CSV +YP M  F  +Q+ LSQIPNFH+LS+LSI+
Sbjct  700  YTITASISLVAIGKANCFHDKGHGAKCSVSNYPLMAAFGIVQIFLSQIPNFHKLSFLSII  759

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            A VMSF+Y+SIG GL++A +A SG+   + LTG VVGVDVT +DK+W+ FQA GNIAF+Y
Sbjct  760  ATVMSFSYASIGFGLALAALA-SGKVGKTGLTGTVVGVDVTASDKLWKSFQAAGNIAFSY  818

Query  264  AYSTVLIEIQ--------DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGND  109
            AYS VL+EIQ        DTLRS PPEN VMKKAS   VSTTT FY++CGCIGYA FGN 
Sbjct  819  AYSVVLVEIQACIISINDDTLRSSPPENKVMKKASLAAVSTTTAFYILCGCIGYATFGNQ  878

Query  108  APGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQ  7
            APG+FLT FGFYEP+WLID AN CIA+HL+GAYQ
Sbjct  879  APGDFLTDFGFYEPYWLIDFANACIAVHLIGAYQ  912


 Score =   431 bits (1108),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 222/334 (66%), Positives = 266/334 (80%), Gaps = 11/334 (3%)
 Frame = -1

Query  984  VEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAA  805
            VE G     N DDDG EKRTGTL+TASAHIITAVIGSGVLSL+WAIAQLGW AG  +L +
Sbjct  32   VESGTVAGNNVDDDGGEKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWVAGTVLLVS  91

Query  804  FSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIG  625
            F+++  +TS +LADCYRSP    GTRN TYMDVVR++LGG KVQLCGL+QY +LVG++IG
Sbjct  92   FAVVVNYTSRMLADCYRSPD--AGTRNNTYMDVVRAYLGGRKVQLCGLAQYGSLVGMTIG  149

Query  624  YTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIV  445
            YTITASIS+VA+ K+NCFH  GH   C V +YP M  F  IQ+VLSQIPNFH+LS+LSI+
Sbjct  150  YTITASISLVAIGKANCFHDKGHGAKCLVSNYPAMAAFGIIQIVLSQIPNFHKLSFLSII  209

Query  444  AAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAY  265
            AAVMSF+YSSIG GL++A +A SG+   + LTG VVGVDVT +DK+W+ FQA GNIAF+Y
Sbjct  210  AAVMSFSYSSIGTGLALADLA-SGKVGKTELTGTVVGVDVTASDKLWKSFQAAGNIAFSY  268

Query  264  AYSTVLIEIQ--------DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGND  109
            AYS VL+EIQ        DTL S PPEN+VMKKAS +GVST T FY++C C+GYA FG+ 
Sbjct  269  AYSVVLVEIQACIFSTRNDTLSSSPPENIVMKKASLVGVSTATAFYILCACMGYATFGSQ  328

Query  108  APGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQ  7
            APG+ LT FGFYEP+WLID AN CIA+HL+G YQ
Sbjct  329  APGDLLTDFGFYEPYWLIDFANACIAVHLIGVYQ  362



>ref|XP_011031114.1| PREDICTED: amino acid permease 4-like isoform X2 [Populus euphratica]
Length=493

 Score =   417 bits (1071),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 204/320 (64%), Positives = 249/320 (78%), Gaps = 3/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K +DDDG  KRTGTL TAS+HIITAVIGSGVLSL+WAIAQLGW AGPAV+  FSL+T++T
Sbjct  38   KCYDDDGRLKRTGTLWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYT  97

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LL DCYR+  P TG RNYTYMD V+S LG VKV LCGL QY  L GI+IGYTI +SIS
Sbjct  98   SSLLTDCYRTGDPYTGERNYTYMDAVQSILG-VKVNLCGLVQYIGLFGIAIGYTIASSIS  156

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFH++G    C + S P+M++F   +++LSQIP+F +L WLSIVAAVMSF Y
Sbjct  157  MMAIKRSNCFHQSGGQNPCHISSNPYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTY  216

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSIG+GL I KVA +G    S     +  V     +KIWR FQA+G IAFAY+YS +LIE
Sbjct  217  SSIGLGLGIGKVAVNGTFKGSLTGISIGTVTE--TEKIWRSFQALGAIAFAYSYSVILIE  274

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E+  MKKA+ I +  TT FY++CGC+GYAAFG  APGN LTGFGFY P+W
Sbjct  275  IQDTIKSPPAESKTMKKAAKISIVVTTTFYMLCGCMGYAAFGEQAPGNLLTGFGFYNPYW  334

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID+AN+ I IHL+GAYQVF
Sbjct  335  LIDIANVAIVIHLIGAYQVF  354



>gb|KDP32820.1| hypothetical protein JCGZ_12112 [Jatropha curcas]
Length=487

 Score =   416 bits (1070),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 201/320 (63%), Positives = 252/320 (79%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K  DDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FS +T++T
Sbjct  31   KLLDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSFVTYYT  90

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LL+ CYRS   VTG RNYTYMDV+RS+LGG KV++CG+ QY NL G++IGYTI +SIS
Sbjct  91   STLLSACYRSGDSVTGKRNYTYMDVIRSNLGGAKVKICGIVQYLNLFGVAIGYTIASSIS  150

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+AVK+SNCFHK+G    C + + P+M+ F   +++ SQIP+F +L WLSI+AAVMSF Y
Sbjct  151  MMAVKRSNCFHKSGGKNPCKMNANPYMIAFGIAEIIFSQIPDFDQLWWLSILAAVMSFTY  210

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            S+IG+GL IAKVA SG+   S     +   +VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  211  STIGLGLGIAKVAESGKIMGS--LTGISLNNVTPTQKIWRSFQALGDIAFAYSYSMILIE  268

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E   MKKA+ I V+ TT FY++CGC GYAAFG+ +PGN LTGFGFY P+W
Sbjct  269  IQDTVKSPPSEAKTMKKATLISVAVTTFFYMLCGCFGYAAFGDMSPGNLLTGFGFYNPYW  328

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN+ I +HLVGAYQV+
Sbjct  329  LLDIANVAIVVHLVGAYQVY  348



>ref|XP_006399392.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
 gb|ESQ40845.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
Length=492

 Score =   416 bits (1070),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/321 (63%), Positives = 250/321 (78%), Gaps = 2/321 (1%)
 Frame = -1

Query  963  LKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFF  784
             K FDDDG  KRTGT+ TASAHI+TAVIGSGVLSL+WAIAQLGW AGPAV+  FSL+T +
Sbjct  34   FKCFDDDGRLKRTGTVWTASAHIVTAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLY  93

Query  783  TSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASI  604
            +S LL+DCYR+   V+G RNYTYMD VRS LGG K ++CGL QY NL GI+IGYTI ASI
Sbjct  94   SSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAIGYTIAASI  153

Query  603  SMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFA  424
            SM+A+K+SNCFHK+G    C + S P+M+IF   +++LSQIP+F ++ W+SIVAAVMSF 
Sbjct  154  SMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVTEILLSQIPDFDQIWWISIVAAVMSFT  213

Query  423  YSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLI  244
            YS+IG+ L I +VA +G    S     +    VT   KIWR FQA+G+IAFAY+YS VLI
Sbjct  214  YSAIGLALGIVQVAANGVFKGS--LTGISIGTVTQTQKIWRTFQALGDIAFAYSYSVVLI  271

Query  243  EIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            EIQDT+RS P E+  MKKA+ I ++ TTVFY++CG +GYAAFG+ APGN LTGFGFY PF
Sbjct  272  EIQDTVRSPPAESKTMKKATKISIAVTTVFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPF  331

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+DVAN  I +HL+GAYQVF
Sbjct  332  WLLDVANAAIVVHLIGAYQVF  352



>ref|XP_010269036.1| PREDICTED: amino acid permease 3-like [Nelumbo nucifera]
Length=476

 Score =   416 bits (1069),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 201/318 (63%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  954  FDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTSA  775
            FDDDG  KRTGT  TASAHI+TAVIGSGVLSL+WAIAQLGW AGPA++  FS + ++TS+
Sbjct  22   FDDDGRLKRTGTFWTASAHIVTAVIGSGVLSLAWAIAQLGWIAGPAMMILFSFVIYYTSS  81

Query  774  LLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISMV  595
            LLADCYRS  PV+G RNYTYMD VRS+LGGVKV++CG+ QY NL G+SIGYTI ASISM+
Sbjct  82   LLADCYRSGDPVSGKRNYTYMDAVRSNLGGVKVKICGVIQYLNLFGVSIGYTIAASISMM  141

Query  594  AVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYSS  415
            A+++SNCFH++G    C V S P+M+IF   +++LSQIP+F ++ WLSIVAA+MS  YS 
Sbjct  142  AIRRSNCFHESGGKNSCHVSSNPYMIIFGVTEILLSQIPDFDQIWWLSIVAAIMSLTYSV  201

Query  414  IGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEIQ  235
            IG+GL I+KVA +G    S     +    VT   KIWR FQA+G+IAFAY+YS +L EIQ
Sbjct  202  IGLGLGISKVAETGSFRGS--LTGITIGAVTETQKIWRSFQALGDIAFAYSYSIILXEIQ  259

Query  234  DTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWLI  55
            +TL+S P E   MKKA+   V  TT+FY++CGC+GYAAFG+ APGN LTGFGFY PFW+I
Sbjct  260  NTLKSPPSEAKTMKKATLFSVFVTTLFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPFWVI  319

Query  54   DVANICIAIHLVGAYQVF  1
            D+AN  + IHLVGAYQVF
Sbjct  320  DIANAAVVIHLVGAYQVF  337



>gb|KHG13110.1| Amino acid permease 6 -like protein [Gossypium arboreum]
 gb|KHG26079.1| Amino acid permease 6 -like protein [Gossypium arboreum]
Length=433

 Score =   414 bits (1064),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 229/344 (67%), Positives = 258/344 (75%), Gaps = 52/344 (15%)
 Frame = -1

Query  1032  RKHPRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSW  853
             ++  +  M + Q+P   E G +I KN DDDG  KRTGT VTASAHIITAVIGSGVLSL+W
Sbjct  3     KQMQKTSMFIEQSPGDYENG-DIQKNLDDDGRPKRTGTWVTASAHIITAVIGSGVLSLAW  61

Query  852   AIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQ  673
             AIAQLGW AGPAVL AFS IT+FTS LLADCYR+P PV G RNYTYMDVVR++LGG KVQ
Sbjct  62    AIAQLGWVAGPAVLMAFSFITYFTSTLLADCYRAPDPVHGKRNYTYMDVVRAYLGGRKVQ  121

Query  672   LCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLV  493
             LCGL+QYANLVGI+IGYTITASISM                                   
Sbjct  122   LCGLAQYANLVGITIGYTITASISM-----------------------------------  146

Query  492   LSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGAD  313
                      LSWLSIVAA+MSFAYSSIG+GLSIAKVAG G    ++LTGV VGVDV+G++
Sbjct  147   ---------LSWLSIVAAIMSFAYSSIGLGLSIAKVAG-GEHVRTSLTGVTVGVDVSGSE  196

Query  312   KIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCI  133
             K+WR FQAIG+IAFAYAYST      DT++S PPEN  MK+AS+IGVSTTT+FYV+CG I
Sbjct  197   KVWRTFQAIGDIAFAYAYST------DTIKSSPPENKSMKRASSIGVSTTTLFYVLCGLI  250

Query  132   GYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GYAAFGNDAPGNFLTGFGFYEPFWLID ANICIAIHL+GAYQVF
Sbjct  251   GYAAFGNDAPGNFLTGFGFYEPFWLIDFANICIAIHLIGAYQVF  294



>ref|XP_004965605.1| PREDICTED: amino acid permease 6-like [Setaria italica]
Length=486

 Score =   416 bits (1069),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 206/320 (64%), Positives = 250/320 (78%), Gaps = 1/320 (0%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            +  DDDG +KRTGT+ TASAHIITAVIGSGVLSL+W+ AQLGW  GP  L  F+ IT++T
Sbjct  32   EELDDDGRKKRTGTVWTASAHIITAVIGSGVLSLAWSTAQLGWVVGPVTLMIFAFITYYT  91

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S+LLADCYRS    TG RNYTYMD V ++LG  +V  CG+ QY NLVG ++GYTITASIS
Sbjct  92   SSLLADCYRSGNQATGKRNYTYMDAVAAYLGRWQVWSCGIFQYVNLVGTAVGYTITASIS  151

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
              AV K+NCFHK GH  DCS     +M++F  +Q+  SQ+PNF +LSWLSI+AA+MSF+Y
Sbjct  152  AAAVHKANCFHKKGHAADCSQYDTVYMVVFGIVQIFFSQVPNFSDLSWLSILAAIMSFSY  211

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SSI +GLS+A+   SG    +TLTG  VGVDV  A KIW   QA+GNIAFAY+YS +LIE
Sbjct  212  SSIAVGLSLARTI-SGSTGKTTLTGTEVGVDVDSAQKIWMALQALGNIAFAYSYSMILIE  270

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P EN  MKKA+ +GVSTTT FY++ GC+GYAAFGN APGN +TGFGFYEP+W
Sbjct  271  IQDTVKSPPAENKTMKKATLLGVSTTTAFYMLAGCLGYAAFGNAAPGNIMTGFGFYEPYW  330

Query  60   LIDVANICIAIHLVGAYQVF  1
            LID AN+CI +HLVGAYQVF
Sbjct  331  LIDFANVCIVVHLVGAYQVF  350



>emb|CAF22024.1| amino acid permease [Brassica napus]
Length=487

 Score =   416 bits (1069),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 200/321 (62%), Positives = 250/321 (78%), Gaps = 2/321 (1%)
 Frame = -1

Query  963  LKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFF  784
             K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FSL+T +
Sbjct  29   FKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLVFSLVTLY  88

Query  783  TSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASI  604
            +S LL+DCYR+   V+G RNYTYMD VRS LGG K ++CGL QY NL GI+IGYTI ASI
Sbjct  89   SSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAIGYTIAASI  148

Query  603  SMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFA  424
            SM+A+K+SNCFHK+G    C + S P+M+IF   +++LSQ+P+F ++ W+SIVAAVMSF 
Sbjct  149  SMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVTEILLSQVPDFDQIWWISIVAAVMSFT  208

Query  423  YSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLI  244
            YS+IG+ L I +VA +G    S     +    VT   KIWR FQA+G+IAFAY+YS VLI
Sbjct  209  YSAIGLALGIVQVAANGVFKGS--LTGISIGTVTQTQKIWRTFQALGDIAFAYSYSVVLI  266

Query  243  EIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            EIQDT+RS P E+  MKKA+ + ++ TT+FY++CG +GYAAFG+ APGN LTGFGFY PF
Sbjct  267  EIQDTVRSPPSESKTMKKATKLSIAITTIFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPF  326

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+D+AN  I +HL+GAYQVF
Sbjct  327  WLLDIANAAIVVHLIGAYQVF  347



>ref|XP_010537371.1| PREDICTED: amino acid permease 3 [Tarenaya hassleriana]
Length=480

 Score =   415 bits (1067),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 203/344 (59%), Positives = 256/344 (74%), Gaps = 8/344 (2%)
 Frame = -1

Query  1032  RKHPRLLMAVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSW  853
             + H R   AV   P     G EI   FDDDG  KRTG++ TASAHIITAVIGSGVLSL+W
Sbjct  6     KSHDRQAFAVDMPP---SGGSEI---FDDDGRHKRTGSVWTASAHIITAVIGSGVLSLAW  59

Query  852   AIAQLGWAAGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQ  673
             A AQLGW AGPA +  FS +T+FTS LL+ CYRS  P++G RNYTYMD VRS+LGGVKV+
Sbjct  60    ATAQLGWVAGPAAMLLFSAVTYFTSTLLSSCYRSGDPLSGKRNYTYMDAVRSNLGGVKVK  119

Query  672   LCGLSQYANLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLV  493
             LCGL QY NL G++IGYTI ++ SM+A+K+SNCFHK+     C + S P+M+ F  ++++
Sbjct  120   LCGLVQYLNLFGVAIGYTIASATSMMAIKRSNCFHKSRGKNPCRMNSNPYMIAFGVVEII  179

Query  492   LSQIPNFHELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGAD  313
              SQIP+F +L WLSI+AAVMSF YSS+G+ L IAKVA +G+   S     +    VT   
Sbjct  180   FSQIPDFDQLWWLSILAAVMSFTYSSVGLALGIAKVAENGKWRGS--LTGISVGRVTETQ  237

Query  312   KIWRCFQAIGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCI  133
             K+WR FQA+G+IAFAY+YS +LIEIQDTL+S P E   MKKA+ + V  TT+FY++CGC+
Sbjct  238   KVWRSFQALGDIAFAYSYSIILIEIQDTLKSPPAEEKTMKKATLVSVGVTTLFYMLCGCM  297

Query  132   GYAAFGNDAPGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             GYAAFG+ +P N LTGFG+Y PFWL+DVAN  I +HLVGAYQV+
Sbjct  298   GYAAFGDMSPANLLTGFGYYNPFWLLDVANAAIVVHLVGAYQVY  341



>ref|NP_196484.1| amino acid permease 2 [Arabidopsis thaliana]
 sp|Q38967.1|AAP2_ARATH RecName: Full=Amino acid permease 2; AltName: Full=Amino acid 
transporter AAP2 [Arabidopsis thaliana]
 emb|CAA50672.1| amine acid permease [Arabidopsis thaliana]
 emb|CAC05448.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
 gb|AAL91247.1| AT5g09220/T5E8_20 [Arabidopsis thaliana]
 gb|AED91352.1| amino acid permease 2 [Arabidopsis thaliana]
Length=493

 Score =   416 bits (1068),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 201/321 (63%), Positives = 250/321 (78%), Gaps = 2/321 (1%)
 Frame = -1

Query  963  LKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFF  784
             K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FSL+T +
Sbjct  35   FKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLY  94

Query  783  TSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASI  604
            +S LL+DCYR+   V+G RNYTYMD VRS LGG K ++CGL QY NL GI+IGYTI ASI
Sbjct  95   SSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAIGYTIAASI  154

Query  603  SMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFA  424
            SM+A+K+SNCFHK+G    C + S P+M++F   +++LSQ+P+F ++ W+SIVAAVMSF 
Sbjct  155  SMMAIKRSNCFHKSGGKDPCHMSSNPYMIVFGVAEILLSQVPDFDQIWWISIVAAVMSFT  214

Query  423  YSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLI  244
            YS+IG+ L I +VA +G    S     +    VT   KIWR FQA+G+IAFAY+YS VLI
Sbjct  215  YSAIGLALGIVQVAANGVFKGS--LTGISIGTVTQTQKIWRTFQALGDIAFAYSYSVVLI  272

Query  243  EIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            EIQDT+RS P E+  MKKA+ I ++ TT+FY++CG +GYAAFG+ APGN LTGFGFY PF
Sbjct  273  EIQDTVRSPPAESKTMKKATKISIAVTTIFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPF  332

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+D+AN  I +HLVGAYQVF
Sbjct  333  WLLDIANAAIVVHLVGAYQVF  353



>emb|CDX88364.1| BnaC06g38080D [Brassica napus]
Length=476

 Score =   415 bits (1066),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 197/320 (62%), Positives = 250/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTG++ TASAHIITAVIGSGVLSL+WA AQLGW AGP V+  FS++T+FT
Sbjct  20   KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLAGPVVMLLFSIVTYFT  79

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLA CYRS  P++G RNYTYMD VRS+LGGVKV+LCG+ QY NL G++IGYTI ++IS
Sbjct  80   STLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQYLNLFGVAIGYTIASAIS  139

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFHK+G    C + S P+M+ F  +Q++ SQIP+F +L WLSI+AAVMSF Y
Sbjct  140  MMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDFDQLWWLSILAAVMSFTY  199

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SS G+ L IA+V  +G+   S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  200  SSAGLALGIAQVVANGKVKGS--LTGISIGAVTETQKIWRSFQALGDIAFAYSYSIILIE  257

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E   MKKA+ + V  TT+FY++CGC+GYAAFG+ +PGN LTGFGFY P+W
Sbjct  258  IQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDMSPGNLLTGFGFYNPYW  317

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I +HLVGAYQV+
Sbjct  318  LLDIANAAIVVHLVGAYQVY  337



>ref|XP_009106399.1| PREDICTED: amino acid permease 3 [Brassica rapa]
Length=476

 Score =   414 bits (1065),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 197/320 (62%), Positives = 250/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTG++ TASAHIITAVIGSGVLSL+WA AQLGW AGP V+  FS++T+FT
Sbjct  20   KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLAGPVVMLLFSIVTYFT  79

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLA CYRS  P++G RNYTYMD VRS+LGGVKV+LCG+ QY NL G++IGYTI ++IS
Sbjct  80   STLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQYLNLFGVAIGYTIASAIS  139

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFHK+G    C + S P+M+ F  +Q++ SQIP+F +L WLSI+AAVMSF Y
Sbjct  140  MMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDFDQLWWLSILAAVMSFTY  199

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SS G+ L IA+V  +G+   S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  200  SSAGLALGIAQVVANGKVKGS--LTGISIGAVTETQKIWRSFQALGDIAFAYSYSIILIE  257

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E   MKKA+ + V  TT+FY++CGC+GYAAFG+ +PGN LTGFGFY P+W
Sbjct  258  IQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDMSPGNLLTGFGFYNPYW  317

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I +HLVGAYQV+
Sbjct  318  LLDIANAAIVVHLVGAYQVY  337



>emb|CDX81121.1| BnaC03g03750D [Brassica napus]
Length=487

 Score =   415 bits (1066),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/336 (60%), Positives = 254/336 (76%), Gaps = 10/336 (3%)
 Frame = -1

Query  1008  AVSQNPMYVEEGREILKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWA  829
             +V Q P +        K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW 
Sbjct  22    SVPQQPAF--------KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWI  73

Query  828   AGPAVLAAFSLITFFTSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYA  649
             AGPAV+  FS +T ++S LL+DCYR+   V+G RNYTYMD VRS LGG K ++CGL QY 
Sbjct  74    AGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYL  133

Query  648   NLVGISIGYTITASISMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFH  469
             NL GI++GYTI ASISM+A+K+SNCFHK+G    C + S P+M+IF   +++LSQ+P+F 
Sbjct  134   NLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVTEILLSQVPDFD  193

Query  468   ELSWLSIVAAVMSFAYSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQA  289
             ++ W+SIVAAVMSF YS+IG+ L I +VA +G    S     +    VT   KIWR FQA
Sbjct  194   QIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGS--LTGISIGTVTQTQKIWRTFQA  251

Query  288   IGNIAFAYAYSTVLIEIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGND  109
             +G+IAFAY+YS VLIEIQDT+RS P E+  MKKA+ I ++ TT+FY++CG +GYAAFG+ 
Sbjct  252   LGDIAFAYSYSVVLIEIQDTVRSPPSESTTMKKATKISIAVTTIFYMLCGSMGYAAFGDA  311

Query  108   APGNFLTGFGFYEPFWLIDVANICIAIHLVGAYQVF  1
             APGN LTGFGFY PFWL+D+AN  I +HL+GAYQVF
Sbjct  312   APGNLLTGFGFYNPFWLLDIANAAIVVHLIGAYQVF  347



>ref|XP_010491540.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   415 bits (1067),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 249/321 (78%), Gaps = 2/321 (1%)
 Frame = -1

Query  963  LKNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFF  784
             K FDDDG  KRTGT+ TASAHIITAVIGSGVLSL+WAIAQLGW AGPAV+  FSL+T +
Sbjct  35   FKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMILFSLVTLY  94

Query  783  TSALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASI  604
            +S LL+DCYR+   V+G RNYTYMD VRS LGG K ++CGL QY NL GI+IGYTI ASI
Sbjct  95   SSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAIGYTIAASI  154

Query  603  SMVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFA  424
            SM+A+K+SNCFHK+G    C + S P+M+IF   ++ LSQ+P+F ++ W+SIVAAVMSF 
Sbjct  155  SMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVTEIFLSQVPDFDQIWWISIVAAVMSFT  214

Query  423  YSSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLI  244
            YS+IG+ L I +VA +G    S     +    VT   KIWR FQA+G+IAFAY+YS VLI
Sbjct  215  YSAIGLALGIVQVAANGVFKGS--LTGISIGTVTQTQKIWRTFQALGDIAFAYSYSAVLI  272

Query  243  EIQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPF  64
            EIQDT+RS P E+  MKKA+ I ++ TT+FY++CG +GYAAFG+ APGN LTGFGFY PF
Sbjct  273  EIQDTVRSPPAESKTMKKATKISIAVTTMFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPF  332

Query  63   WLIDVANICIAIHLVGAYQVF  1
            WL+D+AN  I +HLVGAYQVF
Sbjct  333  WLLDIANAAIVVHLVGAYQVF  353



>dbj|BAJ93107.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=526

 Score =   416 bits (1069),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 250/319 (78%), Gaps = 1/319 (0%)
 Frame = -1

Query  957  NFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFTS  778
            + DDDG  +RTGT+ TASAH+ITAVIGSGVLSL W++AQLGW AGPA L  F+LIT++TS
Sbjct  73   SLDDDGKPRRTGTVWTASAHVITAVIGSGVLSLPWSVAQLGWVAGPATLLLFALITYYTS  132

Query  777  ALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASISM  598
             LL DCYRS   V G RNYTYMD V S LG  +V  CGL QY NLVG +IGYTITASIS 
Sbjct  133  VLLGDCYRSDDAVAGKRNYTYMDAVGSLLGKGQVWFCGLCQYVNLVGTAIGYTITASISA  192

Query  597  VAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAYS  418
             A+ K+NCFH  GH  DC V +  +M++F   Q+V SQ+PN HE++WLS++AAVMSF+YS
Sbjct  193  AALYKANCFHSKGHSADCGVYTTMYMVVFGISQIVFSQLPNLHEMAWLSMLAAVMSFSYS  252

Query  417  SIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIEI  238
            +IG+GLS+A+    G    +T+ G  +GVDVT A KIW   QA+GNIAFAY+YS VLIEI
Sbjct  253  TIGVGLSLAQTI-KGPTGKTTIGGTQIGVDVTSAQKIWLTLQALGNIAFAYSYSMVLIEI  311

Query  237  QDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFWL  58
            QDT+++ P EN  M+KA+ +GVSTTT FY++CGC+GY+AFGNDAPGN LTGFGFYEPFWL
Sbjct  312  QDTVKAPPAENKTMRKANLMGVSTTTAFYMLCGCLGYSAFGNDAPGNMLTGFGFYEPFWL  371

Query  57   IDVANICIAIHLVGAYQVF  1
            ID  N+CI +HLVGAYQV+
Sbjct  372  IDFTNVCIVVHLVGAYQVY  390



>emb|CDX87522.1| BnaA07g33510D [Brassica napus]
Length=476

 Score =   414 bits (1065),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 250/320 (78%), Gaps = 2/320 (1%)
 Frame = -1

Query  960  KNFDDDGHEKRTGTLVTASAHIITAVIGSGVLSLSWAIAQLGWAAGPAVLAAFSLITFFT  781
            K FDDDG  KRTG++ TASAHIITAVIGSGVLSL+WA AQLGW AGP V+  FS++T+FT
Sbjct  20   KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLAGPVVMLLFSIVTYFT  79

Query  780  SALLADCYRSPGPVTGTRNYTYMDVVRSHLGGVKVQLCGLSQYANLVGISIGYTITASIS  601
            S LLA CYRS  P++G RNYTYMD VRS+LGGVKV+LCG+ QY NL G++IGYTI ++IS
Sbjct  80   STLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQYLNLFGVAIGYTIASAIS  139

Query  600  MVAVKKSNCFHKNGHDFDCSVPSYPFMMIFAAIQLVLSQIPNFHELSWLSIVAAVMSFAY  421
            M+A+K+SNCFHK+G    C + S P+M+ F  +Q++ SQIP+F +L WLS++AAVMSF Y
Sbjct  140  MMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDFDQLWWLSVLAAVMSFTY  199

Query  420  SSIGIGLSIAKVAGSGRAANStltgvvvgvdvtGADKIWRCFQAIGNIAFAYAYSTVLIE  241
            SS G+ L IA+V  +G+   S     +    VT   KIWR FQA+G+IAFAY+YS +LIE
Sbjct  200  SSAGLALGIAQVVANGKVKGS--LTGISIGAVTETQKIWRSFQALGDIAFAYSYSIILIE  257

Query  240  IQDTLRSHPPENMVMKKASAIGVSTTTVFYVMCGCIGYAAFGNDAPGNFLTGFGFYEPFW  61
            IQDT++S P E   MKKA+ + V  TT+FY++CGC+GYAAFG+ +PGN LTGFGFY P+W
Sbjct  258  IQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDMSPGNLLTGFGFYNPYW  317

Query  60   LIDVANICIAIHLVGAYQVF  1
            L+D+AN  I +HLVGAYQV+
Sbjct  318  LLDIANAAIVVHLVGAYQVY  337



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3228071565840