BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16962_g1_i2 len=1193 path=[311:0-522 258:523-1192]

Length=1193
                                                                      Score     E

gb|ADV41672.1|  cysteine protease                                       391   1e-130   
ref|XP_009759551.1|  PREDICTED: zingipain-2-like                        391   1e-130   
ref|XP_004233054.1|  PREDICTED: senescence-specific cysteine prot...    389   6e-130   
ref|XP_006362420.1|  PREDICTED: vignain-like                            389   1e-129   
ref|XP_009608954.1|  PREDICTED: zingipain-2-like                        382   7e-127   
gb|AAW78661.2|  senescence-specific cysteine protease                   381   1e-126   Nicotiana tabacum [American tobacco]
gb|AGT97048.1|  senescence-specific cysteine protease                   381   1e-126   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                         366   2e-121   
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg             367   3e-121   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g             361   7e-119   Populus trichocarpa [western balsam poplar]
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g             357   2e-117   Populus trichocarpa [western balsam poplar]
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                        357   3e-117   
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...    357   5e-117   
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                        354   5e-116   
ref|NP_568651.1|  cysteine protease SAG12                               354   5e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                        353   6e-116   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...    353   7e-116   
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                        353   8e-116   
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g             353   1e-115   
ref|XP_006398274.1|  hypothetical protein EUTSA_v10000948mg             352   2e-115   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                     352   3e-115   
ref|XP_002865220.1|  senescence-associated gene 12                      352   3e-115   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...    352   4e-115   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...    352   5e-115   
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...    351   6e-115   
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g             350   8e-115   
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...    350   1e-114   
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...    349   2e-114   
gb|KDP23984.1|  hypothetical protein JCGZ_25372                         349   3e-114   
ref|XP_007048792.1|  Senescence-associated gene 12                      349   3e-114   
gb|AAC49135.1|  SAG12 protein                                           349   4e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                        349   4e-114   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g             349   7e-114   Populus trichocarpa [western balsam poplar]
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...    347   1e-113   
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g             347   2e-113   
gb|KFK31512.1|  hypothetical protein AALP_AA6G122300                    347   2e-113   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...    347   2e-113   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         347   3e-113   
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             347   3e-113   Populus trichocarpa [western balsam poplar]
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...    347   3e-113   Vitis vinifera
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                        347   4e-113   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                        345   7e-113   
emb|CAN64655.1|  hypothetical protein VITISV_005140                     345   7e-113   Vitis vinifera
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g             345   1e-112   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    345   2e-112   
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                        344   2e-112   
ref|XP_007048796.1|  Senescence-associated gene 12                      344   2e-112   
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...    344   4e-112   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         343   4e-112   
ref|XP_006469011.1|  PREDICTED: vignain-like                            342   1e-111   
emb|CDX87758.1|  BnaC02g31910D                                          342   2e-111   
ref|XP_009128825.1|  PREDICTED: ervatamin-B                             342   2e-111   
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...    342   2e-111   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    342   2e-111   
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             342   2e-111   
ref|XP_002523447.1|  cysteine protease, putative                        342   2e-111   Ricinus communis
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    342   3e-111   Vitis vinifera
ref|XP_002523448.1|  cysteine protease, putative                        342   3e-111   Ricinus communis
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...    342   3e-111   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    341   4e-111   
gb|AAD53011.1|AF089848_1  senescence-specific cysteine protease         341   4e-111   Brassica napus [oilseed rape]
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g             340   7e-111   
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    341   9e-111   
ref|XP_002522559.1|  cysteine protease, putative                        340   1e-110   Ricinus communis
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...    340   2e-110   Vitis vinifera
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g             339   2e-110   
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                        339   2e-110   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    339   2e-110   
ref|XP_002525123.1|  cysteine protease, putative                        339   3e-110   Ricinus communis
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                        339   3e-110   
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g             338   4e-110   Populus trichocarpa [western balsam poplar]
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g             337   4e-110   Populus trichocarpa [western balsam poplar]
dbj|BAF56430.1|  cysteine proteinase                                    338   5e-110   Lotus japonicus
ref|XP_006469012.1|  PREDICTED: vignain-like                            338   5e-110   
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...    337   7e-110   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g             338   8e-110   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             338   8e-110   
ref|XP_002531151.1|  cysteine protease, putative                        338   8e-110   Ricinus communis
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...    338   9e-110   Vitis vinifera
gb|AAT34987.1|  putative cysteine protease                              338   9e-110   Gossypium hirsutum [American cotton]
gb|KDP40484.1|  hypothetical protein JCGZ_24483                         337   1e-109   
emb|CAN70559.1|  hypothetical protein VITISV_032465                     337   1e-109   Vitis vinifera
gb|AAR92154.1|  putative cysteine protease 1                            337   1e-109   Iris x hollandica [Dutch iris]
ref|XP_007050065.1|  Senescence-associated gene 12                      337   2e-109   
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg             337   2e-109   
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                        337   2e-109   
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...    337   2e-109   
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...    337   3e-109   
dbj|BAF56428.1|  cysteine proteinase                                    336   3e-109   Lotus japonicus
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                     336   4e-109   
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg             336   5e-109   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                        336   6e-109   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                        336   6e-109   
dbj|BAF46311.1|  cysteine proteinase precursor                          335   6e-109   Ipomoea nil [qian niu]
emb|CDP18644.1|  unnamed protein product                                335   7e-109   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                        335   7e-109   
ref|XP_007025398.1|  Senescence-associated gene 12                      335   8e-109   
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2             335   1e-108   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...    335   1e-108   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1             335   1e-108   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    334   2e-108   
ref|XP_002531152.1|  cysteine protease, putative                        334   2e-108   Ricinus communis
ref|XP_007048674.1|  Senescence-associated gene 12                      334   2e-108   
gb|KHN38752.1|  Vignain                                                 333   3e-108   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                333   3e-108   
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                333   4e-108   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                        333   5e-108   
dbj|BAD29959.1|  cysteine protease                                      334   6e-108   Daucus carota [carrots]
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                        333   6e-108   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg             333   8e-108   
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                        333   8e-108   
gb|AAL14199.1|  cysteine proteinase precursor                           333   9e-108   Ipomoea batatas [batate]
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                        333   9e-108   
gb|AAA50755.1|  cysteine proteinase                                     332   1e-107   Alnus glutinosa
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g             332   1e-107   
gb|AAK27968.1|AF242372_1  cysteine protease                             332   2e-107   Ipomoea batatas [batate]
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                        332   2e-107   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g             332   2e-107   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...    332   2e-107   
gb|AFV30165.1|  cysteine proteinase                                     332   2e-107   
emb|CDP18645.1|  unnamed protein product                                331   2e-107   
ref|XP_003538185.1|  PREDICTED: vignain-like                            331   3e-107   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            331   3e-107   
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1            331   4e-107   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                        331   4e-107   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...    331   4e-107   
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                        331   4e-107   
emb|CDP18641.1|  unnamed protein product                                331   5e-107   
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g             331   5e-107   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg             330   5e-107   
ref|XP_006362426.1|  PREDICTED: vignain-like                            331   5e-107   
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                     330   6e-107   
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...    330   7e-107   Vitis vinifera
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                        330   7e-107   
ref|XP_010052201.1|  PREDICTED: ervatamin-B-like                        330   7e-107   
dbj|BAF56427.1|  cysteine proteinase                                    330   9e-107   Lotus japonicus
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                        330   9e-107   
gb|KHN13721.1|  Vignain                                                 329   1e-106   
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g             330   1e-106   
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg             330   1e-106   
ref|XP_007025415.1|  Senescence-associated gene 12, putative            330   1e-106   
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    330   1e-106   
ref|XP_003557016.1|  PREDICTED: vignain-like                            329   2e-106   
gb|KHN08187.1|  Thiol protease SEN102                                   328   2e-106   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                        329   2e-106   
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    329   2e-106   Vitis vinifera
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                        329   2e-106   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                         328   2e-106   
dbj|BAF56429.1|  cysteine proteinase                                    329   2e-106   Lotus japonicus
gb|AHA62780.1|  RCR3-like cysteine protease                             329   3e-106   
ref|XP_006592465.1|  PREDICTED: vignain-like                            329   3e-106   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg             328   5e-106   
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...    328   5e-106   
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...    328   7e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008340724.1|  PREDICTED: vignain-like                            327   8e-106   
ref|XP_002525124.1|  cysteine protease, putative                        328   8e-106   Ricinus communis
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...    328   8e-106   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g             328   8e-106   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                        327   1e-105   
gb|EMT33085.1|  Vignain                                                 327   1e-105   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...    327   2e-105   
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...    326   2e-105   Oryza sativa Indica Group [Indian rice]
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg             326   2e-105   
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                        326   2e-105   
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                     325   3e-105   
gb|AHA62781.1|  RCR3-like cysteine protease                             326   3e-105   
gb|KHN08873.1|  Vignain                                                 326   3e-105   
ref|XP_006582264.1|  PREDICTED: vignain-like                            326   3e-105   
emb|CDY58055.1|  BnaA06g40240D                                          325   3e-105   
gb|AHA62779.1|  RCR3-like cysteine protease                             326   3e-105   
ref|XP_008228922.1|  PREDICTED: vignain-like                            326   3e-105   
emb|CAL64936.1|  putative cysteine protease 8                           326   3e-105   Trifolium pratense [peavine clover]
ref|XP_009101555.1|  PREDICTED: ervatamin-B-like                        326   3e-105   
gb|EMT12294.1|  Vignain                                                 326   3e-105   
ref|XP_003612210.1|  Cysteine proteinase                                326   3e-105   
ref|XP_003539770.1|  PREDICTED: vignain-like                            326   3e-105   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...    326   4e-105   
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                        325   5e-105   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                        327   5e-105   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                        325   5e-105   
ref|XP_003539970.1|  PREDICTED: vignain-like                            325   5e-105   
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                        325   6e-105   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                        325   6e-105   
gb|ADV74756.1|  cysteine protease                                       326   6e-105   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                    325   6e-105   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg                325   7e-105   
ref|XP_006467666.1|  PREDICTED: vignain-like                            325   7e-105   
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like              325   8e-105   
gb|AAP32196.1|  cysteine protease 8                                     325   9e-105   Trifolium repens [creeping white clover]
ref|XP_004489011.1|  PREDICTED: vignain-like                            325   9e-105   
ref|XP_003539989.1|  PREDICTED: vignain-like                            325   9e-105   
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                        325   1e-104   
ref|XP_006582263.1|  PREDICTED: vignain-like                            325   1e-104   
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like              325   1e-104   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                        324   1e-104   
ref|XP_003607647.1|  Cysteine proteinase                                324   2e-104   
ref|XP_003605890.1|  Cysteine proteinase                                324   2e-104   
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like              324   2e-104   
gb|KHN32069.1|  Vignain                                                 323   2e-104   
emb|CAH66275.1|  OSIGBa0147O06.5                                        324   2e-104   Oryza sativa [red rice]
ref|XP_006652104.1|  PREDICTED: vignain-like                            324   3e-104   
ref|XP_003596314.1|  Cysteine proteinase                                323   3e-104   
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like              323   3e-104   
ref|XP_006360707.1|  PREDICTED: vignain-like                            323   3e-104   
ref|XP_010239696.1|  PREDICTED: senescence-specific cysteine prot...    323   3e-104   
ref|XP_006360708.1|  PREDICTED: vignain-like                            323   3e-104   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                        323   3e-104   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                        323   3e-104   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                        323   3e-104   
ref|XP_003527350.1|  PREDICTED: vignain-like                            323   4e-104   
gb|AHA62783.1|  RCR3-like cysteine protease                             323   4e-104   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                        323   4e-104   
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like              323   5e-104   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                        323   5e-104   
gb|AHA62782.1|  RCR3-like cysteine protease                             323   5e-104   
ref|XP_009361500.1|  PREDICTED: vignain-like                            323   6e-104   
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                        323   7e-104   
gb|AFK44139.1|  unknown                                                 323   7e-104   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...    322   8e-104   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...    322   8e-104   
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                        322   9e-104   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                        322   9e-104   
gb|KHN28095.1|  Thiol protease                                          322   1e-103   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like              322   1e-103   
ref|XP_003599736.1|  Cysteine proteinase                                322   2e-103   
ref|XP_006592467.1|  PREDICTED: vignain-like                            322   2e-103   
gb|KHN07750.1|  KDEL-tailed cysteine endopeptidase CEP1                 320   2e-103   
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...    321   2e-103   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                        321   2e-103   
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410          321   3e-103   Sorghum bicolor [broomcorn]
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like              321   3e-103   
ref|XP_004297571.1|  PREDICTED: vignain-like                            321   3e-103   
ref|XP_003527388.1|  PREDICTED: vignain-like                            321   4e-103   
ref|XP_004975184.1|  PREDICTED: vignain-like                            321   4e-103   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                        320   4e-103   
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like              320   4e-103   
ref|XP_003526208.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    320   4e-103   
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                321   4e-103   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...    320   5e-103   
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like              320   6e-103   
ref|XP_004306597.1|  PREDICTED: vignain-like                            320   6e-103   
ref|XP_009359967.1|  PREDICTED: vignain-like                            320   6e-103   
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...    320   7e-103   
ref|XP_003526232.1|  PREDICTED: vignain-like                            320   8e-103   
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like              320   9e-103   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                    323   9e-103   
ref|XP_004505498.1|  PREDICTED: vignain-like                            320   1e-102   
gb|EAY93078.1|  hypothetical protein OsI_14879                          320   1e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_006469128.1|  PREDICTED: vignain-like                            320   1e-102   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg             320   1e-102   
emb|CDP18638.1|  unnamed protein product                                319   1e-102   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            320   1e-102   
ref|XP_009349242.1|  PREDICTED: vignain-like                            324   2e-102   
gb|KHN12137.1|  Thiol protease                                          319   2e-102   
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like              319   2e-102   
emb|CAD40112.2|  OSJNBa0035O13.5                                        319   2e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g             319   2e-102   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg                318   2e-102   
dbj|BAD29955.1|  cysteine protease                                      320   2e-102   Daucus carota [carrots]
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    319   2e-102   
ref|XP_003556992.1|  PREDICTED: vignain-like                            319   2e-102   
gb|KCW84689.1|  hypothetical protein EUGRSUZ_B01506                     317   2e-102   
ref|XP_003527349.1|  PREDICTED: vignain-like                            319   2e-102   
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400          319   2e-102   
gb|KHN33935.1|  KDEL-tailed cysteine endopeptidase CEP1                 318   3e-102   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                        318   3e-102   
ref|XP_009365508.1|  PREDICTED: vignain-like                            325   3e-102   
ref|XP_004290089.1|  PREDICTED: vignain-like                            318   3e-102   
gb|EYU28078.1|  hypothetical protein MIMGU_mgv1a009081mg                319   3e-102   
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g             318   3e-102   
ref|XP_009797968.1|  PREDICTED: vignain-like                            318   3e-102   
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                        318   4e-102   
emb|CDP05747.1|  unnamed protein product                                318   4e-102   
gb|EMT20796.1|  Vignain                                                 320   4e-102   
gb|KHN27806.1|  Vignain                                                 317   4e-102   
ref|XP_003526215.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    318   5e-102   
ref|XP_008244477.1|  PREDICTED: zingipain-2-like                        318   5e-102   
ref|XP_003540013.1|  PREDICTED: vignain-like                            318   5e-102   
gb|EMT15489.1|  Thiol protease SEN102                                   318   6e-102   
ref|XP_004303175.1|  PREDICTED: vignain-like                            317   7e-102   
ref|XP_003609015.1|  Cysteine proteinase                                318   7e-102   
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890          317   1e-101   
ref|XP_006592475.1|  PREDICTED: vignain-like                            317   1e-101   
gb|KHN33962.1|  Vignain                                                 316   1e-101   
gb|AAM73806.1|AF448505_1  cysteine proteinase                           317   1e-101   
ref|XP_004506025.1|  PREDICTED: vignain-like                            317   1e-101   
ref|XP_010279091.1|  PREDICTED: ervatamin-B                             317   1e-101   
emb|CAH66233.1|  H0825G02.10                                            317   2e-101   
ref|XP_003607571.1|  Cysteine proteinase EP-B                           317   2e-101   
gb|EMS56453.1|  KDEL-tailed cysteine endopeptidase CEP1                 316   2e-101   
ref|NP_001239703.1|  uncharacterized protein LOC100799247 precursor     316   2e-101   
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                        316   2e-101   
dbj|BAG16376.1|  cysteine protease                                      316   3e-101   
emb|CBI21976.3|  unnamed protein product                                315   3e-101   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             316   4e-101   
emb|CDP18639.1|  unnamed protein product                                315   4e-101   
ref|XP_003607548.1|  Cysteine protease                                  316   4e-101   
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                        317   4e-101   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                        315   5e-101   
ref|XP_004505458.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    315   6e-101   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741    329   6e-101   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                        315   6e-101   
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                   314   7e-101   
ref|XP_010035848.1|  PREDICTED: zingipain-2-like                        315   7e-101   
gb|EMT29823.1|  Vignain                                                 315   7e-101   
ref|XP_007132822.1|  hypothetical protein PHAVU_011G127400g             315   7e-101   
gb|KHN13720.1|  Vignain                                                 313   8e-101   
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                        315   9e-101   
ref|XP_007214697.1|  hypothetical protein PRUPE_ppa026948mg             315   9e-101   
ref|XP_003607574.1|  Cysteine protease                                  315   9e-101   
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                        315   1e-100   
ref|XP_004487576.1|  PREDICTED: vignain-like                            314   1e-100   
ref|XP_004505502.1|  PREDICTED: vignain-like                            314   1e-100   
ref|XP_007132896.1|  hypothetical protein PHAVU_011G134100g             313   2e-100   
gb|AAP32195.1|  cysteine protease 5                                     314   2e-100   
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                     314   2e-100   
ref|XP_004975183.1|  PREDICTED: vignain-like                            314   2e-100   
gb|EMT20795.1|  Vignain                                                 314   2e-100   
gb|ABF70145.1|  cysteine protease, putative                             315   2e-100   
ref|XP_008663073.1|  PREDICTED: ervatamin-B-like                        314   2e-100   
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...    313   2e-100   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                        313   2e-100   
ref|XP_003581047.2|  PREDICTED: senescence-specific cysteine prot...    313   2e-100   
ref|XP_008669676.1|  PREDICTED: ervatamin-B-like                        313   3e-100   
ref|XP_007025397.1|  Senescence-associated gene 12, putative            312   3e-100   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             313   4e-100   
dbj|BAB13759.1|  cysteine proteinase                                    313   4e-100   
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070          313   4e-100   
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...    313   5e-100   
ref|XP_004487579.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    313   5e-100   
ref|XP_008368631.1|  PREDICTED: ervatamin-B-like                        313   6e-100   
gb|AGT16936.1|  vignain-like protein                                    313   6e-100   
gb|KHN32068.1|  Vignain                                                 311   6e-100   
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg                312   7e-100   
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g             312   7e-100   
gb|EMT29822.1|  Vignain                                                 312   7e-100   
ref|XP_007132818.1|  hypothetical protein PHAVU_011G127100g             312   9e-100   
ref|XP_004975182.1|  PREDICTED: vignain-like                            312   9e-100   
ref|XP_003526212.1|  PREDICTED: thiol protease SEN102-like              312   1e-99    
gb|AAP32198.1|  cysteine protease 12                                    312   1e-99    
ref|XP_003558756.1|  PREDICTED: senescence-specific cysteine prot...    312   1e-99    
emb|CBI21977.3|  unnamed protein product                                310   1e-99    
ref|XP_003578807.1|  PREDICTED: senescence-specific cysteine prot...    311   1e-99    
ref|XP_007132821.1|  hypothetical protein PHAVU_011G127300g             311   1e-99    
ref|XP_006362428.1|  PREDICTED: vignain-like                            311   1e-99    
gb|EMT29821.1|  Thiol protease SEN102                                   311   1e-99    
ref|XP_004306851.1|  PREDICTED: vignain-like                            311   2e-99    
ref|XP_006449486.1|  hypothetical protein CICLE_v10018236mg             310   2e-99    
ref|XP_004297572.1|  PREDICTED: vignain-like                            310   4e-99    
ref|XP_009407029.1|  PREDICTED: ervatamin-B-like                        310   4e-99    
ref|XP_004308524.1|  PREDICTED: vignain-like                            310   5e-99    
gb|KHN27801.1|  Vignain                                                 309   6e-99    
ref|XP_003599735.1|  Cysteine proteinase                                310   7e-99    
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3             309   7e-99    
ref|XP_003527330.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    310   8e-99    
ref|XP_004306813.1|  PREDICTED: vignain-like                            310   8e-99    
gb|KCW76125.1|  hypothetical protein EUGRSUZ_D00501                     312   1e-98    
ref|XP_004306836.1|  PREDICTED: vignain-like                            309   1e-98    
ref|XP_008228971.1|  PREDICTED: zingipain-2-like                        309   2e-98    
ref|XP_004505500.1|  PREDICTED: vignain-like                            309   2e-98    
ref|XP_003526217.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    308   3e-98    
ref|XP_003540991.1|  PREDICTED: vignain-like                            308   4e-98    
emb|CBI21973.3|  unnamed protein product                                307   5e-98    
ref|XP_004505522.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    307   8e-98    
dbj|BAG16370.1|  cysteine protease                                      306   1e-97    
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g             305   2e-97    
gb|KHN05669.1|  Vignain                                                 305   2e-97    
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                        306   2e-97    
gb|EMT08019.1|  Vignain                                                 305   3e-97    
gb|KHN27797.1|  Thiol protease SEN102                                   305   3e-97    
gb|EEC84514.1|  hypothetical protein OsI_31214                          306   3e-97    
ref|XP_007050023.1|  Cysteine proteinases superfamily protein, pu...    305   4e-97    
ref|XP_009366071.1|  PREDICTED: ervatamin-B-like                        305   7e-97    
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230          305   7e-97    
emb|CBI21972.3|  unnamed protein product                                303   9e-97    
gb|EMT09279.1|  Thiol protease SEN102                                   303   1e-96    
gb|KHN05670.1|  Vignain                                                 303   1e-96    
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...    304   1e-96    
ref|XP_010917956.1|  PREDICTED: ervatamin-B-like                        305   1e-96    
gb|KCW76118.1|  hypothetical protein EUGRSUZ_D00495                     304   1e-96    
ref|XP_007132874.1|  hypothetical protein PHAVU_011G132000g             303   1e-96    
ref|XP_004487577.1|  PREDICTED: vignain-like isoform X1                 303   2e-96    
ref|XP_006652103.1|  PREDICTED: cysteine protease 1-like                304   2e-96    
ref|XP_004294729.1|  PREDICTED: vignain-like                            303   2e-96    
ref|XP_003527331.1|  PREDICTED: vignain-like                            303   2e-96    
ref|XP_006446541.1|  hypothetical protein CICLE_v10015814mg             303   4e-96    
gb|ADP02218.1|  Peptidase_C1 domain-containing protein                  303   4e-96    
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...    303   4e-96    
ref|XP_003596711.1|  Cysteine proteinase                                303   5e-96    
ref|XP_008364019.1|  PREDICTED: zingipain-2-like                        303   5e-96    
ref|XP_008780645.1|  PREDICTED: vignain-like                            300   5e-96    
gb|KHN07749.1|  Vignain                                                 301   5e-96    
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934    315   6e-96    
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...    302   6e-96    
ref|XP_009366072.1|  PREDICTED: zingipain-2-like                        302   1e-95    
gb|KHN33932.1|  KDEL-tailed cysteine endopeptidase CEP1                 301   1e-95    
ref|XP_006470292.1|  PREDICTED: xylem cysteine proteinase 1-like ...    301   1e-95    
gb|EMT08022.1|  Vignain                                                 301   1e-95    
ref|XP_007214465.1|  hypothetical protein PRUPE_ppa023848mg             301   2e-95    
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g             300   3e-95    
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like              300   3e-95    
gb|EAY97106.1|  hypothetical protein OsI_19029                          300   5e-95    
ref|NP_001052232.2|  Os04g0203500                                       299   7e-95    
ref|XP_003540007.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    300   7e-95    
ref|NP_565649.1|  cysteine proteinase-like protein                      299   1e-94    
dbj|BAF46304.1|  cysteine proteinase precursor                          303   1e-94    
ref|NP_001274877.1|  low-temperature-induced cysteine proteinase-...    303   1e-94    
ref|XP_006470291.1|  PREDICTED: xylem cysteine proteinase 1-like ...    299   2e-94    
ref|XP_002880913.1|  hypothetical protein ARALYDRAFT_481640             298   2e-94    
gb|KHN34255.1|  KDEL-tailed cysteine endopeptidase CEP1                 298   2e-94    
gb|KDO55227.1|  hypothetical protein CISIN_1g019112mg                   298   2e-94    
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840          298   2e-94    
gb|ABA97421.1|  Vignain precursor, putative                             298   3e-94    
ref|XP_006342644.1|  PREDICTED: low-temperature-induced cysteine ...    302   4e-94    
ref|XP_009616844.1|  PREDICTED: zingipain-1-like                        298   4e-94    
ref|XP_011069730.1|  PREDICTED: low-temperature-induced cysteine ...    302   4e-94    
ref|XP_002436840.1|  hypothetical protein SORBIDRAFT_10g009830          297   4e-94    
ref|NP_001234324.1|  low-temperature-induced cysteine proteinase ...    301   5e-94    
ref|XP_004487578.1|  PREDICTED: vignain-like isoform X2                 297   6e-94    
emb|CBI30671.3|  unnamed protein product                                296   9e-94    
ref|XP_004505461.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    295   3e-93    
ref|XP_008229136.1|  PREDICTED: zingipain-2                             295   3e-93    
emb|CAD40110.2|  OSJNBa0035O13.9                                        294   3e-93    
gb|KCW76139.1|  hypothetical protein EUGRSUZ_D00515                     295   4e-93    
gb|AAX13273.1|  putative cysteine protease                              295   4e-93    
ref|XP_003635767.1|  Cysteine proteinase                                295   6e-93    
gb|EAY93080.1|  hypothetical protein OsI_14881                          293   6e-93    
gb|KCW76140.1|  hypothetical protein EUGRSUZ_D00517                     294   6e-93    
gb|KHN08598.1|  Cysteine proteinase RD21a                               298   6e-93    
gb|AAP32194.1|  cysteine protease 1                                     293   6e-93    
gb|EYU36326.1|  hypothetical protein MIMGU_mgv1a005614mg                299   7e-93    
ref|XP_004293931.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    294   8e-93    
ref|XP_002446132.1|  hypothetical protein SORBIDRAFT_06g002150          294   9e-93    
ref|XP_004232961.1|  PREDICTED: zingipain-2-like                        294   1e-92    
ref|XP_008811650.1|  PREDICTED: vignain-like                            292   1e-92    
dbj|BAD29954.1|  cysteine protease                                      298   2e-92    
gb|KFK31525.1|  hypothetical protein AALP_AA6G123900                    293   2e-92    
ref|XP_006362436.1|  PREDICTED: vignain-like                            293   2e-92    
ref|XP_008669668.1|  PREDICTED: ervatamin-B-like                        293   4e-92    
ref|XP_002446135.1|  hypothetical protein SORBIDRAFT_06g002170          292   4e-92    
ref|XP_007214244.1|  hypothetical protein PRUPE_ppa023515mg             292   4e-92    
ref|XP_008374352.1|  PREDICTED: vignain                                 293   5e-92    
ref|XP_010510777.1|  PREDICTED: ervatamin-B-like                        292   6e-92    
ref|XP_008392874.1|  PREDICTED: vignain-like                            292   1e-91    
gb|KGN62053.1|  hypothetical protein Csa_2G292830                       291   1e-91    
ref|XP_002446133.1|  hypothetical protein SORBIDRAFT_06g002160          290   2e-91    
ref|XP_011088223.1|  PREDICTED: low-temperature-induced cysteine ...    295   2e-91    
ref|XP_007025413.1|  Maternal effect embryo arrest 18                   308   2e-91    
ref|XP_010093524.1|  Germination-specific cysteine protease 1           291   2e-91    
ref|XP_010557424.1|  PREDICTED: ervatamin-B-like                        290   3e-91    
ref|XP_006470296.1|  PREDICTED: xylem cysteine proteinase 1-like        290   3e-91    
emb|CDP15898.1|  unnamed protein product                                291   3e-91    
ref|XP_002525147.1|  cysteine protease, putative                        290   3e-91    
ref|XP_009109364.1|  PREDICTED: cysteine proteinase COT44-like          291   3e-91    
ref|XP_008790576.1|  PREDICTED: ervatamin-B-like                        291   3e-91    
ref|XP_008805113.1|  PREDICTED: vignain-like                            291   3e-91    
ref|XP_004957245.1|  PREDICTED: vignain-like                            290   4e-91    
emb|CDY50157.1|  BnaA01g26170D                                          293   4e-91    
gb|KHG18408.1|  Cysteinease RD21a -like protein                         291   4e-91    
ref|XP_010054326.1|  PREDICTED: zingipain-2-like                        292   4e-91    
ref|XP_008239373.1|  PREDICTED: vignain-like                            290   4e-91    
gb|KEH44128.1|  papain family cysteine protease                         294   5e-91    
ref|XP_007209277.1|  hypothetical protein PRUPE_ppa007566mg             290   5e-91    
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg             290   5e-91    
ref|XP_010437247.1|  PREDICTED: germination-specific cysteine pro...    291   5e-91    
ref|XP_002883178.1|  hypothetical protein ARALYDRAFT_479457             293   5e-91    
ref|XP_007145379.1|  hypothetical protein PHAVU_007G234100g             293   6e-91    
ref|XP_006339859.1|  PREDICTED: cysteine proteinase RD21a-like          290   6e-91    
ref|XP_011000142.1|  PREDICTED: cysteine proteinase RD21a-like          294   7e-91    
gb|AAC35211.1|  cysteine proteinase                                     290   7e-91    
emb|CDY22445.1|  BnaC03g61580D                                          290   7e-91    
ref|XP_007047371.1|  Granulin repeat cysteine protease family pro...    290   8e-91    
gb|AFW57869.1|  hypothetical protein ZEAMMB73_830006                    292   8e-91    
ref|XP_011074404.1|  PREDICTED: low-temperature-induced cysteine ...    293   8e-91    
ref|XP_010417893.1|  PREDICTED: ervatamin-B-like                        289   1e-90    
ref|XP_006411912.1|  hypothetical protein EUTSA_v10025483mg             290   1e-90    
gb|AER60490.1|  cysteine proteases                                      290   1e-90    
ref|XP_003607546.1|  Cysteine proteinase                                289   1e-90    
ref|XP_004148072.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    288   1e-90    
ref|XP_008364021.1|  PREDICTED: ervatamin-B-like                        289   2e-90    
ref|XP_008458487.1|  PREDICTED: ervatamin-B-like                        288   2e-90    
ref|XP_006294508.1|  hypothetical protein CARUB_v10023540mg             288   2e-90    
gb|KEH31479.1|  papain family cysteine protease                         289   2e-90    
dbj|BAC75924.1|  cysteine protease-2                                    289   2e-90    
ref|XP_002990132.1|  hypothetical protein SELMODRAFT_428615             289   2e-90    
emb|CAE03344.2|  OSJNBb0005B05.11                                       287   2e-90    
ref|XP_010686292.1|  PREDICTED: zingipain-2-like                        288   2e-90    
ref|XP_011100224.1|  PREDICTED: zingipain-2                             288   2e-90    
ref|XP_004169046.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    287   2e-90    
emb|CDX95457.1|  BnaC01g33490D                                          291   2e-90    
ref|XP_002436842.1|  hypothetical protein SORBIDRAFT_10g009850          286   2e-90    
ref|XP_002298740.2|  hypothetical protein POPTR_0001s30950g             292   3e-90    
ref|XP_004496965.1|  PREDICTED: cysteine proteinase RD21a-like is...    292   3e-90    
ref|XP_006849385.1|  hypothetical protein AMTR_s01332p00008900          288   3e-90    
ref|XP_006362435.1|  PREDICTED: fruit bromelain-like                    288   3e-90    
ref|XP_004234718.1|  PREDICTED: cysteine proteinase COT44-like          289   3e-90    
gb|AAB23155.1|  COT44=cysteine proteinase homolog                       287   3e-90    
sp|P25251.1|CYSP4_BRANA  RecName: Full=Cysteine proteinase COT44;...    287   3e-90    
ref|XP_002450949.1|  hypothetical protein SORBIDRAFT_05g021550          288   4e-90    
ref|XP_008381611.1|  PREDICTED: ervatamin-B                             288   4e-90    



>gb|ADV41672.1| cysteine protease [Nicotiana tabacum]
Length=349

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 209/354 (59%), Positives = 253/354 (71%), Gaps = 17/354 (5%)
 Frame = +2

Query  68    SKILGSSLLFITTIILGVWSYLVAST--FDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             S+ L  +L FI    LGVW   VAS+   +Y+ SMR RH QW+A+H KVY D  E +MRF
Sbjct  7     SQYLCLALFFI---FLGVWRSQVASSRPINYEASMRARHDQWIAHHDKVYKDLNEKEMRF  63

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NVERIE FNAG +KGYKLGVNKF+DLTN++FR LH   GY  R + KV   MS+S
Sbjct  64    KIFKENVERIEAFNAGEDKGYKLGVNKFSDLTNEKFRVLHT--GY-KRSHPKV---MSSS  117

Query  422   KSK-HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             K K HFRYAN T++P T+DWR KGAVTPIKDQ  CG CWAF+ VAA EG+H+LKTG L+ 
Sbjct  118   KPKTHFRYANVTDIPPTMDWRKKGAVTPIKDQKECGCCWAFSAVAATEGLHQLKTGKLIP  177

Query  599   LSEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             LSEQELVDCD   +  GC GG   +AF FI+ N GLTTE NYPYKG +  VCN  K+A  
Sbjct  178   LSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKGLTTEANYPYKG-EDGVCNKKKSALS  236

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
             A +I+GYE VPA +E AL+QAVA+QPV + I+G  F F+FY  GVFSG C   L+H    
Sbjct  237   AAKIAGYEDVPANSEKALLQAVANQPVSVAIDGSSFDFQFYSSGVFSGSCSTWLNH--AV  294

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G  A   G KYW+IKNSWG++WG++GYMRI+RD  +K+GLCGLA  ASYPT
Sbjct  295   TAVGYGATTDGTKYWIIKNSWGSKWGDSGYMRIKRDVHEKEGLCGLAMDASYPT  348



>ref|XP_009759551.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=349

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 209/354 (59%), Positives = 253/354 (71%), Gaps = 17/354 (5%)
 Frame = +2

Query  68    SKILGSSLLFITTIILGVWSYLVAST--FDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             S+ L  +L FI    LGVW   VAS+   +Y+ SMR RH QW+A+H KVY D  E +MRF
Sbjct  7     SQYLCLALFFI---FLGVWRSQVASSRPINYEASMRARHDQWIAHHDKVYKDLNEKEMRF  63

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NVERIE FNAG +KGYKLGVNKF+DLTN++FR LH   GY  R + KV   MS+S
Sbjct  64    KIFKENVERIEAFNAGEDKGYKLGVNKFSDLTNEKFRVLHT--GY-KRSHPKV---MSSS  117

Query  422   KSK-HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             K K HFRYAN T++P T+DWR KGAVTPIKDQ  CG CWAF+ VAA EG+H+LKTG L+ 
Sbjct  118   KPKTHFRYANVTDIPPTMDWRKKGAVTPIKDQKECGCCWAFSAVAATEGLHQLKTGKLIP  177

Query  599   LSEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             LSEQELVDCD   +  GC GG   +AF FI+ N GLTTE NYPYKG +  VCN  K+A  
Sbjct  178   LSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKGLTTEANYPYKG-EDGVCNKKKSALS  236

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
             A +I+GYE VPA +E AL+QAVA+QPV + I+G  F F+FY  GVFSG C   L+H    
Sbjct  237   AAKIAGYEDVPANSEKALLQAVANQPVSVAIDGSSFDFQFYSSGVFSGSCSTWLNH--AV  294

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G  A   G KYW+IKNSWG++WG++GYMRI+RD  +K+GLCGLA  ASYPT
Sbjct  295   TAVGYGATSDGTKYWIIKNSWGSKWGDSGYMRIKRDVHEKEGLCGLAMDASYPT  348



>ref|XP_004233054.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=351

 Score =   389 bits (1000),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 203/354 (57%), Positives = 251/354 (71%), Gaps = 16/354 (5%)
 Frame = +2

Query  68    SKILGSSLLFITTIILGVWSYLVAST--FDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             SK +  +L FI   + G+WS  +AS+   + + +MR+RH+QW+A+H K+Y D  E ++RF
Sbjct  8     SKYICLALFFI---VFGLWSSQLASSRPINNETTMRVRHEQWIAHHDKIYNDLKEKEIRF  64

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NVERIETFNAG +KGYKLGVNKFADLTN+EFR LH   GY    + K+   MS+S
Sbjct  65    KIFKENVERIETFNAGEDKGYKLGVNKFADLTNEEFRVLHT--GYKSSSHPKI---MSSS  119

Query  422   KSK-HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             K K HFRYAN T++P  +DWR KGAVTPIKDQ  CG CWAF+ VAA+EG+H+LKTG L+ 
Sbjct  120   KPKTHFRYANITDVPPIMDWRRKGAVTPIKDQMECGCCWAFSAVAAMEGLHQLKTGKLIP  179

Query  599   LSEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             LSEQELVDCD   +  GC GG   +AFQFI+ N GLTTE NYPY+     VCN  K+A  
Sbjct  180   LSEQELVDCDVEGEDLGCTGGLLDTAFQFIIKNKGLTTEANYPYQAADG-VCNKKKSALS  238

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
               +I+GYE VPA NE AL+QAVA+QPV + I+G  F F+FY  GVFSG C   L+H    
Sbjct  239   VAKITGYEDVPANNEKALLQAVANQPVSVAIDGSSFDFQFYSSGVFSGSCSTWLNH--AV  296

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G  A   G KYW+IKNSWG++WGENGY  ++RD  DKKGLCGLA  ASYPT
Sbjct  297   TAVGYGAASDGTKYWIIKNSWGSKWGENGYAHMKRDIDDKKGLCGLAMKASYPT  350



>ref|XP_006362420.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=347

 Score =   389 bits (999),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/354 (57%), Positives = 250/354 (71%), Gaps = 20/354 (6%)
 Frame = +2

Query  68    SKILGSSLLFITTIILGVWSYLVAST--FDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             SK +  + LF+   + G+WS  + S+   +Y+ +MR+RH+QW+A+H K+Y D  E +MRF
Sbjct  8     SKYICLAFLFL---VFGLWSSQLVSSRPINYETTMRVRHEQWIAHHDKIYNDLKEKEMRF  64

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NV+RIETFNAG +KGYKLGVNKFADLTN+EFR +H   GY          FMS+S
Sbjct  65    KIFKENVKRIETFNAGEDKGYKLGVNKFADLTNEEFRVVHT--GYK-------SSFMSSS  115

Query  422   KSK-HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             K K HFRYAN T++P T+DWR KGAVTPIKDQ  CGSCWAF+ VAA+EG+H++ TG L+ 
Sbjct  116   KPKTHFRYANITDVPPTMDWRKKGAVTPIKDQMECGSCWAFSAVAAMEGVHQVTTGKLIP  175

Query  599   LSEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             LSEQELVDCD   +  GC GG   +AFQFI+ N GLTTE NYPY+     VCN  K+A  
Sbjct  176   LSEQELVDCDVEGEDVGCTGGLLDTAFQFIIKNKGLTTEANYPYEAADG-VCNKKKSAVS  234

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
               +I+GYE VPA NE AL+QAVA+QPV + I+G  F F+FY  GVFSG C   L+H    
Sbjct  235   VAKITGYEDVPANNEKALLQAVANQPVSVAIDGSSFDFQFYSSGVFSGSCSTWLNH--AV  292

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G  A   G KYW+IKNSWG++WGENGY  ++RD  DKKGLCGLA  ASYPT
Sbjct  293   TAVGYGAASDGAKYWIIKNSWGSKWGENGYAHMKRDIDDKKGLCGLAMKASYPT  346



>ref|XP_009608954.1| PREDICTED: zingipain-2-like [Nicotiana tomentosiformis]
Length=349

 Score =   382 bits (980),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 203/354 (57%), Positives = 251/354 (71%), Gaps = 17/354 (5%)
 Frame = +2

Query  68    SKILGSSLLFITTIILGVWSYLVAST--FDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             S+ L  +L FI    LG+WS  VA +   +Y+ +MR RH QW+ +H KVY D  E ++RF
Sbjct  7     SQYLCLALFFI---FLGLWSSQVALSRPINYEATMRARHDQWIVHHEKVYKDLNEKEVRF  63

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NVERIE FNAG +KGYKLG NKF+DLTN+EFR LH   GY  R + KV   M++S
Sbjct  64    QIFKENVERIEAFNAGEDKGYKLGFNKFSDLTNEEFRVLHT--GY-KRSHPKV---MTSS  117

Query  422   KSK-HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             K K HFRY N T++P T+DWR KGAVTPIKDQ  CG CWAF+ VAA+EG+H+LKTG L+ 
Sbjct  118   KGKTHFRYTNVTDIPPTMDWRKKGAVTPIKDQKECGCCWAFSAVAAMEGLHQLKTGELIP  177

Query  599   LSEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             LSEQELVDCD   +  GC GG   +AF FI+ N GLTTE NYPYKG +  VCN  K+A  
Sbjct  178   LSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKGLTTEVNYPYKG-EDGVCNKKKSALS  236

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
             A +I+GYE VPA +E AL+QAVA+QPV + I+G  F F+FY  GVFSG C   L+H    
Sbjct  237   AAKITGYEDVPANSEKALLQAVANQPVSVAIDGSSFDFQFYSSGVFSGSCSTWLNH--AV  294

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G  A   G KYW+IKNSWG++WG++GYMRI+RD  +K+GLCGLA  ASYPT
Sbjct  295   TAVGYGATTDGTKYWIIKNSWGSKWGDSGYMRIKRDVHEKEGLCGLAMDASYPT  348



>gb|AAW78661.2| senescence-specific cysteine protease [Nicotiana tabacum]
Length=349

 Score =   381 bits (979),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 203/354 (57%), Positives = 251/354 (71%), Gaps = 17/354 (5%)
 Frame = +2

Query  68    SKILGSSLLFITTIILGVWSYLVAST--FDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             S+ L  +L FI    LG+WS  VA +   +Y+ +MR RH QW+ +H KVY D  E ++RF
Sbjct  7     SQYLCLALFFI---CLGLWSSQVALSRPINYEATMRARHDQWIVHHEKVYKDLNEKEVRF  63

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NVERIE FNAG +KGYKLG NKF+DLTN+EFR LH   GY  R + KV   M++S
Sbjct  64    QIFKENVERIEAFNAGEDKGYKLGFNKFSDLTNEEFRVLHT--GY-KRSHPKV---MTSS  117

Query  422   KSK-HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             K K HFRY N T++P T+DWR KGAVTPIKDQ  CG CWAF+ VAA+EG+H+LKTG L+ 
Sbjct  118   KGKTHFRYTNVTDIPPTMDWRKKGAVTPIKDQKECGCCWAFSAVAAMEGLHQLKTGELIP  177

Query  599   LSEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             LSEQELVDCD   +  GC GG   +AF FI+ N GLTTE NYPYKG +  VCN  K+A  
Sbjct  178   LSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKGLTTEVNYPYKG-EDGVCNKKKSALS  236

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
             A +I+GYE VPA +E AL+QAVA+QPV + I+G  F F+FY  GVFSG C   L+H    
Sbjct  237   AAKITGYEDVPANSEKALLQAVANQPVSVAIDGSSFDFQFYSSGVFSGSCSTWLNH--AV  294

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G  A   G KYW+IKNSWG++WG++GYMRI+RD  +K+GLCGLA  ASYPT
Sbjct  295   TAVGYGATTDGTKYWIIKNSWGSKWGDSGYMRIKRDVHEKEGLCGLAMDASYPT  348



>gb|AGT97048.1| senescence-specific cysteine protease [Capsicum annuum]
Length=347

 Score =   381 bits (978),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 206/357 (58%), Positives = 251/357 (70%), Gaps = 17/357 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQH---SMRLRHQQWMAYHGKVYVDTYEAD  232
             MA   L  +L FI+   LG+WS  VAS     +   SMR RH+QW+A+H KVY +  E +
Sbjct  1     MAFANLCLALFFIS---LGLWSSQVASPRPIHYDATSMRARHEQWIAHHEKVYNNLNEKE  57

Query  233   MRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFM  412
             MR  IF+ NVERIETFNAG +KGYKLGVNKFADLTN+EFR LHL  GY    + KV   M
Sbjct  58    MRSKIFKENVERIETFNAGEDKGYKLGVNKFADLTNEEFRVLHL--GYKWSSHPKV---M  112

Query  413   SASK-SKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGN  589
             S+SK + HFRYAN T++P T+DWR KGAVTPIKDQ +CG CWAF+ VAA+E +H+LKTG 
Sbjct  113   SSSKPNTHFRYANVTDIPPTMDWRKKGAVTPIKDQKDCGCCWAFSAVAAMESLHQLKTGK  172

Query  590   LVSLSEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKT  763
             L  LSEQELVDCD   +  GC GG   +AF+FI+ N GLTTE NYPY+G    VCN  K+
Sbjct  173   LNPLSEQELVDCDVEGEDVGCSGGLLDTAFKFIMKNKGLTTEANYPYEGAD-GVCNKKKS  231

Query  764   ASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHg  943
             A  A +I+GYE VPA NE AL+QAVA+QPV + I+G  F F+ Y  GVFSG C   L+H 
Sbjct  232   AVSAAKITGYEDVPANNEKALLQAVANQPVSVAIDGSSFDFQSYSSGVFSGSCSTWLNH-  290

Query  944   vtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                   G  A   G KYW+IKNSWG++WGENGY+ ++RD  D++GLCGLA  ASYPT
Sbjct  291   -AVTAVGYGATSDGTKYWIIKNSWGSKWGENGYIHMKRDIDDREGLCGLAMEASYPT  346



>gb|KDP45355.1| hypothetical protein JCGZ_09604 [Jatropha curcas]
Length=311

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 235/319 (74%), Gaps = 11/319 (3%)
 Frame = +2

Query  164   MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTND  343
             M  RH++W A HG+VY DT E   ++ +F++N+ERIE+FN G ++GYKLG+NKFADLT++
Sbjct  1     MLKRHEEWRAQHGRVYKDTAEKQKKYLVFKDNLERIESFNNGVDRGYKLGLNKFADLTDE  60

Query  344   EFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNC  523
             EF+ +HL  GY    ++     MS SKS+ FRY N T++P+T+DWR  GAVTP+KDQG+C
Sbjct  61    EFQAMHL--GYKSPPSK----LMSTSKSRSFRYRNVTSVPTTIDWRKAGAVTPVKDQGSC  114

Query  524   GSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD--RKSYGCDGGFPISAFQFIVNNNG  697
             GSCWAF+ VAA+EGI KLKTGNL+SLSEQELVDCD   + YGCDGGF  +AFQ+I+ N G
Sbjct  115   GSCWAFSAVAAMEGITKLKTGNLISLSEQELVDCDVAGEDYGCDGGFMDTAFQYILKNGG  174

Query  698   LTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGGD  877
             LT+E NYPY+G +  +C+  KTA+   +I+GYE VP+ +E AL+QAVA+QPV + I+   
Sbjct  175   LTSEANYPYQG-EDGICSKKKTATSMAKITGYEDVPSNSEKALLQAVANQPVSVAIDASG  233

Query  878   FHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQR  1057
             + FRFY  GVF G C   L+H       G  +   G KYW++KNSWGT WGENGYMR+QR
Sbjct  234   YDFRFYSSGVFKGDCPTDLNH--AVTVIGYGSSSDGTKYWLLKNSWGTGWGENGYMRMQR  291

Query  1058  DYADKKGLCGLAKAASYPT  1114
             + +  +GLCG+A  ASYPT
Sbjct  292   EISANEGLCGIAMKASYPT  310



>ref|XP_006281607.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
 gb|EOA14505.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
Length=346

 Score =   367 bits (942),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 188/356 (53%), Positives = 242/356 (68%), Gaps = 14/356 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGV-WSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMR  238
             MA K+  + + F+ +++L   +S  ++   D +  M+  H  WM  HG+VY D  E   R
Sbjct  1     MAFKL--AQIFFLVSLVLSTCFSITLSRPLDNELVMQKMHFDWMTKHGRVYADMKEQKNR  58

Query  239   FNIFRNNVERIETFNAGP-NKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMS  415
             + +F++NVERIE  N+ P  + YKL VN+FADLTNDEFR +H   GY G  +   +   S
Sbjct  59    YAVFKSNVERIELLNSMPAGRTYKLAVNQFADLTNDEFRSMHT--GYKGVSSLSSQ---S  113

Query  416   ASKSKHFRYANATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGN  589
              +K+  FRY N ++  LP+++DWR KGAVTPIKDQG+CG CWAF+VVAA+EG  ++K G 
Sbjct  114   QTKTTLFRYQNVSSGALPTSIDWRTKGAVTPIKDQGSCGCCWAFSVVAAIEGAAQIKKGK  173

Query  590   LVSLSEQELVDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTAS  769
             L+SLSEQ+LVDCD   YGC+GG   +AF  I    GLTTE NYPYKG +   CN  KT+ 
Sbjct  174   LISLSEQQLVDCDPNDYGCEGGLMDTAFAHIKATGGLTTESNYPYKG-EDATCNSKKTSP  232

Query  770   KAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvt  949
             KA  I+GYE VPA +E+ALM+AVAHQPV + I GG F F+FY  GVFSG+C  +LDH   
Sbjct  233   KATTITGYEDVPANDESALMKAVAHQPVSVAIEGGGFAFQFYSSGVFSGECTTNLDH--A  290

Query  950   avgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
                 G      G KYW+IKNSWGT+WGE+GYMRIQ+D  DK+GLCGLA  ASYPTI
Sbjct  291   VTAVGYGETTNGSKYWIIKNSWGTKWGESGYMRIQKDIKDKQGLCGLAMEASYPTI  346



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score =   361 bits (926),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 239/352 (68%), Gaps = 14/352 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVAS-TFDYQHSMRLRHQQWMAYHGKVYVDTYEADMR  238
             MA+K   + +     +IL  W+  +A    D Q  M  RH++WMA HG+VY D  E + R
Sbjct  1     MAAKKCNTRIFLPFLLILAAWATKIACRPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEKR  60

Query  239   FNIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSA  418
             + IF+ N+ERIE FN G ++GYKLGVNKFADLTN+EFR ++   GY  RQ+ K+   MS+
Sbjct  61    YLIFKENIERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMYH--GYK-RQSSKL---MSS  114

Query  419   SKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             S    FRY N +++P+++DWRN GAVTP+KDQG CG CWAF+ VAA+EGI KL+TGNL+S
Sbjct  115   S----FRYENLSDIPTSMDWRNDGAVTPVKDQGTCGCCWAFSTVAAIEGIIKLQTGNLIS  170

Query  599   LSEQELVDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAV  778
             LSEQ+LVDC   + GC GG   +AFQ+I+ N GLT+E+NYPY+G     C+  K AS   
Sbjct  171   LSEQQLVDCTAGNKGCQGGLMDTAFQYIIRNGGLTSEDNYPYQGVDG-TCSSEKAASTEA  229

Query  779   RISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavg  958
             +I+GYE VP  NE AL+QAVA QPV + + GG   F+FY+ GVF G C  +L+H      
Sbjct  230   QITGYEDVPQNNENALLQAVAKQPVSVAVEGGGHDFQFYKSGVFEGDCGTNLNH--AVTA  287

Query  959   ygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G      G  YW++KNSWGT WGENGYMR++R     +GLCG+AK ASYPT
Sbjct  288   IGYGTDSDGTDYWLVKNSWGTSWGENGYMRMRRGIGSSEGLCGVAKDASYPT  339



>ref|XP_002305072.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
 gb|EEE85583.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
Length=340

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/352 (52%), Positives = 238/352 (68%), Gaps = 14/352 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVAS-TFDYQHSMRLRHQQWMAYHGKVYVDTYEADMR  238
             MA+K   + +     +IL  W+  +A    D Q  M  RH++WMA HG+VY D  E + R
Sbjct  1     MAAKKCNTRIFVPFLLILAAWATKIACRPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEKR  60

Query  239   FNIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSA  418
             + IF+ N+ERIE FN G ++GYKLGVNKFADLTN+EFR ++   GY  RQ+ K+   MS+
Sbjct  61    YLIFKENIERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMYH--GYK-RQSSKL---MSS  114

Query  419   SKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             S    FRY N +++P+++DWRN GAVTP+KDQG CG CWAF+ VAA+EGI KL+TGNL+S
Sbjct  115   S----FRYENLSDIPTSMDWRNDGAVTPVKDQGTCGCCWAFSTVAAIEGIIKLQTGNLIS  170

Query  599   LSEQELVDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAV  778
             LSEQ+LVDC   + GC GG   +AFQ+I+ N GLT+E+NYPY+G     C+  K AS   
Sbjct  171   LSEQQLVDCTAGNKGCQGGHMDTAFQYIIRNGGLTSEDNYPYQGVDG-TCSSEKAASTEA  229

Query  779   RISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavg  958
             +I+GYE VP  NE AL+QAVA QPV + + GG   F+FY+ GVF G C  +L+H      
Sbjct  230   QITGYEDVPQNNENALLQAVAKQPVSVAVEGGGHDFQFYKSGVFEGDCGTNLNH--AVTA  287

Query  959   ygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G      G  YW++KNSWGT WGENGYMR++R     +GLCG+A  ASYPT
Sbjct  288   IGYGTDSDGTDYWLVKNSWGTSWGENGYMRMRRGIGSSEGLCGVAMDASYPT  339



>ref|XP_010054320.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76122.1| hypothetical protein EUGRSUZ_D00499 [Eucalyptus grandis]
Length=345

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 193/346 (56%), Positives = 243/346 (70%), Gaps = 11/346 (3%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             L S+ L +  II+ V S  +    + +H ++ +H++WMA HG+VY D  E   R+ IF+ 
Sbjct  10    LTSAALLV--IIVSV-SETLCRPLEEEHLLK-QHEEWMAIHGRVYKDAVEKAKRYEIFKE  65

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHF  436
             NV+RI  FN G + GYKL VNKFADLTN+EFR  +   GY  R  +     +S+ + K F
Sbjct  66    NVKRINAFNNGKDVGYKLAVNKFADLTNEEFRASYT--GYKRRPTR----VLSSGEKKPF  119

Query  437   RYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQEL  616
             +YAN T +P+ +DWR K AVTP+KDQGNCGSCWAF+ VAA+EGI  +K G LV LS QEL
Sbjct  120   KYANFTAIPAALDWRTKKAVTPVKDQGNCGSCWAFSAVAAMEGITMIKKGKLVPLSVQEL  179

Query  617   VDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYE  796
             VDCD    GC GG   SAF+FIV+N GLTTE NYPY+G     CN  KTA++A  I+GY+
Sbjct  180   VDCDDNDDGCMGGLMDSAFEFIVSNGGLTTEANYPYQGIDG-TCNTAKTANQAASITGYQ  238

Query  797   RVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttag  976
              VPA NE AL+QAVA+QPV + I GG ++F+FY  GVF+G C   +DH VTAVGYG T+G
Sbjct  239   DVPANNEKALLQAVANQPVSVAIEGGGYNFQFYSSGVFTGSCGTDIDHAVTAVGYGKTSG  298

Query  977   dggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              GG KYW++KNSWGT WGE GYMRIQ+D + K GLCGLA  ASYPT
Sbjct  299   SGGTKYWLMKNSWGTGWGEKGYMRIQKDVSSKAGLCGLATEASYPT  344



>ref|XP_010441658.1| PREDICTED: senescence-specific cysteine protease SAG12 [Camelina 
sativa]
Length=346

 Score =   357 bits (915),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 239/356 (67%), Gaps = 14/356 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGV-WSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMR  238
             MA K++   + F+ ++IL + +S  ++   D +  M+ RH +WM  HG+VY D  E + R
Sbjct  1     MAFKLM--QVCFLVSLILSICFSIALSRPLDNELIMQKRHIEWMTKHGRVYADMKEKNNR  58

Query  239   FNIFRNNVERIETFNAGP-NKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMS  415
             + +F++NVERIE  N+ P  + +KL VN+FADLTNDEFR +     Y G +       + 
Sbjct  59    YAVFKSNVERIELLNSMPAGRTFKLAVNQFADLTNDEFRSM-----YTGYKGVSTLPSLG  113

Query  416   ASKSKHFRYANATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGN  589
              +K++ FRY N ++  LP +VDWR KGAVTPIKDQ +CG CWAF+ VAA+EG  ++K G 
Sbjct  114   QTKTRAFRYQNVSSGSLPISVDWRTKGAVTPIKDQRSCGCCWAFSAVAAIEGAAQIKKGK  173

Query  590   LVSLSEQELVDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTAS  769
             L+SLSEQ+LVDCD   +GCDGG   +AF+ I    GLTTE NYPYKG +   CN  KT  
Sbjct  174   LISLSEQQLVDCDTNDFGCDGGLMDTAFEHIKATGGLTTESNYPYKG-EDGTCNSKKTNP  232

Query  770   KAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvt  949
             KA  I+GYE VPA +E ALM+AVAHQPV + I GG F F+FY  GVF+G+C  +LDH   
Sbjct  233   KATSITGYEDVPANDENALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDH--A  290

Query  950   avgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
                 G      G KYW+IKNSWGT+WGE+GYMRIQ+D   K+GLCGLA  ASYPT+
Sbjct  291   VTAIGYGESTNGSKYWIIKNSWGTKWGESGYMRIQKDVKAKEGLCGLAMKASYPTL  346



>ref|XP_010052199.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76124.1| hypothetical protein EUGRSUZ_D00500 [Eucalyptus grandis]
Length=345

 Score =   354 bits (908),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 190/343 (55%), Positives = 238/343 (69%), Gaps = 10/343 (3%)
 Frame = +2

Query  95    FITTIILGVWSYLVASTFDY---QHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             F+T+  L V    V+ T      +  +  +H++WMA HG+VY DT E   R+ IF+ NV+
Sbjct  9     FLTSAALLVIIVSVSKTLCRPLEEEQLLKQHEEWMAIHGRVYKDTVEKAKRYEIFKENVK  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RI  FN G + GYK+ VNKFADLTN+EFR  +   GY  R  +     +S+ + K F+YA
Sbjct  69    RINAFNNGKDVGYKMAVNKFADLTNEEFRASYT--GYKRRPTR----VLSSGEKKPFKYA  122

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T +P+ +DWR K AVTP+KDQG CGSCWAF+ VAA+EGI  +K G LV LS QELVDC
Sbjct  123   NFTAIPAALDWRTKKAVTPVKDQGGCGSCWAFSAVAAMEGITMIKKGKLVPLSVQELVDC  182

Query  626   DRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
             D    GC GG   SAF+FIV+N GLTTE NYPY+G     CN  KTA++A  I+GY+ VP
Sbjct  183   DDNDDGCMGGLMDSAFEFIVSNGGLTTEANYPYQGIDG-TCNTAKTANQAASITGYQDVP  241

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A NE AL+QAVA+QPV + I GG ++F+FY  GVF+G C   +DH VTAVGYG T+G GG
Sbjct  242   ANNEKALLQAVANQPVSVSIEGGGYNFQFYSSGVFTGSCGTDIDHAVTAVGYGKTSGSGG  301

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGE GYMRIQ+D + K GLCGLA  ASYPT
Sbjct  302   TKYWLMKNSWGTGWGEKGYMRIQKDVSSKAGLCGLATEASYPT  344



>ref|NP_568651.1| cysteine protease SAG12 [Arabidopsis thaliana]
 sp|Q9FJ47.1|SAG12_ARATH RecName: Full=Senescence-specific cysteine protease SAG12; AltName: 
Full=Cysteine proteinase SAG12; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 12; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK43946.1|AF370131_1 putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 dbj|BAB09317.1| senescence-specific cysteine protease [Arabidopsis thaliana]
 gb|AAK64131.1| putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 gb|AED95312.1| cysteine protease [Arabidopsis thaliana]
Length=346

 Score =   354 bits (908),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 228/346 (66%), Gaps = 11/346 (3%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
              LF+       +S  ++   D +  M+ RH +WM  HG+VY D  E + R+ +F+NNVER
Sbjct  9     FLFVAIFSSFCFSITLSRPLDNELIMQKRHIEWMTKHGRVYADVKEENNRYVVFKNNVER  68

Query  269   IETFNAGP-NKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             IE  N+ P  + +KL VN+FADLTNDEFR +     Y G +        S +K   FRY 
Sbjct  69    IEHLNSIPAGRTFKLAVNQFADLTNDEFRSM-----YTGFKGVSALSSQSQTKMSPFRYQ  123

Query  446   NATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             N ++  LP +VDWR KGAVTPIK+QG+CG CWAF+ VAA+EG  ++K G L+SLSEQ+LV
Sbjct  124   NVSSGALPVSVDWRKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQQLV  183

Query  620   DCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             DCD   +GC+GG   +AF+ I    GLTTE NYPYKG +   CN  KT  KA  I+GYE 
Sbjct  184   DCDTNDFGCEGGLMDTAFEHIKATGGLTTESNYPYKG-EDATCNSKKTNPKATSITGYED  242

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VP  +E ALM+AVAHQPV + I GG F F+FY  GVF+G+C  +LDH       G     
Sbjct  243   VPVNDEQALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDH--AVTAIGYGEST  300

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
              G KYW+IKNSWGT+WGE+GYMRIQ+D  DK+GLCGLA  ASYPTI
Sbjct  301   NGSKYWIIKNSWGTKWGESGYMRIQKDVKDKQGLCGLAMKASYPTI  346



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score =   353 bits (907),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 238/353 (67%), Gaps = 14/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MAS ++G  L+ +   ILG+W+  V S   ++ +MR RH+QWMA HG VY D  E + RF
Sbjct  1     MASTLVGK-LVLVMVAILGLWASQVRSRELHKATMRQRHEQWMARHGWVYQDDAEKERRF  59

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
             +IF+NNV+ IE+FN   NK Y L +N FADLT +EF+          R   K        
Sbjct  60    SIFKNNVDFIESFNKDGNKPYTLAINAFADLTIEEFK--------ASRNGYKRSSSPRQV  111

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
              +K FRY + T +PS++DWR KGAVTPIKDQG CGSCWAF+ V A+EG ++L TG L+SL
Sbjct  112   STKPFRYEHVTAVPSSMDWRKKGAVTPIKDQGQCGSCWAFSAVGAMEGNNQLTTGKLISL  171

Query  602   SEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD   +  GC+GGF  +AF+FI+ N+GLTTE NYPY+      CN  K AS A
Sbjct  172   SEQELVDCDTSGEDQGCEGGFMDNAFEFIIGNHGLTTETNYPYQAVDG-TCNARKEASSA  230

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I+GYE VPA +E+AL++AVAHQPV + I+ G+  F+FY  G+F+G+C  +LDH     
Sbjct  231   AKITGYEDVPANSESALLKAVAHQPVSVAIDAGESAFQFYSSGIFTGECGTNLDH--GVT  288

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G    + G KYW++KNSWGT WGE GY+R++RD   K+GLCG+A  ASYPT
Sbjct  289   AVGYGTSEDGTKYWLVKNSWGTGWGEEGYIRMKRDIDAKEGLCGIAMEASYPT  341



>ref|XP_011014388.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=340

 Score =   353 bits (906),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 184/352 (52%), Positives = 235/352 (67%), Gaps = 14/352 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVAS-TFDYQHSMRLRHQQWMAYHGKVYVDTYEADMR  238
             MA+K   + +     +IL  W+  +A    D Q  M  RH +WMA +G+VY D  E D R
Sbjct  1     MAAKKCNTHIFLPFLLILAAWATKIACRPLDEQEYMLKRHGEWMAQYGRVYGDMKEKDKR  60

Query  239   FNIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSA  418
             + IF+ N+ERIE FN G ++GYKLGVNKFADLTN+EFR ++   GY  RQ+ K+   MS+
Sbjct  61    YLIFKENIERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMYH--GYK-RQSSKL---MSS  114

Query  419   SKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             S    FRY N +++P+++DWRN  AVTP+KDQG CGSCWAF+ VAA+EGI KLKTG L+S
Sbjct  115   S----FRYENLSDIPTSMDWRNAEAVTPVKDQGRCGSCWAFSAVAAIEGIIKLKTGKLIS  170

Query  599   LSEQELVDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAV  778
             LSEQ+LVDC+  + GC GGF  +AFQ+I+   GLT+EENYPY+G     CN  K AS   
Sbjct  171   LSEQQLVDCNAGNKGCQGGFMDTAFQYIIRKGGLTSEENYPYQGVDG-TCNSEKAASIEA  229

Query  779   RISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavg  958
              I+GYE VP  NE AL+QAVA QPV + I+GG   F+FY+ GVF G C    +H      
Sbjct  230   EITGYEDVPQNNENALLQAVAKQPVSVGIDGGGQDFQFYKSGVFKGDCGAEQNH--AVTA  287

Query  959   ygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G      G  YW++KNSWGT WGE+GYMR+QR     +GLCG+A  ASYPT
Sbjct  288   IGFGTDSDGTDYWLVKNSWGTSWGESGYMRMQRGIGASEGLCGVAMDASYPT  339



>ref|XP_010054319.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW76119.1| hypothetical protein EUGRSUZ_D00496 [Eucalyptus grandis]
Length=345

 Score =   353 bits (907),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 191/345 (55%), Positives = 239/345 (69%), Gaps = 11/345 (3%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             L S+ L +  II+ V S  +    + +H ++ +H++WMA HG+VY D  E   R+ IF+ 
Sbjct  10    LTSAALLV--IIVSV-SETLCRPLEEEHLLK-QHEEWMAIHGRVYKDAVEKAKRYEIFKE  65

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHF  436
             NV+RI  FN G + GYK+ VNKFADLTN+EFR  +   GY  R  +     +S+ + K F
Sbjct  66    NVKRINAFNNGKDVGYKMAVNKFADLTNEEFRASYT--GYKRRPTR----VLSSGEKKPF  119

Query  437   RYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQEL  616
             +YAN T +P+ +DWR K AVTP+KDQG CGSCWAF+ VAA+EGI  +K G LV LS QEL
Sbjct  120   KYANFTAIPAALDWRTKKAVTPVKDQGGCGSCWAFSAVAAMEGITMIKKGKLVPLSVQEL  179

Query  617   VDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYE  796
             VDCD    GC GG   SAF+FIV+N GLTTE NYPY+G     CN  KTA+ A  I+GY+
Sbjct  180   VDCDDNDEGCGGGLMDSAFKFIVSNGGLTTEANYPYQGDDG-TCNTAKTANPAASITGYQ  238

Query  797   RVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttag  976
              VPA NE AL+QAVA+QPV + I GG F F+FY  GVF+G C   +DH VTAVGYG T+G
Sbjct  239   DVPANNEKALLQAVANQPVSVAIEGGGFDFQFYSSGVFTGSCGSDIDHAVTAVGYGKTSG  298

Query  977   dggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
              GG KYW++KNSWGT WGE GYMRIQ+D + K GLCGLA  ASYP
Sbjct  299   SGGTKYWLMKNSWGTGWGEKGYMRIQKDVSSKAGLCGLATEASYP  343



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 179/349 (51%), Positives = 225/349 (64%), Gaps = 13/349 (4%)
 Frame = +2

Query  74    ILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             I      F   +ILG W+Y VAS    + SM  RH+QWM  +GKVY D  E + RF IF+
Sbjct  4     ICKRQCFFAFILILGTWAYEVASRELQEPSMSARHEQWMETYGKVYADAAEKERRFEIFK  63

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
             +NVE IE+FN   NK YKL VNKFADLTN+E +        V R   +        K   
Sbjct  64    DNVEYIESFNTAGNKPYKLSVNKFADLTNEELK--------VARNGYRRPLQTRPMKVTS  115

Query  434   FRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             F+Y N T +P+T+DWR KGAVTPIKDQG CGSCWAF+ VAA EGI++L TG LVSLSEQE
Sbjct  116   FKYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQE  175

Query  614   LVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRIS  787
             LVDCD +    GC+GG     F+FI+ N+G+TTE NYPY+      CN  K AS+  +I+
Sbjct  176   LVDCDTQGEDQGCEGGLMEDGFEFIIKNHGITTEANYPYQAADG-TCNSRKEASRIAKIT  234

Query  788   GYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygt  967
             GYE VPA +E AL++AVA QP+ + I+ G   F+FY  GVF+G+C   LDH       G 
Sbjct  235   GYESVPANSEAALLKAVASQPISVSIDAGGSDFQFYSSGVFTGQCGTELDH--GVTAVGY  292

Query  968   tagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                  G KYW++KNSWGT WGE GY+R+QRD   ++GLCG+A  +SYPT
Sbjct  293   GETSDGTKYWLVKNSWGTSWGEEGYIRMQRDTEAEEGLCGIAMDSSYPT  341



>ref|XP_006398274.1| hypothetical protein EUTSA_v10000948mg [Eutrema salsugineum]
 dbj|BAJ33714.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ39727.1| hypothetical protein EUTSA_v10000948mg [Eutrema salsugineum]
Length=347

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/355 (51%), Positives = 230/355 (65%), Gaps = 16/355 (5%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTF-----DYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             + S  + I  I+  + S+ ++ T      D +  M+ RH +WMA HG+VY D  E + R+
Sbjct  1     MASKQIQIFLIVSLISSFCLSITLSRPLDDNELIMQKRHDEWMAKHGRVYADMKEKNNRY  60

Query  242   NIFRNNVERIETFNAGP-NKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSA  418
              +F+ NVERIE  N  P  + +KL VN+FADLTNDEFR +     Y G +   V    S 
Sbjct  61    VVFKRNVERIERLNNVPAGRTFKLAVNQFADLTNDEFRSM-----YTGYKGGSVLSSQSG  115

Query  419   SKSKHFRYANATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNL  592
             +K+  FRY N ++  LP +VDWR KGAVTPIK+QG CG CWAF+ VAA+EG  K+K G L
Sbjct  116   TKTSSFRYQNVSSGALPVSVDWRKKGAVTPIKNQGTCGCCWAFSAVAAIEGATKIKKGKL  175

Query  593   VSLSEQELVDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             +SLSEQ+LVDCD   +GC GG   +AF+ I+   GLTTE NYPYKGK    C    T   
Sbjct  176   ISLSEQQLVDCDTNDFGCSGGLMDTAFEHIMATGGLTTESNYPYKGKDA-TCKIKNTKPT  234

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
             A  I+GYE VP  +E ALM+AVAHQPV + I GG F F+FY  GVF+G+C  +LDH    
Sbjct  235   ATSITGYEDVPVNDEKALMKAVAHQPVSIGIEGGGFDFQFYGSGVFTGECTTYLDH--AV  292

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
                G      G KYW+IKNSWGT+WGE+GYMRI++D  DKKGLCGLA  ASYPTI
Sbjct  293   TAVGYGQSSNGSKYWIIKNSWGTKWGESGYMRIKKDVKDKKGLCGLAMKASYPTI  347



>gb|KCW76123.1| hypothetical protein EUGRSUZ_D00500 [Eucalyptus grandis]
Length=345

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 189/343 (55%), Positives = 237/343 (69%), Gaps = 10/343 (3%)
 Frame = +2

Query  95    FITTIILGVWSYLVASTFDY---QHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             F+T+  L V    V+ T      +  +  +H++WMA HG+VY DT E   R+ IF+ NV+
Sbjct  9     FLTSAALLVIIVSVSKTLCRPLEEEQLLKQHEEWMAIHGRVYKDTVEKAKRYEIFKENVK  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RI  FN G + GYK+ VNKFADLTN+EFR  +   GY  R  +     +S+ + K F+YA
Sbjct  69    RINAFNNGKDVGYKMAVNKFADLTNEEFRASYT--GYKRRPTR----VLSSGEKKPFKYA  122

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T +P+ +DWR K AVTP+KDQG CG CWAF+ VAA+EGI  +K G LV LS QELVDC
Sbjct  123   NFTAIPAALDWRTKKAVTPVKDQGGCGDCWAFSAVAAMEGITMIKKGKLVPLSVQELVDC  182

Query  626   DRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
             D    GC GG   SAF+FIV+N GLTTE NYPY+G     CN  KTA++A  I+GY+ VP
Sbjct  183   DDNDDGCMGGLMDSAFEFIVSNGGLTTEANYPYQGIDG-TCNTAKTANQAASITGYQDVP  241

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A NE AL+QAVA+QPV + I GG ++F+FY  GVF+G C   +DH VTAVGYG T+G GG
Sbjct  242   ANNEKALLQAVANQPVSVSIEGGGYNFQFYSSGVFTGSCGTDIDHAVTAVGYGKTSGSGG  301

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGE GYMRIQ+D + K GLCGLA  ASYPT
Sbjct  302   TKYWLMKNSWGTGWGEKGYMRIQKDVSSKAGLCGLATEASYPT  344



>ref|XP_002865220.1| senescence-associated gene 12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41479.1| senescence-associated gene 12 [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   352 bits (902),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 228/346 (66%), Gaps = 11/346 (3%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
              LF+       +S  ++   D +  M+ RH +WM  HG+VY D  E   R+ +F++NVER
Sbjct  9     FLFVAIFSSFYFSISLSRPLDNELIMQKRHIEWMTKHGRVYADVKEKSNRYVVFKSNVER  68

Query  269   IETFNAGP-NKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             IE  N  P  + +KL VN+FADLTNDEFR +     Y G +        S +K+  FRY 
Sbjct  69    IEHLNNIPAGRTFKLAVNQFADLTNDEFRSM-----YTGFKGVSSLSSQSQTKTTSFRYQ  123

Query  446   NATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             N ++  LP +VDWR KGAVTPIK+QG+CG CWAF+ VAA+EG  ++K G L+SLSEQ+LV
Sbjct  124   NVSSGALPISVDWRTKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQQLV  183

Query  620   DCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             DCD   +GC+GG   +AF+ I+   GLTTE NYPYKG +   CN  KT  KA  I+GYE 
Sbjct  184   DCDTNDFGCEGGLMDTAFEHIMATGGLTTESNYPYKG-EDATCNSKKTNPKATSITGYED  242

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VP  +E ALM+AVAHQPV + I GG F F+FY  GVF+G+C  +LDH       G     
Sbjct  243   VPVNDEQALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDH--AVTAIGYGQST  300

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
              G KYW+IKNSWGT+WGE+GYMRIQ+D  DK+GLCGLA  ASYPTI
Sbjct  301   NGSKYWIIKNSWGTKWGESGYMRIQKDIKDKQGLCGLAMKASYPTI  346



>ref|XP_010277773.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Nelumbo 
nucifera]
Length=345

 Score =   352 bits (902),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 228/335 (68%), Gaps = 15/335 (4%)
 Frame = +2

Query  116   GVW-SYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGP  292
             G+W S   A T   + SM  RH+QWMA HG +Y D  E + RF IF++NVERIE FN   
Sbjct  21    GIWVSQAAARTLPAEASMLERHEQWMASHGVLYEDAVEKEKRFTIFKDNVERIEAFNMAG  80

Query  293   NKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTV  472
             NK YKL VN+FAD TN+EF+          R   K     S+SK+  FRY N T++  ++
Sbjct  81    NKPYKLSVNRFADQTNEEFK--------ASRNGYKRSTQPSSSKT-SFRYENMTSVLPSM  131

Query  473   DWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGC  646
             DWR+KGAVTPIKDQG+CG CWAF+ VAA+EGI KLK G L+SLSEQELVDCD     YGC
Sbjct  132   DWRSKGAVTPIKDQGDCGCCWAFSAVAAMEGITKLKAGKLISLSEQELVDCDTAGGDYGC  191

Query  647   DGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETAL  826
             +GGF  +AFQFI +N GLTTE NYPYK +    C+  K+A  A +ISGYE VPA NE AL
Sbjct  192   EGGFMDNAFQFIQHNGGLTTEANYPYK-QTDGTCDKRKSALSAAKISGYEDVPANNEVAL  250

Query  827   MQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIK  1006
             ++AV++QPV + I+ G F F+FY  G+F+G+C  +LDH       G      G KYW++K
Sbjct  251   LKAVSNQPVSVAIDAGGFDFQFYSSGIFTGECGTNLDH--GVTAVGYGTSSDGTKYWLVK  308

Query  1007  NSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
             NSWGT WGE GY+R++RD A K+GLCG+A  ASYP
Sbjct  309   NSWGTTWGEKGYIRMKRDVASKEGLCGIAMQASYP  343



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score =   352 bits (903),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 182/344 (53%), Positives = 228/344 (66%), Gaps = 16/344 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L+F   ++LG+W+  V S   Y+ SM  RH+ WMA +G+ Y D  E + R N F+NNVE 
Sbjct  32    LIFAVVLLLGLWTSHVWSRSLYEASMMERHETWMAQYGRAYKDRVEKERRLNTFKNNVEF  91

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+FN    K YKL VN+FADL N+EFR          R   K+   +S+S +  FRY N
Sbjct  92    IESFNKDGKKPYKLSVNEFADLMNEEFR--------ASRNGYKMPAHLSSSSTNPFRYEN  143

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              + +PST+DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD
Sbjct  144   ISAVPSTMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLSTGKLISLSEQELVDCD  203

Query  629   R--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
                +  GC+GGF   AF+FI+ N GLTTE NYPY+G     CN  K A+K   I+GYE V
Sbjct  204   TSGEDQGCNGGFMDDAFEFIIQNKGLTTEANYPYQGADG-TCNSGKAAAK---ITGYEDV  259

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E AL++AVA+QPV + I+ G   F+FY  GVF+G C   LDH       G    D 
Sbjct  260   PANSEAALLKAVANQPVSVAIDAGGSAFQFYSSGVFTGDCGTDLDH--GVTAVGYGMSDD  317

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT WGENGY+R++RD   K+GLCG+A  ASYPT
Sbjct  318   GTKYWLVKNSWGTSWGENGYIRMERDIDAKEGLCGIAMEASYPT  361



>ref|XP_010494742.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=346

 Score =   351 bits (901),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 180/356 (51%), Positives = 237/356 (67%), Gaps = 14/356 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGV-WSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMR  238
             MA K++   + F+ ++IL + +S  ++   D +  M+ +H +WM  HG+VY D  E + R
Sbjct  1     MAFKLM--QVCFLVSLILSICFSIALSRPLDNELIMQKKHIEWMTKHGRVYADMKEKNNR  58

Query  239   FNIFRNNVERIETFNAGP-NKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMS  415
             + +F++NVERIE  N+ P  + +KL VN+FADLTNDEFR +     Y G +       + 
Sbjct  59    YVVFKSNVERIELLNSMPVGRTFKLAVNQFADLTNDEFRSM-----YTGYKVVSALSSLG  113

Query  416   ASKSKHFRYANATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGN  589
              +K+  FRY N ++  LP +VDWR KGAVTPIKDQ  CG CWAF+ VAA+EG  ++K G 
Sbjct  114   QTKTTAFRYQNVSSGGLPISVDWRTKGAVTPIKDQRTCGCCWAFSAVAAIEGAAQIKKGK  173

Query  590   LVSLSEQELVDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTAS  769
             L+SLSEQ+LVDCD   +GC+GG   +AF+ I    GLTTE NYPYKG +   CN  KT  
Sbjct  174   LISLSEQQLVDCDTNDFGCEGGLMDTAFEHIKVTGGLTTESNYPYKG-EDGTCNSKKTNP  232

Query  770   KAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvt  949
             KA  I+GYE VPA +E ALM+AVAHQPV + I GG F F+FY  GVF+G+C  +LDH   
Sbjct  233   KATSITGYEDVPANDENALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDH--A  290

Query  950   avgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
                 G      G KYW+IKNSWGT+WGE+GYMRIQ+D   K+GLCGLA  ASYPT+
Sbjct  291   VTAIGYGESTNGSKYWIIKNSWGTKWGESGYMRIQKDVKAKEGLCGLAMKASYPTL  346



>ref|XP_006384060.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
 gb|ERP61857.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
Length=339

 Score =   350 bits (899),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 184/353 (52%), Positives = 234/353 (66%), Gaps = 17/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA+K     +     +IL   + +V    D Q  M  RH++WMA HG+VY D  E + R+
Sbjct  1     MAAKKCSIHIFLPFLLILA--TKIVCRPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEKRY  58

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ N+ERIE FN G ++GYKLGVNKFADLTN+EFR +H   GY  RQ+ K+   MS+S
Sbjct  59    LIFKENIERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMHH--GY-KRQSSKL---MSSS  112

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
                 FR+ N + +P+++DWR  GAVTP+KDQG CG CWAF+ VAA+EGI KLKTG L+SL
Sbjct  113   ----FRHENLSAIPTSMDWRKAGAVTPVKDQGTCGCCWAFSAVAAIEGIIKLKTGKLISL  168

Query  602   SEQELVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQ+LVDCD K    GC GG   +AFQFI+ N GLT+E  YPY+G     C   KTAS  
Sbjct  169   SEQQLVDCDVKGVDQGCGGGLMDNAFQFILRNGGLTSEATYPYQGVDG-TCKSKKTASIE  227

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I+GYE VP  NE AL+QAVA QPV + + GG + F+FY+ GVF G C  +LDH     
Sbjct  228   AKITGYEDVPVNNENALLQAVAKQPVSVAVEGGGYDFQFYKSGVFKGDCGTYLDH--AVT  285

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G      G  YW++KNSWGT WGE+GYMR+QR    ++GLCG+A  ASYPT
Sbjct  286   AIGYGTNSDGTNYWLVKNSWGTSWGESGYMRMQRGIGAREGLCGVAMDASYPT  338



>ref|XP_011037399.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   350 bits (898),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 229/349 (66%), Gaps = 13/349 (4%)
 Frame = +2

Query  74    ILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             I      F   +ILG+W++ VAS    + SM  RH+QWMA +GKVYVD  E + RF IF+
Sbjct  4     ICKRQCFFAFILILGMWAFEVASRELQESSMSARHEQWMATYGKVYVDAAEIERRFKIFK  63

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
             +NVE IE+FN   NK YKL VNKFAD TN+EF+  H   GY  R  Q         K K 
Sbjct  64    DNVEYIESFNTAGNKPYKLSVNKFADQTNEEFKGAH--NGYR-RPFQ-----TRPMKVKS  115

Query  434   FRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             F+Y N T +P+ +DWR KGAVTPIKDQG CGSCWAF+ VAA EGI++L TG LVSLSEQE
Sbjct  116   FKYENVTAIPAAMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQE  175

Query  614   LVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRIS  787
             LVDCD +    GC+GG     F+FI+ N+G+TTE NYPY+      CN  K AS   +I+
Sbjct  176   LVDCDTQGEDQGCEGGLMEDGFEFIIKNHGITTEANYPYQAADG-TCNPEKRASHIAKIT  234

Query  788   GYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygt  967
             GYE VPA +E  L++AVA+QP+ + I+ G   F+FY  GVF+G+C   LDH       G 
Sbjct  235   GYESVPANSEAELLKAVANQPISVSIDAGGSDFQFYSSGVFTGECGTELDH--GVTAVGY  292

Query  968   tagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                  G KYW++KNSWGT WGE GY+R+QRD   ++GLCG+A  +SYPT
Sbjct  293   GKTSDGTKYWLVKNSWGTSWGEEGYIRMQRDIDAEEGLCGIAMDSSYPT  341



>ref|XP_011005485.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=339

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 182/353 (52%), Positives = 235/353 (67%), Gaps = 17/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA+K     +     +IL   + +V    D Q  M  RH++WMA HG+VY D  E + R+
Sbjct  1     MAAKKCSIHIFLPFLLILA--TKIVCRPLDEQEYMLKRHEEWMAQHGRVYEDMKEKEKRY  58

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ N+ERIE FN+G ++GYKLGVNKFADLTN+EFR +H   GY  RQ+ K+   MS+S
Sbjct  59    LIFKENIERIEAFNSGSDRGYKLGVNKFADLTNEEFRAMH--HGY-KRQSSKL---MSSS  112

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
                 FR+ N + +P ++DWR  GAVTP+KDQG+CG CWAF+ VAA+EGI KLKTG L+SL
Sbjct  113   ----FRHENLSAIPPSMDWRKAGAVTPVKDQGSCGCCWAFSAVAAIEGIIKLKTGKLISL  168

Query  602   SEQELVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             +EQ+LVDCD +    GC GG   +AFQFI+ N GLT+E  YPY+G     C   KTAS  
Sbjct  169   TEQQLVDCDVEGLDQGCGGGLMDNAFQFILRNGGLTSEATYPYQGVDG-TCKSKKTASIE  227

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I+GYE VP  NE AL+QAVA QPV + + GG + F+FY+ GVF G C  +LDH     
Sbjct  228   AKITGYEDVPVNNENALLQAVAKQPVSVAVEGGGYDFQFYKSGVFKGDCGTYLDH--AVT  285

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G      G  YW++KNSWGT WGE+GYMR+QR    ++GLCG+A  ASYPT
Sbjct  286   AIGYGTNSDGTNYWLVKNSWGTSWGESGYMRMQRGIGAREGLCGVAMDASYPT  338



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score =   349 bits (896),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 224/353 (63%), Gaps = 16/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA  I    + F   +IL   +Y   +      SM  RH++WMA +G VY D  E +MR 
Sbjct  1     MAPTIQCRCICFAFILILVALAYQAEARSLPDASMYERHEEWMAKYGIVYKDANEKEMRH  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF  NVERIE FN   NK YKLG+N+FADLTN+EF+              + +G M + 
Sbjct  61    KIFNENVERIEYFNRAANKPYKLGINQFADLTNEEFKT----------SRNRFKGHMCSP  110

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             ++  FRY N T +PS++DWR KGAVTPIKDQG CGSCWAF+ VAAVEGI +L T  L+SL
Sbjct  111   QAGPFRYENVTAVPSSMDWRKKGAVTPIKDQGQCGSCWAFSAVAAVEGITQLTTQKLISL  170

Query  602   SEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD K    GC GG    AF+FI  N GLTTE NYPY+G     CN  K A+ A
Sbjct  171   SEQELVDCDTKGEDQGCQGGLMDDAFKFIETNQGLTTEANYPYEGSDG-TCNSNKEANHA  229

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I+GYE VPA NE AL++AVA QPV + I+ G + F+FY  G+F+G C   LDH    V
Sbjct  230   AKITGYEDVPANNEAALLKAVAKQPVSVAIDAGGYEFQFYSSGIFTGDCGTELDH---GV  286

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                      G  YW++KNSWGT+WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  287   AAVGYGVSQGTNYWLVKNSWGTQWGEEGYIRMQRDIDAKEGLCGIAMQASYPT  339



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   349 bits (896),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 187/344 (54%), Positives = 227/344 (66%), Gaps = 17/344 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L FI   I+G       S      SM  RH+QWMA +G+VY D  E + RFNIF+ NV R
Sbjct  14    LAFI--FIVGALVCEATSRTLQDASMYERHEQWMARYGRVYQDNNEREQRFNIFKENVAR  71

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             I++FN   +K YKLGVN+FADLTNDEF               + +G M ++++  F+Y N
Sbjct  72    IDSFNRAKDKPYKLGVNQFADLTNDEFTA----------SRNRFKGHMCSNQATTFKYEN  121

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T LPST+DWR KGAVTPIKDQG CGSCWAF+ VAA+EG+ KL TG L+SLSEQELVDCD
Sbjct  122   VTALPSTMDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGVTKLTTGKLISLSEQELVDCD  181

Query  629   RK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
              K    GC GG    AFQFI NN GLTTE +YPYKG   + CN  K A+ A  I+G+E V
Sbjct  182   TKGDDQGCQGGLMDDAFQFIQNNKGLTTESDYPYKGVDGK-CNTNKEANHAANINGHEDV  240

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA NE AL +AVA+QPV + I+ G + F+FY  GVF+G C   LDH       G  A D 
Sbjct  241   PANNEEALHKAVANQPVSVAIDAGGYEFQFYSSGVFTGDCGTDLDH--GVTAVGYGADDD  298

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  299   GTKYWLVKNSWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPT  342



>gb|AAC49135.1| SAG12 protein [Arabidopsis thaliana]
Length=346

 Score =   349 bits (895),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 227/346 (66%), Gaps = 11/346 (3%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
              LF+       +S  ++   D +  M+ RH +WM  HG+VY D  E + R+ +F+NNVER
Sbjct  9     FLFVAIFSSFCFSITLSRPLDNELIMQKRHIEWMTKHGRVYADVKEENNRYVVFKNNVER  68

Query  269   IETFNAGP-NKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             IE  N+ P  + +KL VN+FADLTNDEF  +     Y G +        S +K   FRY 
Sbjct  69    IEHLNSIPAGRTFKLAVNQFADLTNDEFCSM-----YTGFKGVSALSSQSQTKMSPFRYQ  123

Query  446   NATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             N ++  LP +VDWR KGAVTPIK+QG+CG CWAF+ VAA+EG  ++K G L+SLSEQ+LV
Sbjct  124   NVSSGALPVSVDWRKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQQLV  183

Query  620   DCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             DCD   +GC+GG   +AF+ I    GLTTE +YPYKG +   CN  KT  KA  I+GYE 
Sbjct  184   DCDTNDFGCEGGLMDTAFEHIKATGGLTTESDYPYKG-EDATCNSKKTNPKATSITGYED  242

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VP  +E ALM+AVAHQPV + I GG F F+FY  GVF+G+C  +LDH       G     
Sbjct  243   VPVNDEQALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDH--AVTAIGYGEST  300

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
              G KYW+IKNSWGT+WGE+GYMRIQ+D  DK+GLCGLA  ASYPTI
Sbjct  301   NGSKYWIIKNSWGTKWGESGYMRIQKDVKDKQGLCGLAMKASYPTI  346



>ref|XP_010052198.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76120.1| hypothetical protein EUGRSUZ_D00497 [Eucalyptus grandis]
Length=345

 Score =   349 bits (895),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 239/346 (69%), Gaps = 11/346 (3%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             L S+ L +  II+ V S  +    + +H ++ +H++WMA HG+VY D  E   R+ IF+ 
Sbjct  10    LTSAALLV--IIVSV-SETLCRPLEEEHLLK-QHEEWMAIHGRVYKDAVEKAKRYEIFKE  65

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHF  436
             NV+RI  FN G + GYK+ VNKFADLTN+EFR  +   GY  R  +     +S+ + K F
Sbjct  66    NVKRINAFNNGKDVGYKMAVNKFADLTNEEFRASYT--GYKRRPTR----VLSSGEKKPF  119

Query  437   RYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQEL  616
             +YAN T +P+ +DWR K AVTP+KDQGNCGSCWAF+ VAA+EGI  ++ G LV LS QEL
Sbjct  120   KYANFTAIPAALDWRTKKAVTPVKDQGNCGSCWAFSAVAAMEGITMIRKGKLVPLSVQEL  179

Query  617   VDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYE  796
             VDCD    GC GG     F+FIV+N GLTTE NYP +G +   CN  K A+ A  I+GY+
Sbjct  180   VDCDDNDEGCGGGLVDCVFKFIVSNGGLTTEANYPCQGNKG-TCNTAKAATPAASITGYQ  238

Query  797   RVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttag  976
              VPA NE AL+QAVA+QPV + I GG F F+FY  GVF+G C   +DH VTAVGYG T+G
Sbjct  239   DVPANNEKALLQAVANQPVSVAIEGGGFDFQFYSSGVFTGSCGTDIDHAVTAVGYGKTSG  298

Query  977   dggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              GG KYW++KNSWGT WGE+GYMRIQ+D + K GLCGLA  ASYPT
Sbjct  299   SGGTKYWLMKNSWGTGWGESGYMRIQKDVSSKAGLCGLATEASYPT  344



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score =   349 bits (895),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 181/344 (53%), Positives = 228/344 (66%), Gaps = 16/344 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L+F   ++LG+W+  V S   Y+ SM  RH+ WMA +G+ Y    E + R NIF+NNVE 
Sbjct  32    LIFAVVLLLGLWTSHVWSRSLYEASMMERHETWMAQYGRAYKGHVEKERRLNIFKNNVEF  91

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+FN    K YKL VN+FADLTN+EF+          R   K+   +S+S +K FRY N
Sbjct  92    IESFNKVGKKPYKLSVNEFADLTNEEFQ--------ASRNGYKMSAHLSSSSTKPFRYEN  143

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              + +PST+DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD
Sbjct  144   VSAVPSTMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLSTGKLISLSEQELVDCD  203

Query  629   R--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
                +  GC+GG    AF FI+ N GLTTE NYPY+G     CN  K A+K   I+GYE V
Sbjct  204   TSGEDQGCNGGLMDDAFDFIIQNKGLTTEANYPYQGADG-ACNSGKAAAK---ITGYEDV  259

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E AL++AVA+QPV + I+ G   F+FY  GVF+G C   LDH       G    D 
Sbjct  260   PANSEAALLKAVANQPVSVAIDAGGSAFQFYSSGVFTGDCGTDLDH--GVTAVGYGMSDD  317

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT WGENGY+R++RD   ++GLCG+A  ASYPT
Sbjct  318   GTKYWLVKNSWGTSWGENGYIRMERDIDAQEGLCGIAMEASYPT  361



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   347 bits (891),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 221/338 (65%), Gaps = 13/338 (4%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             +ILG W+Y VAS    + SM  RH+QWMA  GKVY D  E + RF IF++NVE IE+FN 
Sbjct  15    LILGTWAYEVASRELQEPSMSARHEQWMATFGKVYADAAEKERRFEIFKDNVEYIESFNT  74

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPS  466
               NK YKL VNKFADLT +E +        V R   +        K   F Y N T +P+
Sbjct  75    AGNKPYKLSVNKFADLTTEELK--------VARNGYRRPLQTRPMKVTSFEYENVTAVPA  126

Query  467   TVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SY  640
             T+DWR KGAVTPIKDQG CGSCWAF+ VAA EGI++L TG LVSLSEQELVDCD +    
Sbjct  127   TMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGEDQ  186

Query  641   GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNET  820
             GC+GG     F+FI+ N+G+T+E NYPY+      CN  K AS   +I+GYE VPA +E 
Sbjct  187   GCEGGLMEDGFEFIIKNHGITSEANYPYQAADG-TCNSKKEASHIAKITGYESVPANSEA  245

Query  821   ALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWV  1000
             AL++AVA+QP+ + I+ G   F+FY  GVF+G+C   LDH       G      G KYW+
Sbjct  246   ALLKAVANQPISVSIDAGGSDFQFYSSGVFTGQCGTELDH--GVTAVGYGETSDGTKYWL  303

Query  1001  IKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             +KNSWGT WGE GY+R+QRD   ++GLCG+A  +SYPT
Sbjct  304   VKNSWGTSWGEEGYIRMQRDVDAEEGLCGIAMDSSYPT  341



>ref|XP_006376431.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
 gb|ERP54228.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
Length=342

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 179/350 (51%), Positives = 227/350 (65%), Gaps = 15/350 (4%)
 Frame = +2

Query  74    ILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             I      F   +ILG+W++ VAS    +  M  RH+QWMA +GKVYVD  E + RF IF+
Sbjct  4     ICKRQCFFAFILILGMWAFEVASRELQESYMSARHEQWMATYGKVYVDAAEKERRFKIFK  63

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMS-ASKSK  430
             NNVE IE+FN   NK YKL VNKFAD TN++F+         G +N     F +   K  
Sbjct  64    NNVEYIESFNTAGNKPYKLSVNKFADQTNEKFK---------GARNGYRRPFQTRPMKVT  114

Query  431   HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
              F+Y N T +P+T+DWR KGAVTPIKDQG CGSCWAF+ VAA EGI++L TG LVSLSEQ
Sbjct  115   SFKYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQ  174

Query  611   ELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELVDCD +    GC+GG     F+FI+ N+G+TTE NYPY+      CN  K AS   +I
Sbjct  175   ELVDCDNQGEDQGCEGGLMEDGFEFIIKNHGITTEANYPYQAADG-TCNSKKQASHIAKI  233

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
             +GYE VPA +E  L++ VA+QP+ + I+ G   F+FY  GVF+GKC   LDH       G
Sbjct  234   TGYESVPANSEAELLKVVANQPISVSIDAGGSDFQFYSSGVFTGKCGTELDH--GVTAVG  291

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                   G KYW++KNSWGT WGE GY+R+QRD   ++GLCG+A  +SYPT
Sbjct  292   YGETSDGTKYWLVKNSWGTSWGEEGYIRMQRDIDTEEGLCGIAMDSSYPT  341



>gb|KFK31512.1| hypothetical protein AALP_AA6G122300 [Arabis alpina]
Length=342

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 181/349 (52%), Positives = 227/349 (65%), Gaps = 14/349 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
              L ++ +     S  ++   D +  M+ RH  WMA HG+VY D  E D R+ +F+ NVER
Sbjct  2     FLIVSLVSSFCLSITLSRPLDDELIMQKRHDDWMAKHGRVYADVKEKDNRYIVFKRNVER  61

Query  269   IETFNA--GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSK--HF  436
             IE  N      + +KL VN+F+DLTNDEFR +     Y G +   V    S S+SK   F
Sbjct  62    IELSNNIFDSKRTFKLAVNQFSDLTNDEFRSM-----YTGYKGDYVLSSQSQSRSKTTSF  116

Query  437   RYANATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
             RY N ++  LP +VDW+ KGAVTPIK+QG+CG CWAF+ VAA+EG  ++K G L+SLSEQ
Sbjct  117   RYQNVSSSVLPISVDWKKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQ  176

Query  611   ELVDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISG  790
             +LVDCD   YGC GG   +AF+ I+   GLTTE NYPYKG +   CN  KT  KA  ISG
Sbjct  177   QLVDCDINDYGCRGGLMDTAFEHIIATGGLTTESNYPYKG-EDGTCNSKKTNPKATSISG  235

Query  791   YERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtt  970
             YE VP  +E ALM+AVA+QPV + I GG F F+FY  GVF+G+C   LDH       G  
Sbjct  236   YEDVPVNDEKALMKAVAYQPVSVGIEGGGFDFQFYSTGVFTGECTTSLDH--AVTAVGYG  293

Query  971   agdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
                 G KYW+IKNSWGT+WGE+GYMRIQ+D  DK+GLCGLA  ASYPTI
Sbjct  294   ESANGSKYWIIKNSWGTKWGESGYMRIQKDVKDKQGLCGLAMKASYPTI  342



>ref|XP_010906194.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X1 [Elaeis guineensis]
Length=343

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/351 (52%), Positives = 236/351 (67%), Gaps = 18/351 (5%)
 Frame = +2

Query  71    KILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIF  250
             K LG +L  +  ++    S+  A T   + +M  RH+QWM  HG+VY ++ E + RF IF
Sbjct  7     KSLGMALFVL--VLCACASHATARTLT-EMTMAERHEQWMVRHGRVYKESAEKERRFQIF  63

Query  251   RNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSK  430
             + NVE IE+FNAG N  YKLGVN+FADLTN+EF+ +        R   K  G  ++  + 
Sbjct  64    KANVEFIESFNAG-NSKYKLGVNQFADLTNEEFKAM--------RNGLKPSGVKTSKATS  114

Query  431   HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
              FRYAN T +P+ +DWR KGAVTPIKDQG+CGSCWAFAVVAA+EGI KLKT  L+SLSEQ
Sbjct  115   VFRYANVTAVPTRMDWRTKGAVTPIKDQGDCGSCWAFAVVAAMEGITKLKTHKLISLSEQ  174

Query  611   ELVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELV+CD   +  GC+GG P +A +FI+ N GL TE NYPYKG     CN  K+AS A  I
Sbjct  175   ELVECDVGGEDEGCNGGLPDAALEFIIKNGGLATETNYPYKG-MDGTCNTKKSASHAASI  233

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFS-GKCKPHLDHgvtavgy  961
              GYE+VPA +E AL++AVA+QPV + I+ G   F+FY  GVF+ G C+  LDH  +    
Sbjct  234   KGYEQVPANSEAALLKAVANQPVSVNIDSGGSSFQFYASGVFTGGSCETDLDH--SVTAV  291

Query  962   gttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G      G KYW++KNSWG+ WGE GY+R++RD + K+GLCG+A  A YPT
Sbjct  292   GYGKAKDGTKYWLVKNSWGSSWGEKGYIRMERDVSAKEGLCGIAMQAYYPT  342



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 225/344 (65%), Gaps = 17/344 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
              L +  I+  + S  +A +     SM  RH+ WMA +G+VY D  E ++R+ IF+ NVER
Sbjct  11    FLALIFILAALASQAIARSLQ-DASMYERHEDWMAQNGRVYKDANEKEIRYKIFKENVER  69

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+FN    K YKLG+N+FADLTN+EF+              + +G M + +   FRY N
Sbjct  70    IESFNKAGGKSYKLGINQFADLTNEEFKT----------SRNRFKGHMCSPQEGPFRYEN  119

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +PS++DWR KGAVTPIKDQG CGSCWAF+ VAAVEGI +L +  L+SLSEQELVDCD
Sbjct  120   VTAVPSSMDWRKKGAVTPIKDQGQCGSCWAFSAVAAVEGITQLTSHKLISLSEQELVDCD  179

Query  629   RK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
              K    GC GG    AF+FI NN GLTTE NYPY+G     CN  K A+ A +I+GYE V
Sbjct  180   TKGEDQGCQGGLMDDAFKFIENNQGLTTETNYPYEGSDG-TCNANKEANHAAKITGYEDV  238

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E AL++AVA QPV + I+ G F F+FY  G+F+G C   LDH    V         
Sbjct  239   PANDEAALLKAVAQQPVSVAIDAGGFQFQFYSSGIFTGDCGTELDH---GVAAVGYGVSN  295

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT+WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  296   GMKYWLVKNSWGTQWGEVGYIRMQRDIEAKEGLCGIAMQASYPT  339



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 230/351 (66%), Gaps = 20/351 (6%)
 Frame = +2

Query  68    SKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNI  247
             S+ +  +LLF+    LG W    A+      SM  RH+QWMA +G+VY D  E + R+NI
Sbjct  7     SQFICLALLFV----LGAWPSKSAARTLQDVSMYERHEQWMAQYGRVYKDDAEKETRYNI  62

Query  248   FRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKS  427
             F+ NV RI+ FN+   K YKLGVN+FADL+N+EF+              + +G M + ++
Sbjct  63    FKENVARIDAFNSQTGKSYKLGVNQFADLSNEEFKA----------SRNRFKGHMCSPQA  112

Query  428   KHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSE  607
               FRY N + +P+T+DWR KGAVTP+KDQG CG CWAF+ VAA+EGI++L TG L+SLSE
Sbjct  113   GPFRYENVSAVPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSE  172

Query  608   QELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVR  781
             QE+VDCD K    GC+GG    AF+FI  N GLTTE NYPY G     CN  K A+ A +
Sbjct  173   QEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYTGTDG-TCNTQKEATHAAK  231

Query  782   ISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgy  961
             I+G+E VPA +E ALM+AVA QPV + I+ G F F+FY  G+F+G C   LDH    V  
Sbjct  232   ITGFEDVPANSEAALMKAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTQLDH---GVTA  288

Query  962   gttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                    G KYW++KNSWG +WGE GY+R+Q+D + K+GLCG+A  ASYP+
Sbjct  289   VGYGISDGTKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCGIAMQASYPS  339



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 226/345 (66%), Gaps = 19/345 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLF+    L  W+    +   ++ SM  RH+ WMA +G+VY D  E   R+ IF++NV 
Sbjct  13    ALLFV----LAAWASQATARNLHEASMYERHEDWMAQYGRVYKDADEKSKRYKIFKDNVA  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RIE+FN   +K YKL +N+FADLTN+EF          G    + +  + ++++  F+Y 
Sbjct  69    RIESFNKAMDKSYKLSINEFADLTNEEF----------GTSRNRFKAHICSTEATSFKYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T +PST+DWR KGAVTPIKDQG CGSCWAF+ VAA+EGI +L TG L+SLSEQELVDC
Sbjct  119   NVTAVPSTIDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDC  178

Query  626   DR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D   +  GC+GG    AF+FI  N+GLTTE NYPY G     CN  K A  A +I+GYE 
Sbjct  179   DTSGEDQGCNGGLMDDAFKFIKQNHGLTTEANYPYAGTDG-TCNRKKAAHPAAKINGYED  237

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA NE AL +AV HQP+ + I+ G F F+FY  GVF+G+C   LDH       G    D
Sbjct  238   VPANNEKALQKAVVHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDH--GVAAVGYGTSD  295

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  296   DGMKYWLVKNSWGTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPT  340



>ref|XP_010054322.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76126.1| hypothetical protein EUGRSUZ_D00502 [Eucalyptus grandis]
Length=345

 Score =   347 bits (889),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 187/343 (55%), Positives = 234/343 (68%), Gaps = 10/343 (3%)
 Frame = +2

Query  95    FITTIILGVWSYLVASTFDY---QHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             F+T+  L V    V+ T      +  +  +H++WMA HG+VY D  E   R+ IF+ N++
Sbjct  9     FLTSAALLVIIVSVSETLCRPLEEEQLLKQHEEWMAIHGRVYKDAVEKAKRYEIFKENIK  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RI  FN G + GYK+ VNKFADLTN+EFR  +   GY  R  +     +S+ + K F+YA
Sbjct  69    RINAFNNGKDVGYKMAVNKFADLTNEEFRASYT--GYKRRPTR----VLSSGEKKPFKYA  122

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T +P+ +DWR K AVTP+KDQGNCGSCWAF+ VAA+EGI  +K   LV LS QELVDC
Sbjct  123   NFTAIPAALDWRTKKAVTPVKDQGNCGSCWAFSAVAAMEGITMIKKRKLVPLSVQELVDC  182

Query  626   DRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
             D    GC GG   SAF+FIV+N GLTTE NYPY+ +    CN  K A+ A  I+GY+ VP
Sbjct  183   DDNDDGCIGGLMDSAFEFIVSNGGLTTEANYPYQ-ENKGTCNTAKAANPAASITGYKDVP  241

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A NE AL+QAVA+QPV + I GG F F+FY  GVF+G C   +DH VTAVGYG T+G GG
Sbjct  242   ANNEKALLQAVANQPVSVAIEGGGFDFQFYSTGVFTGSCGTDIDHAVTAVGYGKTSGSGG  301

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGE GYMRIQ+D + K GLCGLA  ASYPT
Sbjct  302   TKYWLMKNSWGTGWGEKGYMRIQKDVSSKAGLCGLATEASYPT  344



>ref|XP_009767421.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=334

 Score =   345 bits (886),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 219/344 (64%), Gaps = 15/344 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
              L +   ILG+W+    +       + L+++QWM  +G+VY +  E D  F IF+ N ER
Sbjct  3     FLILLFAILGIWASKTTARTLVDEPLMLKYEQWMIQYGRVYKNNAEKDSHFKIFKKNAER  62

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE FN   N+ YKLG+N FADLTN+EFR          R   K+       K   FRY N
Sbjct  63    IEAFNDAANQPYKLGINAFADLTNEEFR--------AARNGLKIP--FCEPKITSFRYEN  112

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +P+T+DWR KGAVTPIKDQG CGSCWAF+ +AA EGI KL TG L+SLSEQEL+DCD
Sbjct  113   VTAIPTTMDWRIKGAVTPIKDQGQCGSCWAFSAIAATEGITKLSTGKLISLSEQELMDCD  172

Query  629   RKS--YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
             R S   GC+GG+   AF+FIV N GLTTE  YPYK    + CN  K +S    I GYE+V
Sbjct  173   RNSEDQGCEGGYMEDAFEFIVKNKGLTTETTYPYKAADEK-CNTKKESSHVADIKGYEKV  231

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             P  NE AL+ AVA+QP+ + I+  DF F+FY  GVF+G C   LDH       G    + 
Sbjct  232   PKYNEKALLNAVANQPISVSIDASDFSFQFYTSGVFTGTCGTELDH--GVTAVGYGKAED  289

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW+IKNSWG+ WGENGY+R++RD   K+GLCG+A  ASYPT
Sbjct  290   GTKYWLIKNSWGSSWGENGYIRMERDIDAKEGLCGIAMDASYPT  333



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score =   345 bits (886),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 226/345 (66%), Gaps = 19/345 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLF+    L  W+    +   ++ SM  RH+ WMA +G+VY D  E   R+ IF++NV 
Sbjct  13    ALLFV----LAAWASHAKARNLHEASMYERHEDWMAQYGRVYKDAGEKSKRYKIFKDNVA  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RIE+FN   NK YKL +N+FADLTN+EFR              + +  + ++++  F+Y 
Sbjct  69    RIESFNKAMNKSYKLSINEFADLTNEEFRA----------SRNRFKAHICSTEATSFKYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             +   +PSTVDWR KGAVTPIKDQG CGSCWAF+ VAA+EGI +L TG L+SLSEQELVDC
Sbjct  119   HVXAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDC  178

Query  626   DR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D   +  GC GG    AF+FI  N+GLTTE NYPY G     CN  K A  A +I+GYE 
Sbjct  179   DTSGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDG-TCNRKKAAHPAAKINGYED  237

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA NE AL +AVAHQP+ + I+ G F F+FY  GVF+G+C   LDH       G    D
Sbjct  238   VPANNEKALQKAVAHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDH--GVSAVGYGTSD  295

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSWGT WGE GY+R+QRD  +K+GLCG+A  ASYPT
Sbjct  296   DGMKYWLVKNSWGTGWGEEGYIRMQRDVTEKEGLCGIAMQASYPT  340



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/354 (51%), Positives = 236/354 (67%), Gaps = 17/354 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQH-SMRLRHQQWMAYHGKVYVDTYEADMR  238
             MA K L  S L +  +I+  +  L A+    Q  SMR RH+QWM  HGK+Y+D+ E + +
Sbjct  1     MAFKTLFHSTLAL--VIVFAFCALEANARTLQDASMRERHEQWMVTHGKLYLDSSEKEQK  58

Query  239   FNIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSA  418
             + IF+ NV+RIE FN   NK YKLG+N+FADLTN+EF+  +   G++           + 
Sbjct  59    YQIFKENVQRIEAFNNAGNKPYKLGINQFADLTNEEFKARNRFKGHICS---------TI  109

Query  419   SKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             +++  F+Y + T LP+++DWR KGAVTPIKDQG CGSCWAF+ VAA EGI KL TG L+S
Sbjct  110   TRTPTFKYEHVTALPTSLDWRQKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSTGKLIS  169

Query  599   LSEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             LSEQEL+DCD K    GC+GG    AF+FI+NN GLTTE  YPY+G     CN    +S 
Sbjct  170   LSEQELIDCDTKGEDQGCEGGLMDDAFKFILNNKGLTTEATYPYEGIDG-TCNAKAESSH  228

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
             A  I GYE VPA +E+AL++AVA+QPV + I+   + F+FY  GVF+G C  +LDH    
Sbjct  229   AASIKGYEDVPANSESALLKAVANQPVSVAIDASGYEFQFYAGGVFNGSCDTNLDH--GV  286

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G    D G KYW++KNSWG +WGE GY+R+QRD + K+GLCG+A  ASYPT
Sbjct  287   TAVGYGVSDDGSKYWLVKNSWGVKWGEKGYIRMQRDVSAKEGLCGIAMLASYPT  340



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   345 bits (884),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/343 (50%), Positives = 226/343 (66%), Gaps = 12/343 (3%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L+F   ++L +W+Y   +      SM  RH++WMA HG+ Y D  E   RF IF+ NVE 
Sbjct  9     LIFAVLLVLEMWTYQATARSLPDASMIERHEEWMAQHGRAYKDDVEKAKRFKIFKENVEY  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             I++FN    + YKL VNKFADLTN+EF+          R   K+  +  ASK   FRYAN
Sbjct  69    IQSFNEAGTRPYKLAVNKFADLTNEEFQ--------ASRNGYKMGSYGKASKVSSFRYAN  120

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +P+++DWR KGAVT +KDQG CG CWAF+ VAA EGI++L TG L+SLSEQELVDCD
Sbjct  121   VTAVPTSMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCD  180

Query  629   -RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
               +  GC+GG   +AF+FI++N G+TTE NYPY+      CN  K +S A +I+GYE VP
Sbjct  181   TSEDEGCNGGLMDNAFEFIISNGGITTESNYPYEAVDG-TCNSKKESSHAAKITGYEDVP  239

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A +E+AL++AVA+QPV + I+     F+FY  GVF+G+C   LDH       G      G
Sbjct  240   ANSESALLKAVANQPVSVAIDASGSDFQFYTSGVFTGQCGTELDH--GVTAVGYGKTSDG  297

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGENGY+R+QRD    +GLCG+A  ASYP+
Sbjct  298   TKYWLVKNSWGTSWGENGYIRMQRDVDAAEGLCGIAMQASYPS  340



>ref|XP_010045985.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84687.1| hypothetical protein EUGRSUZ_B01504 [Eucalyptus grandis]
Length=342

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/357 (49%), Positives = 236/357 (66%), Gaps = 24/357 (7%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MAS ++G  L+ +   +LG+W+    S   ++ +MR RH QWMA HG+VY D  E + RF
Sbjct  1     MASPLVGK-LVLVMVAVLGLWASQARSRELHEATMRERHDQWMARHGRVYQDDAEKERRF  59

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
             +IF+NNV+ +E+FN   NK Y L +N FADLT +EF+                 G+M +S
Sbjct  60    SIFKNNVDLVESFNKNGNKPYTLAINAFADLTIEEFKASR-------------NGYMRSS  106

Query  422   K-----SKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTG  586
                   +K FRY N T +PS++DWR KGAVTPIK+QG CGSCWAF+ V A+EGI +L TG
Sbjct  107   SPRQVSTKPFRYENVTAVPSSMDWRKKGAVTPIKNQGQCGSCWAFSAVGAMEGIIQLTTG  166

Query  587   NLVSLSEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMK  760
              L+SLSEQELVDCD   K +GC+GG+   AF+FI+  +GLTTE NYPY+      CN  K
Sbjct  167   KLISLSEQELVDCDTSGKDHGCEGGYMDDAFKFIIGRHGLTTETNYPYQAVDG-TCNARK  225

Query  761   TASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDH  940
               S A +I+GY  VPA NE+AL++AV HQPV + I+ G++ F+FY  G+F+G+C  +LDH
Sbjct  226   ANSSAAKITGYADVPANNESALLKAVGHQPVSVAIDAGEWAFQFYSSGIFTGECGTNLDH  285

Query  941   gvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
                    G    + G KYW++KNSWGT WGE GY+R++RD   K+GLCG+A  AS+P
Sbjct  286   --GVTAVGYGTSENGTKYWLVKNSWGTGWGEKGYIRMKRDIDAKEGLCGIAMMASFP  340



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/344 (54%), Positives = 224/344 (65%), Gaps = 17/344 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L FI   I+G       S      SM  RH+QWMA +G+VY D  E + RFNIF+ NV  
Sbjct  14    LAFI--FIVGALVCEATSRTLQDASMYERHEQWMARYGRVYHDNNEREQRFNIFKENVAH  71

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             I++FN   +K YKLGVN+FADLTN+EF               + +G M ++K+  F+Y N
Sbjct  72    IDSFNRAKDKPYKLGVNQFADLTNEEFTA----------SRNRFKGHMCSNKATTFKYEN  121

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T LPSTVDWR KGAVTPIKDQG CG CWAF+ VAA+EG+ KL TG L+SLSEQELVDCD
Sbjct  122   LTALPSTVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGVTKLTTGKLISLSEQELVDCD  181

Query  629   RK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
              K    GC GG    AFQFI NN GLTTE +YPYKG     CN  K A+ A +I+G+E V
Sbjct  182   TKGEDQGCQGGLMDDAFQFIQNNKGLTTESDYPYKGVDG-TCNTNKEANHAAKINGFEDV  240

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E AL +AVA+QPV + I+ G F F+FY  GVF+G C   LDH       G    D 
Sbjct  241   PANSEDALQKAVANQPVSVAIDAGGFKFQFYSGGVFTGDCGTALDH--GVTAVGYGVDDD  298

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  299   GTKYWLVKNSWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPT  342



>ref|XP_010481519.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=342

 Score =   344 bits (882),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 179/356 (50%), Positives = 235/356 (66%), Gaps = 18/356 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVW-SYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMR  238
             MA K++   +  + ++IL +W S  ++   + +  M+ RH +WM  HG+VY D  E + R
Sbjct  1     MAFKLM--QICLLVSLILSIWFSIALSRPLENELIMQKRHIEWMTKHGRVYADMKEKNNR  58

Query  239   FNIFRNNVERIETFNA-GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMS  415
             + +F++NVERIE  N+    + +KL VN+FADLTNDEFR  +   GY G           
Sbjct  59    YVVFKSNVERIELLNSMSAGRPFKLAVNQFADLTNDEFRSTYT--GYKGLSTL-------  109

Query  416   ASKSKHFRYANATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGN  589
             +S  + FRY N ++  LP +VDWR KGAVTPIKDQ +CG CWAF+ VAA+EG  ++K G 
Sbjct  110   SSLGQTFRYQNVSSGGLPISVDWRTKGAVTPIKDQRSCGCCWAFSAVAAIEGAAQIKKGK  169

Query  590   LVSLSEQELVDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTAS  769
             L+SLSEQ+LVDCD  ++GC+GG   +AF+ I    GLTTE NYPYKG+    CN  KT  
Sbjct  170   LISLSEQQLVDCDTNNFGCEGGLMDTAFEHIKATGGLTTESNYPYKGEDGS-CNSKKTNP  228

Query  770   KAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvt  949
             KA  I+GYE VPA +E ALM+AVAHQPV + I GG F F+FY  GVF+G+C  +LDH   
Sbjct  229   KATSITGYEDVPANDENALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDH--A  286

Query  950   avgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
                 G      G KYW+IKNSWG +WGE+GYMRIQ+D   K+GLCGLA  ASYPT+
Sbjct  287   VTAIGYGESTNGSKYWIIKNSWGKKWGESGYMRIQKDVKAKEGLCGLAMKASYPTL  342



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score =   343 bits (881),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 180/345 (52%), Positives = 223/345 (65%), Gaps = 18/345 (5%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             SL  I   ILG  +    +      S+  RH++WMA +GKVY D  E  +R  IF+ NVE
Sbjct  11    SLALI--FILGALASQAIARSLQDASINERHEKWMAQYGKVYKDANEKVIRRKIFKRNVE  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RIE+FN    K YKLG+N+FADLTN+EF+              + +G M + ++  FRY 
Sbjct  69    RIESFNKAGGKPYKLGINQFADLTNEEFKT----------SRNRFKGHMCSPQAGPFRYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T +PS++DWR KGAVTPIKDQG CGSCWAF+ VAAVEGI +L T  L+SLSEQELVDC
Sbjct  119   NVTAVPSSMDWRKKGAVTPIKDQGQCGSCWAFSTVAAVEGITQLTTKKLISLSEQELVDC  178

Query  626   DRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D K    GC GG    AF+FI NN GLTTE NYPY G     CN  K A+ A +I+GYE 
Sbjct  179   DTKGEDQGCQGGLMDDAFKFIENNQGLTTEANYPYVGSDG-TCNTKKEANHAAKITGYED  237

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA NE AL++AV +QPV + I+ G F F+FY  G+F+G C   LDH    V        
Sbjct  238   VPANNEAALLKAVTNQPVSVAIDAGGFAFQFYSSGIFTGDCGTELDH---GVAAVGYGVS  294

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSWGT+WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  295   NGTKYWLVKNSWGTQWGEEGYIRMQRDIDAKEGLCGIAMQASYPT  339



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 180/344 (52%), Positives = 229/344 (67%), Gaps = 16/344 (5%)
 Frame = +2

Query  92    LFITTIILGVWSYLVASTFDYQHS-MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L +  I+LG W     S+   Q + M  R++QW A +G+VY D  E + RF IF+ NV  
Sbjct  10    LCLALILLGAWIPQAMSSRTLQDAAMYERYEQWTARYGRVYRDNVEKEKRFTIFKQNVAH  69

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE FN    K YKL VN+FADLTN+EF+        V R   + +G M + ++  F+Y N
Sbjct  70    IEAFNKASKKPYKLAVNEFADLTNEEFK--------VSRN--RFKGHMCSEQTGPFKYEN  119

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +PST+DWR KGAVTP+KDQG CG CWAF+ VAA+EGI++L TG L SLSEQELVDCD
Sbjct  120   VTAVPSTMDWRKKGAVTPVKDQGQCGCCWAFSAVAAIEGINQLTTGKLASLSEQELVDCD  179

Query  629   RK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
              K    GC+GG   +AFQF+  N G+TTE NYPYKG   + CN  + A+ A +I+G+E V
Sbjct  180   VKGEDEGCNGGLMDNAFQFVQKNKGITTETNYPYKGVDGK-CNAKEEANHAAKINGHEDV  238

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +ETALM+AVA+QPV + I+ G F F+FY  GVF+G C   LDH       G  A D 
Sbjct  239   PANSETALMKAVANQPVSVAIDAGGFDFQFYSSGVFTGDCGTELDH--GVTAVGYGAADD  296

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  297   GTKYWLVKNSWGTSWGEEGYIRMQRDIDAKQGLCGIAMQASYPT  340



>emb|CDX87758.1| BnaC02g31910D [Brassica napus]
Length=346

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 226/346 (65%), Gaps = 11/346 (3%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
              L ++ +    +S  ++   D++  M+ +H +WMA HG+ Y D  E + R+ +F+ NVER
Sbjct  9     FLIVSLVSSFCFSTTLSRLLDHELIMQKKHDEWMAEHGRTYADMNEKNNRYVVFKRNVER  68

Query  269   IETFNAGP-NKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             IE  N  P  + +KL VN+FADLTNDEFR +     Y G +   V    S +KS  FRY 
Sbjct  69    IERLNNVPAGRTFKLAVNQFADLTNDEFRSM-----YTGYKGDSVLSSQSQTKSTSFRYQ  123

Query  446   NATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             N ++  LP  VDWR KGAVTPIK+QG+CG CWAF+ VAA+EG  ++K G L+SLSEQ+LV
Sbjct  124   NVSSGALPIAVDWRKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQQLV  183

Query  620   DCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             DCD   +GC GG   +AF+ I+   GLTTE NYPYKG+    C    T   A  I+GYE 
Sbjct  184   DCDTNDFGCSGGLMDTAFEHIMATGGLTTESNYPYKGEDAN-CKIKSTKPSAASITGYED  242

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VP  +E ALM+AVAHQPV + I GG F F+FY  GVF+G+C  +LDH       G +   
Sbjct  243   VPVNDENALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDH--AVTAVGYSQSS  300

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
              G KYW+IKNSWGT+WGE GYMRI++D  DK+GLCGLA  ASYPTI
Sbjct  301   AGSKYWIIKNSWGTKWGEGGYMRIKKDIKDKEGLCGLAMKASYPTI  346



>ref|XP_009128825.1| PREDICTED: ervatamin-B [Brassica rapa]
 emb|CDY50483.1| BnaA02g24130D [Brassica napus]
Length=346

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 225/346 (65%), Gaps = 11/346 (3%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
              L ++ +    +S  ++   D +  M+ +H +WMA HG+ Y D  E + R+ +F+ NVER
Sbjct  9     FLIVSLVSSFCFSTTLSRLLDDELIMQKKHDEWMAEHGRTYADMNEKNSRYVVFKRNVER  68

Query  269   IETFNAGP-NKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             IE  N  P  + +KL VN+FADLTNDEFR +     Y G +   V    S +KS  FRY 
Sbjct  69    IERLNNVPAGRTFKLAVNQFADLTNDEFRSM-----YTGYKGDSVLSSQSQTKSTSFRYQ  123

Query  446   NATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             N ++  LP  VDWR KGAVTPIK+QG+CG CWAF+ VAA+EG  ++K G L+SLSEQ+LV
Sbjct  124   NVSSGALPIAVDWRKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQQLV  183

Query  620   DCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             DCD   +GC GG   +AF+ I+   GLTTE NYPYKG +   C    T   A  I+GYE 
Sbjct  184   DCDTNDFGCSGGLMDTAFEHIMATGGLTTESNYPYKG-EDATCKIKSTKPSAASITGYED  242

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VP  +E ALM+AVAHQPV + I GG F F+FY  GVF+G+C  +LDH       G +   
Sbjct  243   VPVNDENALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDH--AVTAVGYSQSS  300

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
              G KYW+IKNSWGT+WGE GYMRI++D  DK+GLCGLA  ASYPTI
Sbjct  301   AGSKYWIIKNSWGTKWGEGGYMRIKKDIKDKEGLCGLAMKASYPTI  346



>ref|XP_010518799.1| PREDICTED: senescence-specific cysteine protease SAG12 [Tarenaya 
hassleriana]
Length=348

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/348 (51%), Positives = 231/348 (66%), Gaps = 11/348 (3%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LL I+ +     S  ++   D +  M  RH++WMA HG+VY+D  E + R+ IF+ NVE
Sbjct  8     ALLIISLVSSLFLSTSLSRPLDEELMMLKRHEEWMAKHGRVYLDAKEKERRYTIFKLNVE  67

Query  266   RIETFNAG--PNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFR  439
             RIET N    P + +KLGVN+FADLTNDEFR ++   GY G+ +  V       K+  F 
Sbjct  68    RIETLNNDNVPERKFKLGVNQFADLTNDEFRSMYT--GYKGQHSTDV--ITDELKTTSFM  123

Query  440   YANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             + N +    P ++DWR KGAVTPIK+Q +CG CWAF+VVAA+EG  K+K G L+SLSEQ+
Sbjct  124   HQNVSLRASPVSLDWRKKGAVTPIKNQASCGCCWAFSVVAAIEGATKIKKGKLISLSEQQ  183

Query  614   LVDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGY  793
             LVDCD+  YGC+GG   +AF+ I  ++GLTTE NYPY G +   CN  K ++KA  I+GY
Sbjct  184   LVDCDKYDYGCEGGLLDTAFEHIKESHGLTTEANYPYNG-EDGTCNSKKASAKAATITGY  242

Query  794   ERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtta  973
             E VPA +E ALM+AV +QPV + I GG F F+FY  GVF+G+C   LDH       G   
Sbjct  243   EDVPANDEKALMKAVTNQPVSVAIEGGGFEFQFYSSGVFTGQCGTDLDH--AVAVVGYGE  300

Query  974   gdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
                G K+W+IKNSWG  WGE+GYMRIQ+D  DK+GLCGLA  ASYP +
Sbjct  301   TVDGTKHWIIKNSWGEHWGESGYMRIQKDVKDKQGLCGLAMKASYPIV  348



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 225/345 (65%), Gaps = 20/345 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLFI+    G W     +       M  RH+QWM  +G+VY D  E   R++IF+ NV 
Sbjct  13    ALLFIS----GAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVA  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RI+ FN+   K YKLGVN+FADLTN+EF+              + +G M + ++  FRY 
Sbjct  69    RIDAFNSQTGKSYKLGVNQFADLTNEEFKA----------SRNRFKGHMCSPQAGPFRYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N + +PST+DWR +GAVTP+KDQG CG CWAF+ VAA+EGI+KL TG L+SLSEQE+VDC
Sbjct  119   NVSAVPSTMDWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDC  178

Query  626   DRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D K    GC+GG    AF+FI  N GLTTE NYPYKG  H  CN  K A+ A +I+G+E 
Sbjct  179   DTKGEDQGCNGGLMDDAFKFIEKNKGLTTEANYPYKGT-HGTCNTKKAANHAAKITGFED  237

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA +E ALM+AVA QPV + I+ G + F+FY  G+F+G C   LDH    V        
Sbjct  238   VPANSEAALMKAVAKQPVSVAIDAGGYDFQFYSSGIFTGSCGTQLDH---GVTAVGYGVS  294

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSWG +WGE GY+R+Q+D + K+GLCG+A  ASYPT
Sbjct  295   DGSKYWLVKNSWGAQWGEEGYIRMQKDVSAKEGLCGIAMQASYPT  339



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 227/344 (66%), Gaps = 16/344 (5%)
 Frame = +2

Query  92    LFITTIILGVWSYLVASTFDYQHS-MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L +  I+LG WS    S+   Q + M  R++QW A +G+VY D  E + RF IF+ NV  
Sbjct  10    LCLALILLGAWSPQAMSSRTLQDAAMYERYEQWTARYGRVYRDNAEKEKRFTIFKQNVAN  69

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE FN    K YKL VN+FADLTN+EF+              + +G M + ++  F+Y N
Sbjct  70    IEAFNKASEKPYKLAVNEFADLTNEEFKA----------SRNRFKGHMCSEQTGPFKYEN  119

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +PST+DWR KGAVTP+KDQG CG CWAF+ VAA+EGI++L TG L SLSEQELVDCD
Sbjct  120   VTAVPSTMDWRKKGAVTPVKDQGQCGCCWAFSAVAAIEGINQLTTGKLASLSEQELVDCD  179

Query  629   RK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
              K    GC+GG   +AFQF+  N G+TTE NYPYKG   + CN  + A+ A +I+G+E V
Sbjct  180   VKGEDEGCNGGLMDNAFQFVQKNKGITTEINYPYKGVDGK-CNAKEEANHAAKINGHEDV  238

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +ETALM+AVA+QPV + I+ G F F+FY  GVF+G C   LDH       G  A D 
Sbjct  239   PANSETALMKAVANQPVSVAIDAGGFDFQFYSSGVFTGDCGTELDH--GVTAVGYGAADD  296

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWG  WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  297   GTKYWLVKNSWGATWGEEGYIRMQRDIDAKQGLCGIAMQASYPT  340



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   342 bits (876),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/344 (50%), Positives = 225/344 (65%), Gaps = 13/344 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L+F+  +++G+W+    S   +  +M  RH+ WMA +G+VY D  E + RF IFRNNVE 
Sbjct  9     LMFVALLVVGLWASQAWSRSLHDAAMNERHEMWMAKYGRVYKDNSEKERRFEIFRNNVEF  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+FN   N+ YKL +N+FADLTN+EF+        V +   K    +  ++   FRYAN
Sbjct  69    IESFNKLGNRPYKLDINEFADLTNEEFK--------VSKNGYKRSSGVGLTEKSSFRYAN  120

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +P+++DWR  GAVTPIKDQG CG CWAF+ VAA+EGI KL TG L+SLSEQELVDCD
Sbjct  121   VTAVPTSMDWRQNGAVTPIKDQGQCGCCWAFSAVAAMEGITKLSTGKLISLSEQELVDCD  180

Query  629   R--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
                +  GC+GG    AF+FI  N GLTTE NYPY+G     CN  K  + A +I+GYE V
Sbjct  181   TSGEDQGCEGGLMDDAFEFIKQNGGLTTEANYPYQGTDG-TCNTNKAGNDAAKITGYEDV  239

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E AL++AVA QPV + I+     F+FY  GVF+G C   LDH       G    D 
Sbjct  240   PANSEDALLKAVASQPVSVAIDASGSAFQFYSGGVFTGDCGTELDH--GVTAVGYGTSDD  297

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT WGE+GY+R++RD   K+GLCG+A   SYPT
Sbjct  298   GTKYWLVKNSWGTSWGEDGYIRMERDIEAKEGLCGIAMQPSYPT  341



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   342 bits (876),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 175/345 (51%), Positives = 223/345 (65%), Gaps = 19/345 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLF+    L  W+    +   ++ SM  RH+ WM  +G+ Y D  E   R+ IF++NV 
Sbjct  13    ALLFV----LAAWASQATARNLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFKDNVA  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RIE+FN   +K YKL +N+FADLTN+EFR              + +  + ++++  F+Y 
Sbjct  69    RIESFNKAMDKSYKLSINEFADLTNEEFRA----------SRNRFKAHICSTEATSFKYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T +PSTVDWR KGAVTPIKDQG CGSCWAF+ VAA+EGI +L TG L+SLSEQELVDC
Sbjct  119   NVTAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDC  178

Query  626   DR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D   +  GC GG    AF+FI  N+GLTTE NYPY G     CN  K A  A +I+GYE 
Sbjct  179   DTSGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDG-TCNRKKAAHPAAKINGYED  237

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA NE AL +AVAHQP+ + I+ G   F+FY  GVF+G+C   LDH       G    D
Sbjct  238   VPANNEKALQKAVAHQPIAVAIDAGGSEFQFYSSGVFTGQCGTELDH--GVSAVGYGTSD  295

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  296   DGMKYWLVKNSWGTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPT  340



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   342 bits (876),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 222/344 (65%), Gaps = 14/344 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L+F+  +++G+W     S   +  +M  RH+ WM  +G+VY D  E + RF IFRNNVE 
Sbjct  9     LMFVALLVVGLWVSQAWSRSLHDAAMNERHEMWMVKYGRVYKDNSEKERRFEIFRNNVEF  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+FN   N+ YKL +N+FADLTN+EF+          R   K    +  S+   FRY N
Sbjct  69    IESFNKPGNRPYKLDINEFADLTNEEFK--------ASRNGYKRSSNVGLSEKSSFRYGN  120

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +P+++DWR KGAVTPIKDQG CG CWAF+ VAA+EGI KL TG L+SLSEQELVDCD
Sbjct  121   VTAVPTSMDWRQKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLSTGKLISLSEQELVDCD  180

Query  629   R--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
                +  GC+GG    AF+FI  N GLTTE NYPY+G     CN  K  + A +I+GYE V
Sbjct  181   TSGEDQGCEGGLMDDAFEFIKQNGGLTTEANYPYQGTDG-TCNTNKAGNDAAKITGYEDV  239

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E AL++AVA QPV + I+     F+FY  GVF+G C   LDH    V         
Sbjct  240   PANSEDALLKAVASQPVSVAIDASGSAFQFYSGGVFTGDCGTELDH---GVTAVGYGTSD  296

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT WGE+GY+R++RD   K+GLCG+A  +SYPT
Sbjct  297   GTKYWLVKNSWGTSWGEDGYIRMERDIEAKEGLCGIAMQSSYPT  340



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   342 bits (876),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 223/353 (63%), Gaps = 14/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MAS I      F   +ILG W+  V      + SM  RH+QWMA  GKVY D  E + RF
Sbjct  1     MAS-ICKRQCFFAIFLILGTWACQVTPRELQEPSMSARHEQWMATFGKVYADAAEKERRF  59

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF++NVE IE+FN   NK YKL VNKFADLTN+E +        + R   +        
Sbjct  60    EIFKDNVEYIESFNTAGNKPYKLSVNKFADLTNEELK--------IARNGYRRPLQTRPM  111

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             K   F Y N T +P+T+DWR KGAVTPIKDQG CGSCWAF+ VAA EGI++L TG LVSL
Sbjct  112   KVTSFEYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSL  171

Query  602   SEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD +    GC+GG     F+FI+ N+G+T+E NYPY+      CN  K AS  
Sbjct  172   SEQELVDCDTQGEDQGCEGGLMEDGFEFIIKNHGITSEANYPYQAADG-TCNSKKEASHI  230

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I+GYE VPA +E AL++AVA+QP+ + I+ G   F+FY  GVF+G+C   LDH     
Sbjct  231   AKITGYESVPANSEAALLKAVANQPISVSIDAGGSDFQFYSSGVFTGQCGTELDH--GVT  288

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G      G KYW+ KNSWGT WGE GY+R+QRD   ++GLCG+A  +SYPT
Sbjct  289   AVGYGETSDGTKYWLFKNSWGTSWGEAGYIRMQRDIDAEEGLCGIAMDSSYPT  341



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 178/342 (52%), Positives = 224/342 (65%), Gaps = 15/342 (4%)
 Frame = +2

Query  95    FITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIE  274
             F   ++    S+  A T   + +M  RH+QWMA  G+ Y D+ E + R+ IF+ NVE IE
Sbjct  13    FSVLLLCACASHATARTLS-EMTMAERHEQWMAQQGRAYRDSAEKERRYQIFKANVELIE  71

Query  275   TFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANAT  454
             +FNAG N  YKLGVN+FADLTN+EF+   ++ G+      K     +   +  F Y N T
Sbjct  72    SFNAG-NSKYKLGVNQFADLTNEEFK--AMMNGF------KPSTLKTLKATNVFSYENVT  122

Query  455   NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK  634
              +PS++DWR KGAVTPIKDQG CG CWAF+ VAA+EGI KLKTG L+SLSEQELVDCD  
Sbjct  123   AVPSSMDWRAKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLKTGKLMSLSEQELVDCDVA  182

Query  635   S--YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPA  808
             S   GCDGG   +AF+FI+NN GLTTE NYPYKG     CN  K+AS    I GYE VPA
Sbjct  183   SDDQGCDGGLMDNAFKFIINNRGLTTETNYPYKGIDG-TCNSKKSASHVASIKGYEDVPA  241

Query  809   KNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggk  988
              +E AL++AVA+QPV + I      F+FY  G+F+G C   LDH       G      G 
Sbjct  242   NSEAALLKAVANQPVSVAIEASSGSFQFYSSGIFTGSCGTDLDH--GVTTVGYGTTKDGT  299

Query  989   kyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             KYW++KNSWG+ WGE GY+R++RD A K+GLCG+A  ASYPT
Sbjct  300   KYWLVKNSWGSSWGEKGYIRMERDVAAKEGLCGIAMEASYPT  341



>gb|AAD53011.1|AF089848_1 senescence-specific cysteine protease [Brassica napus]
Length=346

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 223/346 (64%), Gaps = 11/346 (3%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
              L ++ +    +S  ++   D +  M+ +H +WMA HG+ Y D  E + R+ +F+ NVER
Sbjct  9     FLIVSLVSSFCFSTTLSRLLDDELIMQKKHDEWMAEHGRTYADMNEKNNRYVVFKRNVER  68

Query  269   IETFNAGP-NKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             IE  N  P  + +KL VN+FADLTNDEFR +     Y G +   V    S +KS  FRY 
Sbjct  69    IERLNNVPAGRTFKLAVNQFADLTNDEFRFM-----YTGYKGDFVLFSQSQTKSTSFRYQ  123

Query  446   NA--TNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             N     LP  VDWR KGAVTPIK+QG+CG CWAF+ VAA+EG  ++K G L+SLSEQ+LV
Sbjct  124   NVFFGALPIAVDWRKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQQLV  183

Query  620   DCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             DCD   +GC GG   +AF+ I+   GLTTE NYPYKG+    C    T   A  I+GYE 
Sbjct  184   DCDTNDFGCSGGLMDTAFEHIMATGGLTTESNYPYKGEDAN-CKIKSTKPSAASITGYED  242

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VP  +E ALM+AVAHQPV + I GG F F+FY  GVF+G+C  +LDH       G +   
Sbjct  243   VPVNDENALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDH--AVTAVGYSQSS  300

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
              G KYW+IKNSWGT+WGE GYMRI++D  DK+GLCGLA  ASYPTI
Sbjct  301   AGSKYWIIKNSWGTKWGEGGYMRIKKDIKDKEGLCGLAMKASYPTI  346



>ref|XP_006376351.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
 gb|ERP54148.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
Length=342

 Score =   340 bits (873),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 175/343 (51%), Positives = 222/343 (65%), Gaps = 13/343 (4%)
 Frame = +2

Query  92    LFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERI  271
              F   +ILG+W+Y VAS    + SM  RH+QWMA  GKVY D  E + RF IF++NVE I
Sbjct  10    FFAFILILGMWAYEVASRELQEPSMSARHEQWMATFGKVYADAAETERRFEIFKDNVEYI  69

Query  272   ETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANA  451
             E+FN   NK YKL VNKFAD TN+E +        V R   +        K   F+Y N 
Sbjct  70    ESFNTTGNKPYKLSVNKFADQTNEELK--------VARNGYRRPLQTRPMKVTSFKYENV  121

Query  452   TNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR  631
             T +P+T+DWR KGAVT IKDQG CGSCWAF+ VAA EGI++L TG LVSLSEQELVDCD 
Sbjct  122   TAVPATMDWRKKGAVTLIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDI  181

Query  632   K--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
             +    GC+GG     F+FI+ N+G+TTE NYPY+      CN    AS+  +I+GYE VP
Sbjct  182   QGEDQGCEGGLMEDGFEFIIKNHGITTEANYPYQAADG-TCNSKIEASRIAKITGYESVP  240

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A +E AL++AVA+QP+ + I+ G   F+FY  G F+G+C   LDH       G      G
Sbjct  241   ANSEAALLKAVANQPISVSIDAGGSDFQFYSSGDFTGQCGTELDH--GVTAVGYGETSDG  298

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGE GY+R+QRD   ++GLCG+A  +SYPT
Sbjct  299   TKYWLVKNSWGTSWGEEGYIRMQRDTEAEEGLCGIAMDSSYPT  341



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score =   341 bits (875),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 174/347 (50%), Positives = 227/347 (65%), Gaps = 18/347 (5%)
 Frame = +2

Query  83    SSLLFITTIILGVW-SYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNN  259
             S +      +L  W S  VA T     SM  RH+QWMA +G+VY D  E + R+NIF+ N
Sbjct  33    SQICLALLFVLVAWPSKSVARTLQ-DVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKEN  91

Query  260   VERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFR  439
             V RI+ FN+   K YKLGVN+FADL+N+EF+              + +G M + ++  FR
Sbjct  92    VARIDAFNSQTGKSYKLGVNQFADLSNEEFKA----------SRNRFKGHMCSPQAGPFR  141

Query  440   YANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             Y N + +P+T+DWR KGAVTP+KDQG CG CWAF+ VAA+EGI++L TG L+SLSEQE+V
Sbjct  142   YENVSAVPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSEQEVV  201

Query  620   DCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGY  793
             DCD K    GC+GG    AF+FI  N GLTTE NYPY G     CN  K A+ A +I+G+
Sbjct  202   DCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYTGTDG-TCNTQKEANHAAKITGF  260

Query  794   ERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtta  973
             E VPA +E AL++AVA QPV + I+ G F F+FY  G+F+G C   LDH    V      
Sbjct  261   EDVPANSEAALIKAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTELDH---GVTAVGYG  317

Query  974   gdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G  G KYW++KNSWG +WGE GY+R+Q+D + K+GLCG+A  ASYPT
Sbjct  318   GSDGTKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCGIAMQASYPT  364



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 228/349 (65%), Gaps = 11/349 (3%)
 Frame = +2

Query  74    ILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             +L + L+ +  +++ +W+    S   ++ SM LRH+ WM  +G+VY    E + RF IF+
Sbjct  4     LLHNKLVLMAMLLVTLWASQSWSRSLHEASMELRHKTWMTQYGRVYKGNVEKEKRFKIFK  63

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              NVE IE+FN   NK YKLG+N F DLTN+EFR  H   GY       +    S+ ++K 
Sbjct  64    ENVEFIESFNNNGNKPYKLGINAFTDLTNEEFRASH--NGYT----MSMSSHQSSYRTKS  117

Query  434   FRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             FRY N T +P ++DWR KGAVT IKDQG CG CWAF+ VAA+EGI KL TG L+SLSEQE
Sbjct  118   FRYENVTAVPPSLDWRTKGAVTHIKDQGQCGCCWAFSAVAAMEGITKLSTGTLISLSEQE  177

Query  614   LVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRIS  787
             LVDCD      GC+GG    AF+FI+ NNGLTTE NYPY+G     CN  K A+ A +I+
Sbjct  178   LVDCDTSGMDQGCEGGLMDDAFEFIIENNGLTTEANYPYEGVDGS-CNTRKAANHAAKIT  236

Query  788   GYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygt  967
             GYE VPA +E AL +AVA+QPV + I+ G+  F+ Y  G+F+G C   LDH       G 
Sbjct  237   GYENVPAYDEEALRKAVANQPVSVAIDAGESAFQHYSSGIFTGDCGTELDH--GVTVVGY  294

Query  968   tagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                D G KYW++KNSWGT WGE+GY+R++RD   K+GLCG+A   SYPT
Sbjct  295   GTSDDGTKYWLVKNSWGTSWGEDGYIRMERDIDAKEGLCGIAMEPSYPT  343



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/345 (51%), Positives = 223/345 (65%), Gaps = 19/345 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLF     L  W+    +    + SM  RH+ WMA +G+VY D  E   R+ IF++NV 
Sbjct  13    ALLFF----LAAWASQATARNLLEASMYERHEDWMAQYGRVYKDADEKSKRYKIFKDNVA  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RIE+FN   +K YKL +N+FADLTN+EFR              + +  + ++++  F+Y 
Sbjct  69    RIESFNKAMDKSYKLSINEFADLTNEEFRA----------SRNRFKAHICSTEATSFKYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             +   +PSTVDWR KGAVTPIKDQG CGSCWAF+ VAA+EGI +L TG L+SLSEQELVDC
Sbjct  119   HVAAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDC  178

Query  626   DR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D   +  GC+GG    AF+FI  N+GL TE NYPY G     CN  K A  A +I+GYE 
Sbjct  179   DTSGEDQGCNGGLMDDAFKFIEQNHGLATEANYPYAGTDG-TCNRKKAAHPAAKINGYED  237

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA NE AL +AVAHQP+ + I+ G F F+FY  GVF+G+C   LDH       G    D
Sbjct  238   VPANNEKALQKAVAHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDH--GVAAVGYGTSD  295

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  296   DGMKYWLVKNSWGTGWGEVGYIRMQRDVTAKEGLCGIAMQASYPT  340



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/345 (50%), Positives = 223/345 (65%), Gaps = 20/345 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLFI    LG W     +       M  RH+QWM  +G+VY D  E   R++IF+ NV 
Sbjct  13    ALLFI----LGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVA  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RI+ FN+   K YKLGVN+FADLTN+EF+              + +G M + ++  FRY 
Sbjct  69    RIDAFNSQTGKSYKLGVNQFADLTNEEFKA----------SRNRFKGHMCSPQAGPFRYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N + +PSTVDWR +GAVTP+KDQG CG CWAF+ VAA+EGI+KL TG L+SLSEQE+VDC
Sbjct  119   NVSAVPSTVDWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDC  178

Query  626   DRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D K    GC+GG    AF+FI  N GLTTE NYPYKG     CN  K+A  A +I+G+E 
Sbjct  179   DTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDG-TCNTKKSAIHAAKITGFED  237

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA +E ALM+AVA QPV + I+ G   F+FY  G+F+G C   LDH    V        
Sbjct  238   VPANSEAALMKAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDH---GVTAVGYGVS  294

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSWG +WGE GY+R+Q+D + K+GLCG+A  ASYPT
Sbjct  295   DGSKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCGIAMQASYPT  339



>ref|XP_010045988.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 233/353 (66%), Gaps = 14/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MAS ++G  L+ +   ILG+W+    S   +  +M  RH+Q MA HG+VY D  E + RF
Sbjct  1     MASTLVGK-LVLVMVAILGLWASQARSRELHGATMWERHEQRMARHGRVYQDDAEKERRF  59

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
             +IF+NNV+ IE+FN   NK Y L +N F DLT +EF+          R   K        
Sbjct  60    SIFKNNVDFIESFNKDGNKPYTLAINAFVDLTIEEFK--------ASRNGYKRSSSPRQV  111

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
              +K FRY + T +PS++DWR KGAV PIKDQG CGSCWAF+ V A+EG ++L TG L+SL
Sbjct  112   STKPFRYEHVTAVPSSMDWRKKGAVMPIKDQGQCGSCWAFSAVGAMEGNNQLTTGKLISL  171

Query  602   SEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD   +  GC+GGF  +AF+FI+ N+GLTTE NYPY+      CN  K AS A
Sbjct  172   SEQELVDCDTSGEDQGCEGGFMDNAFEFIIGNHGLTTETNYPYQAVDG-TCNARKEASSA  230

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I+GYE VPA +E+AL++AVAHQPV + I+ G+  F+FY  G+F+G+C  +LDH     
Sbjct  231   AKINGYEDVPANSESALLKAVAHQPVSVAIDAGESAFQFYSSGIFTGECGTNLDH--GVT  288

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G    + G KYW++KNSWGT WGE GY+R++RD   K+GLCG+A  ASYPT
Sbjct  289   AVGYGTSEDGTKYWLVKNSWGTGWGEEGYIRMKRDIDAKEGLCGIAMEASYPT  341



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/343 (50%), Positives = 224/343 (65%), Gaps = 12/343 (3%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L     ++L +W     +      SM  +H+QW+A  G+VY D  E   RFNIF+ NVE 
Sbjct  9     LFLAALVVLEIWGSQATARTLPDASMVEKHEQWIAQFGRVYKDDAEKAKRFNIFKENVEY  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             I++FN    + YKL +NKFADLTN+EF+          R   K+  +  +SK   FRYAN
Sbjct  69    IQSFNEAGARPYKLAINKFADLTNEEFQ--------ASRNGYKMGSYGKSSKVSSFRYAN  120

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +P+++DWR KGAVT +KDQG CG CWAF+ VAA EGI++L TGNL+SLSEQELVDCD
Sbjct  121   VTAVPASMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGNLISLSEQELVDCD  180

Query  629   -RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
               +  GC+GG   +AF+FI++N G+TTE NYPY+G     CN  K +S   +I+GYE VP
Sbjct  181   TSEDEGCNGGLMDNAFEFIISNGGITTESNYPYEGVDG-TCNSKKESSHVAKITGYEDVP  239

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A +E+AL++AVA+QPV + I+     F+FY  GVF+G+C   LDH       G      G
Sbjct  240   ANSESALLKAVANQPVSVAIDASGSDFQFYTSGVFTGQCGTELDH--GVTAVGYGKTSDG  297

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGENGY+R+QRD    +GLCG+A  ASYPT
Sbjct  298   TKYWLVKNSWGTSWGENGYIRMQRDIDAAEGLCGIAMQASYPT  340



>ref|XP_002525123.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37250.1| cysteine protease, putative [Ricinus communis]
Length=349

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 177/350 (51%), Positives = 230/350 (66%), Gaps = 18/350 (5%)
 Frame = +2

Query  71    KILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIF  250
             KIL  +L F+    L + +   AS   ++  M  RH++WMA HGKVY D  E   RF IF
Sbjct  8     KILPIALFFV----LAMCADQAASRELHELEMTGRHEKWMAKHGKVYKDDKEKLRRFQIF  63

Query  251   RNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSK  430
             ++NV  IE+FN   NK Y LG+NKFADLTN+EFR            N       ++ K  
Sbjct  64    KSNVVFIESFNTAGNKSYMLGINKFADLTNEEFRAFW---------NGYKRPLGASRKIT  114

Query  431   HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
              F+Y N T LPS++DWR+KGAVTPIKDQG CGSCWAF+ VAA EGIHKL+TG LVSLSEQ
Sbjct  115   PFKYENVTALPSSIDWRSKGAVTPIKDQGVCGSCWAFSAVAATEGIHKLRTGKLVSLSEQ  174

Query  611   ELVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELVDCD K    GC GG  + AF+FI  + G+T+E NYPY+G+  + C+  K AS+AV+I
Sbjct  175   ELVDCDVKGQDKGCQGGLMVDAFKFIKRHGGMTSEANYPYQGRDGK-CDTKKEASRAVKI  233

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
             +GY+ VP  +E AL++AVA+QPV + I+ G   F+FY  G+F+G C   ++H       G
Sbjct  234   TGYQAVPKNSEAALLKAVANQPVSVAIDAGSLSFQFYRSGIFTGICGKDINH--GVAAVG  291

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 + G KYW++KNSWGT WGE GY+R++RD   K+GLCG+A   SYPT
Sbjct  292   YGRSNSGSKYWIVKNSWGTEWGEKGYIRMKRDVRSKEGLCGIAMECSYPT  341



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   339 bits (869),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 232/344 (67%), Gaps = 13/344 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
              + +  ++LG+++    +    + SMR RH+QWMA HG+VY    E + RF IF+NNVE 
Sbjct  9     FILVAAMVLGLYASQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFMIFKNNVEF  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+FN    + YKLG+N FADLTNDEF+          R   K    +S+S  K FRY N
Sbjct  69    IESFNENNTRPYKLGINGFADLTNDEFKAT--------RNGYKRSSSVSSSGPKSFRYEN  120

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +PSTVDWR KGAVTP+K+QG CG CWAF+ VAA EGIH+L TGNLVSLS Q+LVDCD
Sbjct  121   VTAVPSTVDWRQKGAVTPVKEQGQCGCCWAFSAVAATEGIHQLTTGNLVSLSVQQLVDCD  180

Query  629   RK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
              K  + GC GGF  +AF+FI++N+GLTTE+NYPY+  +   C+  +  S A +I+GYE V
Sbjct  181   TKGDNRGCAGGFVNAAFKFIIDNDGLTTEDNYPYEAVKG-TCDAGQAESPAAKITGYEDV  239

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             P+ +E+AL QAVA+QPV + I+    HF+FY  GVF+G C+  LDH       G    D 
Sbjct  240   PSNSESALSQAVANQPVSVAIDADGSHFQFYSGGVFTGDCQTDLDH--GVTVVGYGTSDD  297

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWG  WGENGY+R++RD    +GLCG+A  A+YPT
Sbjct  298   GTKYWLVKNSWGAGWGENGYIRMKRDIDAVEGLCGIAIRAAYPT  341



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score =   338 bits (868),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 174/345 (50%), Positives = 222/345 (64%), Gaps = 20/345 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLFI    LG W     +       M  RH+QWM  +G+VY D  E   R++IF+ NV 
Sbjct  13    ALLFI----LGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVA  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RI+ FN+   K YKLGVN+FADLTN+EF+              + +G M + ++  FRY 
Sbjct  69    RIDAFNSQTGKSYKLGVNQFADLTNEEFKA----------SRNRFKGHMCSPQAGPFRYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N + +PSTVDWR +GAVTP+KDQG CG CWAF+ VAA+EGI+KL TG L+SLSEQE+VDC
Sbjct  119   NVSAVPSTVDWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDC  178

Query  626   DRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D K    GC+GG    AF+FI  N GLTTE NYPYKG     CN  K A  A +I+G+E 
Sbjct  179   DTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDG-TCNTNKAAIHAAKITGFED  237

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA +E ALM+AVA QPV + I+ G   F+FY  G+F+G C   LDH    V        
Sbjct  238   VPANSEAALMKAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDH---GVTAVGYGVS  294

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSWG +WGE GY+R+Q+D + K+GLCG+A  ASYPT
Sbjct  295   DGSKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCGIAMQASYPT  339



>ref|XP_002307151.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
 gb|EEE94147.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
Length=309

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 216/320 (68%), Gaps = 16/320 (5%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             SM  RH+QWMA +G+VY D  E + R+NIF+ NV RI+ FN+   K Y LGVN+FADLTN
Sbjct  3     SMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVARIDAFNSQTGKSYNLGVNQFADLTN  62

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGN  520
             +EF+              + +G M + ++  FRY N + +P+T+DWR KGAVTP+KDQG 
Sbjct  63    EEFKA----------SRNRFKGHMCSPQAGPFRYENVSAVPATMDWRKKGAVTPVKDQGQ  112

Query  521   CGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNN  694
             CG CWAF+ VAA+EGI++L TG L+SLSEQE+VDCD K    GC+GG    AF+FI  N 
Sbjct  113   CGCCWAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNK  172

Query  695   GLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGG  874
             GLTTE NYPY G     CN  K  S A +I+G++ VPA +E ALM+AVA QPV + I+ G
Sbjct  173   GLTTEANYPYTGTDG-TCNTQKEVSHAAKITGFQDVPANSEAALMKAVAKQPVSVAIDAG  231

Query  875   DFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQ  1054
              F F+FY  G+F+G C   LDH    V      G  G KYW++KNSWG +WGE GY+R+Q
Sbjct  232   GFEFQFYSSGIFTGSCGTELDH---GVTAVGYGGSDGTKYWLVKNSWGAQWGEEGYIRMQ  288

Query  1055  RDYADKKGLCGLAKAASYPT  1114
             +D + K+GLCG+A  ASYPT
Sbjct  289   KDISAKEGLCGIAMQASYPT  308



>dbj|BAF56430.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   338 bits (868),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 229/353 (65%), Gaps = 15/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MASK + +       ++ G  S+   +      SM  RH+QWMA +GKVY D+YE ++R 
Sbjct  1     MASKTVLNITSLTLLLVFGFLSFEANARTLEDASMHERHEQWMAQYGKVYKDSYEKELRS  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NV+RIE FN   NK YKLG+N+FADLTN+EF+  +   G++           +++
Sbjct  61    KIFKENVQRIEAFNNAGNKSYKLGINQFADLTNEEFKARNRFKGHMCS---------NST  111

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             ++  F+Y + T++P+++DWR KGAVTPIKDQG CG CWAF+ VAA EGI KL TG L+SL
Sbjct  112   RTPTFKYEHVTSVPASLDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGITKLSTGKLISL  171

Query  602   SEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD K    GC+GG    AF+FI+ N GL TE  YPY+G     CN    A  A
Sbjct  172   SEQELVDCDTKGVDQGCEGGLMDDAFKFIMQNKGLNTEAKYPYQGV-DATCNANAEAKDA  230

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
               I G+E VPA +E+AL++AVA+QP+ + I+     F+FY  GVF+G C   LDH    V
Sbjct  231   ASIKGFEDVPANSESALLKAVANQPISVAIDASGSEFQFYSSGVFTGSCGTELDH---GV  287

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                    DGG KYW++KNSWG +WGE GY+R+QRD A ++GLCG A  ASYPT
Sbjct  288   TAVGYGSDGGTKYWLVKNSWGEQWGEQGYIRMQRDVAAEEGLCGFAMQASYPT  340



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   338 bits (867),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 228/344 (66%), Gaps = 16/344 (5%)
 Frame = +2

Query  92    LFITTIILGVWSYLVASTFDYQHS-MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L +  I+LG W     S+   Q + M  R++QW A +G+VY D  E + RF IF+ NV  
Sbjct  10    LCLALILLGAWIPQALSSRALQDAAMYERYEQWTARYGRVYRDNVEKEKRFTIFKRNVAH  69

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE FN    K YKL VN+FADLTN+EF+        V R   + +G M + ++  F+Y N
Sbjct  70    IEAFNKASKKPYKLAVNEFADLTNEEFK--------VSRN--RFKGHMCSEQTGPFKYEN  119

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +PST+DWR KGAVTP+KDQG CG CWAF+ VAA+EGI++L TG L SLSEQELVDCD
Sbjct  120   VTAVPSTMDWRKKGAVTPVKDQGQCGCCWAFSAVAAIEGINQLTTGKLASLSEQELVDCD  179

Query  629   RK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
              K    GC+GG   +AFQF+  N G+TTE NYPYKG   + CN  + A+ A +I+G+E V
Sbjct  180   VKGEDEGCNGGLMDNAFQFVQKNKGITTETNYPYKGVDGK-CNAKEEANHAAKINGHEDV  238

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +ETALM+AVA+QPV + I+ G   F+FY  GVF+G C   LDH       G  A D 
Sbjct  239   PANSETALMKAVANQPVSVAIDAGGSDFQFYSSGVFTGDCGTELDH--GVTAVGYGAADD  296

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  297   GTKYWLVKNSWGTSWGEEGYIRMQRDIDAKEGLCGIAMQASYPT  340



>ref|XP_011008467.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=305

 Score =   337 bits (863),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 172/317 (54%), Positives = 219/317 (69%), Gaps = 13/317 (4%)
 Frame = +2

Query  164   MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTND  343
             M  RH +WMA +G+VY D  E D R+ IF+ N+ERIE FN G ++GYKLGVNKFADLTN+
Sbjct  1     MLKRHGEWMAQYGRVYGDMKEKDKRYLIFKENIERIEAFNNGSDRGYKLGVNKFADLTNE  60

Query  344   EFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNC  523
             EFR ++   GY  RQ+ K+   MS+S    FRY N +++P+++DWRN  AVTP+KDQG C
Sbjct  61    EFRAMYH--GYK-RQSSKL---MSSS----FRYENLSDIPTSMDWRNAEAVTPVKDQGRC  110

Query  524   GSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSYGCDGGFPISAFQFIVNNNGLT  703
             G CWAF+ VAA+EGI KLKTG L+SLSEQ+LVDCD  + GC GGF  +AFQ+I+ N GL 
Sbjct  111   GCCWAFSTVAAIEGIIKLKTGKLISLSEQQLVDCDVGNNGCHGGFMDNAFQYIIRNGGLA  170

Query  704   TEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFH  883
             +E+NYPY+G     CN  K +S    I+GYE VP  NE AL+QAVA QPV + ++GG   
Sbjct  171   SEDNYPYQGVDG-TCNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVVVDGGGQD  229

Query  884   FRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDY  1063
             F+FY+ GVF G C    +H       G      G  YW++KNSWGT WGE+GYMR+QR  
Sbjct  230   FQFYKSGVFKGDCGTEQNH--AVTAIGYGTDSDGTDYWLVKNSWGTSWGESGYMRMQRGI  287

Query  1064  ADKKGLCGLAKAASYPT  1114
                +GLCG+A  ASYPT
Sbjct  288   GASEGLCGVAMDASYPT  304



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score =   338 bits (866),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 222/345 (64%), Gaps = 20/345 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLFI    LG W     +       M  RH+QWM  +G+VY D  E   R++IF+ NV 
Sbjct  13    ALLFI----LGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDTERATRYSIFKENVA  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RI+ FN+   K YKLGVN+FADLTN+EF+              + +G M + ++  FRY 
Sbjct  69    RIDAFNSQTGKSYKLGVNQFADLTNEEFKA----------SRNRFKGHMCSPQAGPFRYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N + +PST+DWR +GAVTP+KDQG CG CWAF+ VAA+EGI+KL TG L+SLSEQE+VDC
Sbjct  119   NVSAVPSTMDWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDC  178

Query  626   DRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D K    GC+GG    AF+FI  N GLTTE NYPYKG     CN  K A  A +I+G+E 
Sbjct  179   DTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDG-TCNTNKAAIHAAKITGFED  237

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA +E ALM+AVA QPV + I+ G   F+FY  G+F+G C   LDH    V        
Sbjct  238   VPANSEAALMKAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDH---GVTAVGYGVS  294

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSWG +WGE GY+R+Q+D + K+GLCG+A  ASYPT
Sbjct  295   DGSKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCGIAMQASYPT  339



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score =   338 bits (866),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 227/344 (66%), Gaps = 16/344 (5%)
 Frame = +2

Query  92    LFITTIILGVWSYLVASTFDYQHS-MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L +  I+LG W     S+   Q + M  R++QW A +G+VY D  E + RF IF+ NV  
Sbjct  10    LCLALILLGAWIPQALSSRALQDAAMYERYEQWTARYGRVYRDNAEKEKRFTIFKQNVAH  69

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE FN    K YKL VN+FADLTN+EF+        V R   + +G M + ++  F+Y N
Sbjct  70    IEAFNKASKKPYKLAVNEFADLTNEEFK--------VSRN--RFKGHMCSEQTGPFKYEN  119

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +PST+DWR KGAVTP+KDQG CG CWAF+ VAA+EGI++L TG L SLSEQELVDCD
Sbjct  120   VTAVPSTMDWRKKGAVTPVKDQGQCGCCWAFSAVAAIEGINQLTTGKLASLSEQELVDCD  179

Query  629   RK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
              K    GC+GG   +AFQF+  N G+TTE NYPYKG   + CN  + A+ A +I+G+E V
Sbjct  180   VKGEDEGCNGGLMDNAFQFVQKNKGITTETNYPYKGVDGK-CNAKEEANHAAKINGHEDV  238

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +ETALM AVA+QPV + I+ G   F+FY  GVF+G C   LDH       G  A D 
Sbjct  239   PANSETALMNAVANQPVSVAIDAGGSDFQFYSSGVFTGDCGTELDH--GVTAVGYGAADD  296

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  297   GTKYWLVKNSWGTSWGEEGYIRMQRDIDAKEGLCGIAMQASYPT  340



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   338 bits (866),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 225/345 (65%), Gaps = 20/345 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +L+F+   ++   S  +A T     SM  +H++WM+  G+VY D  E ++R+ IF+ NV+
Sbjct  13    ALIFLLGALV---SQAMARTLQ-DASMHEKHEEWMSRFGRVYNDGNEKEIRYKIFKENVQ  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RIE+FN    K YKLG+N+FADLTN+EF+              + +G M +S++  FRY 
Sbjct  69    RIESFNKASGKSYKLGINQFADLTNEEFKT----------SRNRFKGHMCSSQAGPFRYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T  PS++DWR KGAVT IKDQG CGSCWAF+ VAAVEGI +L T  L+SLSEQELVDC
Sbjct  119   NLTAAPSSMDWRKKGAVTAIKDQGQCGSCWAFSAVAAVEGITQLATSKLISLSEQELVDC  178

Query  626   DRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D K    GC GG    AF+FI  N GLTTE NYPY+G     CN  + A+ A +I+G+E 
Sbjct  179   DTKGEDQGCQGGLMDDAFKFIEQNQGLTTEANYPYEGSDG-TCNTKQEANHAAKINGFED  237

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA NE ALM+AVA QPV + I+ G F F+FY  G+F+G C   LDH    V        
Sbjct  238   VPANNEGALMKAVAKQPVSVAIDAGGFGFQFYSSGIFTGDCGTELDH---GVAAVGYGES  294

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G  YW++KNSWGT+WGE GY+R+Q+D   K+GLCG+A  ASYPT
Sbjct  295   NGMNYWLVKNSWGTQWGEEGYIRMQKDIDAKEGLCGIAMQASYPT  339



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   338 bits (866),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 221/345 (64%), Gaps = 19/345 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLF+    L  W+    +   ++ SM  RH+ WM  +G+ Y D  E   R+ IF++NV 
Sbjct  13    ALLFV----LAAWASQATARSLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFKDNVA  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RIE+FN   +K YKL +N+FADLTN+EFR              + +  + ++++  F+Y 
Sbjct  69    RIESFNKAMDKSYKLSINEFADLTNEEFRA----------SRNRFKAHICSTEATSFKYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T +PSTVDWR KGAVTPIKDQG CGSCWAF+ VAA+EGI +L TG L+SLSEQELVDC
Sbjct  119   NVTAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDC  178

Query  626   DR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D   +  GC GG    AF+FI  N+GLTTE NYPY G     CN  K A  A +I+GYE 
Sbjct  179   DTSGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDG-TCNRKKAAHPAAKINGYED  237

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA NE AL +AVAHQP+ + I+     F+FY  GVF+G+C   LDH       G    D
Sbjct  238   VPANNEKALQKAVAHQPIAVAIDASGSEFQFYSSGVFTGQCGTELDH--GVAAVGYGTSD  295

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSW T WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  296   DGMKYWLVKNSWSTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPT  340



>gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum]
Length=344

 Score =   338 bits (866),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 221/320 (69%), Gaps = 16/320 (5%)
 Frame = +2

Query  170   LRHQQWMAYHGKVYVDTYE--ADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTND  343
             +RH++WM+ HG+VY D  E   + RFN+F+ NVERIE FN G  K +KL +N+FADLTN+
Sbjct  35    MRHEEWMSQHGRVYADEQEDHKNKRFNVFKENVERIEEFNDG--KTFKLAINQFADLTNE  92

Query  344   EFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATN-LPSTVDWRNKGAVTPIKDQGN  520
             EFR       Y G +   V      +K   FRY N ++ LP +VDWR KGAVTP+K+QG 
Sbjct  93    EFR-----ASYNGFKGPMVLS-SQITKPTPFRYENVSSALPVSVDWRKKGAVTPVKNQGQ  146

Query  521   CGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNN  694
             CG CWAF+ VAA+EGI ++ TG L+SLSEQELVDCD K   +GC+GG   +AF+FI+NN 
Sbjct  147   CGCCWAFSAVAAIEGITQISTGKLISLSEQELVDCDTKGIDHGCEGGLMDTAFEFIINNG  206

Query  695   GLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGG  874
             GLTTE NYPYKG +   CNF KT   AV I+GYE VPA +E ALM+AVAHQPV + I  G
Sbjct  207   GLTTESNYPYKG-EDGTCNFNKTNPIAVSITGYEDVPANDEQALMKAVAHQPVSVAIEAG  265

Query  875   DFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQ  1054
                F+FY  GVF+G+C   LDH       G    + G KYW++KNSWGT+WGE+GY+ +Q
Sbjct  266   GSDFQFYSSGVFTGECGTELDH--AVTAVGYGESEDGSKYWIVKNSWGTKWGESGYIEMQ  323

Query  1055  RDYADKKGLCGLAKAASYPT  1114
             +D   K+GLCG+A  ASYPT
Sbjct  324   KDIKVKQGLCGIAMQASYPT  343



>gb|KDP40484.1| hypothetical protein JCGZ_24483 [Jatropha curcas]
Length=339

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/349 (49%), Positives = 230/349 (66%), Gaps = 21/349 (6%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             +G  LLFI    LG W+    +   ++  M  +H+QWM  +G+VY D  E +MR+ IF+ 
Sbjct  10    IGFGLLFI----LGAWTCESMARTVHKPPMYRKHEQWMTRYGRVYKDDNEKEMRYKIFKE  65

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHF  436
             NVERI++FN+   + Y+LGVN+FADLTN+EF               + +G M ++++  F
Sbjct  66    NVERIDSFNSDTRRSYRLGVNQFADLTNEEFNTAR----------NRFKGHMCSAQAGPF  115

Query  437   RYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQEL  616
             RY N T +P+T+DWR KGAVTPIKDQG CGSCWAF+ VAAVEGI ++KTG L++LSEQEL
Sbjct  116   RYQNVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSAVAAVEGIAQIKTGKLIALSEQEL  175

Query  617   VDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISG  790
             VDCD   +  GC GG    AF+FI   +GL +E  YPY   +   CN  + A  AV+I+G
Sbjct  176   VDCDNNGEDQGCQGGLMDDAFKFI-EKHGLASEATYPYHAAES-ACNTKEEAKPAVKITG  233

Query  791   YERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtt  970
             YE VPA +E AL+ AVA+QPV + I+   F F+FY  G+F+G C   LDH    V     
Sbjct  234   YEDVPANDEAALLNAVANQPVSVAIDASGFEFQFYSSGIFTGSCGTELDH---GVAAVGY  290

Query  971   agdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
               + G K+W++KNSWGT+WGE GY+R+QRD A K+GLCG+A  ASYPT+
Sbjct  291   GVNDGNKFWLVKNSWGTQWGEKGYIRMQRDIAAKEGLCGIAMQASYPTM  339



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 221/345 (64%), Gaps = 19/345 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLF+    L  W+    +   ++ SM  RH+ WM  +G+ Y D  E   R+ IF++NV 
Sbjct  13    ALLFV----LAAWASQATARXLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFKDNVA  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RIE+FN   +K YKL +N+FADLTN+EFR              + +  + ++++  F+Y 
Sbjct  69    RIESFNKAMDKSYKLSINEFADLTNEEFRA----------SRNRFKAHICSTEATSFKYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T +PSTVDWR KGAVTPIKDQG CGSCWAF+ VAA+EGI +L TG L+SLSEQELVDC
Sbjct  119   NVTAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDC  178

Query  626   DR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D   +  GC GG    AF+FI  N+GLTTE NYPY G     CN  K A  A +I+GYE 
Sbjct  179   DTSGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDG-TCNRKKAAHPAAKINGYED  237

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA NE AL +AVAHQP+ + I+     F+FY  GVF+G+C   LDH       G    D
Sbjct  238   VPANNEKALQKAVAHQPIAVAIDASGSEFQFYSSGVFTGQCGTELDH--GVAAVGYGTSD  295

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSW T WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  296   DGMKYWLVKNSWSTGWGEEGYIRMQRDVTVKEGLCGIAMQASYPT  340



>gb|AAR92154.1| putative cysteine protease 1 [Iris x hollandica]
Length=340

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 225/346 (65%), Gaps = 20/346 (6%)
 Frame = +2

Query  89    LLFITTIILGVWSYL--VASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNV  262
             L  +  +I+ +W+       +     SM  RH+QWMA HG+VY +  E   RF IFR NV
Sbjct  10    LPALALLIVAIWASQGEAGRSLGENKSMLERHEQWMAQHGRVYKNAAEKAHRFEIFRANV  69

Query  263   ERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRY  442
             ERIE+FNA  N  +KLGVN+FADLTN+EF+           +N      M+++KS  F+Y
Sbjct  70    ERIESFNA-ENHKFKLGVNQFADLTNEEFKT----------RNTLKPSKMASTKS--FKY  116

Query  443   ANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVD  622
              N T +P+T+DWR KGAVTPIKDQG CGSCWAF+ VAA EGI KL TG L+SLSEQE+VD
Sbjct  117   ENVTAVPATMDWRTKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSTGKLISLSEQEVVD  176

Query  623   CDRKS--YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYE  796
             CD  S   GC+GG    AF++I+ N G+TTE NYPYK      CN  K AS A  I+GYE
Sbjct  177   CDVTSDDQGCNGGEMDDAFEYIIKNKGITTEANYPYKAADG-TCNTKKAASHAASITGYE  235

Query  797   RVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttag  976
              V   +E AL++A A+QP+ + I+ GDF F+ Y  GVF+G C   LDH       G  A 
Sbjct  236   DVTVNSEAALLKAAANQPIAVAIDAGDFAFQMYSSGVFTGDCGTDLDH--GVTLVGYGAT  293

Query  977   dggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G KYW++KNSWGT WGE+GY+R++RD   K+GLCG+A  ASYPT
Sbjct  294   SDGTKYWLVKNSWGTSWGEDGYIRMERDVDAKEGLCGIAMDASYPT  339



>ref|XP_007050065.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX94222.1| Senescence-associated gene 12 [Theobroma cacao]
Length=342

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 231/353 (65%), Gaps = 14/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MAS +L    +    +IL V    V S   ++ S+  RH+QWM  +G+VY +  E ++RF
Sbjct  1     MAS-VLPRECIIAFFLILAVCIPNVMSRQLHEASLSQRHEQWMEEYGRVYKNDAETELRF  59

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
             +IF++N+  IE+FNA  N+ YKL +N+FAD TN+EFR      GY GR  +     +++ 
Sbjct  60    SIFKSNLAFIESFNAAGNRPYKLSINEFADQTNEEFRAYR--NGY-GRAQR-----LTSR  111

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             K   FRY N T LP++VDWR KGAVTPIKDQ  CGSCWAF+ VAA EGIH+L TG L+SL
Sbjct  112   KETSFRYENVTALPASVDWRKKGAVTPIKDQAQCGSCWAFSAVAATEGIHQLTTGKLISL  171

Query  602   SEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD +    GC GG    AF+FI+ N+G+ +E  YPYKG     CN  K AS A
Sbjct  172   SEQELVDCDTQGEDQGCAGGEMEDAFEFIIRNHGIASEVTYPYKGDDG-TCNKTKEASHA  230

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
               I+GYE VPA +E ALM+AVA+QPV + I+ G + F+FY  G+F+G C   LDH     
Sbjct  231   ATITGYEVVPANSEKALMKAVANQPVSVSIDAGGYAFQFYSSGIFTGDCGTELDH--GVT  288

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G    + G  YW++KNSWGT WGE GY+R+QRD   K+GLCG+A  +SYPT
Sbjct  289   AVGYGTSEDGTMYWLVKNSWGTGWGEKGYIRMQRDIKAKEGLCGIAMDSSYPT  341



>ref|XP_007227669.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
 gb|EMJ28868.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
Length=342

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 227/350 (65%), Gaps = 20/350 (6%)
 Frame = +2

Query  71    KILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIF  250
             K +  +L+F+    LG WS    S      SM  +++QWMA +G+VY D  E +MRF IF
Sbjct  10    KCICLALIFM----LGAWSSQATSRNLQDASMYGKYEQWMARYGRVYTDIQEKEMRFKIF  65

Query  251   RNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSK  430
             + NV  IE+ N+  NK YKL VN+FADLTN+EF+      G++G +         ++K+ 
Sbjct  66    KENVAFIESSNSDANKPYKLSVNQFADLTNEEFKASR--NGFLGHE--------CSTKTT  115

Query  431   HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
              F+Y N T  P TVDWR KGAVTPIKDQG CG CWAF+ VAA+EGI KL TGNL+SLSEQ
Sbjct  116   TFKYENVT-APPTVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGNLISLSEQ  174

Query  611   ELVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELVDCD K    GC+GG    AFQFI  N+GL+TE NYPY G     CN  K AS A +I
Sbjct  175   ELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVDG-TCNTKKEASHAAKI  233

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
             +G+E VPA +E AL++AVA+QP+ + I+ G   F+FY  GVF+G C   LDH       G
Sbjct  234   TGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQFYSSGVFTGSCGTSLDH--GVTAVG  291

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                   G KYW++KNSWGT WGE GY+R+QR    K+GLCG+A  ASYPT
Sbjct  292   YGVSADGTKYWLVKNSWGTEWGEKGYIRMQRGVEAKEGLCGIAMEASYPT  341



>ref|XP_010045987.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=364

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 217/320 (68%), Gaps = 13/320 (4%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             +MR RH+QWMA HG+VY D  E +  F+IF+  VE IE+FN   NK YKL +N FADLT+
Sbjct  55    TMRERHEQWMARHGRVYEDAAEKERCFSIFKTTVEYIESFNQDGNKPYKLAINAFADLTS  114

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGN  520
             +EF+          R   K    + A+  K F+Y + T +PS++DWR KGAVTPIKDQG 
Sbjct  115   EEFK--------ASRTGYKRSSSLRAASMKPFQYESVTAIPSSMDWRKKGAVTPIKDQGQ  166

Query  521   CGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR--KSYGCDGGFPISAFQFIVNNN  694
             CG  WAF+ VAA+EGI +L TG L SLSEQELVDCDR  +  GC GG    AFQFI++N+
Sbjct  167   CGCRWAFSAVAAMEGITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQFIISNH  226

Query  695   GLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGG  874
             GLTTE NYPY+   +  CN  K AS A +ISGYE VP+ +E+AL++AVAHQPV + I+ G
Sbjct  227   GLTTEANYPYQAVDN-TCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVAIDAG  285

Query  875   DFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQ  1054
             +  F+FY  G+F+G+C   LDH       G    + G KYW++KNSWGT WGE GY+R+Q
Sbjct  286   ETDFQFYSTGIFTGECGTDLDH--GVTAVGYGTSENGTKYWLVKNSWGTGWGEEGYIRMQ  343

Query  1055  RDYADKKGLCGLAKAASYPT  1114
             RD    +GLCG+A  ASYPT
Sbjct  344   RDIDAAEGLCGIAMEASYPT  363



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/347 (49%), Positives = 225/347 (65%), Gaps = 18/347 (5%)
 Frame = +2

Query  83    SSLLFITTIILGVW-SYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNN  259
             S +      +L  W S  VA T     SM  RH+QWMA +G+VY D  E + R+NIF+ N
Sbjct  7     SQICLALLFVLVAWPSKSVARTLQ-DVSMYERHEQWMAQYGRVYKDNAEKETRYNIFKAN  65

Query  260   VERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFR  439
             V RI+ FN+   K YKLGVN+FADL+N+EF+              + +G M + ++  FR
Sbjct  66    VARIDEFNSQTGKSYKLGVNQFADLSNEEFKA----------SRNRFKGHMCSPQAGPFR  115

Query  440   YANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             Y N + +P ++DWR KGAVTP+KDQG CG CWAF+ VAA+EGI++L TG L+SLSEQE+V
Sbjct  116   YENVSAVPDSMDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSEQEVV  175

Query  620   DCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGY  793
             DCD K    GC+GG    AF+FI  N GLTTE NYPY G     CN  K A+ A +I+G+
Sbjct  176   DCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYTGTDG-TCNTQKEANHAAKITGF  234

Query  794   ERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtta  973
             E VPA +E AL++AVA QPV + I+ G F F+FY  G+F+G C   LDH    V      
Sbjct  235   EDVPANSEAALIKAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTQLDH---GVTAVGYG  291

Query  974   gdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G KYW++KNSWG +WGE GY+R+Q+D + K+GLCG+A  ASYP+
Sbjct  292   ISDGTKYWLVKNSWGAQWGEGGYIRMQKDISAKEGLCGIAMQASYPS  338



>ref|XP_010686289.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Beta 
vulgaris subsp. vulgaris]
Length=344

 Score =   337 bits (863),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 225/348 (65%), Gaps = 10/348 (3%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVAS-TFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             L S+L FI   +L +W  L +S   D + SM + H++WM  HG+VY +  E   RF IF 
Sbjct  3     LLSNLCFILLFVLALWGSLASSRLLDDEPSMIIEHEKWMNIHGRVYTNDVEKTRRFKIFN  62

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              NV+RIE  N   N+G+ LGVN FADLTN+EFR      GY  ++  K  G +  SKSK 
Sbjct  63    ENVKRIELLNK-MNRGFTLGVNAFADLTNEEFRASRT--GY--KKQSKQFGVVLKSKSKT  117

Query  434   FRYANAT-NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
             FRY N T    ST+DWR KGAVTPIKDQG+CG CWAF+ VA++E ++++KTGNLVSLSEQ
Sbjct  118   FRYENVTYASSSTMDWRKKGAVTPIKDQGDCGCCWAFSAVASIESLNQIKTGNLVSLSEQ  177

Query  611   ELVDCDRK-SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRIS  787
             ELVDCD +   GC+GG   +AF FI +N GLTTE  YPYK      CN  +  + AV I 
Sbjct  178   ELVDCDTEFDEGCEGGLMDTAFDFIKHNGGLTTEAKYPYKASDGS-CNAKRATTGAVSIH  236

Query  788   GYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygt  967
             GYE VP  NE AL  AV+HQPV + I GG F F+FY  GVF G+C   LDH    V    
Sbjct  237   GYEDVPENNEEALFMAVSHQPVSVGIEGGGFDFQFYSGGVFKGECGTELDH-AVTVIGFG  295

Query  968   tagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
                  G KYW++KNSWGT+WGE GY+RI+R    K+GLCG+A  ASYP
Sbjct  296   VEEKDGSKYWLVKNSWGTKWGEKGYIRIKRGGGAKEGLCGIAMKASYP  343



>dbj|BAF56428.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   336 bits (862),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/353 (48%), Positives = 230/353 (65%), Gaps = 14/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MASK + +       ++ G  ++   +      S++ RH+QWM  +GKVY D+YE ++R 
Sbjct  1     MASKTVLNISSLALLLVFGFLAFEANARTLEDVSLKERHEQWMTQYGKVYTDSYEKELRS  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
             NIF+ NV+RIE FN   NK YKLG+N+FADLTN+EF+  +   G++           +++
Sbjct  61    NIFKENVQRIEAFNNAGNKPYKLGINQFADLTNEEFKARNRFKGHMCS---------NST  111

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             ++  F+Y + +++P+++DWR KGAVTPIKDQG CG CWAF+ VAA EGI KL TG L+SL
Sbjct  112   RTPTFKYEDVSSVPASLDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGITKLSTGKLISL  171

Query  602   SEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD K    GC+GG    AF+FI+ N GL TE  YPY+G     CN    A  A
Sbjct  172   SEQELVDCDTKGVDQGCEGGLMDDAFKFIMQNKGLNTEAKYPYQGV-DATCNANAEAKDA  230

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
               I G+E VPA +E+AL++AVA+QP+ + I+     F+FY  G+F+G C   LDH     
Sbjct  231   ASIKGFEDVPANSESALLKAVANQPISVAIDASGSEFQFYSSGLFTGSCGTELDH--GVT  288

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G    D G KYW++KNSWG +WGE GY+R+QRD A ++GLCG+A  ASYPT
Sbjct  289   AVGYGVSDDGTKYWLVKNSWGEQWGEEGYIRMQRDVAAEEGLCGIAMQASYPT  341



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score =   336 bits (861),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 177/338 (52%), Positives = 230/338 (68%), Gaps = 13/338 (4%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++LG+++    +    + SMR RH+QWMA HG+VY    E + RF IF+NNVE IE+FN 
Sbjct  1     MVLGLYASQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFMIFKNNVEFIESFNE  60

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPS  466
                + YKLG+N FADLTNDEF+          R   K    +S+S  K FRY N T +PS
Sbjct  61    NNTRPYKLGINGFADLTNDEFKAT--------RNGYKRSSSVSSSGPKSFRYENVTAVPS  112

Query  467   TVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SY  640
             TVDWR KGAVTP+K+QG CG CWAF+ VAA EGIH+L TGNLVSLS Q+LVDCD K  + 
Sbjct  113   TVDWRQKGAVTPVKEQGQCGCCWAFSAVAATEGIHQLTTGNLVSLSVQQLVDCDTKGDNR  172

Query  641   GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNET  820
             GC GGF  +AF+FI++N+GLTTE+NYPY+  +   C+  +  S A +I+GYE VP+ +E+
Sbjct  173   GCAGGFVNAAFKFIIDNDGLTTEDNYPYEAVKG-TCDAGQAESPAAKITGYEDVPSNSES  231

Query  821   ALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWV  1000
             AL QAVA+QPV + I+    HF+FY  GVF+G C+  LDH       G    D G KYW+
Sbjct  232   ALSQAVANQPVSVAIDADGSHFQFYSGGVFTGDCQTDLDH--GVTVVGYGTSDDGTKYWL  289

Query  1001  IKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             +KNSWG  WGENGY+R++RD    +GLCG+A  A+YPT
Sbjct  290   VKNSWGAGWGENGYIRMKRDIDAVEGLCGIAIRAAYPT  327



>ref|XP_007226492.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
 gb|EMJ27691.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
Length=342

 Score =   336 bits (861),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 226/350 (65%), Gaps = 20/350 (6%)
 Frame = +2

Query  71    KILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIF  250
             K +  +L+F+    LG WS    S      SM  +++QWMA +G+VY D  E +MRF IF
Sbjct  10    KCICLALIFM----LGAWSSQATSRNLQDASMYGKYEQWMARYGRVYTDIQEKEMRFKIF  65

Query  251   RNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSK  430
             + NV  IE+ N+  NK YKL VN+FADLTN+EF+      G++G +         ++K+ 
Sbjct  66    KENVAFIESSNSDANKPYKLSVNQFADLTNEEFKASR--NGFLGHE--------CSTKTT  115

Query  431   HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
              F+Y N T  P TVDWR KGAVTPIKDQG CG CWAF+ VAA+EGI KL TGNL+SLSEQ
Sbjct  116   TFKYENVT-APPTVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGNLISLSEQ  174

Query  611   ELVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELVDCD K    GC+GG    AFQFI  N+GL TE NYPY G     CN  K AS A +I
Sbjct  175   ELVDCDTKGVDQGCEGGLMDDAFQFISQNHGLRTETNYPYTGVDG-TCNTKKEASHAAKI  233

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
             +G+E VPA +E AL++AVA+QP+ + I+ G   F+FY  GVF+G C   LDH       G
Sbjct  234   TGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQFYSSGVFTGSCGTSLDH--GVTAVG  291

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                   G KYW++KNSWGT WGE GY+R+QR    K+GLCG+A  ASYPT
Sbjct  292   YGVSADGTKYWLVKNSWGTEWGEKGYIRMQRGVEAKEGLCGIAMEASYPT  341



>ref|XP_010052200.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   336 bits (861),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 175/347 (50%), Positives = 226/347 (65%), Gaps = 14/347 (4%)
 Frame = +2

Query  74    ILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             +L S+ L +  II+ + S ++ S  + Q  ++ +H++WMA HG++Y D  E   R  IF+
Sbjct  9     VLTSTTLLV--IIVSI-SEMLCSPLEEQQLLK-QHEEWMAIHGRIYKDAIEKAKRLEIFK  64

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              NV+RI  FN G + GYKL VNKFADLTN+EFR      GY     ++    +S+   K 
Sbjct  65    ENVKRINAFNNGKDVGYKLAVNKFADLTNEEFRASST--GY-----KRPTRVLSSGDEKP  117

Query  434   FRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             F+YAN T +P+ +DWR K AVT +KDQG+CGSCWAF+ VAA+EGI  +K G L+ LS QE
Sbjct  118   FKYANFTAIPAALDWRTKKAVTTVKDQGDCGSCWAFSAVAAMEGITMIKKGKLMPLSVQE  177

Query  614   LVDCDRKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGY  793
             LVDCD    GC GG    AF+FI +  GL+TE NYPY+   +  CN  K A+ A  I+GY
Sbjct  178   LVDCDVDDNGCHGGLMDRAFKFIKSKGGLSTEANYPYQA-NNGTCNTAKMANPAASITGY  236

Query  794   ERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtta  973
             + VPA NE AL+QAVA+QPV + I G  F+F+FY  GVFSG C   +DH       G   
Sbjct  237   QDVPANNEKALLQAVANQPVSVAIEGSGFNFQFYSSGVFSGSCGTSIDH--AVTAVGYGK  294

Query  974   gdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G KYW++KNSWGT WGE+GYMRIQRD + K GLCGLA  ASYPT
Sbjct  295   TSRGTKYWLLKNSWGTGWGESGYMRIQRDVSSKAGLCGLAMEASYPT  341



>ref|XP_008800071.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   336 bits (861),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 172/320 (54%), Positives = 214/320 (67%), Gaps = 13/320 (4%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             SM+ +H+QWMA +G+VY D  E + RF IF+ NVE IE+FNAG +K +KLG N+FADLTN
Sbjct  33    SMKEKHEQWMALYGRVYKDAAEKERRFKIFQANVELIESFNAGNHK-FKLGANQFADLTN  91

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGN  520
             +EFR +H         +       S   +K F+Y NAT +P ++DWR KGAVTPIKDQG 
Sbjct  92    EEFRAVHTXXXXXXXAS-------SGMATKSFKYENATAVPVSMDWRAKGAVTPIKDQGQ  144

Query  521   CGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNN  694
             CG CWAF+ VAA+EGI KL TG L+SLSEQELVDCD K    GC GG    AF+FI+ N 
Sbjct  145   CGCCWAFSAVAAMEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNG  204

Query  695   GLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGG  874
             GLTTE NYPY+      CN  K+ S A  I GYE VPA +E AL++AVA+QPV + I+ G
Sbjct  205   GLTTEANYPYEAADG-TCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAG  263

Query  875   DFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQ  1054
                F+ Y  GVF+G C   LDH       G      G KYW++KNSWG+ WGENGY+R++
Sbjct  264   GSAFQLYSSGVFTGDCGTELDH--GVTAVGYDKTSDGTKYWLVKNSWGSSWGENGYIRME  321

Query  1055  RDYADKKGLCGLAKAASYPT  1114
             RD   K+GLCG+A  ASYPT
Sbjct  322   RDVDAKEGLCGIAMEASYPT  341



>dbj|BAF46311.1| cysteine proteinase precursor [Ipomoea nil]
Length=339

 Score =   335 bits (860),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 227/353 (64%), Gaps = 17/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MAS  L   LL    ++    +YL  S       M +RH+QWMA +G+VY +  E   R+
Sbjct  1     MASNSL--KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  58

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
             NIF+ NVE IE+FN    K YKLG+N FADLTN EF  +    GY+             S
Sbjct  59    NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEF--IASRNGYILPHE--------CS  108

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
              +  FRY N + +P+TVDWR KGAVTP+KDQG CG CWAF+ VAA+EGI KL TGNL+SL
Sbjct  109   SNTPFRYENVSAVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISL  168

Query  602   SEQELVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD K    GC+GG    AF FI+NN GLTTE NYPY+G     C   K+++ A
Sbjct  169   SEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGS-CKKSKSSNSA  227

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +ISGYE VPA +E+AL +AVA+QPV + I+ G   F+FY  GVF+G+C   LDH     
Sbjct  228   AKISGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDH--GVT  285

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G    + G KYW++KNSWGT WGE GY+R+Q+D   K+GLCG+A  +SYP+
Sbjct  286   AVGYGIAEDGSKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  338



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   335 bits (859),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 172/337 (51%), Positives = 225/337 (67%), Gaps = 13/337 (4%)
 Frame = +2

Query  110   ILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAG  289
             +LG+ +   A+      +M  R++QWM+ HG+VY D+ E + RF IF++NVE IE+FN  
Sbjct  10    LLGLLAIQGAARNLNDEAMVERYEQWMSLHGRVYKDSAEKERRFKIFKDNVEFIESFNRA  69

Query  290   PNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPST  469
              N+ YKLG+N+FADLTN+EF   H   G     + ++  FMS S    F+Y N T +P+T
Sbjct  70    GNRPYKLGINQFADLTNEEFVASH--NGLKMSSSPRL--FMSTS----FKYENVTAVPAT  121

Query  470   VDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKS--YG  643
             VDWR KGAVTPIKDQG CGSCWAF+ +AA EGI KL TG L+SLSEQE+VDCDR S   G
Sbjct  122   VDWRTKGAVTPIKDQGQCGSCWAFSAIAATEGITKLSTGKLISLSEQEIVDCDRTSQDQG  181

Query  644   CDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETA  823
             C GG+   AF+FIV N G+ TE  YPY       C+  K AS A +I+ YE+VPA +E A
Sbjct  182   CSGGYMEDAFEFIVKNKGIATETTYPYTAADG-TCSKTKEASHAAKIASYEKVPANSEAA  240

Query  824   LMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVI  1003
             L++AVA+QPV + I+ G   F+FY  GVF+G C   LDH       G      G KYW++
Sbjct  241   LLKAVANQPVSVSIDAGGMAFQFYSSGVFTGDCGTDLDH--GVTAVGYGKTSNGTKYWLV  298

Query  1004  KNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             KNSWGT WGE+GY++++R  A K+GLCG+A  +SYPT
Sbjct  299   KNSWGTSWGESGYIKMKRGIAAKEGLCGIAMDSSYPT  335



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score =   335 bits (860),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 174/343 (51%), Positives = 223/343 (65%), Gaps = 13/343 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L F+  ++LG+W+    S    + SM  +H+ WMA  G+VY D  E   R  IF+NNV+ 
Sbjct  9     LAFVALLVLGMWASQTTSRDLNEASMVQKHEYWMARFGRVYRDDAEKAKRLKIFKNNVDY  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+ N    + YKLG+N+FADLTN+EFR  H   GY    +QK      +SK+  FRY N
Sbjct  69    IESVNKAGIRPYKLGINEFADLTNEEFRATH--NGYKMSSHQK------SSKTISFRYEN  120

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T  P+T+DWR KGAVT +KDQG CG CWAF+ VAA EGI+K+KTG L+SLSEQELVDCD
Sbjct  121   VT-APATIDWRTKGAVTGVKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCD  179

Query  629   RKS-YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
               S  GC+GG    AF FI+ N+GLTTE NYPY+G     C   K ++   +I+GYE VP
Sbjct  180   TSSDMGCEGGLMDDAFTFIIKNHGLTTESNYPYEGTDG-TCKTRKESNHVAKITGYEDVP  238

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A +E+AL+ AVA+QPV + I+     F+FY  GVF+G+C   LDH       G      G
Sbjct  239   ANSESALLSAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDH--GVTAIGYGKTSDG  296

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGENGY+R+QRD    +G CG+A  ASYPT
Sbjct  297   TKYWLVKNSWGTSWGENGYIRMQRDIDAAEGTCGIAMQASYPT  339



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score =   335 bits (859),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 236/353 (67%), Gaps = 18/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MAS     +LLFI    +G+W+   +S    + SM  R +QW+A  G+VY D  E + R 
Sbjct  1     MASTSRSLALLFI----VGIWACQASSRSVPEVSMSDRFEQWLASCGRVYQDASEKEKRL  56

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NVE IE+ NA  +K YKLGVN+F DLTN+EF+ +    GY  R +       ++S
Sbjct  57    QIFKENVEYIESHNADTSKKYKLGVNEFTDLTNEEFKAMR--NGYKLRPS-------TSS  107

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             K   FRY N   +PS++DWR KGAVT IKDQG CG CWAF+ VAA+EGI++LKTG L+SL
Sbjct  108   KKSSFRYENVAAVPSSMDWRKKGAVTNIKDQGQCGCCWAFSAVAAMEGINQLKTGKLISL  167

Query  602   SEQELVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD   +  GC+GGF  +AF+FI++N GLTTE NYPY+G     CN  K A+ A
Sbjct  168   SEQELVDCDINGEDQGCNGGFMDNAFEFIISNKGLTTESNYPYEGVDGS-CNKKKAANHA  226

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I+ +E VP+ +E AL++AVA+QPV + I+ G   F+ Y+ G+F+G+C   LDH     
Sbjct  227   AQITSFEDVPSNSEAALLKAVANQPVSVAIDAGGSDFQHYKSGIFTGECSTFLDH--GVT  284

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G    D G KYW++KNSWGT WGE+GY+R+QRD   ++GLCG+A  ASYPT
Sbjct  285   AVGYGTADDGTKYWLVKNSWGTSWGEDGYIRMQRDIDAEEGLCGIAMEASYPT  337



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 227/341 (67%), Gaps = 15/341 (4%)
 Frame = +2

Query  98    ITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIET  277
             +  ++LGVW     +       MR +H+QWMA +G+VY D  E + RF IFR+N E I++
Sbjct  8     LALMVLGVWVSGATARGIADEPMRTKHEQWMAQNGRVYTDAAEKERRFQIFRDNYEYIKS  67

Query  278   FNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATN  457
              N   ++ YKLG+N+FADLTN EF+   L            +   +AS +  F+YAN T+
Sbjct  68    VNRAGDRKYKLGLNQFADLTNGEFKASRLA----------FKPMPTASTTGSFQYANLTD  117

Query  458   LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK-  634
             +P+++DWR +GAVTP+K+QG+CG  WAF+ VAA+E I ++KTGNLVSLSEQ+LVDCD   
Sbjct  118   VPNSMDWRTRGAVTPVKNQGSCGCFWAFSSVAAIEAITQIKTGNLVSLSEQQLVDCDVND  177

Query  635   -SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAK  811
              + GCDGG    AFQ++++N G+TTE+NYPY    +  C+  KT+S A  ISGYE VPA 
Sbjct  178   GNQGCDGGLMTRAFQYVIDNGGITTEDNYPYMAA-NGTCDTNKTSSSAATISGYESVPAN  236

Query  812   NETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkk  991
             +E++L+QAVA+QPV + I+G    FR Y  G+F+G C+  + H       G    + G +
Sbjct  237   DESSLLQAVANQPVSVGIDGSGQDFRHYSSGIFTGPCETQMTH--AVTAVGYGIAEDGTE  294

Query  992   yWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             YW++KNSWGT WGE GYMRIQRD    +GLCG+AK ASYPT
Sbjct  295   YWLVKNSWGTTWGETGYMRIQRDVGAPEGLCGMAKLASYPT  335



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/352 (47%), Positives = 228/352 (65%), Gaps = 22/352 (6%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             +      +  I+LGVW     +       M  RH+QWMA +G+VY D  E + RF IF++
Sbjct  3     MAPQCFVLKLIVLGVWVSGATARGIADVPMSTRHEQWMAQYGRVYKDAVEKERRFQIFKD  62

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGF----MSASK  424
             N   IE+ N   N+ YKLG+N+FAD+TN+EF+  HL             GF    ++ S 
Sbjct  63    NSNYIESVNRAGNRKYKLGLNQFADMTNEEFKASHL-------------GFKPMRLTKST  109

Query  425   SKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLS  604
             +  F+YAN T++  ++DWR +GAVTP+KDQG+CG CWAF+ +AA+EGI ++ TGNLVSLS
Sbjct  110   TGSFQYANLTDVSDSMDWRTRGAVTPVKDQGSCGCCWAFSSIAAIEGITQINTGNLVSLS  169

Query  605   EQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAV  778
             EQ+LVDCD K  + GC+GG    AFQ++++N G+TTE NYPY       C+  + +S A 
Sbjct  170   EQQLVDCDVKDGNNGCNGGLMTRAFQYVIDNGGITTENNYPYMAADG-TCDTDRASSSAA  228

Query  779   RISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavg  958
              ISGYE VP  +E++L+QAV++QPV + I+GG   F+ Y  G+F+G CK ++DH      
Sbjct  229   TISGYENVPVNDESSLLQAVSNQPVSVGIDGGGQDFQHYSSGIFTGPCKTNMDH--AVTA  286

Query  959   ygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G    + G KYW+IKNSWGT WGE GYMRIQRD    +GLCG+AK ASYPT
Sbjct  287   IGYGTAEDGTKYWLIKNSWGTTWGEKGYMRIQRDVGAPEGLCGIAKLASYPT  338



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 227/341 (67%), Gaps = 15/341 (4%)
 Frame = +2

Query  98    ITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIET  277
             +  ++LGVW     +       MR +H+QWMA +G+VY D  E + RF IFR+N E I++
Sbjct  34    LALMVLGVWVSGATARGIADEPMRTKHEQWMAQNGRVYTDAAEKERRFQIFRDNYEYIKS  93

Query  278   FNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATN  457
              N   ++ YKLG+N+FADLTN EF+   L            +   +AS +  F+YAN T+
Sbjct  94    VNRAGDRKYKLGLNQFADLTNGEFKASRLA----------FKPMPTASTTGSFQYANLTD  143

Query  458   LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK-  634
             +P+++DWR +GAVTP+K+QG+CG  WAF+ VAA+E I ++KTGNLVSLSEQ+LVDCD   
Sbjct  144   VPNSMDWRTRGAVTPVKNQGSCGCFWAFSSVAAIEAITQIKTGNLVSLSEQQLVDCDVND  203

Query  635   -SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAK  811
              + GCDGG    AFQ++++N G+TTE+NYPY    +  C+  KT+S A  ISGYE VPA 
Sbjct  204   GNQGCDGGLMTRAFQYVIDNGGITTEDNYPYMAA-NGTCDTNKTSSSAATISGYESVPAN  262

Query  812   NETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkk  991
             +E++L+QAVA+QPV + I+G    FR Y  G+F+G C+  + H       G    + G +
Sbjct  263   DESSLLQAVANQPVSVGIDGSGQDFRHYSSGIFTGPCETQMTH--AVTAVGYGIAEDGTE  320

Query  992   yWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             YW++KNSWGT WGE GYMRIQRD    +GLCG+AK ASYPT
Sbjct  321   YWLVKNSWGTTWGETGYMRIQRDVGAPEGLCGMAKLASYPT  361



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/343 (49%), Positives = 221/343 (64%), Gaps = 12/343 (3%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L+F   ++L +W     +      +M  +H+QWMA  G+VY D  E   RF IF+ NVE 
Sbjct  9     LVFAALLVLEMWGSQATARTLPDAAMIEKHEQWMAQFGRVYKDDAEKSKRFRIFKENVEY  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+FN    + Y L +NKFADLTN+EF+          R   K+  +  +S    FRYAN
Sbjct  69    IESFNEAGARPYTLAINKFADLTNEEFQ--------ASRNGYKMGSYPKSSMFSSFRYAN  120

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +P+++DWR KGAVT +KDQG CG CWAF+ VAA EGI++L TG L+SLSEQELVDCD
Sbjct  121   VTAVPASMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCD  180

Query  629   -RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
               +  GC+GG   +AF+FI++N G+TTE NYPY+G     CN  K +S A +I+GYE VP
Sbjct  181   TSEDEGCNGGLMDNAFEFIISNGGITTESNYPYEGVDG-TCNTKKESSSAAKITGYEDVP  239

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A +E AL++AVA+QPV + I+     F+FY  GVF+G C   LDH       G      G
Sbjct  240   ANSEPALLKAVANQPVSVAIDASGSDFQFYSSGVFTGDCGTELDH--GVTAVGYGKTSDG  297

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGENGY+R+QRD    +GLCG+A  ASYPT
Sbjct  298   TKYWLVKNSWGTSWGENGYIRMQRDIDAPEGLCGIAMQASYPT  340



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/353 (48%), Positives = 221/353 (63%), Gaps = 16/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA  I    +       LG  +    +      S+  +H++WM    +VY D  E ++R+
Sbjct  1     MAFTIRHGCISLALIFFLGALASQAIARTLQDASIHEKHEEWMTRFKRVYSDAKEKEIRY  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NV+RIE+FN    K YKLG+N+FADLTN+EF+              + +G M +S
Sbjct  61    KIFKENVQRIESFNKASEKSYKLGINQFADLTNEEFKT----------SRNRFKGHMCSS  110

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             ++  FRY N T +PS++DWR +GAVT IKDQG CGSCWAF+ VAAVEGI +L T  L+SL
Sbjct  111   QAGPFRYENITAVPSSMDWRKEGAVTAIKDQGQCGSCWAFSAVAAVEGITQLATSKLISL  170

Query  602   SEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD K    GC GG    AF+FI  N GLTTE NYPY+G     CN  + A+ A
Sbjct  171   SEQELVDCDTKGEDQGCQGGLMDDAFKFIEQNQGLTTEANYPYEGSDG-TCNTKQEANHA  229

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I+G+E VPA NE ALM+AVA QPV + I+ G F F+FY  G+F+G C   LDH    V
Sbjct  230   AKINGFEDVPANNEGALMKAVAKQPVSVAIDAGGFEFQFYSSGIFTGDCGTELDH---GV  286

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                      G  YW++KNSWGT+WGE GY+R+Q+D   K+GLCG+A  ASYPT
Sbjct  287   AAVGYGESNGMNYWLVKNSWGTQWGEEGYIRMQKDIDAKEGLCGIAMQASYPT  339



>ref|XP_007048674.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92831.1| Senescence-associated gene 12 [Theobroma cacao]
Length=344

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 227/350 (65%), Gaps = 26/350 (7%)
 Frame = +2

Query  74    ILGSSLLFITTIILGVWSYLVASTFDYQHS-MRLRHQQWMAYHGKVYVDTYEADMRFNIF  250
             I G++L+F  T          + T   Q S M  RH+QWMA +G+VY D+ + + RF IF
Sbjct  17    IFGTNLVFQAT----------SRTLPIQDSAMYERHEQWMAQYGRVYKDSNDKEKRFKIF  66

Query  251   RNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSK  430
             + NV RI+ FN    K YKLG+N+FADLTN+EF               + +G M ++ + 
Sbjct  67    KENVARIDAFNTANGKPYKLGINQFADLTNEEFTA----------SRNRFKGHMCSNTAA  116

Query  431   HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
              F+Y N T +PS +DWR KGAVTP+KDQG CG CWAF+ VAA+EGI+ + TG L+SLSEQ
Sbjct  117   SFKYENVTAVPSAMDWRQKGAVTPVKDQGQCGCCWAFSAVAAMEGINMITTGKLISLSEQ  176

Query  611   ELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELVDCD K    GC GG    AF+FI    GLTTE +YPY+G     CN  K A+ A +I
Sbjct  177   ELVDCDTKGEDQGCQGGLMDDAFKFIQKIQGLTTETDYPYRGVDG-TCNTNKEANHAAKI  235

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
             +GYE VPA +ET L++AVA+QPV + I+ G F F+FY  G+F+G C+  LDH       G
Sbjct  236   NGYEDVPANSETVLLKAVANQPVSVAIDAGGFEFQFYSGGIFTGACETQLDH--GVTAVG  293

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                GD G KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A AASYPT
Sbjct  294   YGVGDDGTKYWLVKNSWGTSWGEKGYIRMQRDVDAKEGLCGIAMAASYPT  343



>gb|KHN38752.1| Vignain [Glycine soja]
Length=308

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/318 (53%), Positives = 212/318 (67%), Gaps = 14/318 (4%)
 Frame = +2

Query  164   MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTND  343
             MR RH+QWMA HGKVY  +YE + ++  F+ NV+RIE FN   NK YKLG+N FADLTN+
Sbjct  1     MRERHEQWMAIHGKVYTHSYEKEQKYQTFKENVQRIEAFNNAGNKPYKLGINHFADLTNE  60

Query  344   EFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNC  523
             EF+ ++   G+V  +          +++  FRY N T +P+++DWR KGAVTPIKDQG C
Sbjct  61    EFKAINRFKGHVCSKR---------TRTTTFRYENVTAVPASLDWRQKGAVTPIKDQGQC  111

Query  524   GSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY--GCDGGFPISAFQFIVNNNG  697
             G CWAF+ VAA EGI KL TG L+SLSEQELVDCD K    GC+GG    AF+FI+ N G
Sbjct  112   GCCWAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKG  171

Query  698   LTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGGD  877
             L  E  YPY+G     CN     + A  I GYE VPA +E+AL++AVA+QPV + I    
Sbjct  172   LAAEAIYPYEGVDG-TCNAKAEGNHAASIKGYEDVPANSESALLKAVANQPVSVAIEASG  230

Query  878   FHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQR  1057
             F F+FY  GVF+G C  +LDH       G    D G KYW++KNSWG +WG+ GY+R+QR
Sbjct  231   FEFQFYSGGVFTGSCGTNLDH--GVTAVGYGVSDDGTKYWLVKNSWGVKWGDKGYIRMQR  288

Query  1058  DYADKKGLCGLAKAASYP  1111
             D A K+GLCG+A  ASYP
Sbjct  289   DVAAKEGLCGIAMLASYP  306



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/337 (50%), Positives = 225/337 (67%), Gaps = 11/337 (3%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++L +W+    +      SM  RH+QWM  +G+ Y +  E   RFNIF++NVE I++ N 
Sbjct  1     MVLQIWASQATARTLPDTSMVERHEQWMVQYGRTYKNDAEKANRFNIFKDNVEYIQSVNE  60

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPS  466
                + YKL +NKFADL ++EF+      GY  R   K     S+SK   FRYAN + +P 
Sbjct  61    AETRTYKLAINKFADLKHEEFQASR--NGYKMRSQSK-----SSSKVLSFRYANVSGVPP  113

Query  467   TVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD-RKSYG  643
             ++DW  KGAVTP+KDQG CG CWAF+ VAA EGI++L TGNLVSLSEQELVDCD  +  G
Sbjct  114   SMDWTKKGAVTPVKDQGQCGCCWAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSEDQG  173

Query  644   CDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETA  823
             C+GG   +AF+FI++NNGLTTE NYPY+G     CN  K +S A RI+GYE VP+ +E+A
Sbjct  174   CNGGLMDNAFEFIISNNGLTTESNYPYEGVDG-TCNSKKESSHAARITGYEDVPSNSESA  232

Query  824   LMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVI  1003
             L++AVA+QP+ + I+      +FY  GVF+G+C   LDH       G  A + G KYW++
Sbjct  233   LLKAVANQPISVAIDASGPDIQFYSTGVFTGQCGTELDH--GVTAVGYGATNDGTKYWLV  290

Query  1004  KNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             KNSWGT WGENGY+R+QRD    +GLCG+A  ASYPT
Sbjct  291   KNSWGTSWGENGYIRMQRDIHAAEGLCGIAMQASYPT  327



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score =   333 bits (855),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 174/352 (49%), Positives = 229/352 (65%), Gaps = 11/352 (3%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MAS       +    ++L +W+    +      SM  RH+QWM  +G+ Y +  E   R+
Sbjct  1     MASITPNWRFILAVVLVLQMWASQATARTLPNASMVERHEQWMVQYGRTYKNDAEKAKRY  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
             NIF++NVE I++ N    + YKL +NKFADLTN+EF+      GY  R   K     S+S
Sbjct  61    NIFKDNVEYIQSVNEAETRTYKLAINKFADLTNEEFQASR--NGYKMRSLSK-----SSS  113

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             K   FRYAN + +P ++DW  KGAVTP+KDQG CG CWAF+ VAA EGI++L TGNLVSL
Sbjct  114   KVSSFRYANVSAVPPSIDWTKKGAVTPVKDQGQCGCCWAFSAVAATEGINQLTTGNLVSL  173

Query  602   SEQELVDCD-RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAV  778
             SEQELVDCD  +  GC+GG   +AF+FI++NNGLTTE NYPY+G     CN  K +S A 
Sbjct  174   SEQELVDCDTSEDQGCNGGLMDNAFEFIISNNGLTTESNYPYEGVDG-TCNSKKESSHAA  232

Query  779   RISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavg  958
             RI+GYE VP+ +E+AL++AVA+QP+ + I+     F+FY  GVF+G+C   LDH      
Sbjct  233   RITGYEDVPSNSESALLKAVANQPISVAIDASGSDFQFYSGGVFTGQCGTELDH--GVTA  290

Query  959   ygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G      G KYW++KNSWGT WGENGY+R+QRD    +GLCG+A  ASYPT
Sbjct  291   VGYGVTSDGTKYWLVKNSWGTSWGENGYIRMQRDIDAAEGLCGIAMQASYPT  342



>ref|XP_010912725.1| PREDICTED: zingipain-2-like [Elaeis guineensis]
Length=337

 Score =   333 bits (854),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 166/347 (48%), Positives = 228/347 (66%), Gaps = 22/347 (6%)
 Frame = +2

Query  92    LFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERI  271
               +  I+LGVW +   +       M  RH+QWMA +G+VY D  E + RF IF++N   I
Sbjct  6     FVLALIVLGVWVFGAMARGIADVPMSTRHEQWMAQYGRVYKDAAEKERRFQIFKDNCNYI  65

Query  272   ETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGF----MSASKSKHFR  439
             E+ N   N+ YKLG+N+FAD+TN+EF+  HL             GF    ++ S +  F+
Sbjct  66    ESVNRAGNRKYKLGLNQFADMTNEEFKASHL-------------GFKPMRLTKSTTGSFQ  112

Query  440   YANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             YAN T++  +VDWR +GAVTP+K+QG+CG CWAF+ VAA+EGI ++  GNLVSLSEQ++V
Sbjct  113   YANLTDVSDSVDWRTRGAVTPVKNQGSCGCCWAFSTVAAIEGITQINNGNLVSLSEQQVV  172

Query  620   DCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGY  793
             DCD K  + GC GGF   AFQ++++N G+TTEENYPY       C+  K +S A  ISGY
Sbjct  173   DCDVKDGNRGCHGGFMTRAFQYVIDNGGITTEENYPYMAADG-TCDTNKASSSAATISGY  231

Query  794   ERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtta  973
             + VP  +E++L+QAV+ QPV + I+GG   F+ Y  G+F+G C+ ++DH       G   
Sbjct  232   QNVPVNDESSLLQAVSKQPVSVGIDGGGQDFQHYSSGIFAGPCETNMDH--AVTAIGYGT  289

Query  974   gdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              + G KYW++KNSWGT WGE GYMRIQRD +  +GLCG+AK ASYPT
Sbjct  290   AEDGTKYWLLKNSWGTTWGEKGYMRIQRDVSAPEGLCGIAKLASYPT  336



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score =   334 bits (856),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 232/372 (62%), Gaps = 20/372 (5%)
 Frame = +2

Query  5     NNLHFLIPI*LYSTRTHSNMASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQ  184
             ++ +FL+     ST   +NMA K      +    I+LG W+    S    + SM  RH+Q
Sbjct  7     SSFNFLVQCLCTST---TNMAFK----HFMIAALILLGAWACQATSRTLPEASMFERHEQ  59

Query  185   WMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHL  364
             WM  +G+VY D  E  +RF IF +NV+ IE FN    + YKL VN+FAD TN+EF+    
Sbjct  60    WMIQYGRVYKDEAEKSVRFQIFMDNVKFIEEFNKDGRQSYKLAVNEFADQTNEEFQ----  115

Query  365   VGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFA  544
                   R   K+      S++  FRY N T +PS++DWR KGAVTP+KDQG CGSCWAF+
Sbjct  116   ----ASRNGYKMAVSSRPSQTTLFRYENVTAVPSSMDWRKKGAVTPVKDQGQCGSCWAFS  171

Query  545   VVAAVEGIHKLKTGNLVSLSEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENY  718
              +AA EGI KLKTG L+SLSEQELVDCD+  +  GC+GG+    F+FIV N G+  E +Y
Sbjct  172   TIAATEGITKLKTGKLISLSEQELVDCDKTGEDQGCEGGYMEDGFEFIVKNKGIALEASY  231

Query  719   PYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYE  898
             PY       CN  + AS+A +ISGYE+VPA +ETAL++AVA+QPV + I+     F+FY 
Sbjct  232   PYTAADG-TCNSKEEASRAAKISGYEKVPANSETALLKAVANQPVSVSIDASGVAFQFYS  290

Query  899   KGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKG  1078
              GVF+G+C   LDH       G      G KYW++KNSWG  WG++GY+ +QR  A K G
Sbjct  291   SGVFTGECGTDLDH--GVTAVGYGKTSDGTKYWLVKNSWGASWGDSGYIMMQRGVAAKGG  348

Query  1079  LCGLAKAASYPT  1114
             LCG+A  ASYPT
Sbjct  349   LCGIAMDASYPT  360



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   333 bits (854),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 180/349 (52%), Positives = 224/349 (64%), Gaps = 18/349 (5%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             L + L  I  I+LG WS    S      SM  RH+QWM  +G+VY D  E + RF IF+ 
Sbjct  11    LCTCLALI--IMLGAWSSKATSRSLQDASMYGRHEQWMVRYGRVYTDNEEKEKRFKIFKE  68

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHF  436
             NV  IE+ NA  +K YKL VN+F DLTN+EF         +  +N + +G   ++K+  F
Sbjct  69    NVAYIESSNADASKPYKLRVNQFTDLTNEEF---------IASRN-RFKGHECSTKTTSF  118

Query  437   RYANAT-NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             +Y N T ++P+T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG LVSLSEQE
Sbjct  119   KYENVTASVPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQE  178

Query  614   LVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRIS  787
             LVDCD K    GC+GG    AFQFI  N+GL+TE NYPY G     CN  K A+ A +I+
Sbjct  179   LVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDG-TCNTKKEANIAAKIT  237

Query  788   GYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygt  967
             G+E VPA +E AL+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G 
Sbjct  238   GHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGY  295

Query  968   tagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                D G KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  296   GVSDDGTKYWLVKNSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYPT  344



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score =   333 bits (853),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 177/339 (52%), Positives = 220/339 (65%), Gaps = 16/339 (5%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             I+LG WS    S      SM  RH+QWM  +G+VY D  E + RF IF+ NV  IE+ NA
Sbjct  19    IMLGAWSSEATSRSLQDASMYGRHEQWMTRYGRVYTDNEEKEKRFKIFKENVAYIESSNA  78

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN-ATNLP  463
               +K YKL VN+F DLTN+EF         +  +N + +G   ++K+  F+Y N  T++P
Sbjct  79    DTSKPYKLRVNQFTDLTNEEF---------IASRN-RFKGHECSTKTTSFKYENVTTSVP  128

Query  464   STVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--S  637
             +T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG LVSLSEQELVDCD K   
Sbjct  129   ATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQELVDCDTKGVD  188

Query  638   YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNE  817
              GC+GG    AFQFI  N+GL+TE NYPY G     CN  K A+ A +I+G+E VPA +E
Sbjct  189   QGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDG-TCNTKKEANIAAKITGHEDVPANDE  247

Query  818   TALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyW  997
              AL+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G    D G KYW
Sbjct  248   KALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSDDGTKYW  305

Query  998   VIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             ++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  306   LVKNSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYPT  344



>ref|XP_008223851.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   333 bits (853),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 227/350 (65%), Gaps = 20/350 (6%)
 Frame = +2

Query  71    KILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIF  250
             K +  +L+F+    LG WS    S      SM  +++QWMA + +VY+D  E +MRF IF
Sbjct  10    KCICLALIFM----LGAWSSQATSRNLQDASMYGKYEQWMARYERVYMDIQEKEMRFKIF  65

Query  251   RNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSK  430
             + NV  IE+ N   NK YKL VN+FADLTN+EF+      G++G +         ++K+ 
Sbjct  66    KENVAFIESSNGNTNKPYKLSVNQFADLTNEEFKASR--NGFLGHE--------CSTKTT  115

Query  431   HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
              F+Y N T  P TVDWR KGAVTPIKDQG CG CWAF+ VAA+EGI KL TGNL+SLSEQ
Sbjct  116   TFKYENVT-APPTVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGNLISLSEQ  174

Query  611   ELVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELVDCD K    GC+GG    AFQFI  N+GL+TE NYPY G     CN  K AS A +I
Sbjct  175   ELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVDG-TCNTKKEASHAAKI  233

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
             +G+E VPA +E AL++AVA+QP+ + I+ G   F+FY  GVF+G C   LDH       G
Sbjct  234   TGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQFYSSGVFTGACGTSLDH--GVTAVG  291

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 D G KYW++KNSWGT WGE GY+R+QR    K+GLCG+A  ASYPT
Sbjct  292   YGVSDDGTKYWLVKNSWGTEWGEKGYIRMQRGVEAKEGLCGIAMEASYPT  341



>gb|AAL14199.1| cysteine proteinase precursor [Ipomoea batatas]
 gb|AAK15148.2| cysteine proteinase-like protein [Ipomoea batatas]
Length=341

 Score =   333 bits (853),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 220/332 (66%), Gaps = 15/332 (5%)
 Frame = +2

Query  125   SYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGY  304
             +YL  S       M +RH+QWMA +G+VY +  E   RFNIF+ NVE IE+FN    K Y
Sbjct  22    AYLATSRTLSDSLMVVRHEQWMAQYGRVYENEVEKTKRFNIFKENVEYIESFNKAGTKPY  81

Query  305   KLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRN  484
             KLG+N FADLTN EF+          R   K+      S +  FRY N +++P+TVDWR 
Sbjct  82    KLGINAFADLTNQEFK--------ASRNGYKLP--HDCSSNTPFRYENVSSVPTTVDWRT  131

Query  485   KGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY--GCDGGF  658
             KGAVTP+KDQG CG CWAF+ VAA+EGI KL TGNL+SLSEQELVDCD K    GC+GG 
Sbjct  132   KGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGL  191

Query  659   PISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAV  838
                AF FI+NN GLTTE NYPY+G     C   K+++ A +ISGYE VPA +E+AL +AV
Sbjct  192   MDDAFSFIINNKGLTTESNYPYQGTDGS-CKKSKSSNSAAKISGYEDVPANSESALEKAV  250

Query  839   AHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWG  1018
             A+QPV + I+ G   F+FY  GVF+G+C   LDH       G    + G KYW++KNSWG
Sbjct  251   ANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDH--GVTAVGYGIAEDGSKYWLVKNSWG  308

Query  1019  TRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             T WGE GY+R+Q+D   K+GLCG+A  +SYP+
Sbjct  309   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  340



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score =   333 bits (853),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 229/353 (65%), Gaps = 14/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQH-SMRLRHQQWMAYHGKVYVDTYEADMR  238
             MA      +L F   ++L  ++    S   Y+  SM  +H+QWM++ G+VY D  E   R
Sbjct  1     MARLTFNWNLAFAALLVLVSFASQATSRDLYEAASMVQKHEQWMSHFGRVYKDDVEKAKR  60

Query  239   FNIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSA  418
             F IF++NVE IE  N    + YKLG+N+FADL+N+EFR          R   K+      
Sbjct  61    FKIFQHNVEYIEFVNKAGTRPYKLGINEFADLSNEEFRDT--------RNGYKMTSHQQL  112

Query  419   SKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             SK+  F+YAN T  P+T+DWR KGAVT IKDQG CG CWAF+ VAA EGI+K+KTG L+S
Sbjct  113   SKTTSFKYANVT-APATMDWRTKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLIS  171

Query  599   LSEQELVDCDRKS-YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             LSEQELVDCD  S  GC+GG    AF+FI+ NNGLTTE NYPY+G  +  C   K ++ A
Sbjct  172   LSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNNGLTTESNYPYEGT-NATCKTGKESNHA  230

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I+GYE VPA +E+AL++AVA+QP+ + I+     F+FY  GVF+G+C   LDH     
Sbjct  231   AKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQFYSTGVFTGECGTELDH--GVT  288

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G      G +YW++KNSWGT WGENGY+R+QRD   ++GLCG+A  ASYPT
Sbjct  289   AIGYGKTSDGTQYWLVKNSWGTSWGENGYIRMQRDVDAEEGLCGIAMQASYPT  341



>gb|AAA50755.1| cysteine proteinase [Alnus glutinosa]
Length=340

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 174/345 (50%), Positives = 219/345 (63%), Gaps = 16/345 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQH-SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
                +  + LG  +  +A+    Q  SMR RH++WMA +G+VY D  E   R+ IF  NV 
Sbjct  8     FCLVVMVTLGALASQLAAARSLQDASMRERHEEWMASYGRVYKDINEKQKRYKIFEENVA  67

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
              IE+ N   NK YKL VN+FADLTN+EF+              + +G + ++KS  F+Y 
Sbjct  68    LIESSNKDANKPYKLSVNQFADLTNEEFKA----------SRNRFKGHICSTKSTSFKYG  117

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N + +PS +DWR KGAVTP+KDQG CG CWAF+ VAA EGI KL TG L+SLSEQELVDC
Sbjct  118   NVSAVPSAMDWRMKGAVTPVKDQGQCGCCWAFSAVAATEGITKLTTGELISLSEQELVDC  177

Query  626   DRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D      GC+GG   +AF FI +N+GL +E NYPYKG     CN  K A  A  I+G+E 
Sbjct  178   DTSGVDQGCEGGLMDNAFTFIQHNHGLASEANYPYKGVDG-TCNTNKQAIHAAEINGFED  236

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA +E AL+ AVAHQPV + I+ G   F+FY KGVF G C   LDH       G    D
Sbjct  237   VPANSEEALLNAVAHQPVSVAIDAGGSGFQFYSKGVFIGACGTQLDH--GVTAVGYGTSD  294

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSWGT+WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  295   DGTKYWLVKNSWGTQWGEEGYIRMQRDVDAKEGLCGIAMKASYPT  339



>ref|XP_007132865.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
 gb|ESW04859.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
Length=344

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 218/346 (63%), Gaps = 18/346 (5%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVAS-TFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNV  262
             +LLF     +G W + V   T     SM  RH++WM  +G VY D  E + RF IF+ NV
Sbjct  13    ALLFC----MGFWGFQVTCRTLQDDVSMYERHEEWMTRYGSVYKDPEEREKRFRIFKKNV  68

Query  263   ERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRY  442
               IETFN   NK Y+LG N+FADLTN+EF          GR   K     S  ++  F+Y
Sbjct  69    NYIETFNNAANKPYQLGTNQFADLTNEEF--------IAGRNRFKGHMCSSILRTTTFKY  120

Query  443   ANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVD  622
              N T +PSTVDWR KGAVTP+KDQG CG CWAF+ VAA EGIH L +G L+SLSEQELVD
Sbjct  121   ENVTTIPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVD  180

Query  623   CDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYE  796
             CD K    GC+GGF   AF+FI+ N+G+ TE NYPYKG   + CN    A     I+GYE
Sbjct  181   CDTKGVDQGCEGGFMDGAFKFIIKNHGINTEVNYPYKGVDGK-CNAKAEAVNGATITGYE  239

Query  797   RVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttag  976
              VP  NE+AL +AV+ QPV + I+     F+FY+ GVFSG C   LDH       G    
Sbjct  240   DVPVNNESALEKAVSSQPVSVAIDASGSDFQFYKSGVFSGSCGTELDH--GVTAVGYGVS  297

Query  977   dggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             D GKKYW++KNSWGT WGE GY+R+QRD A  +GLCG+A  ASYPT
Sbjct  298   DDGKKYWLVKNSWGTEWGEEGYIRMQRDVAAAEGLCGIAMMASYPT  343



>gb|AAK27968.1|AF242372_1 cysteine protease [Ipomoea batatas]
Length=339

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 219/332 (66%), Gaps = 15/332 (5%)
 Frame = +2

Query  125   SYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGY  304
             +YL  S       M +RH+QWMA +G+VY    E   RFNIF+ NVE IE+FN    K Y
Sbjct  20    AYLATSRTLSDSLMVVRHEQWMAQYGRVYKTEAEKTKRFNIFKENVEYIESFNKAGTKPY  79

Query  305   KLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRN  484
             KLG+N FADLTN EF+          R   K+      S +  FRY N +++P+TVDWR 
Sbjct  80    KLGINAFADLTNQEFK--------ASRNGYKLP--HDCSSNTPFRYENVSSVPTTVDWRT  129

Query  485   KGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGF  658
             KGAVTP+KDQG CG CWAF+ VAA+EGI KL TGNL+SLSEQELVDCD K    GC+GG 
Sbjct  130   KGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGTDQGCEGGL  189

Query  659   PISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAV  838
                AF FI+NN GLTTE NYPY+G     C   K+++ A +ISGYE VPA +E+AL +AV
Sbjct  190   MDDAFSFIINNKGLTTESNYPYQGTDGS-CKKSKSSNSAAKISGYEDVPANSESALEKAV  248

Query  839   AHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWG  1018
             A+QPV + I+ G   F+FY  GVF+G+C   LDH       G    + G KYW++KNSWG
Sbjct  249   ANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDH--GVTAVGYGIAEDGSKYWLVKNSWG  306

Query  1019  TRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             T WGE GY+R+Q+D   K+GLCG+A  +SYP+
Sbjct  307   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  338



>ref|XP_008800073.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 212/320 (66%), Gaps = 13/320 (4%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             S + +H+QWMA +G+ Y D  E + RF IF+ NVE IE+FNAG +K +KLG N+FADLTN
Sbjct  33    STKEKHEQWMALYGRAYKDAAEKERRFKIFQANVELIESFNAGNHK-FKLGANQFADLTN  91

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGN  520
             +EFR +H         +       S   +K F+Y NAT +P ++DWR KGAVTPIKDQG 
Sbjct  92    EEFRAVHTXXXXXXXAS-------SGMATKSFKYENATAVPVSMDWRAKGAVTPIKDQGQ  144

Query  521   CGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNN  694
             CG CWAF+ VAA+EGI KL TG L+SLSEQELVDCD K    GC GG    AF+FI+ N 
Sbjct  145   CGCCWAFSAVAAMEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNG  204

Query  695   GLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGG  874
             GLTTE NYPY+      CN  K+ S A  I GYE VPA +E AL++AVA+QPV + I+ G
Sbjct  205   GLTTEANYPYEAADG-TCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAG  263

Query  875   DFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQ  1054
                F+ Y  GVF+G C   LDH       G      G KYW++KNSWG+ WGENGY+R++
Sbjct  264   GSAFQLYSSGVFTGDCGTDLDH--GVTAVGYDKTSDGTKYWLVKNSWGSSWGENGYIRME  321

Query  1055  RDYADKKGLCGLAKAASYPT  1114
             RD   K+GLCG+A  ASYPT
Sbjct  322   RDVDAKEGLCGIAMEASYPT  341



>ref|XP_007132887.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
 gb|ESW04881.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
Length=343

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 173/355 (49%), Positives = 218/355 (61%), Gaps = 17/355 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA+K     +       + +W++ V S      SM  RH++WM  +G+VY D  E + R 
Sbjct  1     MATKTQFYHISLTLLFCMAIWTFQVTSRTLQDASMNERHEEWMTRYGRVYKDPPEREKRL  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NV  IE FN   NK YKL VN+FADLTN+EF         +  +N + +G M +S
Sbjct  61    RIFKENVNYIEAFNNAANKPYKLAVNQFADLTNEEF---------IAPRN-RFKGHMCSS  110

Query  422   --KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
               ++  F+Y N T +PSTVDWR KGAVTP+KDQG CG CWAF+ VAA EGIH L  G L+
Sbjct  111   ITRTTSFKYENVTAVPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVAAAEGIHALTAGKLI  170

Query  596   SLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTAS  769
             SLSEQELVDCD K    GC+GG    AF+F++ N GL TE NYPYKG     CN    + 
Sbjct  171   SLSEQELVDCDSKGVDQGCEGGLMDDAFKFVIQNQGLNTEANYPYKGTDE-TCNANAASG  229

Query  770   KAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvt  949
              A  I GYE VPA NE AL +AV +QPV + I+     F+FYE GVF+G C   LDH   
Sbjct  230   HAATIKGYEDVPANNEKALQKAVVNQPVSVAIDASGSDFQFYESGVFTGSCGTELDH--G  287

Query  950   avgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 G    D G +YW++KNSWGT WGE GY+R+QR    ++GLCG+A  ASYPT
Sbjct  288   VTAVGYGVSDDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPT  342



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 223/346 (64%), Gaps = 22/346 (6%)
 Frame = +2

Query  86    SLLFITTIILGVW-SYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNV  262
             +LLFI    +G W S  +A T      M  RH+QWM  +G+VY D  E   R++IF+ NV
Sbjct  33    ALLFI----VGAWPSKSIARTL-LDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENV  87

Query  263   ERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRY  442
              R++ FN+   K YKLGVN+FADLTN+EF+              + +G M + ++  FRY
Sbjct  88    ARVDAFNSQTGKSYKLGVNQFADLTNEEFKA----------SRNRFKGHMCSPQAGPFRY  137

Query  443   ANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVD  622
              N + +PST+DWR +GAVTP KDQG CG CWAF+ VAA+EGI+KL TG L+ LSEQE+VD
Sbjct  138   ENVSAVPSTMDWRKEGAVTPAKDQGQCGCCWAFSAVAAIEGINKLTTGKLIFLSEQEVVD  197

Query  623   CDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYE  796
             CD K    GC+GG    AF+FI  N GLTTE NYPYKG     CN  K  + A +I+G+E
Sbjct  198   CDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDG-TCNTKKATNHAAKITGFE  256

Query  797   RVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttag  976
              VPA +E ALM+AVA QPV + I+ G + F+FY  G+F+G C   LDH    V       
Sbjct  257   YVPANSEAALMKAVAEQPVSVAIDAGGYDFQFYSSGIFTGSCDTQLDH---GVTAVGYGV  313

Query  977   dggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G KYW++KNSWG +WGE GY+R+Q+D   K+GLCG+A  ASYPT
Sbjct  314   SDGSKYWLVKNSWGAQWGEEGYIRMQKDIPAKEGLCGIAMQASYPT  359



>gb|AFV30165.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 226/355 (64%), Gaps = 18/355 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA+K     + F   + LG+W++ V+S      SM+ RH+QWMA +G+VY D  E + RF
Sbjct  1     MATKNQFYQVSFALVLCLGLWAFQVSSRTLQDASMQERHEQWMARYGRVYKDLQEKEKRF  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
             +IF+ NV  IE  N   +K YKLGVN+FADLTN+EF         +  +N K +G MS+S
Sbjct  61    SIFKENVNYIEASNNAGDKPYKLGVNQFADLTNEEF---------IATRN-KFKGHMSSS  110

Query  422   --KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
               ++  F+Y N T  PSTVDWR +GAVTP+K+QG CG CWAF+ VAA EGIHKL TGNLV
Sbjct  111   ITRTTTFKYENVT-APSTVDWRQEGAVTPVKNQGTCGCCWAFSAVAATEGIHKLSTGNLV  169

Query  596   SLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTAS  769
             SLSEQELVDCD      GC GG    AF+FI+ N GL TE  YPY+G     CN  + A+
Sbjct  170   SLSEQELVDCDTSGADQGCQGGLMDDAFKFIIQNGGLNTEAQYPYQGVDG-TCNTNEEAT  228

Query  770   KAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvt  949
                 I+GYE VP+ NE AL QAVA+QP+ + I+     F+ Y+ GVF+G C   LDH   
Sbjct  229   HVATITGYEDVPSNNEQALQQAVANQPISIAIDASGSDFQNYQSGVFTGSCGTQLDH--G  286

Query  950   avgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 G    D G KYW++KNSWG  WGE GY+R+QRD    +GLCGLA   SYPT
Sbjct  287   VAVVGYGVSDDGTKYWLVKNSWGADWGEEGYIRMQRDVDAPEGLCGLAMQPSYPT  341



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/321 (51%), Positives = 208/321 (65%), Gaps = 13/321 (4%)
 Frame = +2

Query  158   HSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLT  337
              +M  RH+QWM+ HG+VY D  E + RF IF+ NVE IE FN    + YKLGVN+FADLT
Sbjct  27    EAMVERHEQWMSLHGRVYTDDAEKERRFQIFKKNVEFIEAFNQAGKRPYKLGVNQFADLT  86

Query  338   NDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQG  517
             N+EF+          R   K    +   +   F+Y N T +P+T+DWR KGAV PIKDQG
Sbjct  87    NEEFK--------ASRNGFKASSSLKLIRGASFKYENVTAVPATMDWRKKGAVAPIKDQG  138

Query  518   NCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKS--YGCDGGFPISAFQFIVNN  691
              CGSCWAF+ +AA EGI KL TG L+SLSEQE+VDCDR S   GC+GG    AF FIV N
Sbjct  139   QCGSCWAFSAIAATEGITKLSTGKLISLSEQEIVDCDRTSQDQGCNGGEMEDAFAFIVKN  198

Query  692   NGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEING  871
              G+ +E  YPY       C+  K AS A +I+GYE+VPA NE AL++AVA+QPV + I+ 
Sbjct  199   KGIASEATYPYTAADG-TCSKTKEASHAAKIAGYEKVPANNEAALLKAVANQPVSVSIDA  257

Query  872   GDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRI  1051
                 F+FY  GVF+G C   LDH       G      G KYW++KNSWGT WGE+GY+R+
Sbjct  258   SGMAFQFYTSGVFTGDCGTDLDH--GVTAVGYGKASNGTKYWLVKNSWGTSWGESGYIRM  315

Query  1052  QRDYADKKGLCGLAKAASYPT  1114
             QR  + K+GLCG+A  +SYPT
Sbjct  316   QRGISAKEGLCGIAMDSSYPT  336



>ref|XP_003538185.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   331 bits (849),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/318 (53%), Positives = 212/318 (67%), Gaps = 14/318 (4%)
 Frame = +2

Query  164   MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTND  343
             MR RH+QWMA HGKVY  +YE + ++  F+ NV+RIE FN   NK YKLG+N FADLTN+
Sbjct  36    MRERHEQWMAIHGKVYTHSYEKEQKYQTFKENVQRIEAFNHAGNKPYKLGINHFADLTNE  95

Query  344   EFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNC  523
             EF+ ++   G+V  +          +++  FRY N T +P+T+DWR +GAVTPIKDQG C
Sbjct  96    EFKAINRFKGHVCSK---------ITRTPTFRYENMTAVPATLDWRQEGAVTPIKDQGQC  146

Query  524   GSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY--GCDGGFPISAFQFIVNNNG  697
             G CWAF+ VAA EGI KL TG L+SLSEQELVDCD K    GC+GG    AF+FI+ N G
Sbjct  147   GCCWAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKG  206

Query  698   LTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGGD  877
             L  E  YPY+G     CN     + A  I GYE VPA +E+AL++AVA+QPV + I    
Sbjct  207   LAAEAIYPYEGVDG-TCNAKAEGNHATSIKGYEDVPANSESALLKAVANQPVSVAIEASG  265

Query  878   FHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQR  1057
             F F+FY  GVF+G C  +LDH       G    D G KYW++KNSWG +WG+ GY+R+QR
Sbjct  266   FEFQFYSGGVFTGSCGTNLDH--GVTAVGYGVSDDGTKYWLVKNSWGVKWGDKGYIRMQR  323

Query  1058  DYADKKGLCGLAKAASYP  1111
             D A K+GLCG+A  ASYP
Sbjct  324   DVAAKEGLCGIAMLASYP  341



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score =   331 bits (849),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/350 (48%), Positives = 225/350 (64%), Gaps = 16/350 (5%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLV--ASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIF  250
             L  + +F++ ++LG+W+ L    +  +  +SM  RH+QWMA +G+ Y D  E + RF IF
Sbjct  5     LQKTSIFVSLLVLGMWAALANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIF  64

Query  251   RNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSK  430
             ++NVE IE+ N   NK YKLG+N+FAD TN+EFR           +N      +    + 
Sbjct  65    KSNVEYIESVNKAGNKPYKLGINEFADQTNEEFR---------ASRNGYKRSPIPRPINP  115

Query  431   HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
              FRY + T +PS+VDWR KGAVTP+KDQG CG CWAF+ VAA+EGI +L TG L+SLSEQ
Sbjct  116   SFRYESVTKVPSSVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQ  175

Query  611   ELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELVDCD      GC+GG    AF FI+ N GLTTE  YPYKG     CN  K +S A  I
Sbjct  176   ELVDCDTSGTDQGCEGGLMDDAFDFILGNEGLTTESKYPYKGVDE-TCNKKKASSHAASI  234

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
             +G+E VPA +E AL +AVA+QPV + I+ G   F+ Y  GVF+G+C   LDH       G
Sbjct  235   TGHEDVPANSEKALQKAVANQPVSVAIDAGGSDFQLYSSGVFTGECGTELDH--GVTAVG  292

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 + G KYW++KNSWG+ WGE GY+R++RD   ++GLCG+A  ASYP+
Sbjct  293   YGKTEDGTKYWLVKNSWGSSWGEEGYIRMERDVDAEEGLCGIAMEASYPS  342



>ref|XP_010099379.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB78104.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=348

 Score =   331 bits (849),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 176/344 (51%), Positives = 224/344 (65%), Gaps = 20/344 (6%)
 Frame = +2

Query  107   IILGVWS-YLVAST---FDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIE  274
             I LG W+ Y V +T        ++++RH++WM+ HG VY D  E   RF IF+ NV RIE
Sbjct  16    ISLGTWAKYNVEATSRSLQDASTLKIRHEEWMSRHGIVYKDADEKAKRFEIFKENVARIE  75

Query  275   TFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASK--SKHFRYAN  448
              FN    K YKLG+NKFADLTN+EF         + ++N+       + +  S  F+Y N
Sbjct  76    AFNRAAIKPYKLGINKFADLTNEEF---------ITKRNKFKAHVCDSGRAISTSFKYEN  126

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T++PS +DWR KGAVTP+KDQG CG CWAF+ VAA+EGI KL TG L+SLSEQELVDCD
Sbjct  127   VTSVPSALDWRKKGAVTPVKDQGQCGCCWAFSTVAAMEGITKLSTGKLLSLSEQELVDCD  186

Query  629   RK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
              K    GC+GG    AF+FI +N GLTTE NYPY+G     CN  K A+ A +I+GYE V
Sbjct  187   VKGEDQGCNGGLMDEAFKFIQHNGGLTTEANYPYEGVDG-TCNAKKEATHAAKITGYEDV  245

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E  L++AV HQPV + I+   F F+FY  GVF+G C  +LDH       G  A   
Sbjct  246   PANSEKDLLKAVTHQPVSVAIDASGFEFQFYSGGVFTGACGTNLDH--GVTAVGYGATKD  303

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWG +WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  304   GTKYWLVKNSWGKQWGEKGYIRMQRDVDAKEGLCGIAMMASYPT  347



>ref|XP_008659445.1| PREDICTED: ervatamin-B-like [Zea mays]
 gb|AFW86316.1| hypothetical protein ZEAMMB73_635707 [Zea mays]
Length=340

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 173/350 (49%), Positives = 220/350 (63%), Gaps = 18/350 (5%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             L +S+L I        + L A       +M  RH+QWMA + +VY D  E   RF +F+ 
Sbjct  4     LKASILAILGFAFFCGAALAARDLSDDSAMVARHEQWMAQYSRVYKDASEKARRFEVFKA  63

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHF  436
             NV+ IE+FNAG N  + LGVN+FADLTNDEFR +    G+    N K+           F
Sbjct  64    NVKFIESFNAGGNNKFWLGVNQFADLTNDEFRSIKTNKGFK-SSNMKI--------PTGF  114

Query  437   RYANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
             RY N +   LP+T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI K+ TG LVSL+EQ
Sbjct  115   RYENVSVDALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLVSLAEQ  174

Query  611   ELVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELVDCD   +  GC+GG    AF+FI+NN GLTTE +YPY     +       ++ A  I
Sbjct  175   ELVDCDVHGEDQGCEGGLMDDAFKFIINNGGLTTESSYPYTAADGKC---KSGSNSAATI  231

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
              GYE VPA +E ALM+AVA+QPV + ++GGD  F+FY  GV +G C   LDH       G
Sbjct  232   KGYEDVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSSGVMTGSCGTDLDH--GIAAIG  289

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                   G KYW++KNSWGT WGENGY+R+++D +DK+G+CGLA   SYPT
Sbjct  290   YGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 220/343 (64%), Gaps = 12/343 (3%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L+    ++L +WS    +      +    H+QWMA  G+VY D  E   RF IF+ NVE 
Sbjct  9     LVIAALLVLEMWSSQGTARTLPDAATVQEHEQWMAQFGRVYKDEAEKSKRFRIFKENVEY  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             I +FN    + Y+L +NKFADLTN+EF           R   K+  +M ++K   FRYAN
Sbjct  69    IRSFNEAAARPYRLAINKFADLTNEEF--------VASRNGYKMGSYMKSTKVSSFRYAN  120

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              + +P+++DWR KGAVT +KDQG CG CWAF+ VAA EGI++L TG L+SLSEQELVDCD
Sbjct  121   VSAVPASMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCD  180

Query  629   -RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
               +  GC+GG    AF+FI++N G+TTE NYPY+G     CN  K +S A +I+GYE VP
Sbjct  181   TSEDEGCNGGLMDDAFEFIISNGGITTESNYPYEGVDG-TCNSKKESSHAAKITGYEDVP  239

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A +E AL++AVA+QPV + I+     F+FY  GVF+G+C   LDH       G      G
Sbjct  240   ANSEPALLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDH--GVTAVGYGKTSDG  297

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWG+ WGENGY+R+QRD    +GLCG+A  ASYPT
Sbjct  298   TKYWLVKNSWGSSWGENGYIRMQRDIDAAEGLCGIAMQASYPT  340



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 179/350 (51%), Positives = 226/350 (65%), Gaps = 20/350 (6%)
 Frame = +2

Query  71    KILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIF  250
             K +  +L+F+    LG WS    S      SM  +++QWM  +G+V+    E +MRF IF
Sbjct  10    KCICLALIFM----LGAWSSQATSRNLQDASMYGKYEQWMTRYGRVFTGVQEKEMRFKIF  65

Query  251   RNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSK  430
             + NV  IE+ N+  NK YKL VN+FADLTN+EF+      G++G +         ++K+ 
Sbjct  66    KENVAFIESSNSDANKPYKLSVNQFADLTNEEFKASR--NGFLGHE--------CSTKTT  115

Query  431   HFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
              F+Y N T  P TVDWR KGAVTPIKDQG CG CWAF+ VAA+EGI KL TGNL+SLSEQ
Sbjct  116   TFKYENVT-APPTVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQ  174

Query  611   ELVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELVDCD K    GC+GG    AFQFI  N+GL+TE NYPY G     CN  K AS A +I
Sbjct  175   ELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVDG-TCNTKKEASHAAKI  233

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
             +G+E VPA +E AL++AVA+QPV + I+ G   F+FY  GVF+G C   LDH       G
Sbjct  234   TGHEDVPANSEAALLKAVANQPVSVAIDAGGSDFQFYSSGVFTGACGTSLDH--GVTAVG  291

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 D G KYW++KNSWGT WGE GY+R+QR    K+GLCG+A  ASYPT
Sbjct  292   YGVSDDGTKYWLVKNSWGTEWGEKGYIRMQRGVEAKEGLCGIAMEASYPT  341



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   331 bits (848),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 222/353 (63%), Gaps = 18/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MAS I  S L+F   ++L V +         + SM  +H+QWMA +G+VY +  E   R+
Sbjct  1     MAS-IATSKLIFTAFLMLTVLASQAVCRNLNEASMIEKHEQWMAQNGRVYKNEAEKGNRY  59

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NVE IE+FN    K YKLG+N+FADLTN EFR      GY  ++           
Sbjct  60    KIFKENVEFIESFNKAGTKSYKLGINQFADLTNVEFRAAR--NGYKPKE----------C  107

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             K   FRY N + +P+ +DWR KGAVT IKDQG CG CWAF+ VAA EGIH+LKTG L+SL
Sbjct  108   KGTLFRYENVSAVPAAMDWRKKGAVTGIKDQGQCGCCWAFSAVAATEGIHQLKTGKLISL  167

Query  602   SEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD   +  GC+GG    AF FI+NN GLTTE NYPY+      CN  K A  A
Sbjct  168   SEQELVDCDTAGEDQGCNGGLMDDAFTFIINNKGLTTEANYPYQAVDG-TCNTNKEAKPA  226

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I+G+E VPA NE AL++AVA+QPV + I+     F+FY  GVF+G C   LDH     
Sbjct  227   AKITGFEDVPANNEAALLKAVANQPVSVAIDASGSAFQFYSSGVFTGDCGTELDH--GVT  284

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G      G KYW++KNSWGT WGENGY+ +QRD   K+GLCG+A  +SYPT
Sbjct  285   AVGYGKSSDGTKYWLVKNSWGTSWGENGYILMQRDIDAKEGLCGIAMQSSYPT  337



>ref|XP_007132861.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
 gb|ESW04855.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
Length=343

 Score =   331 bits (848),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 172/355 (48%), Positives = 218/355 (61%), Gaps = 17/355 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA+K     +       + +W++ V S      SM  RH++WM  +G+VY D  E + R 
Sbjct  1     MATKTQFYHISLTLLFCMAIWAFQVTSRTLQDASMNERHEEWMTRYGRVYKDPQEREKRL  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NV  IE FN   NK YKL +N+FADLTN+EF         +  +N + +G M +S
Sbjct  61    RIFKENVNYIEAFNNAANKPYKLAINQFADLTNEEF---------IAPRN-RFKGHMCSS  110

Query  422   --KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
               ++  F+Y N T +PSTVDWR KGAVTP+KDQG CG CWAF+ VAA EGIH L  G L+
Sbjct  111   ITRTTSFKYENVTAVPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGIHALTAGKLI  170

Query  596   SLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTAS  769
             SLSEQELVDCD K    GC+GG    AF+F++ N GL TE  YPYKG     CN    + 
Sbjct  171   SLSEQELVDCDSKGVDQGCEGGLMDDAFKFVIQNQGLNTEAKYPYKGTDE-TCNANAASG  229

Query  770   KAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvt  949
              AV I GYE VPA NE AL +AV +QPV + I+     F+FYE GVF+G C   LDH   
Sbjct  230   HAVTIKGYEDVPANNEKALQKAVVNQPVSVAIDASGSDFQFYESGVFTGSCGTELDH--G  287

Query  950   avgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 G    D G +YW++KNSWGT WGE GY+R+QR    ++GLCG+A  ASYPT
Sbjct  288   VTAVGYGVSDDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPT  342



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score =   330 bits (847),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 223/351 (64%), Gaps = 20/351 (6%)
 Frame = +2

Query  71    KILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIF  250
             K +G  LLF+    LG WS    S      SM  R++QWM  +G+VY D  E + RF IF
Sbjct  5     KCIGFGLLFM----LGAWSCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIF  60

Query  251   RNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSK  430
             + NV  IE+ N   NK YKLGVN+FADLTN+EF+      G+ G +         ++K+ 
Sbjct  61    KENVAFIESSNNDVNKPYKLGVNQFADLTNEEFKASR--NGFKGHE--------CSTKTT  110

Query  431   HFRYANA-TNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSE  607
              F+Y N    +P+T+DWR KGAVTP+KDQG CG CWAF+ VAA EGI +L TG L+SLSE
Sbjct  111   SFKYENVKAPVPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSE  170

Query  608   QELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVR  781
             QELVDCD   +  GC+GG    AFQFI  N+GL+ E NYPY G     CN  K AS A +
Sbjct  171   QELVDCDTSGEDQGCEGGLMDDAFQFIQQNHGLSAEANYPYNGVDGS-CNTKKAASIAAK  229

Query  782   ISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgy  961
             I+GYE VPA +E AL+ AVAHQPV + I+ G   F+FY  GVF+G C   LDH       
Sbjct  230   ITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDH--GVTAV  287

Query  962   gttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G    D G KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  288   GYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRDVEAKEGLCGIAMEASYPT  338



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   331 bits (848),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 225/341 (66%), Gaps = 13/341 (4%)
 Frame = +2

Query  95    FITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIE  274
             F+  ++LG+W+    S    + SM  +H++WMA+ G+VY D  E   RFNIF++N + IE
Sbjct  11    FLALLVLGMWANEATSRDLNEASMVQKHEKWMAHFGRVYRDDTEKAKRFNIFKDNFDYIE  70

Query  275   TFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANAT  454
             + N    + YKL +N FADLTN+EFR  H   GY      K+     +SK+  FRY N T
Sbjct  71    SINKAGMRPYKLRINGFADLTNEEFRATH--NGY------KMSSPHMSSKTTFFRYENVT  122

Query  455   NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK  634
               P+T+DWR KGAVT +KDQG CG CWAF+ VAA EGI+++KTG L+SLSEQELVDCD  
Sbjct  123   -APATMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINEIKTGKLISLSEQELVDCDTS  181

Query  635   S-YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAK  811
             S  GC+GG    AF+FI+ N+GLTTE NYPY+G     C   K ++ A +I+GYE VPA 
Sbjct  182   SDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDG-TCKTGKESNDAAKITGYEDVPAN  240

Query  812   NETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkk  991
             +E+AL+ AVA+QPV + I+     F+FY  GVF+G+C   LDH       G      G K
Sbjct  241   SESALLNAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDH--GVTAVGYGITSDGTK  298

Query  992   yWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             YW+IKNSWGT WGENGY+R+QR    ++GLCG+A  ASYPT
Sbjct  299   YWLIKNSWGTSWGENGYIRMQRGVVPEEGLCGIAMQASYPT  339



>gb|KCW76128.1| hypothetical protein EUGRSUZ_D00504 [Eucalyptus grandis]
Length=318

 Score =   330 bits (845),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 169/328 (52%), Positives = 215/328 (66%), Gaps = 11/328 (3%)
 Frame = +2

Query  131   LVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKL  310
             ++ S  + Q  ++ +H++WMA HG++Y D  E   R  IF+ NV+RI  FN G + GYKL
Sbjct  1     MLCSPLEEQQLLK-QHEEWMAIHGRIYKDAIEKAKRLEIFKENVKRINAFNNGKDVGYKL  59

Query  311   GVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKG  490
              VNKFADLTN+EFR      GY     ++    +S+   K F+YAN T +P+ +DWR K 
Sbjct  60    AVNKFADLTNEEFRASST--GY-----KRPTRVLSSGDEKPFKYANFTAIPAALDWRTKK  112

Query  491   AVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSYGCDGGFPISA  670
             AVT +KDQG+CGSCWAF+ VAA+EGI  +K G L+ LS QELVDCD    GC GG    A
Sbjct  113   AVTTVKDQGDCGSCWAFSAVAAMEGITMIKKGKLMPLSVQELVDCDVDDNGCHGGLMDRA  172

Query  671   FQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQP  850
             F+FI +  GL+TE NYPY+   +  CN  K A+ A  I+GY+ VPA NE AL+QAVA+QP
Sbjct  173   FKFIKSKGGLSTEANYPYQA-NNGTCNTAKMANPAASITGYQDVPANNEKALLQAVANQP  231

Query  851   VLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWG  1030
             V + I G  F+F+FY  GVFSG C   +DH       G      G KYW++KNSWGT WG
Sbjct  232   VSVAIEGSGFNFQFYSSGVFSGSCGTSIDH--AVTAVGYGKTSRGTKYWLLKNSWGTGWG  289

Query  1031  ENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             E+GYMRIQRD + K GLCGLA  ASYPT
Sbjct  290   ESGYMRIQRDVSSKAGLCGLAMEASYPT  317



>ref|XP_002280263.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=339

 Score =   330 bits (847),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 221/345 (64%), Gaps = 21/345 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLFI    L  W+    S   ++ SM  RH+ WMA +G++Y D  E + RF IF++NV 
Sbjct  13    ALLFI----LAAWASQATSRSLHEASMYERHEDWMARYGRMYKDANEKEKRFKIFKDNVA  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RIE+FN   +K YKL +N+FADLTN+EFR L        R   K       S++  F+Y 
Sbjct  69    RIESFNKAMDKTYKLSINEFADLTNEEFRSL--------RNRFKAH---ICSEATTFKYE  117

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T +PST+DWR KGAVTPIKDQ  CG CWAF+ VAA EGI ++ TG L+SLSEQELVDC
Sbjct  118   NVTAVPSTIDWRKKGAVTPIKDQQQCGCCWAFSAVAATEGITQITTGKLISLSEQELVDC  177

Query  626   DR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D   ++ GC GG    AF+FI   +GL +E  YPY+G     CN  K A  A +I GYE 
Sbjct  178   DTGGENQGCSGGLMDDAFRFI-KIHGLASEATYPYEGDDG-TCNSKKEAHPAAKIKGYED  235

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA NE AL +AVAHQPV + I+ G F F+FY  GVF+G+C   LDH       G   GD
Sbjct  236   VPANNEKALQKAVAHQPVAVAIDAGGFEFQFYTSGVFTGQCGTELDH--GVAAVGYGIGD  293

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G  YW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  294   DGMMYWLVKNSWGTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPT  338



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   330 bits (847),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 179/349 (51%), Positives = 223/349 (64%), Gaps = 18/349 (5%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             L + L  I  I+LG WS    S      SM  RH+QWM  +G+VY D  E + RF IF+ 
Sbjct  11    LCTCLALI--IMLGAWSSKATSRSLQDASMYGRHEQWMVRYGRVYTDNEEKEKRFKIFKE  68

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHF  436
             NV  IE+ NA  +K YKL VN+F DLTN+EF         +  +N + +G   ++K+  F
Sbjct  69    NVAYIESSNADSSKPYKLRVNQFTDLTNEEF---------IASRN-RFKGHECSTKTTSF  118

Query  437   RYANAT-NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             +Y N T ++P+T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG LVSLSEQE
Sbjct  119   KYENVTASVPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQE  178

Query  614   LVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRIS  787
             LVDCD K    GC+GG    AFQFI  N+GL+TE NYPY G     CN  K A+ A +I+
Sbjct  179   LVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDG-TCNTKKEANIAAKIT  237

Query  788   GYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygt  967
              +E VPA +E AL+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G 
Sbjct  238   DHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGY  295

Query  968   tagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                D G KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  296   GVSDDGTKYWLVKNSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYPT  344



>ref|XP_010052201.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76129.1| hypothetical protein EUGRSUZ_D00505 [Eucalyptus grandis]
Length=345

 Score =   330 bits (847),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 224/346 (65%), Gaps = 14/346 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDY---QHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNN  259
             L F+T+  L V    V+ T      +  +  +H++WMA HG+VY DT E   R+ IF+ N
Sbjct  7     LSFLTSATLLVIIVSVSETLCRPLGEERLLKQHEEWMAIHGRVYKDTAEKTKRYEIFKEN  66

Query  260   VERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFR  439
             V+RI  FN   +  YKL VNKF DLTN+EFR  +   GY  R+  +V   + A   K F+
Sbjct  67    VKRINAFNNDKDMAYKLAVNKFTDLTNEEFRAFYT--GY-KRRPTRVPFSVDA---KPFK  120

Query  440   YANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             YAN T +P+ +DWR K AVT +KDQG CGSCWAF+V AA+EGI  LK G L+SLS QELV
Sbjct  121   YANFTAVPTALDWRTKKAVTSVKDQGQCGSCWAFSVAAAIEGITMLKKGKLLSLSVQELV  180

Query  620   DCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGY  793
             DCD   K+ GC GG+  SAF+FI++  GLTTE NYPY+G + R CN  KT   A  I+GY
Sbjct  181   DCDVNGKNSGCKGGYMDSAFEFIISKGGLTTEANYPYRGNE-RTCNTAKTGYHAASITGY  239

Query  794   ERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtta  973
             E VPA NE AL+QAVA+QPV + +  G + F+FY  GVF+G C   +DH       G   
Sbjct  240   EDVPANNEKALLQAVANQPVSVAVEAGGYDFQFYSSGVFTGSCGTSVDH--AVTVVGYGK  297

Query  974   gdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
               GG  YW++KNSWGT WGE+GYMRI+RD   + GLCGLA  ASYP
Sbjct  298   TSGGTMYWLLKNSWGTGWGESGYMRIERDVRSRTGLCGLAMNASYP  343



>dbj|BAF56427.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   330 bits (846),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 223/355 (63%), Gaps = 18/355 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA+K     + F   + LG+W++ V+S      SM  RH+QWMA +GKVY D  E + RF
Sbjct  1     MATKNQFYQISFALVLCLGLWAFQVSSRTLQDASMHERHEQWMARYGKVYKDLQEKEKRF  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
             NIF+ NV+ IE  N   NK YKLGVN+F DLTN EF         +  +N K +G MS+S
Sbjct  61    NIFQENVKYIEASNNAGNKPYKLGVNQFTDLTNKEF---------IATRN-KFKGHMSSS  110

Query  422   --KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
               ++  F+Y N T  PSTVDWR +GAVTP+K+QG CG CWAF+ VAA EGIHKL TGNLV
Sbjct  111   ITRTTTFKYENVT-APSTVDWRQEGAVTPVKNQGTCGCCWAFSAVAATEGIHKLSTGNLV  169

Query  596   SLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTAS  769
             SLSEQELVDCD      GC GG    AF+FI+ N GL TE  YPY+G     CN  +  +
Sbjct  170   SLSEQELVDCDTSGADQGCQGGLMDDAFKFIIQNGGLNTEAQYPYQGVDG-TCNTNEEVT  228

Query  770   KAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvt  949
                 I+GYE VP+ NE AL QAVA+QP+ + I+     F+ Y+ GVF+G C   LDH   
Sbjct  229   HVATITGYEDVPSNNEQALQQAVANQPISVAIDASGSDFQNYQSGVFTGSCGTQLDH--G  286

Query  950   avgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 G    D G KYW++KNSWG  WGE GY+R+QRD    +GLCG+A   SYPT
Sbjct  287   VAVVGYGVSDDGTKYWLVKNSWGEDWGEEGYIRMQRDVEAPEGLCGIAMQPSYPT  341



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   330 bits (846),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 220/344 (64%), Gaps = 18/344 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L FI   ILG  S    S      SM  +++QWMA +G+ Y D  E + RFNIF+ NV  
Sbjct  14    LAFI--FILGALSSQATSRTLQDASMYAKYEQWMASYGRAYADINEKEKRFNIFKENVAF  71

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+ N   NK YKL VN+FADLTN+EF+      G++G +         ++K+  F+Y N
Sbjct  72    IESSNNDANKLYKLSVNQFADLTNEEFKASR--NGFMGHE--------CSTKTTAFKYEN  121

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T  P TVDWRNKGAVTPIKDQG CG CWAF+ VAA+EGI KL TG L+SLSEQELVDCD
Sbjct  122   VT-APPTVDWRNKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCD  180

Query  629   RKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
                   GC GG    AFQFI  N+GL+TE NYPY G     CN  K AS A +I+GYE V
Sbjct  181   TSGVDQGCGGGLMDDAFQFINKNHGLSTETNYPYTGVDG-TCNTKKEASHAAKITGYEDV  239

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E AL++AVA+QP+ + I+ G   F+FY  GVF+G C   LDH       G      
Sbjct  240   PANSEEALLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGISAD  297

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT+WGE GY+R+QR    K+GLCG+A  ASYPT
Sbjct  298   GTKYWLVKNSWGTQWGEEGYIRMQRGVEAKEGLCGIAMEASYPT  341



>gb|KHN13721.1| Vignain [Glycine soja]
Length=326

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/322 (53%), Positives = 214/322 (66%), Gaps = 17/322 (5%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             SM  RH+QWM  +GKVY D  E + RF IF+ NV  IE FN   NK YKL +N+FADLTN
Sbjct  17    SMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADLTN  76

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFRYANATNLPSTVDWRNKGAVTPIKDQ  514
             +EF         +  +N + +G M +S  ++  F+Y N T +PSTVDWR KGAVTPIKDQ
Sbjct  77    EEF---------IAPRN-RFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQ  126

Query  515   GNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVN  688
             G CG CWAF+ VAA EGIH L +G L+SLSEQELVDCD K    GC+GG    AF+F++ 
Sbjct  127   GQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQ  186

Query  689   NNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEIN  868
             N+GL TE NYPYKG   + CN  + A+ A  I+GYE VPA NE AL +AVA+QPV + I+
Sbjct  187   NHGLNTEANYPYKGVDGK-CNVNEAANDAATITGYEDVPANNEKALQKAVANQPVSVAID  245

Query  869   GGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMR  1048
                  F+FY+ GVF+G C   LDH       G    + G +YW++KNSWGT WGE GY+R
Sbjct  246   ASGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIR  303

Query  1049  IQRDYADKKGLCGLAKAASYPT  1114
             +QR    ++GLCG+A  ASYPT
Sbjct  304   MQRGVDSEEGLCGIAMQASYPT  325



>ref|XP_007132895.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
 gb|ESW04889.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
Length=343

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/355 (48%), Positives = 217/355 (61%), Gaps = 17/355 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA+K     +       + +W++ V S      SM  RH +WM  +G+VY D  E + R 
Sbjct  1     MATKTQFYHISLTLLFCMAIWAFQVTSRTLQDTSMNERHAEWMTRYGRVYKDPQEREKRL  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NV  IE FN   NK YKL VN+FADLTN+EF         +  +N + +G M +S
Sbjct  61    RIFKENVNYIEAFNNAANKPYKLAVNQFADLTNEEF---------IAPRN-RFKGHMCSS  110

Query  422   --KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
               ++  F+Y N T +PS VDWR KGAVTP+KDQG CG CWAF+ VAA EGIH L  G L+
Sbjct  111   ITRTTSFKYENVTAVPSKVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGIHALTAGKLI  170

Query  596   SLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTAS  769
             SLSEQELVDCD K    GC+GG    AF+F++ N GL+TE NYPYKG     CN    + 
Sbjct  171   SLSEQELVDCDSKGVDQGCEGGLMDDAFKFVIQNQGLSTEANYPYKGTDE-TCNANAASG  229

Query  770   KAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvt  949
              A  I GYE VPA NE AL +AV +QPV + I+     F+FYE GVF+G C   LDH   
Sbjct  230   HAATIKGYEDVPANNEKALQKAVVNQPVSVAIDASGSDFQFYESGVFTGSCGTELDH--G  287

Query  950   avgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 G    D G +YW++KNSWGT WGE GY+R+QR    ++GLCG+A  ASYPT
Sbjct  288   VTAVGYGVSDDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPT  342



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 173/355 (49%), Positives = 228/355 (64%), Gaps = 17/355 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLV--ASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADM  235
             MA  +  SS + +T ++LGVW+      +  D   SM  RH+QWMA +  +Y D  E + 
Sbjct  1     MAFTLRKSSSILLTLLVLGVWASQANCRTLLDAHTSMLDRHEQWMARYVPIYKDDEEREK  60

Query  236   RFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMS  415
             RF IF++NVE IE+FN   N+ YKL +N FAD +++EF+           +N+      +
Sbjct  61    RFQIFKDNVEFIESFNYASNQPYKLNINGFADQSHEEFQ---------ASRNRYRTSLNT  111

Query  416   ASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
              S    FRY N T +PS++DWR KGAVTPIKDQG CG CWAF+ VAA EG  KLK+G LV
Sbjct  112   MSSKTPFRYENVTAIPSSMDWRKKGAVTPIKDQGECGCCWAFSAVAATEGTTKLKSGKLV  171

Query  596   SLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTAS  769
             SLSEQELVDCD +  + GC+GG    AF+F++ N GL  E NYPY+G    +CN  K A 
Sbjct  172   SLSEQELVDCDTQGENQGCEGGLMDDAFKFVMRNKGLAAEANYPYRGIDG-ICNKNKVAY  230

Query  770   KAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvt  949
              A +I+GYE VPA NE AL++AVA+QPV + I+ G + F+FY +G+ +G C  HL+H   
Sbjct  231   HAAKITGYEDVPA-NELALLKAVANQPVSVAIDAGGYEFQFYSRGILTGDCGTHLNH--G  287

Query  950   avgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 G   G  G KYW++KNSWG  WGE GY+RIQRD   ++GLCG+A  ASYPT
Sbjct  288   VTVVGYGTGADGTKYWLVKNSWGAEWGEGGYVRIQRDVHTRQGLCGIAMKASYPT  342



>ref|XP_007025415.1| Senescence-associated gene 12, putative [Theobroma cacao]
 gb|EOY28037.1| Senescence-associated gene 12, putative [Theobroma cacao]
Length=341

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 234/353 (66%), Gaps = 15/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA  +    L+FI  I+ G  +  ++ T   +  +  +++QWMA +G+ Y    E +MRF
Sbjct  1     MAFALKNKFLVFIL-IVSGALASAMSRTLS-ETVVAEKYKQWMAQYGRTYEMKEEENMRF  58

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              +F+NN+E IE FN   N+ YKL +N+FADLTN+EF  L    GY      K+     +S
Sbjct  59    EVFKNNLEYIENFNNMGNQPYKLSINEFADLTNEEF--LAYYAGY------KIIPSTVSS  110

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             K+K F+Y N TN+P+++DWRNKGAVT IKDQG+CGSCWAF+ VAAVEGI K+KTG L SL
Sbjct  111   KTKRFKYQNLTNVPASIDWRNKGAVTQIKDQGHCGSCWAFSTVAAVEGIAKIKTGRLFSL  170

Query  602   SEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQ+LVDC R   S GC GG+   AF++IV N+GL  E  YPYK K+   C+  K A KA
Sbjct  171   SEQQLVDCVRTKGSQGCKGGWMHDAFEYIVKNHGLAEETRYPYK-KKDGTCSPRKAAIKA  229

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
             V+I GYE VP KNE AL++A + QPV + ++G    F+FY  GVF+G C+  L+H     
Sbjct  230   VQILGYEDVPHKNEEALLKAASQQPVSVALDGNGTAFQFYSGGVFTGPCRTSLNH--AVT  287

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G    + G KYW+IKNSWG  WGENGYMRI+RD+  KKGLCG+AK ASYP 
Sbjct  288   VVGYGTSEDGSKYWLIKNSWGKSWGENGYMRIKRDFNSKKGLCGIAKRASYPV  340



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 229/353 (65%), Gaps = 14/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             M   +  S  + +  ++L  ++    +    + +M  RH+QWM+ HG+VY D+ E + RF
Sbjct  1     MTLPLTKSLCMALFVLLLCTFASHATARMLSEMTMHERHEQWMSQHGRVYGDSAEKERRF  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NVE IE+FNAG N  YKLGVN+FADLT +EF+ +       G +   V  F +  
Sbjct  61    QIFKANVELIESFNAG-NSKYKLGVNQFADLTIEEFKAM-----MNGFKPSSVNTFKA--  112

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
              +  FRY N T +P+++DWR +GAVTPIKDQG+ G CWAF+ VAA+EGI KLKTG L+SL
Sbjct  113   -TNVFRYENVTAVPTSMDWRAEGAVTPIKDQGDYGCCWAFSAVAAMEGITKLKTGKLISL  171

Query  602   SEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD   +  GC+GG    AF+FI+ N GLTTE NYPYKG     CN  K+ S A
Sbjct  172   SEQELVDCDVAGEDQGCEGGLMDDAFEFIIRNGGLTTETNYPYKGIDG-TCNTKKSFSHA  230

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
               I GYE VPA +E AL+ AV++QPV + I    + F+FY  GVF+G C   LDH     
Sbjct  231   ASIKGYEDVPANSEAALLNAVSNQPVSVAIEASGYSFQFYSSGVFTGSCGTDLDH--GVT  288

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G      G KYW++KNSWG+ WGE+GY+R++RD A K+GLCG+A  ASYPT
Sbjct  289   AVGYGTARDGTKYWLVKNSWGSSWGESGYVRMERDVAAKEGLCGIAMKASYPT  341



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/322 (53%), Positives = 214/322 (66%), Gaps = 17/322 (5%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             SM  RH+QWM  +GKVY D  E + RF IF+ NV  IE FN   NK YKL +N+FADLTN
Sbjct  34    SMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADLTN  93

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFRYANATNLPSTVDWRNKGAVTPIKDQ  514
             +EF         +  +N + +G M +S  ++  F+Y N T +PSTVDWR KGAVTPIKDQ
Sbjct  94    EEF---------IAPRN-RFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQ  143

Query  515   GNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY--GCDGGFPISAFQFIVN  688
             G CG CWAF+ VAA EGIH L +G L+SLSEQELVDCD K    GC+GG    AF+F++ 
Sbjct  144   GQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQ  203

Query  689   NNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEIN  868
             N+GL TE NYPYKG   + CN  + A+ A  I+GYE VPA NE AL +AVA+QPV + I+
Sbjct  204   NHGLNTEANYPYKGVDGK-CNVNEAANDAATITGYEDVPANNEKALQKAVANQPVSVAID  262

Query  869   GGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMR  1048
                  F+FY+ GVF+G C   LDH       G    + G +YW++KNSWGT WGE GY+R
Sbjct  263   ASGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIR  320

Query  1049  IQRDYADKKGLCGLAKAASYPT  1114
             +QR    ++GLCG+A  ASYPT
Sbjct  321   MQRGVNSEEGLCGIAMQASYPT  342



>gb|KHN08187.1| Thiol protease SEN102 [Glycine soja]
Length=326

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/322 (53%), Positives = 214/322 (66%), Gaps = 17/322 (5%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             SM  RH+QWM  +GKVY D  E + RF IF+ NV  IE FN   NK YKL +N+FADLTN
Sbjct  17    SMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADLTN  76

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFRYANATNLPSTVDWRNKGAVTPIKDQ  514
             +EF         +  +N + +G M +S  ++  F+Y N T +PSTVDWR KGAVTPIKDQ
Sbjct  77    EEF---------IAPRN-RFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQ  126

Query  515   GNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVN  688
             G CG CWAF+ VAA EGIH L +G L+SLSEQELVDCD K    GC+GG    AF+F++ 
Sbjct  127   GQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQ  186

Query  689   NNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEIN  868
             N+GL TE NYPYKG   + CN  + A+  V I+GYE VPA NE AL +AVA+QPV + I+
Sbjct  187   NHGLNTEANYPYKGVDGK-CNANEAANDVVTITGYEDVPANNEKALQKAVANQPVSVAID  245

Query  869   GGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMR  1048
                  F+FY+ GVF+G C   LDH       G    + G +YW++KNSWGT WGE GY+R
Sbjct  246   ASGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIR  303

Query  1049  IQRDYADKKGLCGLAKAASYPT  1114
             +QR    ++GLCG+A  ASYPT
Sbjct  304   MQRGVDSEEGLCGIAMQASYPT  325



>ref|XP_010038688.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW47321.1| hypothetical protein EUGRSUZ_K01109 [Eucalyptus grandis]
Length=340

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 171/345 (50%), Positives = 225/345 (65%), Gaps = 18/345 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVAS-TFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +L     +LG W++  A  TF     M   H QWMA +G+VY D  E   RF IF+ N +
Sbjct  10    ILVPLVFLLGAWAHQAAGRTFQRDDPMYEMHGQWMARYGRVYKDVEERQSRFEIFKANAQ  69

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
              IE+FN   +K Y+LGVN+FADLTN+EF+              + +  M ++++  FRY 
Sbjct  70    GIESFNHANDKPYRLGVNQFADLTNEEFK-----------ARNRFKSHMCSTEAASFRYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T +PS++DWR KGAVTP+K+QG CG CWAF+ VAAVEG++++ TG L+SLSEQELVDC
Sbjct  119   NITAVPSSMDWRKKGAVTPVKNQGQCGCCWAFSAVAAVEGVNEITTGKLISLSEQELVDC  178

Query  626   D--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D   +  GC+GG+  SAFQF V  +GLTTE NYPY G   + CN    +++AV I GYE 
Sbjct  179   DVGGQDQGCEGGWMDSAFQF-VEKHGLTTETNYPYNGTDGK-CNVKSESNRAVIIKGYED  236

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA +E AL++AVA QPV + I+ G F F+FY  GVF+G C   LDH       G    D
Sbjct  237   VPANSEGALLKAVAKQPVSVAIDAGGFDFQFYSSGVFTGACGTELDH--GVTAVGYGTSD  294

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G K+W++KNSWG  WGE GY+R+QRD + K+GLCG+A  ASYPT
Sbjct  295   DGTKFWLVKNSWGEEWGEKGYIRMQRDVSAKEGLCGIAMKASYPT  339



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 223/348 (64%), Gaps = 13/348 (4%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             L S ++ IT +I+GVW+    S   ++ SM  RH+ WM  +G+ Y D  E + RF IF+ 
Sbjct  3     LESKIICITLLIMGVWASQALSRTLHEVSMSERHEDWMGLYGRTYKDIAEKERRFKIFKE  62

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHF  436
             NVE IE+ N+  N+ YKL +N+FAD TN+EF+          R    +     +S+   F
Sbjct  63    NVEYIESVNSAGNRRYKLSINEFADQTNEEFK--------ASRNGYNMSSRPRSSEITSF  114

Query  437   RYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQEL  616
             RY N   +PS++DWR KGAVTPIKDQG CG CWAF+ VAA+EG+ +LKTG L+SLSEQEL
Sbjct  115   RYENVAAVPSSMDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGVTQLKTGELISLSEQEL  174

Query  617   VDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISG  790
             VDCD   +  GC GG   SAF+FI+ N GLTTE NYPYKG     CN  K AS A +I  
Sbjct  175   VDCDTSGEDQGCGGGLMDSAFEFIIGNGGLTTEANYPYKGVDA-TCNKKKAASSAAKIKN  233

Query  791   YERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtt  970
             YE VPA +E AL++AVA  PV + I+ G   F+FY  GVF+G+C   LDH       G  
Sbjct  234   YEDVPANSEAALLKAVAQHPVSVAIDAGGSDFQFYSSGVFTGQCGTELDH--GVTAVGYG  291

Query  971   agdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               D G KYW++KNSWGT WGE+GY+ ++RD    +GLCG+A  ASYPT
Sbjct  292   KTDDGTKYWLVKNSWGTGWGEDGYIWMERDIGADEGLCGIAMEASYPT  339



>ref|XP_010052203.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76130.1| hypothetical protein EUGRSUZ_D00506 [Eucalyptus grandis]
Length=345

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 175/347 (50%), Positives = 222/347 (64%), Gaps = 14/347 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFD---YQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNN  259
             L F+T+  L V    V+ T      +  +  +H++WMA HG++Y D  E   R+ IF+ N
Sbjct  7     LSFLTSATLLVIIVSVSETLCRPLVEEHLLKQHEEWMAIHGRIYKDAVEKAKRYEIFKEN  66

Query  260   VERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFR  439
             V+ I  FN G + GYK+ VNKFADLTN+EFR  +   GY  R  +     +S+   K F+
Sbjct  67    VKHINAFNNGKDVGYKMAVNKFADLTNEEFRASYT--GYKRRPTR----VLSSVDVKPFK  120

Query  440   YANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             YAN T +P+ +DWR K AVT +KDQG CG CWAF+ VAA+EG+ +LK   LV LS QELV
Sbjct  121   YANFTAIPAALDWRTKKAVTSVKDQGGCGCCWAFSAVAAMEGLTQLKKRKLVPLSVQELV  180

Query  620   DCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGY  793
             DCD   K  GC GG+  SAF+F+++N GLTTE  YPY+G   R CN  KTA  A  I+GY
Sbjct  181   DCDVNGKDKGCRGGYMDSAFEFVISNGGLTTEAEYPYQGTD-RTCNKAKTAKHAASITGY  239

Query  794   ERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtta  973
             + VPA NE AL+QAVA+QPV + I GG   F+ Y  GVF+G C   +DH       G   
Sbjct  240   QDVPANNEKALLQAVANQPVSVAIEGGGLKFQLYSSGVFTGSCGTDIDH--AVTVVGYGK  297

Query  974   gdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               GG KYW++KNSW T WGE+GYMRIQRD + K GLCGLA  ASYPT
Sbjct  298   TSGGIKYWLLKNSWSTEWGESGYMRIQRDVSSKAGLCGLAMNASYPT  344



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 210/323 (65%), Gaps = 13/323 (4%)
 Frame = +2

Query  152   YQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFAD  331
             Y+ S+  RH+ WMA H +VY D  E +MRF IFR NV+ IE+FN   NK YKLG+N F D
Sbjct  14    YEASLEERHEIWMAQHERVYKDATEKEMRFQIFRENVKFIESFNKAGNKSYKLGINAFTD  73

Query  332   LTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKD  511
             LTN EFR          R   K   + S+S +  F+Y N T +PS++DWR+KG VTPIKD
Sbjct  74    LTNKEFR--------ASRNGYKRSSYSSSSGTNSFKYENVTTIPSSLDWRSKGVVTPIKD  125

Query  512   QGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIV  685
             QG CG CWAF+ VAA+EGI KL T  L+SLSEQEL+DCD      GC+GG    AF+FI+
Sbjct  126   QGQCGCCWAFSAVAAMEGITKLSTEKLISLSEQELIDCDTSGIDQGCEGGLMDDAFEFII  185

Query  686   NNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEI  865
              NNGLTTE NYPY+  +   CN  K A+ A  I+ YE VP  NE AL  AVA+QPV + I
Sbjct  186   QNNGLTTEANYPYQA-EDGTCNTEKAANHAATITSYEDVPENNEEALRMAVANQPVSVAI  244

Query  866   NGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYM  1045
             + G+  F+ Y  G+F+G C   LDH       G    D G KYW++KNSWGT WGE+GY+
Sbjct  245   DAGESAFQHYSSGIFTGDCGTELDH--GVTVVGYGTSDDGTKYWLVKNSWGTSWGEDGYI  302

Query  1046  RIQRDYADKKGLCGLAKAASYPT  1114
             R+QRD   K+GLCG+A   SYPT
Sbjct  303   RMQRDIDAKEGLCGIAMQPSYPT  325



>dbj|BAF56429.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/344 (49%), Positives = 216/344 (63%), Gaps = 17/344 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L     + +G+   +     + + S+  RH+QWMA + KVY D  E + RF IF++NVE 
Sbjct  12    LALFLLLAVGISRVISRELHETETSLIERHEQWMAKYDKVYKDAAEKEKRFLIFKDNVEF  71

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+FNA  NK YKLGVN  ADLT +EF+           +N     +     +  F+Y N
Sbjct  72    IESFNAAGNKPYKLGVNHLADLTIEEFK---------ASRNGLKRSYDYEVGTTSFKYEN  122

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +P++VDWR KGAVTPIKDQG CGSCWAF+ VAA EGIHK+ TG LVSLSEQELVDCD
Sbjct  123   VTAIPASVDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGIHKISTGKLVSLSEQELVDCD  182

Query  629   RK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
             RK    GC+GG+    F+FI+ N G+TTE NYPYK       N     + A +I GYE+V
Sbjct  183   RKGTDQGCEGGYMEDGFEFIIKNGGITTEANYPYKAVDGSCKN---ATAPAAQIKGYEKV  239

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             P  +E AL++AVA+QPV + I+  D  F FY  G+F+G+C   LDH    V         
Sbjct  240   PVNSEKALLKAVANQPVSVSIDAADGSFMFYSSGIFTGECGTELDH---GVTAVGYGRAN  296

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G  YW++KNSWGT WGE GY+R+QR  A K+GLCG+A  +SYPT
Sbjct  297   GTDYWIVKNSWGTVWGEQGYIRMQRGIAAKEGLCGIAMDSSYPT  340



>gb|AHA62780.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score =   329 bits (843),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 223/353 (63%), Gaps = 16/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             + +KI  S LLFI  I+    SY ++     +  M  +H+QWM  +G++Y +  E   RF
Sbjct  3     LVTKIC-SILLFILVILP---SYSLSRLLHIESFMIEKHEQWMTLYGRIYENNNEKMKRF  58

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF  N++RIE  N    +G+ LGVN FADLTNDEFR         G + Q      +  
Sbjct  59    KIFSENIKRIEAMNK-MGRGFTLGVNAFADLTNDEFRNSR-----TGYKKQLTTTNNNNL  112

Query  422   KSKHFRYANATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
              SK+F+Y N TN  + ++ DWR KGAVTPIKDQGNCG CWAFA VAA EG+++LKTG L+
Sbjct  113   ASKYFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCCWAFATVAATEGLNQLKTGKLI  172

Query  596   SLSEQELVDCDRK-SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             SLSEQELVDCD     GC+GG   +A+ FI+ N GLTTE NYPY      +C    +A  
Sbjct  173   SLSEQELVDCDTSFDQGCEGGLLDTAYTFILKNGGLTTESNYPYMATDG-ICTTKHSAKS  231

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
             A  I GY+ VPA +E AL++AVAHQPV + + GG F F+FY  GVF G+C   LDH    
Sbjct  232   AASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQFYSSGVFQGECGYELDH--AV  289

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
                G    D G KYW+IKNSWGT+WGENGYMRI+RD  DK GLCGLA   SYP
Sbjct  290   AIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRDVDDKYGLCGLAMQPSYP  342



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   329 bits (843),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/322 (53%), Positives = 214/322 (66%), Gaps = 17/322 (5%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             SM  RH+QWM  +GKVY D  E + RF IF+ NV  IE FN   NK YKL +N+FADLTN
Sbjct  34    SMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADLTN  93

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFRYANATNLPSTVDWRNKGAVTPIKDQ  514
             +EF         +  +N + +G M +S  ++  F+Y N T +PSTVDWR KGAVTPIKDQ
Sbjct  94    EEF---------IAPRN-RFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQ  143

Query  515   GNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVN  688
             G CG CWAF+ VAA EGIH L +G L+SLSEQELVDCD K    GC+GG    AF+F++ 
Sbjct  144   GQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQ  203

Query  689   NNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEIN  868
             N+GL TE NYPYKG   + CN  + A+  V I+GYE VPA NE AL +AVA+QPV + I+
Sbjct  204   NHGLNTEANYPYKGVDGK-CNANEAANDVVTITGYEDVPANNEKALQKAVANQPVSVAID  262

Query  869   GGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMR  1048
                  F+FY+ GVF+G C   LDH       G    + G +YW++KNSWGT WGE GY+R
Sbjct  263   ASGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIR  320

Query  1049  IQRDYADKKGLCGLAKAASYPT  1114
             +QR    ++GLCG+A  ASYPT
Sbjct  321   MQRGVDSEEGLCGIAMQASYPT  342



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score =   328 bits (840),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 217/338 (64%), Gaps = 16/338 (5%)
 Frame = +2

Query  110   ILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAG  289
             +LG WS    S      SM  R++QWM  +G+VY D  E + RF IF+ NV  IE+ N  
Sbjct  1     MLGAWSCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNND  60

Query  290   PNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN-ATNLPS  466
              NK YKLGVN+FADLTN+EF+      G+ G +         ++K+  F+Y N    +P+
Sbjct  61    VNKPYKLGVNQFADLTNEEFKASR--NGFKGHE--------CSTKTTSFKYENIKAPVPA  110

Query  467   TVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR--KSY  640
             T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD   +  
Sbjct  111   TMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQ  170

Query  641   GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNET  820
             GC+GG    AFQFI  N+GL+ E NYPY G     CN  K AS A +I+GYE VPA +E 
Sbjct  171   GCEGGLMDDAFQFIQQNHGLSAEANYPYNGVDGS-CNTKKAASIAAKITGYEDVPANSEK  229

Query  821   ALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWV  1000
             AL+ AVAHQPV + I+ G   F+FY  GVF+G C   LDH       G    D G KYW+
Sbjct  230   ALLTAVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDH--GVTAVGYGVSDDGTKYWL  287

Query  1001  IKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             +KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  288   VKNSWGTEWGEEGYIRMQRDVEAKEGLCGIAMEASYPT  325



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score =   328 bits (841),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 176/344 (51%), Positives = 221/344 (64%), Gaps = 17/344 (5%)
 Frame = +2

Query  92    LFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERI  271
             L +  I+LG  S    S      SM  RH+QWMA +G+ Y D  E + RFNIF+ NV  I
Sbjct  15    LALILIMLGACSSEATSRSLQDASMYGRHEQWMARYGRTYNDIREKEKRFNIFKENV-XI  73

Query  272   ETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANA  451
             E+ N   NK YKL VN+FADLTNDEF+              + +G   ++K+  F+Y N 
Sbjct  74    ESSNDDANKLYKLSVNQFADLTNDEFKA----------SRNRFKGHECSTKTTSFKYENV  123

Query  452   T-NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
             T ++P+T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD
Sbjct  124   TASVPTTMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCD  183

Query  629   R--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
                +  GC+GG    AFQFI  N+GL+TE NYPY G     CN  K AS A +I+GYE V
Sbjct  184   TNGEDQGCEGGLMDDAFQFIQQNHGLSTEANYPYSGVDG-TCNTKKEASIAAKITGYEDV  242

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             P  +E AL++AVA+QPV + I+     F+FY  GVF+G C   LDH       G   GD 
Sbjct  243   PTNSEQALLKAVANQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVGDD  300

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G K+W++KNSWGT WGE GY+R+QRD    +GLCG+A +ASYPT
Sbjct  301   GTKFWLVKNSWGTEWGEEGYIRMQRDVDAAEGLCGIAMSASYPT  344



>sp|Q7XWK5.2|SAG39_ORYSJ RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Japonica Group]
 emb|CAD40026.2| OSJNBa0052O21.11 [Oryza sativa Japonica Group]
 gb|EAZ29764.1| hypothetical protein OsJ_13822 [Oryza sativa Japonica Group]
Length=339

 Score =   328 bits (840),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 223/350 (64%), Gaps = 18/350 (5%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWS-YLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             +  +LLF     L + S  L A       +M  RH++WMA +G+VY D  E   RF +F+
Sbjct  3     MAKALLFAILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEVFK  62

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              NV  IE+FNAG N  + LGVN+FADLTNDEFR +    G++    +   GF        
Sbjct  63    ANVAFIESFNAG-NHNFWLGVNQFADLTNDEFRWMKTNKGFIPSTTRVPTGF-------R  114

Query  434   FRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             +   N   LP+TVDWR KGAVTPIKDQG CG CWAF+ VAA+EGI KL TG L+SLSEQE
Sbjct  115   YENVNIDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQE  174

Query  614   LVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAV-RI  784
             LVDCD   +  GC+GG    AF+FI+ N GLTTE NYPY     +     K+ S +V  I
Sbjct  175   LVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESNYPYAAADDKC----KSVSNSVASI  230

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
              GYE VPA NE ALM+AVA+QPV + ++GGD  F+FY+ GV +G C   LDH    V  G
Sbjct  231   KGYEDVPANNEAALMKAVANQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDH--GIVAIG  288

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                   G KYW++KNSWGT WGENG++R+++D +DK+G+CGLA   SYPT
Sbjct  289   YGKASDGTKYWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPT  338



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score =   327 bits (839),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 173/344 (50%), Positives = 218/344 (63%), Gaps = 16/344 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             + F    +LG  S    S      SM  +++QWMA++G+VY +  E + RFNIF+ NV+ 
Sbjct  8     MCFALIFMLGALSSHATSRTLQDPSMYGKYEQWMAHYGRVYTNINEKEKRFNIFKANVDF  67

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+ N   NK YKL VN+FADLTN+EF+              +  G   ++K+  F+Y N
Sbjct  68    IESSNNDANKPYKLKVNQFADLTNEEFKA----------SRNRFMGHECSTKTTSFKYEN  117

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T  P+TVDWR KGAVTPIKDQG CG CWAF+ VAA+EGI KL TG L+SLSEQELVDCD
Sbjct  118   VT-APATVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCD  176

Query  629   RKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
                   GC+GG    AFQFI  N+GL+TE NYPY G     CN  K AS A  I+G+E V
Sbjct  177   TSGVDQGCEGGLMDDAFQFITQNHGLSTETNYPYTGVDG-TCNTKKEASHAATITGHEDV  235

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E AL++AVA+QP+ + I+ G   F+FY  GVF+G C   LDH       G      
Sbjct  236   PANSEAALLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDH--GVTAVGFGVSAD  293

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWG  WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  294   GTKYWLVKNSWGAEWGEEGYIRMQRDVEAKEGLCGIAMEASYPT  337



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   328 bits (840),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 170/353 (48%), Positives = 220/353 (62%), Gaps = 14/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA    G  LL     +L +W+   ++   ++ +M  RH++WMA HGKVY D  E   RF
Sbjct  1     MALLCKGQFLLIALFFVLAMWADQASTRELHESTMVERHEKWMAKHGKVYKDDEEKLRRF  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+NNVE IE+ NA  N  Y LG+N+FADLTN+EFR            N       ++ 
Sbjct  61    QIFKNNVEFIESSNAAGNNSYMLGINRFADLTNEEFR---------ASWNGYKRPLDASR  111

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
                 F+Y N T LP ++DWR KGAVT IKDQ  CGSCWAF+ VAA EG+HKL+TG LVSL
Sbjct  112   IVTPFKYENVTALPYSMDWRRKGAVTSIKDQRECGSCWAFSAVAATEGVHKLRTGKLVSL  171

Query  602   SEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELVDCD K    GC GG    AF+FI  N G+TTE NY Y+G+  + C+  K AS  
Sbjct  172   SEQELVDCDVKGEDKGCQGGLMEDAFKFIKRNGGITTEANYAYRGRDGK-CDTKKEASHV  230

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I+GY+ VP  +E AL++AVAHQPV + I+ G   F+FY+ G+++G C   L+H     
Sbjct  231   AKITGYQVVPENSEAALLKAVAHQPVSVSIDAGSMSFQFYQSGIYAGSCGSDLNH--GVA  288

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G      G KYW++KNSWG  WGE GY+R++RD   +KGLCG+A   SYPT
Sbjct  289   AVGYGTSSSGSKYWIVKNSWGPEWGERGYVRMKRDITSRKGLCGIAMDCSYPT  341



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   328 bits (840),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 219/343 (64%), Gaps = 12/343 (3%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L+    ++L +WS    +      +    H+QWMA  G+VY D  E   RF IF+ NVE 
Sbjct  9     LVIAALLVLEMWSSQGTARTLPDAATVQEHEQWMAQFGRVYKDEAEKSKRFRIFKENVEY  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             I +FN    + Y+L +NKFADLTN+EF           R   K+  +M ++K   FRYAN
Sbjct  69    IRSFNEAAARPYRLAINKFADLTNEEF--------VASRNGYKMGSYMKSTKVSSFRYAN  120

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              + +P+++DWR KGAVT +KDQG CG CWAF+ VAA EGI++L T  L+SLSEQELVDCD
Sbjct  121   VSAVPASMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTRKLISLSEQELVDCD  180

Query  629   -RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
               +  GC+GG    AF+FI++N G+TTE NYPY+G     CN  K +S A +I+GYE VP
Sbjct  181   TSEDEGCNGGLMDDAFEFIISNGGITTESNYPYEGVDG-TCNSKKESSHAAKITGYEDVP  239

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A +E AL++AVA+QPV + I+     F+FY  GVF+G+C   LDH       G      G
Sbjct  240   ANSEPALLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDH--GVTAVGYGKTSDG  297

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWG+ WGENGY+R+QRD    +GLCG+A  ASYPT
Sbjct  298   TKYWLVKNSWGSSWGENGYIRMQRDIDAAEGLCGIAMQASYPT  340



>ref|XP_007132875.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
 gb|ESW04869.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
Length=343

 Score =   328 bits (840),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 172/355 (48%), Positives = 221/355 (62%), Gaps = 17/355 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             M +K     +       +  W+  V S      S+  RH++WMA + +VY D  E + RF
Sbjct  1     MVTKFHLCHISLAMLFCMAFWALQVTSRTLQDASIYERHEEWMARYSRVYKDPQEKEKRF  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ N+  IE FN   NK YKL +N+FADLTN+EF         +  +N + +G M +S
Sbjct  61    RIFKQNMNYIEAFNNAANKPYKLAINQFADLTNEEF---------IAPRN-RFKGHMRSS  110

Query  422   --KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
               K+  F+Y N T++PSTVDWR KGAVTP+KDQG CG CWAF+ VA+ EGIH+L TG L+
Sbjct  111   IIKTTTFKYENVTSVPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVASAEGIHQLTTGKLI  170

Query  596   SLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTAS  769
             SLSEQELVDCD K    GC+GG    AF+FI+ NNGL TE NYP+KG     CN    +S
Sbjct  171   SLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNNGLNTEANYPFKGVDG-TCNAKAASS  229

Query  770   KAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvt  949
              A  I GYE VPA NE AL +AV +QPV + I+     F+FY+ GVF+G C   LDH   
Sbjct  230   HAATIRGYEDVPANNEKALQKAVTNQPVSVAIDASGSDFKFYKSGVFTGSCGTELDH--G  287

Query  950   avgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 G    D G +YW++KNSWGT WGE GY+R+QR    ++GLCG+A  ASYPT
Sbjct  288   VTAVGYGVSDDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPT  342



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 217/339 (64%), Gaps = 17/339 (5%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++LG WS    S      SM  R++QW+  +G+VY D  E + RF IF+ NV  IE+ N 
Sbjct  18    LMLGAWSSGATSRTLQDASMYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIESSNK  77

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANAT-NLP  463
               NK Y+L VN+FADLTN+EF+      G+ G +          S    F+Y N T +LP
Sbjct  78    DANKPYRLSVNQFADLTNEEFKASR--NGFKGHE---------CSTKTSFKYENLTASLP  126

Query  464   STVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR--KS  637
             +T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD   + 
Sbjct  127   ATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGED  186

Query  638   YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNE  817
              GC+GG    AFQFI  N G++TE NYPY G     CN  K AS+A +I+G+E VPA +E
Sbjct  187   QGCEGGLMDDAFQFIQQNRGISTEANYPYDGVDG-TCNAKKEASRAAKITGFEDVPANSE  245

Query  818   TALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyW  997
              AL+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G    + G KYW
Sbjct  246   KALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSEDGTKYW  303

Query  998   VIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             ++KNSWGT WGE GY+R+QRD A  +GLCG+A AASYPT
Sbjct  304   LVKNSWGTEWGEAGYIRMQRDVAAGEGLCGIAMAASYPT  342



>gb|EMT33085.1| Vignain [Aegilops tauschii]
Length=342

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/351 (50%), Positives = 219/351 (62%), Gaps = 26/351 (7%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             LLF       V S L A       S+  RH+QWMA +G+VY D  E   R  +F+ NV  
Sbjct  8     LLFAILACACVLSALAARDLADDRSIVARHEQWMAKYGRVYSDAAEKAHRLEVFKANVAF  67

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHL-----VGGYVGRQNQKVEGFMSASKSKH  433
             IE+ NAG +K + L  N+FAD+T+DEF+  H      VGG  GR+               
Sbjct  68    IESVNAGTDK-FWLEANQFADITDDEFKATHTGYKAPVGGSKGRKT-------------G  113

Query  434   FRYANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSE  607
             FRYAN +   LP++VDWR KGAVTPIKDQG CG CWAF+ VA++EGI KL TG L+SLSE
Sbjct  114   FRYANVSLDALPTSVDWRTKGAVTPIKDQGQCGCCWAFSTVASMEGIVKLSTGKLISLSE  173

Query  608   QELVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVR  781
             QELVDCD      GC+GG   +AF+FI++N GLTTE NYPY G     CN  K ++ A  
Sbjct  174   QELVDCDVDGLDQGCEGGLMDNAFEFIIDNGGLTTEGNYPYTGTDDS-CNSNKESNAAAS  232

Query  782   ISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgy  961
             I GYE VPA +E +L +AVA QPV + ++GGD  FRFY+ GV SG C   LDH       
Sbjct  233   IKGYEDVPAHDEASLQKAVAAQPVSVAVDGGDNLFRFYKGGVLSGDCGTELDH--GIAAV  290

Query  962   gttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G      G KYWV+KNSWG  WGENG++R++RD AD++GLCGLA   SYPT
Sbjct  291   GYGIAGDGTKYWVMKNSWGASWGENGFIRMERDVADEQGLCGLAMQPSYPT  341



>ref|XP_010939512.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/352 (47%), Positives = 223/352 (63%), Gaps = 22/352 (6%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             + S    +  I+LGVW     +       +  RH+QWMA +G+VY D  E + RF IF++
Sbjct  3     MASQCFVLKLIVLGVWVSAATARGIADVPISTRHEQWMARYGRVYKDAVEKERRFQIFKD  62

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGF----MSASK  424
             N   IE+ N   N+ YKLG+N+FAD+TN+EF+  HL             GF    ++ S 
Sbjct  63    NHNYIESVNRAGNRKYKLGLNQFADMTNEEFKASHL-------------GFKPMHLAKSA  109

Query  425   SKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLS  604
             +  F+YAN T++  ++DWR +GAVTPIK+Q +CG CWAF+ VAA+EGI ++ TGNLVSLS
Sbjct  110   TGSFQYANLTDVSDSMDWRTRGAVTPIKNQKSCGCCWAFSSVAAIEGITQINTGNLVSLS  169

Query  605   EQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAV  778
             EQ+LV+CD      GC GGF   AF +++NN G+T+E NYPYK      C+  K +S   
Sbjct  170   EQQLVNCDVNDGDNGCQGGFMTRAFHYVINNGGITSEANYPYKAADG-TCDTNKASSSVA  228

Query  779   RISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavg  958
              ISGYE VPA +E++L+QAV+ QPV + I+GG   F++Y  G+F+G C   +DH      
Sbjct  229   TISGYENVPANDESSLLQAVSKQPVSVGIDGGGKDFQYYSSGIFTGACTTDMDH--AVTA  286

Query  959   ygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G      G KYW++KNSWGT WGE GYMR+QRD    +GLCG+AK ASYPT
Sbjct  287   IGYGKAKDGTKYWLLKNSWGTTWGEKGYMRLQRDVGASEGLCGIAKLASYPT  338



>sp|A2XQE8.1|SAG39_ORYSI RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Indica Group]
 gb|EAY93058.1| hypothetical protein OsI_14861 [Oryza sativa Indica Group]
Length=339

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 222/350 (63%), Gaps = 18/350 (5%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWS-YLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             +  +LLF     L + S  L A       +M  RH++WMA +G+VY D  E   RF +F+
Sbjct  3     MAKALLFAILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEVFK  62

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              NV  IE+FNAG N  + LGVN+FADLTNDEFR      G++    +   GF        
Sbjct  63    ANVAFIESFNAG-NHNFWLGVNQFADLTNDEFRWTKTNKGFIPSTTRVPTGF-------R  114

Query  434   FRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             +   N   LP+TVDWR KGAVTPIKDQG CG CWAF+ VAA+EGI KL TG L+SLSEQE
Sbjct  115   YENVNIDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQE  174

Query  614   LVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAV-RI  784
             LVDCD   +  GC+GG    AF+FI+ N GLTTE NYPY     +     K+ S +V  I
Sbjct  175   LVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESNYPYAAADDKC----KSVSNSVASI  230

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
              GYE VPA NE ALM+AVA+QPV + ++GGD  F+FY+ GV +G C   LDH    V  G
Sbjct  231   KGYEDVPANNEAALMKAVANQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDH--GIVAIG  288

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                   G KYW++KNSWGT WGENG++R+++D +DK+G+CGLA   SYPT
Sbjct  289   YGKASDGTKYWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPT  338



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/343 (51%), Positives = 218/343 (64%), Gaps = 16/343 (5%)
 Frame = +2

Query  95    FITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIE  274
             F   ++ G W     S      SM  R++QWM  +G++Y D  E + RF IF+ NV  IE
Sbjct  9     FGLILMFGAWCCEATSRSLQDASMYGRYEQWMTRYGRIYNDVNEKENRFKIFKENVAFIE  68

Query  275   TFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANA-  451
             + N   NK YKLGVN+FADLTN+EF+      G+ G +         ++K+  F+Y N  
Sbjct  69    SSNNDVNKPYKLGVNQFADLTNEEFKASR--NGFKGHE--------CSTKTTSFKYENVK  118

Query  452   TNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR  631
               +P+T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD 
Sbjct  119   APVPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDT  178

Query  632   --KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
               +  GC+GG    AFQFI  N+GL+TE NYPY G     CN  K AS A +I+GYE VP
Sbjct  179   SGEDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGS-CNTKKAASIAAKITGYEDVP  237

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A +E AL+ AVAHQPV + I+ G   F+FY  GVF+G C   LDH       G    D G
Sbjct  238   ANSEKALLTAVAHQPVSVAIDAGGSDFQFYSSGVFTGACGTSLDH--GVTAVGYGVSDDG  295

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              K+W++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  296   TKFWLVKNSWGTEWGEEGYIRMQRDVEAKEGLCGIAMEASYPT  338



>ref|XP_010038689.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=340

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/345 (49%), Positives = 224/345 (65%), Gaps = 19/345 (6%)
 Frame = +2

Query  92    LFITTIILGVWSYLVASTFDYQHS--MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             + +T I L   S   A+    Q    M   H+QWMA + +VY D  E   RF IF+ N +
Sbjct  10    ILVTLIFLLGASACQAAGHALQQDDPMYEMHEQWMARYERVYKDMDERQSRFQIFKANTQ  69

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
             RIE+FN G  K YKL VN+FADLTN+EF+              + +  + ++++  F+Y 
Sbjct  70    RIESFNRGSGKPYKLSVNQFADLTNEEFK-----------ARNRFKSHVCSAEAASFKYG  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T +PS++DWR KGAVTP+K+QG CG CWAF+ V AVEG+H++ TG L+SLSEQELVDC
Sbjct  119   NGTAVPSSMDWRKKGAVTPVKNQGQCGCCWAFSAVTAVEGVHEITTGKLISLSEQELVDC  178

Query  626   DRKS--YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D +S   GC+GG+  SAFQF V  +GLTTE NYPY G   + CN  + +++AV I GYE 
Sbjct  179   DVRSQYQGCEGGWMDSAFQF-VEKHGLTTEMNYPYTGTDGK-CNAKRESNRAVTIKGYED  236

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA +E AL++AVA+QPV + I+ G F F+FY  GVF+G C   LDH       G    D
Sbjct  237   VPANSEEALLKAVANQPVSVAIDAGGFEFQFYSSGVFTGACGTDLDH--GVAAVGYGTSD  294

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                KYW++KNSWG +WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  295   DSTKYWLVKNSWGAKWGEEGYIRMQRDVTAKEGLCGIAMKASYPT  339



>gb|KCW47322.1| hypothetical protein EUGRSUZ_K01110 [Eucalyptus grandis]
Length=305

 Score =   325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/319 (52%), Positives = 215/319 (67%), Gaps = 17/319 (5%)
 Frame = +2

Query  164   MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTND  343
             M   H+QWMA + +VY D  E   RF IF+ N +RIE+FN G  K YKL VN+FADLTN+
Sbjct  1     MYEMHEQWMARYERVYKDMDERQSRFQIFKANTQRIESFNRGSGKPYKLSVNQFADLTNE  60

Query  344   EFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNC  523
             EF+  +    +V            ++++  F+Y N T +PS++DWR KGAVTP+K+QG C
Sbjct  61    EFKARNRFKSHV-----------CSAEAASFKYGNGTAVPSSMDWRKKGAVTPVKNQGQC  109

Query  524   GSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKS--YGCDGGFPISAFQFIVNNNG  697
             G CWAF+ V AVEG+H++ TG L+SLSEQELVDCD +S   GC+GG+  SAFQF V  +G
Sbjct  110   GCCWAFSAVTAVEGVHEITTGKLISLSEQELVDCDVRSQYQGCEGGWMDSAFQF-VEKHG  168

Query  698   LTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGGD  877
             LTTE NYPY G   + CN  + +++AV I GYE VPA +E AL++AVA+QPV + I+ G 
Sbjct  169   LTTEMNYPYTGTDGK-CNAKRESNRAVTIKGYEDVPANSEEALLKAVANQPVSVAIDAGG  227

Query  878   FHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQR  1057
             F F+FY  GVF+G C   LDH       G    D   KYW++KNSWG +WGE GY+R+QR
Sbjct  228   FEFQFYSSGVFTGACGTDLDH--GVAAVGYGTSDDSTKYWLVKNSWGAKWGEEGYIRMQR  285

Query  1058  DYADKKGLCGLAKAASYPT  1114
             D   K+GLCG+A  ASYPT
Sbjct  286   DVTAKEGLCGIAMKASYPT  304



>gb|AHA62781.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 221/353 (63%), Gaps = 16/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             + +KI  S LLFI  I+    SY ++     +  M  +H+QWM  HG++Y +  E   RF
Sbjct  3     LVTKIC-SILLFILVILP---SYSLSRLLHIESFMIEKHEQWMTLHGRIYENNNEKMKRF  58

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF  N++RIE  N    + + LGVN FADLTNDEFR         G + Q      +  
Sbjct  59    KIFSENIKRIEAMNK-MGRSFTLGVNAFADLTNDEFRNSR-----TGYKKQLTTTNNNNL  112

Query  422   KSKHFRYANATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
              SK+F+Y N TN  + ++ DWR KGAVTPIKDQGNCG CWAFA VAA EG+++LKTG L+
Sbjct  113   ASKYFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCCWAFATVAATEGLNQLKTGKLI  172

Query  596   SLSEQELVDCDRK-SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             SLSEQELVDCD     GC+GG   +A+ FI+ N GLTTE NYPY      +C    +A  
Sbjct  173   SLSEQELVDCDTNFDQGCEGGLLDTAYTFILKNGGLTTESNYPYMATDG-ICTTKHSAKS  231

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
                I GY+ VPA +E AL++AVAHQPV + + GG F F+FY  GVF G+C   LDH    
Sbjct  232   DASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQFYSSGVFQGECGYELDH--AV  289

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
                G    D G KYW+IKNSWGT+WGENGYMRI+RD  DK GLCGLA   SYP
Sbjct  290   AIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRDVDDKYGLCGLAMQPSYP  342



>gb|KHN08873.1| Vignain [Glycine soja]
Length=335

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 167/341 (49%), Positives = 216/341 (63%), Gaps = 13/341 (4%)
 Frame = +2

Query  92    LFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERI  271
             +    ++L + +  V S   ++ SM  RH+QWM  +GKVY D  E   R  IF++NVE I
Sbjct  7     ILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDNVEFI  66

Query  272   ETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANA  451
             E+FNA  NK YKL +N  AD TN+EF   H    Y G  +Q             F+Y N 
Sbjct  67    ESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKYKGSHSQT-----------PFKYGNV  115

Query  452   TNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR  631
             T++P+ VDWR  GAVT +KDQG CGSCWAF+ VAA EGI+++ TG L+SLSEQELVDCD 
Sbjct  116   TDIPTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCDS  175

Query  632   KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAK  811
               +GCDGG     F+FI+ N G+++E NYPY       C+  K AS A +I GYE VPA 
Sbjct  176   VDHGCDGGLMEDGFEFIIKNGGISSEANYPYTAVD-GTCDASKEASPAAQIKGYETVPAN  234

Query  812   NETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkk  991
             +E AL QAVA+QPV + I+ G   F+FY  GVF+G+C   LDH    V    T  DG  +
Sbjct  235   SEEALQQAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDH-GVTVVGYGTTDDGTHE  293

Query  992   yWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             YW++KNSWGT+WGE GY+R+QR    ++GLCG+A  ASYPT
Sbjct  294   YWIVKNSWGTQWGEEGYIRMQRGIDAQEGLCGIAMDASYPT  334



>ref|XP_006582264.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN33267.1| Vignain [Glycine soja]
Length=338

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 167/341 (49%), Positives = 216/341 (63%), Gaps = 13/341 (4%)
 Frame = +2

Query  92    LFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERI  271
             +    ++L + +  V S   ++ SM  RH+QWM  +GKVY D  E   R  IF++NVE I
Sbjct  10    ILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDNVEFI  69

Query  272   ETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANA  451
             E+FNA  NK YKL +N  AD TN+EF   H    Y G  +Q             F+Y N 
Sbjct  70    ESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKYKGSHSQT-----------PFKYGNV  118

Query  452   TNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR  631
             T++P+ VDWR  GAVT +KDQG CGSCWAF+ VAA EGI+++ TG L+SLSEQELVDCD 
Sbjct  119   TDIPTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCDS  178

Query  632   KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAK  811
               +GCDGG     F+FI+ N G+++E NYPY       C+  K AS A +I GYE VPA 
Sbjct  179   VDHGCDGGLMEDGFEFIIKNGGISSEANYPYTAVD-GTCDASKEASPAAQIKGYETVPAN  237

Query  812   NETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkk  991
             +E AL QAVA+QPV + I+ G   F+FY  GVF+G+C   LDH    V    T  DG  +
Sbjct  238   SEEALQQAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDH-GVTVVGYGTTDDGTHE  296

Query  992   yWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             YW++KNSWGT+WGE GY+R+QR    ++GLCG+A  ASYPT
Sbjct  297   YWIVKNSWGTQWGEEGYIRMQRGIDAQEGLCGIAMDASYPT  337



>emb|CDY58055.1| BnaA06g40240D [Brassica napus]
Length=322

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 169/321 (53%), Positives = 208/321 (65%), Gaps = 13/321 (4%)
 Frame = +2

Query  164   MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFN-AGPNKGYKLGVNKFADLTN  340
             + LRH +WM  HG+VY D  E + R+ +F+ NVERIE  N       +KL VN+FADLTN
Sbjct  12    VSLRHAEWMTEHGRVYADANEKNNRYAVFKRNVERIERLNDVQSGLTFKLAVNQFADLTN  71

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATN--LPSTVDWRNKGAVTPIKDQ  514
             +EFR +     Y G +   V    S +K   FRY N ++  LP +VDWR KGAVTPIKDQ
Sbjct  72    EEFRSM-----YTGFKGNSV--LSSRTKPTSFRYQNVSSDALPVSVDWRKKGAVTPIKDQ  124

Query  515   GNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSYGCDGGFPISAFQFIVNNN  694
             G CGSCWAF+ VAA+EG+ ++K G L+SLSEQELVDCD    GC GG   +AF + +   
Sbjct  125   GLCGSCWAFSAVAAIEGVAQIKKGKLISLSEQELVDCDTNDGGCMGGLMDTAFNYTITIG  184

Query  695   GLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGG  874
             GLT+E NYPYK   +  CNF KT   A  I G+E VPA +E ALM+AVAH PV + I GG
Sbjct  185   GLTSESNYPYK-STNGTCNFNKTKQIATSIKGFEDVPANDEKALMKAVAHHPVSIGIAGG  243

Query  875   DFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQ  1054
             D  F+FY  GVFSG+C  HLDH       G      G KYW++KNSWG +WGE GYMRI+
Sbjct  244   DIGFQFYSSGVFSGECTTHLDH--GVTAVGYGRSKNGLKYWILKNSWGPKWGERGYMRIK  301

Query  1055  RDYADKKGLCGLAKAASYPTI  1117
             +D   K G CGLA  ASYPT+
Sbjct  302   KDIKPKHGQCGLAMNASYPTM  322



>gb|AHA62779.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 222/353 (63%), Gaps = 16/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             + +KI  S LLFI  I+    SY ++     +  M  +H+QWM  +G++Y +  E   RF
Sbjct  3     LVTKIC-SILLFILVILP---SYSLSRLLHIESFMIEKHEQWMTLYGRIYENNNEKMKRF  58

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF  N++RIE  N    +G+ LGVN FADLTNDEFR         G + Q      +  
Sbjct  59    KIFSENIKRIEAMNK-MGRGFTLGVNAFADLTNDEFRNSR-----TGYKKQLTTTNNNNL  112

Query  422   KSKHFRYANATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
              SK+F+Y N TN  + ++ DWR KGAVTPIKDQGNCG CWAFA VAA EG+++LKTG L+
Sbjct  113   ASKYFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCCWAFATVAATEGLNQLKTGKLI  172

Query  596   SLSEQELVDCDRK-SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             SLSEQELVDCD     GC+GG   +A+ FI+ N GLTTE NYPY      +C    +A  
Sbjct  173   SLSEQELVDCDTNFDQGCEGGLLDTAYTFILKNGGLTTESNYPYMATDG-ICTTKHSAKS  231

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
                I GY+ VPA +E AL++AVAHQPV + + GG F F+FY  GVF G+C   LDH    
Sbjct  232   DASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQFYSSGVFQGECGYELDH--AV  289

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
                G    D G KYW+IKNSWGT+WGENGYMRI+RD  DK GLCGLA   SYP
Sbjct  290   AIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRDVDDKYGLCGLAMQPSYP  342



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score =   326 bits (835),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 175/338 (52%), Positives = 215/338 (64%), Gaps = 16/338 (5%)
 Frame = +2

Query  110   ILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAG  289
             + G WS    S      SM  R++QWM  +G+VY D  E + RF IF+ NV  IE+ N  
Sbjct  1     MFGAWSCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNND  60

Query  290   PNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANA-TNLPS  466
              NK YKLGVN+FADLTN+EF+      G+ G +         ++K+  F+Y N    +P+
Sbjct  61    VNKPYKLGVNQFADLTNEEFKASR--NGFKGHE--------CSTKTTSFKYENVKAPVPA  110

Query  467   TVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY--  640
              +DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD      
Sbjct  111   AMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQ  170

Query  641   GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNET  820
             GC+GG    AFQFI  N+GL+TE NYPY G     CN  K AS A +I+GYE VPA +E 
Sbjct  171   GCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGS-CNTKKAASIAAKITGYEDVPANSEK  229

Query  821   ALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWV  1000
             AL+ AVAHQPV + I+ G   F+FY  GVF+G C   LDH       G    D G KYW+
Sbjct  230   ALLTAVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDH--GVTAVGYGVSDDGTKYWL  287

Query  1001  IKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             +KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  288   VKNSWGTEWGEEGYIRMQRDVEAKEGLCGIAMEASYPT  325



>emb|CAL64936.1| putative cysteine protease 8 [Trifolium pratense]
Length=344

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 175/348 (50%), Positives = 226/348 (65%), Gaps = 22/348 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLF     LG+++  V S      SM  RH QWM+ +GK+Y D  E + RF IF+ NV 
Sbjct  13    ALLFC----LGLFAIQVTSRTLQDDSMYERHGQWMSQYGKIYKDHQERETRFKIFKENVN  68

Query  266   RIETFN-AGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHF  436
              IETFN A   K YKLG+N+FADLTN+EF         +  +N K +G M +S  ++  F
Sbjct  69    YIETFNNADDTKSYKLGINQFADLTNEEF---------IASRN-KFKGHMCSSIMRTTSF  118

Query  437   RYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQEL  616
             +Y N + +PSTVDWR KGAVTP+K+QG CG CWAF+ VAA EGIHKL TG L+SLSEQEL
Sbjct  119   KYENVSGIPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQEL  178

Query  617   VDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISG  790
             VDCD K    GC+GG    AF+FI+ N+GL+TE  YPY+G     CN  K + +AV I+G
Sbjct  179   VDCDTKGVDQGCEGGLMDDAFKFIIQNHGLSTEAQYPYEGVDG-TCNANKASVQAVTITG  237

Query  791   YERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtt  970
             YE VPA +E AL +AVA+QP+ + I+     F+FY+ GVF+G C   LDH       G  
Sbjct  238   YEDVPANSEQALQKAVANQPISVAIDASGSDFQFYKSGVFTGACGTELDH--GVTAVGYG  295

Query  971   agdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               + G KYW++KNSWGT WGE GY+ +QR     +G+CG+A  ASYPT
Sbjct  296   VSNDGTKYWLVKNSWGTDWGEEGYIMMQRGIEAAEGICGIAMQASYPT  343



>ref|XP_009101555.1| PREDICTED: ervatamin-B-like [Brassica rapa]
 gb|AAD53012.1|AF089849_1 senescence-specific cysteine protease [Brassica napus]
Length=344

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 169/322 (52%), Positives = 209/322 (65%), Gaps = 13/322 (4%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFN-AGPNKGYKLGVNKFADLT  337
             +M+ RH +WM  HG+VY D  E + R+ +F+ NVERIE  N       +KL VN+FADLT
Sbjct  33    AMQKRHAEWMTEHGRVYADANEKNNRYAVFKRNVERIERLNDVQSGLTFKLAVNQFADLT  92

Query  338   NDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATN--LPSTVDWRNKGAVTPIKD  511
             N+EFR +     Y G +   V    S +K   FRY N ++  LP +VDWR KGAVTPIKD
Sbjct  93    NEEFRSM-----YTGFKGNSV--LSSRTKPTSFRYQNVSSDALPVSVDWRKKGAVTPIKD  145

Query  512   QGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSYGCDGGFPISAFQFIVNN  691
             QG CGSCWAF+ VAA+EG+ ++K G L+SLSEQELVDCD    GC GG   +AF + +  
Sbjct  146   QGLCGSCWAFSAVAAIEGVAQIKKGKLISLSEQELVDCDTNDGGCMGGLMDTAFNYTITI  205

Query  692   NGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEING  871
              GLT+E NYPYK   +  CNF KT   A  I G+E VPA +E ALM+AVAH PV + I G
Sbjct  206   GGLTSESNYPYK-STNGTCNFNKTKQIATSIKGFEDVPANDEKALMKAVAHHPVSIGIAG  264

Query  872   GDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRI  1051
             GD  F+FY  GVFSG+C  HLDH       G      G KYW++KNSWG +WGE GYMRI
Sbjct  265   GDIGFQFYSSGVFSGECTTHLDH--GVTAVGYGRSKNGLKYWILKNSWGPKWGERGYMRI  322

Query  1052  QRDYADKKGLCGLAKAASYPTI  1117
             ++D   K G CGLA  ASYPT+
Sbjct  323   KKDIKPKHGQCGLAMNASYPTM  344



>gb|EMT12294.1| Vignain [Aegilops tauschii]
Length=342

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 177/351 (50%), Positives = 218/351 (62%), Gaps = 26/351 (7%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             LLF       V S L A       S+  RH+QWMA +G+VY D  E   R  +F+ NV  
Sbjct  8     LLFTILACACVLSTLAARDLADDRSIVARHEQWMAKYGRVYSDVAEKAQRLEVFKTNVAF  67

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHL-----VGGYVGRQNQKVEGFMSASKSKH  433
             IE+ NAG +K + L  N+FAD+T +EFR  H      VGG  GR+               
Sbjct  68    IESVNAGNDK-FWLEANQFADITENEFRATHTGYKAPVGGNKGRKT-------------G  113

Query  434   FRYANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSE  607
             FRYAN +   LP++VDWR KGAVTPIKDQG CG CWAF+ VA++EGI KL TG L+SLSE
Sbjct  114   FRYANVSLDALPTSVDWRTKGAVTPIKDQGQCGCCWAFSTVASMEGIVKLSTGKLISLSE  173

Query  608   QELVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVR  781
             QELVDCD      GC+GG   +AF+FI++N GLTTE NYPY G     CN  K ++ A  
Sbjct  174   QELVDCDVDGMDQGCEGGLMDNAFEFIIDNGGLTTEGNYPYTGTDGS-CNSNKESNAAAS  232

Query  782   ISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgy  961
             I GYE VPA +E +L +AVA QPV + ++GGD  FRFY+ GV SG C   LDH       
Sbjct  233   IKGYEDVPANDEASLQKAVAAQPVSVAVDGGDNLFRFYKGGVLSGDCGTELDH--GIAAI  290

Query  962   gttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G      G KYWV+KNSWGT WGENG++R++RD  D++GLCGLA   SYPT
Sbjct  291   GYGVASDGTKYWVMKNSWGTSWGENGFIRMERDITDEQGLCGLAMQPSYPT  341



>ref|XP_003612210.1| Cysteine proteinase [Medicago truncatula]
 gb|AES95168.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 174/339 (51%), Positives = 221/339 (65%), Gaps = 18/339 (5%)
 Frame = +2

Query  113   LGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGP  292
             LG+W+  V S      SM  RH++WM ++GKVY D  E + RF IF  N++ IE FN G 
Sbjct  18    LGLWAIQVTSRTLQDGSMHERHERWMNHYGKVYKDHQEREKRFKIFTENMKYIEAFNNGD  77

Query  293   N-KGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFRYANATNLP  463
             N + YKLG+N+FADLTN+EF         V  +N K +G M +S  ++  F+Y N + +P
Sbjct  78    NNESYKLGINQFADLTNEEF---------VASRN-KFKGHMCSSIIRTTTFKYENVSAIP  127

Query  464   STVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY-  640
             STVDWR KGAVTP+K+QG CG CWAF+ VAA EGIHKL TG LVSLSEQELVDCD K   
Sbjct  128   STVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLVSLSEQELVDCDTKGVD  187

Query  641   -GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNE  817
              GC+GG    AF+FI+ N+GL TE  YPY+G     CN  K + +A  I+GYE VPA NE
Sbjct  188   QGCEGGLMDDAFKFIIQNHGLNTEAQYPYQGVD-GTCNANKASIQATTITGYEDVPANNE  246

Query  818   TALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyW  997
              AL +AVA+QP+ + I+     F+FY+ GVF+G C   LDH       G    + G KYW
Sbjct  247   QALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGVSNDGTKYW  304

Query  998   VIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             ++KNSWGT WGE GY+ +QR     +GLCG+A  ASYPT
Sbjct  305   LVKNSWGTDWGEEGYIMMQRGVEAAEGLCGIAMQASYPT  343



>ref|XP_003539770.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 221/353 (63%), Gaps = 15/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MAS+ L         ++ G W++   +      SM  RH+QWMA HGKVY D +E ++R+
Sbjct  1     MASENLFHCTSLALLLLFGFWAFSANTRTLEDASMHERHEQWMAQHGKVYKDHHEKELRY  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF+ NV+ IE FN   NK +KLGVN+FADLT +EF+ ++ + GY+         +   S
Sbjct  61    KIFQQNVKGIEGFNNAGNKSHKLGVNQFADLTEEEFKAINKLKGYM---------WSKIS  111

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQG-NCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             ++  F+Y + T +P+T+DWR KGAVTPIK QG  CGSCWAFA VAA EGI KL TG L+S
Sbjct  112   RTSTFKYEHVTKVPATLDWRQKGAVTPIKSQGLKCGSCWAFAAVAATEGITKLTTGELIS  171

Query  599   LSEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             LSEQEL+DCD    + GC  G    AF+FIV N GL TE +YPY+      CN    +  
Sbjct  172   LSEQELIDCDTNGDNGGCKWGIIQEAFKFIVQNKGLATEASYPYQAVD-GTCNAKVESKH  230

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
                I GYE VPA NETAL+ AVA+QPV + ++  D+ FRFY  GV SG C    DH    
Sbjct  231   VASIKGYEDVPANNETALLNAVANQPVSVLVDSSDYDFRFYSSGVLSGSCGTTFDH--AV  288

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
                G    D G KYW+IKNSWG  WGE GY+RI+RD A K+G+CG+A  ASYP
Sbjct  289   TVVGYGVSDDGTKYWLIKNSWGVYWGEQGYIRIKRDVAAKEGMCGIAMQASYP  341



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 171/343 (50%), Positives = 220/343 (64%), Gaps = 13/343 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L FI  ++L + +    S   Y+ SM  +H QWM   G+VY D  E   RF IF++N E 
Sbjct  9     LAFIALLVLVMQASQATSRGLYETSMVQKHDQWMTRFGRVYKDDVEKAKRFKIFKDNTEY  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             I++FN    K YKL +N+FADLTN+EFR  H   GY     +K     S      F+Y N
Sbjct  69    IDSFNKAGTKPYKLDINEFADLTNEEFRATH--NGYRMPSQKKSPEITS------FKYEN  120

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T  P+T+DWR KGAVT IKDQG CG CWAF+ VAA EGI+K+KTG L+SLSEQELVDCD
Sbjct  121   VT-APATMDWRKKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCD  179

Query  629   RKS-YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
               S  GC+GG    AF+FI+ N+GLTTE NYPY+G     C   K ++ A +I+ YE VP
Sbjct  180   TSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDS-TCKTGKESNHAAKITSYEDVP  238

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A +E+ L++AVA+QPV + I+     F+FY  GVF+G+C   LDH       G      G
Sbjct  239   ANSESDLLKAVANQPVSVAIDASASDFQFYSSGVFTGECGTELDH--GVTAVGYGKASDG  296

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGENGY+R+QR+   ++GLCG+A  ASYPT
Sbjct  297   TKYWLVKNSWGTSWGENGYIRMQRNVDTEEGLCGIAMEASYPT  339



>ref|XP_008779585.1| PREDICTED: zingipain-2-like [Phoenix dactylifera]
Length=326

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 225/338 (67%), Gaps = 15/338 (4%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++LGVW     +       M  RH+QWM  +G+VY+D  E + RF IFR+N E IE+ N 
Sbjct  1     MVLGVWVSGATAHGIADEPMSRRHEQWMVQYGRVYMDAAEKERRFQIFRDNYEYIESVNR  60

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPS  466
               ++ YKLG+N+FAD+TN EF+  HL     G +   +E     SK+  F+YAN T+ P 
Sbjct  61    AGDRKYKLGLNQFADMTNGEFKASHL-----GFKPMPME-----SKTGSFQYANLTDAPH  110

Query  467   TVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SY  640
             ++DWR +GAVT +K+Q +CG CWAF+ VAA+E I ++KTGNLV LSEQ+LVDCD    ++
Sbjct  111   SMDWRTRGAVTAVKNQRSCGCCWAFSSVAAIEAITQIKTGNLVYLSEQQLVDCDANDGNH  170

Query  641   GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNET  820
             GC GGF   AFQ+++NN G+TTE NYPY+      C+  + +S A  I GYE VPA +E+
Sbjct  171   GCHGGFMTGAFQYVINNGGITTENNYPYRANDG-TCDTNRASSSAATIGGYESVPANDES  229

Query  821   ALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWV  1000
             +L+QAV +QPV + I+G    FR Y+ G+F+G C+ +++H       G    + G KYW+
Sbjct  230   SLLQAVTNQPVSVGIDGSGQDFRHYKGGIFTGACETNMNH--AVTAVGYGTAEDGTKYWL  287

Query  1001  IKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             +KNSWGT WGE GYMRIQRD A  +GLCG+AK ASYPT
Sbjct  288   VKNSWGTTWGEMGYMRIQRDVAAPEGLCGIAKLASYPT  325



>ref|XP_010052197.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76117.1| hypothetical protein EUGRSUZ_D00494 [Eucalyptus grandis]
Length=369

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 183/363 (50%), Positives = 225/363 (62%), Gaps = 14/363 (4%)
 Frame = +2

Query  35    LYSTRTHSNMASKILGSSLLFITTIILGVW-SYLVASTFDYQHSMRLRHQQWMAYHGKVY  211
             L ST T S MA +     L   T +++ V+ S  +  T   +H ++ +H+QWMA HG+VY
Sbjct  17    LDSTHT-STMAKQNQLPFLTLATLLVIIVFVSETLCRTLGEEHLLK-QHEQWMAVHGRVY  74

Query  212   VDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQN  391
              D  E   R+ IF+ NV RI  FN   +  YKL VNKFADLTN+EFR      GY  R  
Sbjct  75    KDADEKAKRYEIFKQNVNRINAFNNDKDAAYKLAVNKFADLTNEEFRASFT--GYKRRST  132

Query  392   QKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIH  571
             +     +S+   K F+YAN T  P  +DWR K AVT +KDQ +CG+CWAF+ VAA+EGI 
Sbjct  133   R----VLSSVDEKPFKYANFTAAPPVLDWRTKKAVTSVKDQSSCGACWAFSAVAAMEGIT  188

Query  572   KLKTGNLVSLSEQELVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRV  745
              LK G LVSLSEQELVDCD      GC+GG   SAFQFI +  GLT+E NYPY+G     
Sbjct  189   MLKKGKLVSLSEQELVDCDVNGVNEGCEGGLMDSAFQFIKSKGGLTSEANYPYQGNDG-T  247

Query  746   CNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCK  925
             C   K A+    I+GY+ VPA NE AL+QAVA+QPV + I G  F F+FY  GVF+G C 
Sbjct  248   CRTAKAANIVASITGYQDVPANNEKALLQAVANQPVSVAIEGSGFSFQFYSGGVFTGSCG  307

Query  926   PHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAAS  1105
               LDH       G     GG KYW++KNSWGT WGE+GYMRI+RD   K GLCGLA   S
Sbjct  308   TSLDH--AVTAVGYGTTSGGAKYWLLKNSWGTGWGESGYMRIRRDVTSKAGLCGLAMEPS  365

Query  1106  YPT  1114
             YPT
Sbjct  366   YPT  368



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   325 bits (834),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 171/345 (50%), Positives = 220/345 (64%), Gaps = 16/345 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             + F   ++LG WS    S      SM  R++QW+A +G+VY D  E + RF IF+ NV  
Sbjct  12    MCFGLILMLGAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAF  71

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+ N   NK YKL VN+FADLTN+EF+      G+ G +         ++K+  F+Y N
Sbjct  72    IESSNKDANKPYKLSVNQFADLTNEEFKASR--NGFKGHE--------CSTKTTSFKYKN  121

Query  449   ATN-LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
              T  LP+T+DWR KGAVTP+KDQG CG CWAF+ VAA EG+ +L TG L+SLSEQELVDC
Sbjct  122   VTAALPATMDWRTKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGRLISLSEQELVDC  181

Query  626   DR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D   +  GC+GG    AFQFI  N+G++TE NYPY G     CN  K A  A +I+G+E 
Sbjct  182   DTAGEDQGCEGGLMDDAFQFIQQNHGISTETNYPYNGVDG-TCNTKKEAIIAAKITGFED  240

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA +E AL+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G    +
Sbjct  241   VPANSEKALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSE  298

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSWG  WGE GY+R+QRD A  +GLCG+A +ASYPT
Sbjct  299   DGTKYWLVKNSWGXEWGEXGYIRMQRDVAAAEGLCGIAMSASYPT  343



>ref|XP_003539970.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   325 bits (834),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 222/347 (64%), Gaps = 21/347 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLF     LG W++ V S      SM  RH++WMA + KVY D  E + RF IF+ NV 
Sbjct  13    ALLFC----LGFWAFQVTSRTLQDASMYERHEEWMARYAKVYKDPEEREKRFKIFKENVN  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFR  439
              IE FN   NK YKLG+N+FADLTN+EF         +  +N + +G M +S  ++  F+
Sbjct  69    YIEAFNNAANKPYKLGINQFADLTNEEF---------IAPRN-RFKGHMCSSITRTTTFK  118

Query  440   YANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             Y N T LPSTVDWR KGAVTPIKDQG CG CWAF+ VAA EGIH L +G L+SLSEQE+V
Sbjct  119   YENVTALPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALNSGKLISLSEQEVV  178

Query  620   DCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGY  793
             DCD K    GC GGF   AF+FI+ N+GL TE NYPYK    + CN  + A+ A  I+GY
Sbjct  179   DCDTKGEDQGCAGGFMDGAFKFIIQNHGLNTEANYPYKAVDGK-CNANEAANHAATITGY  237

Query  794   ERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtta  973
             E VP  NE AL +AVA+QPV + I+     F+FY+ GVF+G C   LDH       G   
Sbjct  238   EDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYKTGVFTGSCGTQLDH--GVTAVGYGV  295

Query  974   gdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G +YW++KNSWGT WGE GY+ +QR    ++GLCG+A  ASYPT
Sbjct  296   SADGTQYWLVKNSWGTEWGEEGYIMMQRGVKAQEGLCGIAMMASYPT  342



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   325 bits (834),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 218/339 (64%), Gaps = 16/339 (5%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++LG WS    S      S+  R++QW+  +G+VY D  E + RF IF+ NV  IE+ N 
Sbjct  18    LMLGAWSXGATSRTLQDASIYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIESSNX  77

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANAT-NLP  463
               NK YKL VN+FADLTN+EF+        V R   K  G   ++K+  F+Y N T +LP
Sbjct  78    DANKPYKLSVNQFADLTNEEFK--------VSRNGFK--GHECSTKTTSFKYENVTASLP  127

Query  464   STVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKS--  637
             +T+DWR KGAVTP+KDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD  S  
Sbjct  128   ATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGTLISLSEQELVDCDTASED  187

Query  638   YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNE  817
              GC+GG    AFQFI  N+G+ TE NYPY+G     CN  K AS A +I+G+E VPA +E
Sbjct  188   QGCEGGLMDDAFQFIQQNHGIGTEANYPYEGVDG-TCNSKKEASHAAKITGFEDVPANSE  246

Query  818   TALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyW  997
               L+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G    + G KYW
Sbjct  247   KDLLAAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSEDGTKYW  304

Query  998   VIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             ++KNSWG  WGE GY+R+QRD A  +GLCG+A AASYPT
Sbjct  305   LVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMAASYPT  343



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score =   325 bits (834),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 175/343 (51%), Positives = 217/343 (63%), Gaps = 16/343 (5%)
 Frame = +2

Query  95    FITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIE  274
             F   ++ G WS    S      SM  +++QWM  +G+VY D  E + RF IF+ NV  IE
Sbjct  9     FGLILMFGAWSCEATSRSLQDASMYGKYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIE  68

Query  275   TFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANA-  451
             + N   NK YKLGVN+FADLTN+EF+      G+ G +         ++K+  F+Y N  
Sbjct  69    SSNNDVNKPYKLGVNQFADLTNEEFKASR--NGFKGHE--------CSTKTTSFKYENVK  118

Query  452   TNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR  631
               +P+ +DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD 
Sbjct  119   APVPAAMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDT  178

Query  632   KSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
                  GC+GG    AFQFI  N+GL+TE NYPY G     CN  K AS A +I+GYE VP
Sbjct  179   SGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGS-CNTKKAASIAAKITGYEDVP  237

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A +E AL+ AVAHQPV + I+ G   F+FY  GVF+G C   LDH       G    D G
Sbjct  238   ANSEKALLTAVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDH--GVTAVGYGVSDDG  295

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGE GY+R+QRD   K+GLCG+A  ASYPT
Sbjct  296   TKYWLVKNSWGTEWGEEGYIRMQRDVEAKEGLCGIAMEASYPT  338



>gb|ADV74756.1| cysteine protease [Lactuca sativa]
Length=363

 Score =   326 bits (836),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 170/321 (53%), Positives = 211/321 (66%), Gaps = 12/321 (4%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             +M  RH+QWMA+HG++Y D  E  +RF IF+NNV  I+  NA  ++ Y L VNKFADLTN
Sbjct  50    TMIARHEQWMAHHGRIYTDENEKQLRFQIFKNNVAYIDAHNARSDQSYTLEVNKFADLTN  109

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGN  520
             DEFR      GY     +K     S   S  FRYAN + +P  VDWR +GAVTP+KDQG+
Sbjct  110   DEFRASR--NGY-----KKQPDSDSHVVSGLFRYANVSAVPDEVDWRKEGAVTPVKDQGD  162

Query  521   CGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNN  694
             CG CWAF+ VAA+EGI+KL+ G LVSLSEQELVDCD      GC+GG   +AFQFI    
Sbjct  163   CGCCWAFSAVAAMEGINKLENGKLVSLSEQELVDCDIDGIDQGCEGGLMENAFQFIEKRK  222

Query  695   GLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGG  874
             GL  E  YPY G +  +CN  K A  A +ISG+E+VPA NE AL+QAVA+QPV + I+  
Sbjct  223   GLAAESVYPYTG-EDGICNTKKAAIPAAKISGHEKVPANNEKALLQAVANQPVSIAIDAS  281

Query  875   DFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQ  1054
              + F+FY  GVF+G C   LDH       G  A   G KYW++KNSWG  WGENGY+RI+
Sbjct  282   GYEFQFYSGGVFTGSCGTELDH--AITAVGYGATMDGTKYWLMKNSWGASWGENGYIRIK  339

Query  1055  RDYADKKGLCGLAKAASYPTI  1117
             RD   K+GLCG+A   SYP +
Sbjct  340   RDSLAKEGLCGIAMDPSYPVV  360



>gb|AFW76902.1| hypothetical protein ZEAMMB73_056195 [Zea mays]
Length=340

 Score =   325 bits (833),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 218/350 (62%), Gaps = 18/350 (5%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             L +S+L + +      + L A   +   +M  RH+QWMA + +VY D  E   RF +F+ 
Sbjct  4     LQASILAVLSFAFFCGAALAARDLNEDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKA  63

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHF  436
             NV+ IE+FN G N+ + LG+N+FADLTNDEFR      G+    ++   GF         
Sbjct  64    NVKFIESFNTGGNRKFWLGINQFADLTNDEFRTTKTNKGFKPSLDKVSTGF---------  114

Query  437   RYANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
             RY N +   +P+T+DWR  GAVTPIKDQG CG CWAF+ VAA EGI K+ TG L+SLSEQ
Sbjct  115   RYENVSVDAIPATIDWRTNGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQ  174

Query  611   ELVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELVDCD   +  GC+GG    AF+FI+ N GLTTE NYPY     +       ++ A  I
Sbjct  175   ELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESNYPYTAADGKC---KSGSNSAANI  231

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
              GYE VP  +E ALM+AVA+QPV + ++GGD  F+FY  GV +G C   LDH       G
Sbjct  232   KGYEDVPTNDEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDH--GIAAIG  289

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                   G KYW++KNSWGT WGENGY+R+++D +DKKG+CGLA   SYPT
Sbjct  290   YGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKKGMCGLAMEPSYPT  339



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score =   325 bits (832),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 162/319 (51%), Positives = 216/319 (68%), Gaps = 10/319 (3%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             SM  +H+QWM  +G+ Y D  E   R+ IF+ NVE I++ +   N+ YKL +NKFADLT+
Sbjct  15    SMIEKHEQWMLQYGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAENRTYKLAINKFADLTS  74

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGN  520
             DEF+     G  +G Q+ K     S+ +   FRY N + +P ++DW  KGAVTP+KDQG 
Sbjct  75    DEFKASR-NGFKMGSQSIK-----SSFEVSSFRYGNVSAVPPSIDWTKKGAVTPVKDQGQ  128

Query  521   CGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD-RKSYGCDGGFPISAFQFIVNNNG  697
             CG CWAF+ VAA EG+++LKTG L+SLSEQELVDCD  +  GC+GG   +AF+FI++NNG
Sbjct  129   CGCCWAFSAVAATEGLNQLKTGKLISLSEQELVDCDTSEDQGCNGGLMDNAFEFIISNNG  188

Query  698   LTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGGD  877
             LTTE NYPY+G     CN  K +S   +I+GYE VPA +E+AL++AVA+QP+ + I+   
Sbjct  189   LTTESNYPYEGVDG-TCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASG  247

Query  878   FHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQR  1057
               F+FY  GVFSG+C   LDH       G      G KYW++KNSWG+ WGENGY+R+QR
Sbjct  248   SDFQFYSGGVFSGQCGTELDH--GVTAVGYGVTSDGTKYWLVKNSWGSSWGENGYIRMQR  305

Query  1058  DYADKKGLCGLAKAASYPT  1114
             D    +GLCG+A  ASYPT
Sbjct  306   DIDAAEGLCGIAMQASYPT  324



>ref|XP_006467666.1| PREDICTED: vignain-like [Citrus sinensis]
 gb|KDO77831.1| hypothetical protein CISIN_1g042468mg [Citrus sinensis]
Length=346

 Score =   325 bits (834),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 226/354 (64%), Gaps = 12/354 (3%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA  +L + L+    ++LGVW+    S      +M  RH+ WMA +G+VY D  E +MRF
Sbjct  1     MAMILLENKLVLAAILVLGVWAPQSWSRTLNDATMNERHEMWMAQYGRVYRDNAEKEMRF  60

Query  242   NIFRNNVERIETFN-AGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSA  418
              IF+ NVE I +FN    NK YKLG+N+FAD TN+EFR      GY  R+   V    S 
Sbjct  61    KIFKENVEYIASFNNKARNKPYKLGINEFADQTNEEFRAPR--NGY-KRRLPSVRS--SE  115

Query  419   SKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             +    FRY NA+ +P+++DWR KGAVT +KDQG CG CWAF+ VAA+EGI+ + T  L S
Sbjct  116   TTDVSFRYENAS-VPASIDWRKKGAVTGVKDQGQCGCCWAFSAVAAMEGINHITTRKLTS  174

Query  599   LSEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             LSEQELVDCD   +  GC+GG    AF+FI++N GL TE  YPYK      CN  +    
Sbjct  175   LSEQELVDCDTSGEDQGCEGGLMDDAFEFIISNKGLATEAKYPYKASDGS-CNKKEANPS  233

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
             A +ISGYE VP+ NE ALM+AVA+QPV + I+     F+FY  GVF+G+C   LDH    
Sbjct  234   AAKISGYEDVPSNNEAALMKAVANQPVSVAIDASGSDFQFYSSGVFTGQCGTELDH--GV  291

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G    D G KYW++KNSWGT WGENGY+R+QRD   K+GLCG+A  ASYPT
Sbjct  292   TAVGYGTADDGTKYWLVKNSWGTTWGENGYIRMQRDIDAKEGLCGIAMQASYPT  345



>ref|XP_004975180.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   325 bits (833),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 169/332 (51%), Positives = 213/332 (64%), Gaps = 18/332 (5%)
 Frame = +2

Query  131   LVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKL  310
             L A       +M  RH+QWMA HG++Y D  E   RF +F+ NV+ IETFNA  N+ + L
Sbjct  22    LAARELSDDSAMVARHEQWMAQHGRLYKDDAEKARRFEVFKTNVKFIETFNAAGNRKFWL  81

Query  311   GVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATN--LPSTVDWRN  484
             GVN+FADLTNDEFR      G+     +   GF         RYAN +   LP+TVDWR 
Sbjct  82    GVNQFADLTNDEFRATKTNKGFNPNAVKVPTGF---------RYANVSTDALPATVDWRT  132

Query  485   KGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD--RKSYGCDGGF  658
             KGAVTPIKDQG CG CWAF+ VAA+EGI K+ TG L+SLSEQELVDCD   +  GC+GG 
Sbjct  133   KGAVTPIKDQGQCGCCWAFSAVAAMEGIVKISTGKLISLSEQELVDCDVHGEDQGCNGGE  192

Query  659   PISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAV  838
                AF FI+ N GLTTE +YPY  +  +       ++ A  I GYE VPA +E ALM+AV
Sbjct  193   MDDAFTFIIKNGGLTTESSYPYAAQDGQC---KAGSNSAATIKGYEDVPANDEAALMKAV  249

Query  839   AHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWG  1018
             A+QPV + ++GGD  F+FY  GV +G C   LDH       G      G KYW++KNSWG
Sbjct  250   ANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDH--GIAAIGYGTASDGTKYWLLKNSWG  307

Query  1019  TRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             T WGENG++R+++D +DK+G+CGLA   SYPT
Sbjct  308   TTWGENGFLRMEKDISDKRGMCGLAMQPSYPT  339



>gb|AAP32196.1| cysteine protease 8 [Trifolium repens]
Length=343

 Score =   325 bits (833),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 171/338 (51%), Positives = 219/338 (65%), Gaps = 17/338 (5%)
 Frame = +2

Query  113   LGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGP  292
             LG+++  V S      SM  RH QWM+ +GK+Y D  E + RF IF  NV  +E  NA  
Sbjct  18    LGLFAIQVTSRTLQDDSMYERHGQWMSQYGKIYKDHQERETRFKIFTENVNYVEASNADD  77

Query  293   NKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFRYANATNLPS  466
              K YKLG+N+FADLTN+EF         V  +N K +G M +S  ++  F+Y N + +PS
Sbjct  78    TKSYKLGINQFADLTNEEF---------VASRN-KFKGHMCSSITRTTTFKYENVSAIPS  127

Query  467   TVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY--  640
             TVDWR KGAVTP+K+QG CG CWAF+ VAA EGIHKL TG L+SLSEQELVDCD K    
Sbjct  128   TVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQ  187

Query  641   GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNET  820
             GC+GG    AF+FI+ N+GL+TE  YPY+G     CN  K + +AV I+GYE VPA +E 
Sbjct  188   GCEGGLMDDAFKFIIQNHGLSTEAQYPYEGVDG-TCNANKASVQAVTITGYEDVPANSEQ  246

Query  821   ALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWV  1000
             AL +AVA+QP+ + I+     F+FY+ GVF+G C   LDH       G    + G KYW+
Sbjct  247   ALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGVSNDGTKYWL  304

Query  1001  IKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             +KNSWGT WGE GY+ +QR     +GLCG+A  ASYPT
Sbjct  305   VKNSWGTDWGEEGYIMMQRGVEAAEGLCGIAMQASYPT  342



>ref|XP_004489011.1| PREDICTED: vignain-like [Cicer arietinum]
Length=343

 Score =   325 bits (833),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 169/344 (49%), Positives = 218/344 (63%), Gaps = 17/344 (5%)
 Frame = +2

Query  95    FITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIE  274
             F   + LG+W++   S      SM  RH+QWM  +GKVY +  E + RF IF+ NV  IE
Sbjct  12    FTFVLCLGLWAFQATSRNLQDDSMHERHEQWMGQYGKVYKNAKEREKRFGIFKENVNYIE  71

Query  275   TFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFM--SASKSKHFRYAN  448
               N+  NK YKLG+N+FADLTN EF         V  +N K   ++  S++K+  F+Y N
Sbjct  72    VSNSVGNKSYKLGINEFADLTNHEF---------VASRN-KFNAYLDGSSTKTTTFKYHN  121

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              + +PSTVDWR +GAVTP+KDQG CG CWAF+ VA+ EGIHKL TGNLVSLSEQELVDCD
Sbjct  122   VSAVPSTVDWRLEGAVTPVKDQGQCGCCWAFSAVASTEGIHKLSTGNLVSLSEQELVDCD  181

Query  629   R--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
                +  GC+GG    AF+FI+ NNGL TE  YPY+G     CN  +  +    ISGYE V
Sbjct  182   TSGEDQGCEGGLMDDAFKFIIQNNGLNTEAEYPYQGVD-GTCNTNEEGNHVATISGYEDV  240

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E AL +AVA+QP+ + I+     F+FY  GVF+G C   LDH       G    + 
Sbjct  241   PANDELALQKAVANQPISVAIDASGSDFQFYSSGVFTGSCGTELDH--GVAVVGYGVSED  298

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               +YW++KNSWG +WGE GY+R+QR     +GLCG+A  ASYPT
Sbjct  299   EIEYWLVKNSWGIKWGEEGYIRMQRGVDALEGLCGIAMQASYPT  342



>ref|XP_003539989.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   325 bits (833),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 222/347 (64%), Gaps = 21/347 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLF     LG W++ V S      SM  RH++WMA + KVY D  E + RF IF+ NV 
Sbjct  13    ALLFC----LGFWAFQVTSRTLQDASMYERHEEWMARYAKVYKDPEEREKRFKIFKENVN  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFR  439
              IE FN   +K YKLG+N+FADLTN+EF         +  +N K +G M +S  ++  F+
Sbjct  69    YIEAFNNAADKPYKLGINQFADLTNEEF---------IAPRN-KFKGHMCSSITRTTTFK  118

Query  440   YANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             Y N T LPSTVDWR KGAVTPIKDQG CG CWAF+ VAA EGIH L +G L+SLSEQE+V
Sbjct  119   YENVTALPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALNSGKLISLSEQEVV  178

Query  620   DCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGY  793
             DCD K    GC GGF   AF+FI+ N+GL TE NYPYK    + CN  + A+ A  I+GY
Sbjct  179   DCDTKGEDQGCAGGFMDGAFKFIIQNHGLNTEANYPYKAVDGK-CNANEAANHAATITGY  237

Query  794   ERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtta  973
             E VP  NE AL +AVA+QPV + I+     F+FY+ GVF+G C   LDH       G   
Sbjct  238   EDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYKTGVFTGSCGTQLDH--GVTAVGYGV  295

Query  974   gdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G +YW++KNSWGT WGE GY+ +QR    ++GLCG+A  ASYPT
Sbjct  296   SADGTQYWLVKNSWGTEWGEEGYIMMQRGVKAQEGLCGIAMMASYPT  342



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 216/339 (64%), Gaps = 16/339 (5%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++LG WS    S       M  R++QW+  +G+VY D  E + RF IF+ NV  IE+ N 
Sbjct  7     LMLGTWSSGATSRTLQDAPMYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIESSNK  66

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANAT-NLP  463
               NK YKL VN+FADLTN+EF+                +G   ++K+  F+Y N T +LP
Sbjct  67    YANKPYKLSVNQFADLTNEEFKA----------SKNGFKGHECSTKTTSFKYENVTASLP  116

Query  464   STVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR--KS  637
             +T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD   + 
Sbjct  117   ATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLMSLSEQELVDCDTAGED  176

Query  638   YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNE  817
              GC+GG    AFQFI  N+G++TE NYPY+G     CN  K  S A +I+G+E VPA +E
Sbjct  177   QGCEGGLMDDAFQFIQQNHGISTEANYPYEGVDG-TCNTKKETSHAAKITGFEDVPANSE  235

Query  818   TALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyW  997
              AL+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G    + G KYW
Sbjct  236   KALLAAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSEDGTKYW  293

Query  998   VIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             ++KNSWG  WGE GY+R+QRD A  +GLCG+A AASYPT
Sbjct  294   LVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMAASYPT  332



>ref|XP_006582263.1| PREDICTED: vignain-like [Glycine max]
Length=338

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/341 (49%), Positives = 215/341 (63%), Gaps = 13/341 (4%)
 Frame = +2

Query  92    LFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERI  271
             +    ++L + +  V S   ++ SM  RH+QWM  +GKVY D  E   R  IF++NVE I
Sbjct  10    ILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDNVEFI  69

Query  272   ETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANA  451
             E+FNA  NK YKL +N  AD TN+EF   H    Y G  +Q             F+Y N 
Sbjct  70    ESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKYKGSHSQT-----------PFKYGNV  118

Query  452   TNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR  631
             T++P+ VDWR  GAVT +KDQG CGSCWAF+ VAA EGI+++ TG L+SLSEQELVDCD 
Sbjct  119   TDIPTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCDS  178

Query  632   KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAK  811
               +GCDGG     F+FI+ N G+++E NYPY       C+  K AS A +I GYE VPA 
Sbjct  179   VDHGCDGGLMEDGFEFIIKNGGISSEANYPYTAVD-GTCDASKEASPAAQIKGYETVPAN  237

Query  812   NETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkk  991
             +E AL QAVA+QPV + I+ G   F+FY  GVF+G+C   LDH    V    T  DG  +
Sbjct  238   SEEALQQAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDH-GVTVVGYGTTDDGTHE  296

Query  992   yWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             YW++KNSWGT+WGE GY+R+QR     +GLCG+A  ASYPT
Sbjct  297   YWIVKNSWGTQWGEEGYIRMQRGIDALEGLCGIAMDASYPT  337



>ref|XP_004974538.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 214/351 (61%), Gaps = 26/351 (7%)
 Frame = +2

Query  74    ILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             ILG + LF           L A       +M  RH+QWMA + +VY D  E   RF +F+
Sbjct  11    ILGCAFLFSGA--------LAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFK  62

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              NV+ IE+FNA  N+ + LGVN+FADLTNDEFR      G+     +   GF        
Sbjct  63    ANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKPSPMKVPTGF--------  114

Query  434   FRYANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSE  607
              RY N +   LP+T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI K+ TG L+SLSE
Sbjct  115   -RYENVSIDALPATIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSE  173

Query  608   QELVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVR  781
             QELVDCD   +  GC+GG    AF+FI+ N GLTTE  YPY     +       ++ A  
Sbjct  174   QELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESGYPYTAADDKC---KSGSNSAAT  230

Query  782   ISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgy  961
             I GYE VPA NE ALM+AVA+QPV + ++GGD  F+FY  GV +G C   LDH       
Sbjct  231   IKGYEDVPANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDH--GIAAI  288

Query  962   gttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G      G  YW++KNSWGT WGENGY+R+++D +DK+G+CGLA   SYPT
Sbjct  289   GYGKASDGTNYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 221/338 (65%), Gaps = 15/338 (4%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++LGVW     +       M  RH+QWMA +G+VY D  E + RF IFR N E IE+ N 
Sbjct  1     MVLGVWVSGAMARGIADEPMLRRHEQWMAQYGRVYKDAAEKERRFQIFRGNYEYIESINR  60

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPS  466
               ++ YKLG+N+FAD+TN+EF+   L     G +    E     S +  F+YAN ++ P 
Sbjct  61    AGDRKYKLGLNQFADMTNEEFKASRL-----GFKPMPTE-----STTGSFQYANLSDAPD  110

Query  467   TVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SY  640
             ++DWR KGAVT +K+Q +CG CWAF+ VAA+E I ++KTGNLVSLSEQ+LVDCD    + 
Sbjct  111   SMDWRTKGAVTAVKNQRSCGCCWAFSSVAAIEAITEIKTGNLVSLSEQQLVDCDTNDGNK  170

Query  641   GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNET  820
             GCDGG    AFQ++++N G+TTE+NYPYK      C+  + +S A  ISGYE VPA +E+
Sbjct  171   GCDGGLMTRAFQYVIDNGGITTEDNYPYKAADG-TCDTNRASSSAATISGYETVPANDES  229

Query  821   ALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWV  1000
             +L+QAVA+QPV + I+G    F+ Y  G+F+G C+  + H       G    + G KYW+
Sbjct  230   SLLQAVANQPVSVGIDGSGPDFQHYSSGIFTGPCETEMTH--AVTAVGYGTAEDGTKYWL  287

Query  1001  IKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             +KNSWGT WGE GYMRIQRD    +GLCG+AK ASYPT
Sbjct  288   VKNSWGTTWGEMGYMRIQRDVGAPEGLCGIAKLASYPT  325



>ref|XP_003607647.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89844.1| papain family cysteine protease [Medicago truncatula]
Length=340

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/320 (51%), Positives = 214/320 (67%), Gaps = 17/320 (5%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             S++ RH+QWM+ +GK+Y D  E + RF IF++NVE IE+FNA  NK YKL VN  ADLT 
Sbjct  35    SLQERHEQWMSEYGKLYKDAIEKEKRFMIFKDNVEFIESFNAADNKPYKLSVNHLADLTL  94

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGN  520
             DEF+      GY     +K++   + +    F+Y N T +P  VDWR KGAVTPIKDQG 
Sbjct  95    DEFKASR--NGY-----KKIDREFATT---SFKYENVTAIPEAVDWRVKGAVTPIKDQGQ  144

Query  521   CGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNN  694
             CGSCWAF+ VAA+EGI+++ TG L+SLSEQELVDCD K    GC+GG     F+FI+ N 
Sbjct  145   CGSCWAFSTVAAIEGINQITTGKLISLSEQELVDCDTKGEDQGCEGGLMEDGFEFIIKNG  204

Query  695   GLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGG  874
             G+T+E NYPYK      CN   TA  A +I+GYE+VP  +E +L++AVA+QP+ + I+  
Sbjct  205   GITSETNYPYKAADGS-CNTATTAPVA-KITGYEKVPVNSEISLLKAVANQPISVSIDAS  262

Query  875   DFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQ  1054
             D  F FY  G+++G+C   LDH    V         G  YW++KNSWGT WGE GY+R+Q
Sbjct  263   DSSFMFYSSGIYTGECGTELDH---GVTAVGYGSANGTDYWIVKNSWGTVWGEKGYIRMQ  319

Query  1055  RDYADKKGLCGLAKAASYPT  1114
             R  ADK+GLCG+A  +SYPT
Sbjct  320   RGIADKEGLCGIAMDSSYPT  339



>ref|XP_003605890.1| Cysteine proteinase [Medicago truncatula]
 gb|AES88087.1| papain family cysteine protease [Medicago truncatula]
Length=343

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/325 (53%), Positives = 211/325 (65%), Gaps = 18/325 (6%)
 Frame = +2

Query  155   QHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPN-KGYKLGVNKFAD  331
             Q  M  RH+QWM+ +GKVY D+ E + RF IF  NV  IE FN G N K Y LGVN+FAD
Sbjct  31    QDDMYERHRQWMSQYGKVYKDSQEREKRFKIFTENVNYIEAFNKGDNNKLYTLGVNQFAD  90

Query  332   LTNDEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFRYANATNLPSTVDWRNKGAVTPI  505
             LTNDEF               K +G M +S  ++  F+Y NA+ +PS+VDWR KGAVTP+
Sbjct  91    LTNDEFTS----------SRNKFKGHMCSSITRTSTFKYENASAIPSSVDWRKKGAVTPV  140

Query  506   KDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQF  679
             K+QG CG CWAF+ VAA EGIHKL TG L+SLSEQELVDCD K    GC+GG    AF+F
Sbjct  141   KNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKF  200

Query  680   IVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLL  859
             I+ N+GL TE NYPY+G     CN  K +  AV I+GYE VP  NE AL +AVA+QP+ +
Sbjct  201   IIQNHGLNTEANYPYQGVDG-TCNANKGSINAVTITGYEDVPTNNEQALQKAVANQPISV  259

Query  860   EINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENG  1039
              I+     F+FY+ GVF+G C   LDH       G    + G KYW++KNSWGT WGE G
Sbjct  260   AIDASGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGVSNDGTKYWLVKNSWGTEWGEEG  317

Query  1040  YMRIQRDYADKKGLCGLAKAASYPT  1114
             Y+ +QR     +GLCG+A  ASYPT
Sbjct  318   YIMMQRGVDAAEGLCGIAMQASYPT  342



>ref|XP_004973089.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 214/351 (61%), Gaps = 26/351 (7%)
 Frame = +2

Query  74    ILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             ILG + LF           L A T     +M  RH+QWMA + +VY D  E   RF +F+
Sbjct  11    ILGCAFLFSGA--------LAARTLSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFK  62

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              NV+ IE+FNA  N+ + LGVN+FADLTNDEFR      G+     +   GF        
Sbjct  63    ANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKPSPMKVPTGF--------  114

Query  434   FRYANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSE  607
              RY N +   LP+T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI K+ TG L+SLSE
Sbjct  115   -RYENVSIDALPATIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSE  173

Query  608   QELVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVR  781
             QELVDCD   +  GC+GG    AF+FI+ N GLTTE  YPY     +       ++ A  
Sbjct  174   QELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKC---KSGSNSAAT  230

Query  782   ISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgy  961
             I  YE VPA NE ALM+AVA+QPV + ++GGD  F+FY  GV +G C   LDH       
Sbjct  231   IKSYEDVPANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDH--GIAAI  288

Query  962   gttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G      G  YW++KNSWGT WGENGY+R+++D +DK+G+CGLA   SYPT
Sbjct  289   GYGKASDGTNYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>gb|KHN32069.1| Vignain [Glycine soja]
Length=333

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/328 (52%), Positives = 214/328 (65%), Gaps = 22/328 (7%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             SM  RH+QWM  +GKVY D  E + RF IF+ NV  IE FN   NK YKL +N+FADLTN
Sbjct  17    SMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADLTN  76

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFRYANATNLPSTVDWRNKGAVTPIKDQ  514
             +EF         +  +N + +G M +S  ++  F+Y N T +PSTVDWR KGAVTPIKDQ
Sbjct  77    EEF---------IAPRN-RFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQ  126

Query  515   GNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVN  688
             G CG CWAF+ VAA EGIH L +G L+SLSEQELVDCD K    GC+GG    AF+F++ 
Sbjct  127   GQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQ  186

Query  689   NNGLTTEENYPYKG--KQHRVCNFM----KTASKAVRISGYERVPAKNETALMQAVAHQP  850
             N+GL TE NYPYKG     R C +     + A+ A  I+GYE VPA NE AL +AVA+QP
Sbjct  187   NHGLNTEANYPYKGVDGNQRCCYYYWVLNEAANDAATITGYEDVPANNEKALQKAVANQP  246

Query  851   VLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWG  1030
             V + I+     F+FY+ GVF+G C   LDH       G    + G +YW++KNSWGT WG
Sbjct  247   VSVAIDASGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGVSNDGTEYWLVKNSWGTEWG  304

Query  1031  ENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             E GY+R+QR    ++GLCG+A  ASYPT
Sbjct  305   EEGYIRMQRGVNSEEGLCGIAMQASYPT  332



>emb|CAH66275.1| OSIGBa0147O06.5 [Oryza sativa Indica Group]
Length=339

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/350 (49%), Positives = 222/350 (63%), Gaps = 18/350 (5%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWS-YLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             +  +LLF     L + S  L A       +M  RH++WMA +G++Y D  E   RF +F+
Sbjct  3     MAKALLFAILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFK  62

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              NV  IE+FNAG +K + LGVN+FADLTNDEFR      G++    +   GF        
Sbjct  63    ANVAFIESFNAGNHK-FWLGVNQFADLTNDEFRSTKTNKGFIPSTTRVPTGF-------R  114

Query  434   FRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             +   N   LP+T+DWR KG VTPIKDQG CG CWAF+ VAA+EGI KL TG L+SLSEQE
Sbjct  115   YENVNIDALPATMDWRTKGVVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQE  174

Query  614   LVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAV-RI  784
             LVDCD   +  GC+GG    AF+FI+ N GLTTE NYPY     +     K+ S +V  I
Sbjct  175   LVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESNYPYAAADDKC----KSVSNSVASI  230

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
              GYE VPA NE ALM+AVA+QPV + ++GGD  F+FY+ GV +G C   LDH    V  G
Sbjct  231   KGYEDVPANNEAALMKAVANQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDH--GIVAIG  288

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                   G KYW++KNSWGT WGENG++R+++D +DK+G+CGLA   SYPT
Sbjct  289   YGKASDGTKYWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPT  338



>ref|XP_006652104.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=342

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/326 (52%), Positives = 211/326 (65%), Gaps = 17/326 (5%)
 Frame = +2

Query  149   DYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFA  328
             D   +M  RH++WMA +G+VY D  E   RF +F+ NV  IE+FN G  + + LGVN+FA
Sbjct  29    DDDAAMAARHERWMAQYGRVYKDAAEKARRFEVFKANVAFIESFNGGGGRKFWLGVNQFA  88

Query  329   DLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANAT--NLPSTVDWRNKGAVTP  502
             DLTN EFR  +   G++    +   GF         RY N +   LP+TVDWR KGAVTP
Sbjct  89    DLTNYEFRATNTNKGFIPSTVRVPTGF---------RYENVSIDALPATVDWRTKGAVTP  139

Query  503   IKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD--RKSYGCDGGFPISAFQ  676
             IKDQG CG CWAF+ VAA+EGI KL TG L+SLSEQELVDCD   +  GC+GG    AF+
Sbjct  140   IKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGEDQGCEGGLMDDAFK  199

Query  677   FIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVL  856
             FIVNN GLTTE NYPY     +      + S A  I GYE VPA +E ALM+AVA QPV 
Sbjct  200   FIVNNGGLTTESNYPYTAADGKCKG--GSGSAAATIKGYEDVPANDEAALMKAVASQPVS  257

Query  857   LEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGEN  1036
             + ++GGD  F+FY  GV SG C   LDH    V  G      G KYW++KNSWGT WGEN
Sbjct  258   VAVDGGDMTFQFYSGGVMSGSCGTDLDH--GIVAIGYGTAGDGTKYWLLKNSWGTTWGEN  315

Query  1037  GYMRIQRDYADKKGLCGLAKAASYPT  1114
             G++R+++D +DK+G+CGLA   SYPT
Sbjct  316   GFLRMEKDISDKRGMCGLAMEPSYPT  341



>ref|XP_003596314.1| Cysteine proteinase [Medicago truncatula]
 gb|AES66565.1| papain family cysteine protease [Medicago truncatula]
Length=341

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/344 (49%), Positives = 214/344 (62%), Gaps = 15/344 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             + F   + LG+ S+   S       M   H+QWM  HGKVY   +E   RF IF+ NV  
Sbjct  10    IPFALFLCLGLLSFQATSRTLQNDPMYEMHEQWMVQHGKVYKAAHEKQKRFGIFKENVNY  69

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE FN   NK YKLG+N FADLTN EF         +  +N K  G++  S    F+Y N
Sbjct  70    IEAFNNVGNKSYKLGLNHFADLTNHEF---------IAARN-KFNGYLHGSIITTFKYKN  119

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              +++PS VDWR +GAVTP+K+QG CG CWAF+ VA+ EGIHKL TGNLVSLSEQELVDCD
Sbjct  120   VSDVPSAVDWRQEGAVTPVKNQGQCGCCWAFSAVASTEGIHKLTTGNLVSLSEQELVDCD  179

Query  629   R--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
                +  GC+GG    AF+FI+ NNGL+TE  YPY+G     CN  +  S A  ISGYE V
Sbjct  180   TNGEDQGCEGGLMDDAFEFIIQNNGLSTEAEYPYQGVD-GTCNKTEVGSSAATISGYENV  238

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             P  +E AL +AVA+QPV + I+     F+FY+ GVF+G C   LDH       G   G+ 
Sbjct  239   PVNDEQALQKAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDH--GVAVVGYGVGED  296

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               +YW++KNSWGT+WGE GY+R+QR     +GLCG+A   SYPT
Sbjct  297   ETEYWLVKNSWGTQWGEEGYIRMQRGVDASEGLCGIAMQPSYPT  340



>ref|XP_003526207.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 210/323 (65%), Gaps = 19/323 (6%)
 Frame = +2

Query  152   YQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFAD  331
             ++ SMR RH+QWM  +GKVY D  E D RF IF++NVE IE+FNA  NK YKLGVN  AD
Sbjct  30    HETSMRERHEQWMTEYGKVYKDAAEKDKRFQIFKDNVEFIESFNADGNKPYKLGVNHLAD  89

Query  332   LTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKD  511
             LT +EF+          R   K     S +    F+Y N T +P+ +DWR KGAVTPIKD
Sbjct  90    LTVEEFK--------ASRNGFKRPHEFSTTT---FKYENVTAIPAAIDWRTKGAVTPIKD  138

Query  512   QGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY--GCDGGFPISAFQFIV  685
             QG CGSCWAF+ +AA EGIH++ TG LVSLSEQELVDCD K    GC+GG+    F+FI+
Sbjct  139   QGQCGSCWAFSTIAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGYMEDGFEFII  198

Query  686   NNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEI  865
              N G+T+E NYPYK    + CN  K  S   +I GYE+VP  +ETAL +AVA+QPV + I
Sbjct  199   KNGGITSETNYPYKAVDGK-CN--KATSPVAQIKGYEKVPPNSETALQKAVANQPVSVSI  255

Query  866   NGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYM  1045
             +     F FY  G+++G+C   LDH    V         G  YW++KNSWGT+WGE GY+
Sbjct  256   DADGAGFMFYSSGIYNGECGTELDH---GVTAVGYGTANGTDYWIVKNSWGTQWGEKGYV  312

Query  1046  RIQRDYADKKGLCGLAKAASYPT  1114
             R+QR  A K GLCG+A  +SYPT
Sbjct  313   RMQRGIAAKHGLCGIALDSSYPT  335



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 222/343 (65%), Gaps = 13/343 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L F+  ++LG+ +    S   Y+ SM  +H+QWM + G+VY D  E   RFNIF++N + 
Sbjct  9     LAFVALLVLGMQASQATSRGLYETSMVQKHEQWMTHFGRVYKDDVEKAKRFNIFKDNTKY  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             I + N    K YKL +N+FADLTN+EFR          R   K+     + +   F+Y N
Sbjct  69    INSVNKAGIKPYKLDINEFADLTNEEFRAT--------RNGYKMPSQKKSPEITSFKYEN  120

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T  P+T+DWR KGAVT IK+QG CG CWAF+ VAA EGI+K+KTG L+SLSEQELVDCD
Sbjct  121   VT-APATMDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCD  179

Query  629   RKS-YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
               S  GC+GG    AF+FI+ N+GLTTE NYPY+G     C   K +S A +I+ YE VP
Sbjct  180   TSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDG-TCKTGKESSHAAKITSYEDVP  238

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A +E+AL++AVA+QPV + I+     F+FY  GVF+G+C   LDH       G      G
Sbjct  239   ANSESALLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDH--GVTAVGYGEASDG  296

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGENGY+R+QR+   ++GLCG+A  ASYPT
Sbjct  297   TKYWLVKNSWGTSWGENGYIRMQRNVDTEEGLCGIAMEASYPT  339



>ref|XP_010239696.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=341

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 223/355 (63%), Gaps = 19/355 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MAS+ LG  L+ I      V S L A       SM  RH+QWMA +G+VY D  E   R 
Sbjct  1     MASRSLGF-LIAILACTCAV-SALAARDLTDDLSMVARHEQWMAKYGRVYNDVAEKAQRL  58

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              +F+ NV  IE  NAG +K + L  N+FAD+T DEFR  H   GY      K        
Sbjct  59    EVFKANVAFIELVNAGNDK-FSLEANQFADMTVDEFRAAHT--GYKPVPANK-------G  108

Query  422   KSKHFRYANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
             ++  F+YAN +   LP+++DWR KGAVTPIKDQG CG CWAF+ VA+VEGI KL TG L+
Sbjct  109   RTTQFKYANVSLDALPASMDWRAKGAVTPIKDQGQCGCCWAFSTVASVEGIVKLSTGKLI  168

Query  596   SLSEQELVDCDRKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTAS  769
             SLSEQELVDCD      GC+GG   +AF+FI++N GLTTE NYPY G     CN  K ++
Sbjct  169   SLSEQELVDCDVDGMDQGCEGGLMDNAFEFIIDNGGLTTEGNYPYTGTDDS-CNSNKESN  227

Query  770   KAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvt  949
                 I GYE VP+ +ET+L++AVA QPV + ++GGD  FRFY+ GV SG C   LDH   
Sbjct  228   DVASIKGYEDVPSNDETSLLKAVAAQPVSIAVDGGDNLFRFYKGGVLSGACGTELDH--G  285

Query  950   avgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 G      G K+W++KNSWGT WGE G++R++RD AD++GLCGLA   SYPT
Sbjct  286   IAAVGYGITSDGTKFWLMKNSWGTSWGEKGFIRMERDIADEEGLCGLAMQPSYPT  340



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/343 (50%), Positives = 224/343 (65%), Gaps = 13/343 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L F+  ++LG+ +    S   Y+ S+  +H+QWMA  G+VY D  E   RF IF++N E 
Sbjct  9     LAFVALLVLGMQASQATSRGLYETSIVKKHEQWMARFGRVYKDDVEKAKRFKIFKDNTEY  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             I++ N    K YKL VN+F+DLTN+EFR  H   GY     +K     S      F+Y N
Sbjct  69    IDSVNMAGIKPYKLDVNEFSDLTNEEFRATH--NGYRMPSQKKYPEITS------FKYEN  120

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T  P+T+DWR KGAVT IK+QG CG CWAF+ VAA EGI+K+KTG L+SLSEQELVDCD
Sbjct  121   VT-APATMDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCD  179

Query  629   RKS-YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
               S  GC+GG    AF+FI+ N+GLTTE NYPY+G  +  C   K ++ A +I+ YE VP
Sbjct  180   TSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDN-TCKTGKESNHAAKITSYEDVP  238

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             A +E+AL++AVA+QPV + I+     F+FY  GVF+G+C   LDH       G      G
Sbjct  239   ANSESALLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDH--GVTAVGYGEASDG  296

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGENGY+R+QR+   ++GLCG+A  ASYPT
Sbjct  297   TKYWLVKNSWGTSWGENGYIRMQRNVDTEEGLCGIAMEASYPT  339



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 215/339 (63%), Gaps = 17/339 (5%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++LG WS    S       M  R++QW+  +G++Y D  E + RF IF+ NV  IE+ N 
Sbjct  18    LMLGAWSSGATSRTLQDARMYGRYEQWLTRYGRIYNDVNEKETRFKIFKENVAFIESSNK  77

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANAT-NLP  463
               NK Y+L VN+FADLTN+EF+      G+ G +          S    F+Y N T +LP
Sbjct  78    DANKPYRLSVNQFADLTNEEFKTSR--NGFKGHE---------CSTKTSFKYENLTASLP  126

Query  464   STVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR--KS  637
             +T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD   + 
Sbjct  127   ATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGED  186

Query  638   YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNE  817
              GC+GG    AFQFI  N G++TE NYPY G     CN  K AS+A +I+G+E VPA +E
Sbjct  187   QGCEGGLMDDAFQFIQQNRGISTEANYPYDGVDG-TCNAKKEASRAAKITGFEDVPANSE  245

Query  818   TALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyW  997
              AL+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G    + G KYW
Sbjct  246   KALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSEDGTKYW  303

Query  998   VIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             ++KNSWG  WGE GY+R+QRD A  +GLCG+A AASYPT
Sbjct  304   LVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMAASYPT  342



>ref|XP_008659446.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=340

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 216/350 (62%), Gaps = 18/350 (5%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             L +S+  I        + + A        M  RH+QWMA + +VY D  E   RF +F+ 
Sbjct  4     LKASISAIIGFAFFCGAAMAARDLSDDSVMVARHEQWMAQYSRVYKDASEKARRFEVFKA  63

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHF  436
             NV+ IE+FNAG N  + LGVN+FADLTNDEFR      G +   N K+           F
Sbjct  64    NVQFIESFNAGGNNKFWLGVNQFADLTNDEFRSTKTNKG-LKSSNMKI--------PTGF  114

Query  437   RYAN--ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
             RY N  A  LP+T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI K+ TG LVSL+EQ
Sbjct  115   RYENVSADALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLVSLAEQ  174

Query  611   ELVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELVDCD   +  GC+GG    AF+FI+ N GLTTE +YPY     +       ++ A  I
Sbjct  175   ELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESSYPYTAADGKC---KSGSNSAATI  231

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
              GYE VPA +E ALM+AVA+QPV + ++GGD  F+FY  GV +G C   LDH       G
Sbjct  232   KGYEDVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDH--GIAAIG  289

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                   G KYW++KNSWGT WGENGY+R+++D +DK+G+CGLA   SYPT
Sbjct  290   YGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 223/352 (63%), Gaps = 13/352 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MAS      + F   ++L ++     S   Y+ S+  +H+QWM+  G+VY D  E   RF
Sbjct  1     MASLTFNWKVAFGALLVLEMFVSQATSRDLYEASIFQKHKQWMSLFGRVYKDDIEKAKRF  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF++N E IE  N    + Y LG+N+FADL+N+EF+          R   K+      S
Sbjct  61    KIFKDNFEYIEFVNKVGTRPYILGINEFADLSNEEFK--------ASRNGYKMYSHQQLS  112

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             KS  F+Y N T  P+T+DWR KGAVT IKDQG CG CWAF+ VAA EGI+K+KTG L+SL
Sbjct  113   KSTSFKYENVT-APATMDWRTKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISL  171

Query  602   SEQELVDCD-RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAV  778
             SEQELVDCD R   GC+GG    AF+FI+ NNGLTTE NYPY+G     C   K ++ A 
Sbjct  172   SEQELVDCDTRSDMGCEGGLMDDAFKFIIKNNGLTTESNYPYEGTD-ATCKTGKESNHAA  230

Query  779   RISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavg  958
             +I+GYE VP  +E+AL++AVA+QP+ + I+     F+FY  GVF+GKC   LDH      
Sbjct  231   KITGYEDVPDNSESALLKAVANQPISVAIDASGSDFQFYSSGVFTGKCGTELDH--GVTA  288

Query  959   ygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G      G KYW++KNSWGT WGENGY+R+QRD   ++GLCG+A  ASYP+
Sbjct  289   VGYGKIGDGTKYWLVKNSWGTSWGENGYIRMQRDVDAEEGLCGIAMQASYPS  340



>ref|XP_003527350.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003556993.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 171/353 (48%), Positives = 223/353 (63%), Gaps = 13/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA+KI    +       LG  ++ VAS      SM  RH+QWMA +GKVY D  E + RF
Sbjct  1     MATKIQFHHISLALFFCLGFLAFQVASRTLQDASMYERHEQWMARYGKVYKDPEEKEKRF  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              +F+ NV  IE FN   NK YKLG+N+FADLT++EF         V R         S +
Sbjct  61    RVFKENVNYIEAFNNAANKPYKLGINQFADLTSEEF--------IVPRNRFNGHTRSSNT  112

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             ++  F+Y N T LP ++DWR KGAVTPIK+QG+CG CWAF+ +AA EGIHK+ TG LVSL
Sbjct  113   RTTTFKYENVTVLPDSIDWRQKGAVTPIKNQGSCGCCWAFSAIAATEGIHKISTGKLVSL  172

Query  602   SEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQE+VDCD K   +GC+GG+   AF+FI+ N+G+ TE +YPYKG   + CN  + A  A
Sbjct  173   SEQEVVDCDTKGTDHGCEGGYMDGAFKFIIQNHGINTEASYPYKGVDGK-CNIKEEAVHA  231

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
               I+GYE VP  NE AL +AVA+QPV + I+     F+FY+ G+F+G C   LDH     
Sbjct  232   ATITGYEDVPINNEKALQKAVANQPVSVAIDASGADFQFYKSGIFTGSCGTELDH--GVT  289

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G    + G KYW++KNSWGT WGE GY+ +QR     +G+CG+A  ASYPT
Sbjct  290   AVGYGENNEGTKYWLVKNSWGTEWGEEGYIMMQRGVKAVEGICGIAMMASYPT  342



>gb|AHA62783.1| RCR3-like cysteine protease [Mirabilis viscosa]
Length=343

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 222/353 (63%), Gaps = 17/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             + +KI  S LLFI  I+    SY ++     +  M  +H+QWM  +G++Y +  E   RF
Sbjct  3     LVTKIC-SILLFILVILP---SYSLSRLLHIESFMIEKHEQWMTLYGRIYENNNEKMKRF  58

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF  N++RIE  N    + + LGVN FADLTNDEFR         G + Q      +  
Sbjct  59    KIFSENIKRIEAMNK-MGRSFTLGVNAFADLTNDEFRNSR-----TGYKKQLTTTNNNNL  112

Query  422   KSKHFRYANATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
              SK+F+Y N TN  + ++ DWR KGAVTPIKDQGNCG CWAFA VAA EG+++LKTG L+
Sbjct  113   ASKYFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCCWAFATVAATEGLNQLKTGKLI  172

Query  596   SLSEQELVDCDRK-SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             SLSEQELVDCD     GC+GG   +A+ FI+ N GLTTE NYPY      +C    +A  
Sbjct  173   SLSEQELVDCDTSFDQGCEGGLLDTAYTFILKNGGLTTESNYPYMATDG-ICTTKHSAKS  231

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
             A  I GY+ VPA +E AL++AVAHQPV + + GG F F+FY  GVF G+C   LDH    
Sbjct  232   AASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQFYSSGVFQGECGYELDH--AV  289

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
                G    D G KYW+IKNSWGT+WGENGYMRI+RD  DK GLCGLA   SYP
Sbjct  290   AIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRD-VDKYGLCGLAMQPSYP  341



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   323 bits (827),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/339 (50%), Positives = 219/339 (65%), Gaps = 16/339 (5%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++LG WS    S      S+  R++QW+A +G+VY D  E ++RF IF+ NV  IE+ N 
Sbjct  7     LMLGAWSSQATSRSLQDASIYARYEQWLARYGRVYNDVDEKEIRFKIFKENVAFIESSNK  66

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATN-LP  463
               NK +KL VN+FADLTN+EF+      G+ G +         ++K+  F+Y N T  LP
Sbjct  67    DANKPHKLSVNQFADLTNEEFKASR--NGFKGHE--------CSTKTTSFKYENVTAALP  116

Query  464   STVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR--KS  637
             +T+DWR KGAVTP+KDQG CG CWAF+ VAA EG+ +L TG L+SLSEQELVDCD   + 
Sbjct  117   ATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGED  176

Query  638   YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNE  817
              GC+GG    AFQFI  N+G++TE NYPY G     CN  K A  A +I+G+E VPA +E
Sbjct  177   QGCEGGLMDDAFQFIQQNHGISTETNYPYNGVDG-TCNTKKEAIIAAKITGFEDVPANSE  235

Query  818   TALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyW  997
              AL+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G    + G KYW
Sbjct  236   KALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSEDGTKYW  293

Query  998   VIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             ++KNSWG  WGE GY+R+QRD A  +GLCG+A +ASYPT
Sbjct  294   LVKNSWGAEWGEAGYIRMQRDVAAPEGLCGIAMSASYPT  332



>ref|XP_004974540.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   323 bits (828),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 214/351 (61%), Gaps = 26/351 (7%)
 Frame = +2

Query  74    ILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             ILG + LF           L A       +M  RH+QWMA + +VY D  E   RF +F 
Sbjct  11    ILGCAFLFSGA--------LAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFN  62

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              NV+ IE+FNA  N+ + LGVN+FADLTNDEFR      G+     +   GF        
Sbjct  63    ANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKVPTGF--------  114

Query  434   FRYANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSE  607
              RY N +   LP+T+DWR+KGAVTPIKDQG CG CWAF+ VAA EGI K+ TG L+SLSE
Sbjct  115   -RYENVSIDALPATIDWRSKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSE  173

Query  608   QELVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVR  781
             QELVDCD   +  GC+GG    AF+FI+ N GLTTE  YPY     +       ++ A  
Sbjct  174   QELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKC---KSGSNSAAT  230

Query  782   ISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgy  961
             I GYE VPA NE ALM+AVA+QPV + ++GGD  F+FY  GV +G C   LDH       
Sbjct  231   IKGYEDVPANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDH--GIAAI  288

Query  962   gttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G      G  YW++KNSWGT WGENGY+R+++D +DK+G+CGLA   SYPT
Sbjct  289   GYGKASDGTNYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   323 bits (827),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 217/339 (64%), Gaps = 16/339 (5%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++LG WS    S      SM  R++QW+A +G++Y DT E + RF IF+ NV  IE  N 
Sbjct  7     LMLGAWSSEATSRSLQDASMYGRYKQWLARYGRIYNDTNEKETRFKIFKENVAFIEFSNK  66

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANAT-NLP  463
               NK YKL VN+FADLTN+EF+      G+ G +         ++K+  F+Y N T  LP
Sbjct  67    DANKPYKLSVNQFADLTNEEFKATR--NGFKGHE--------CSTKTSSFKYENVTVPLP  116

Query  464   STVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR--KS  637
             +T+DWR KGAVTP+KDQG CG CWAF+ VAA EGI +L TG L+SLSEQ LVDCD   + 
Sbjct  117   ATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQXLVDCDTAGED  176

Query  638   YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNE  817
              GC+GG    AFQFI  N+G++TE NYPY G     CN  K A  A +I+G+E VPA +E
Sbjct  177   QGCEGGLMDDAFQFIQQNHGISTEANYPYNGVDG-TCNTKKEAIIAAKITGFEDVPANSE  235

Query  818   TALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyW  997
              AL+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G    + G KYW
Sbjct  236   KALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSEDGTKYW  293

Query  998   VIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             ++KNSWG  WGE GY+R+QRD A  +GLCG+A +ASYPT
Sbjct  294   LVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMSASYPT  332



>gb|AHA62782.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=343

 Score =   323 bits (828),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 222/353 (63%), Gaps = 17/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             + +KI  S LLFI  I+    SY ++     +  M  +H+QWM  +G++Y +  E   RF
Sbjct  3     LVTKIC-SILLFILVILP---SYSLSRLLHIESFMIEKHEQWMTLYGRIYENNNEKMKRF  58

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF  N++RIE  N    +G+ LGVN FADLTNDEFR         G + Q      +  
Sbjct  59    KIFSENIKRIEAMNK-MGRGFTLGVNAFADLTNDEFRNSR-----TGYKKQLTTTNNNNL  112

Query  422   KSKHFRYANATN--LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLV  595
              SK+F+Y N TN  + ++ DWR KGAVTPIKDQGNCG CWAFA VAA EG+++LKTG L+
Sbjct  113   ASKYFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCCWAFATVAATEGLNQLKTGKLI  172

Query  596   SLSEQELVDCDRK-SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             SLSEQELVDCD     GC+GG   +A+ FI+ N GLTTE NYPY      +C    +A  
Sbjct  173   SLSEQELVDCDTSFDQGCEGGLLDTAYTFILKNGGLTTESNYPYMATDG-ICTTKHSAKS  231

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
                I GY+ VPA +E AL++AVAHQPV + + GG F F+FY  GVF G+C   LDH    
Sbjct  232   DASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQFYSSGVFQGECGYELDH--AV  289

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
                G    D G KYW+IKNSWGT+WGENGYMRI+RD  DK GLCGLA   SYP
Sbjct  290   AIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRD-VDKYGLCGLAMQPSYP  341



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   323 bits (827),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 171/344 (50%), Positives = 217/344 (63%), Gaps = 16/344 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             ++     +LG  S    S      SM  R++QWMA++G+VY D  E + RFNIF+ NV  
Sbjct  12    IILALIFMLGALSSQATSRTLQDASMYGRYEQWMAHYGRVYSDINEKEKRFNIFKENVAF  71

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+ N   NK +KL VN+FADLTN+EF+              +  G   ++K+  F+Y N
Sbjct  72    IESSNNDANKLHKLSVNQFADLTNEEFKA----------SRNRFMGHECSAKTTSFKYEN  121

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T  P TVDWR KGAVTP+KDQG CG CWAF+ VAA+EGI KL TG L+SLSEQELVDCD
Sbjct  122   VT-APPTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCD  180

Query  629   RKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
                   GC+GG    AFQFI  N+GL+TE NYPY G     CN  K A+ A +I+G+E V
Sbjct  181   TSGVDQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVDG-TCNTKKEANHAAKITGHEDV  239

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E AL++AVA+QP+ + I+ G   F+FY  GVF+G C   LDH       G      
Sbjct  240   PANSEEALLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSAD  297

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT WGE GY+R+QR    K+GLCG+A  ASYPT
Sbjct  298   GTKYWLVKNSWGTEWGEEGYIRMQRGIKAKEGLCGIAMEASYPT  341



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   323 bits (827),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 218/339 (64%), Gaps = 16/339 (5%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++LG WS    S      S+  R++QW+  +G+VY D  E + RF IF+ NV  IE+ N 
Sbjct  18    LMLGAWSSGATSRTLQDASIYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIESSNK  77

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANAT-NLP  463
               NK  +L VN+FADLTN+EF+      G+ G +         ++K+  F+Y N T +LP
Sbjct  78    DANKPCRLSVNQFADLTNEEFKASR--NGFKGHE--------CSTKTSSFKYENVTASLP  127

Query  464   STVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKS--  637
             +T+DWR KGAVTP+KDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD  S  
Sbjct  128   ATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGTLISLSEQELVDCDTASED  187

Query  638   YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNE  817
              GC+GG    AFQFI  N+G++TE NYPY+G     CN  K AS A +I+G+E VPA +E
Sbjct  188   QGCEGGLMDDAFQFIQQNHGISTEANYPYEGVDG-TCNAKKEASHAAKITGFEDVPANSE  246

Query  818   TALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyW  997
               L+ AVAHQPV + I+     F+FY  GVFSG C   LDH       G    + G KYW
Sbjct  247   KDLLAAVAHQPVSVAIDASGSDFQFYSSGVFSGTCGTSLDH--GVTAVGYGVSEDGTKYW  304

Query  998   VIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             ++KNSWG  WGE GY+R+QRD A  +GLCG+A AASYPT
Sbjct  305   LVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMAASYPT  343



>gb|AFK44139.1| unknown [Medicago truncatula]
Length=340

 Score =   323 bits (827),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 214/320 (67%), Gaps = 17/320 (5%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             S++ RH+QWM+ +GK+Y D  E + RF IF++NVE IE+FNA  NK YKL VN  ADLT 
Sbjct  35    SLQERHEQWMSEYGKLYKDAIEKEKRFMIFKDNVEFIESFNAADNKPYKLSVNHLADLTL  94

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGN  520
             DEF+      GY     +K++   + +    F+Y N T +P  VDWR KGAVTPIKDQG 
Sbjct  95    DEFKASR--NGY-----KKIDREFATT---SFKYENVTAIPEAVDWRVKGAVTPIKDQGQ  144

Query  521   CGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNN  694
             CGSCWAF+ VAA+EGI+++ TG L+SLSEQELVDCD K    GC+GG     F+FI+ N 
Sbjct  145   CGSCWAFSTVAAIEGINQITTGKLISLSEQELVDCDTKGEDQGCEGGLMEDGFEFIIKNG  204

Query  695   GLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGG  874
             G+T+E NYPYK      C+   TA  A +I+GYE+VP  +E +L++AVA+QP+ + I+  
Sbjct  205   GITSETNYPYKAADGS-CSAATTAPVA-KITGYEKVPVNSEISLLKAVANQPISVSIDAS  262

Query  875   DFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQ  1054
             D  F FY  G+++G+C   LDH    V         G  YW++KNSWGT WGE GY+R+Q
Sbjct  263   DSSFMFYSSGIYTGECGTELDH---GVTAVGYGSANGTDYWIVKNSWGTVWGEKGYIRMQ  319

Query  1055  RDYADKKGLCGLAKAASYPT  1114
             R  ADK+GLCG+A  +SYPT
Sbjct  320   RGIADKEGLCGIAMDSSYPT  339



>ref|XP_011078435.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=340

 Score =   322 bits (826),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 164/353 (46%), Positives = 223/353 (63%), Gaps = 18/353 (5%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQH-SMRLRHQQWMAYHGKVYVDTYEADMR  238
             MA  I   S+  +  +IL +W+Y   S    +  +M  RH++WM  +G+VY +  E  MR
Sbjct  1     MALSIAKISVFIV--LILTLWAYQTTSRLVPERLAMLERHEEWMERYGRVYKNEEEKMMR  58

Query  239   FNIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSA  418
             + IF++NVE IE FNA   + YKLG+N FAD TN+EF+      G    Q          
Sbjct  59    YKIFKDNVEFIEAFNAAGTRPYKLGINAFADQTNEEFKAAR--NGLFKVQK--------L  108

Query  419   SKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVS  598
             SK+  F+Y N + LPS++DWR KGAVTP+KDQG CGSCWAF+ +AA EGI+++ TG L+S
Sbjct  109   SKATPFKYENVSALPSSMDWRKKGAVTPVKDQGQCGSCWAFSAIAATEGINQISTGKLIS  168

Query  599   LSEQELVDCDRKS--YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASK  772
             LSEQE+VDCD+ S   GC+GG+   AF+FI++N G+ +E  YPY       CN  + +  
Sbjct  169   LSEQEIVDCDKTSQDQGCEGGYMEDAFEFIIDNKGIASESTYPYSATDG-TCNKKEESPI  227

Query  773   AVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvta  952
             A +I+ YE+VP  NE AL++AVA QPV + I+ G   F+FY  GVF+G C   LDH    
Sbjct  228   AAKITSYEKVPENNEKALLKAVAKQPVSVSIDAGGMEFQFYSSGVFTGDCGTDLDH--GV  285

Query  953   vgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
                G      G KYW++KNSWGT WGE GY+ ++RD A K+GLCG+A  +SYP
Sbjct  286   TAVGYGKTSDGTKYWLVKNSWGTSWGEEGYIMMERDVAAKEGLCGIAMDSSYP  338



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score =   322 bits (824),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 168/331 (51%), Positives = 216/331 (65%), Gaps = 13/331 (4%)
 Frame = +2

Query  125   SYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGY  304
             +Y   S   Y+ S+  RH+QWMA  G+VY D  E   RF IF++N E I++ N    K Y
Sbjct  3     AYQATSRDLYEASIVKRHEQWMARFGRVYKDDAEKAKRFKIFKDNTEYIDSVNMAGIKPY  62

Query  305   KLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRN  484
             KL VN+FADLTNDEFR        V R   ++     + +   F+Y N T  P+T+DWR 
Sbjct  63    KLDVNEFADLTNDEFR--------VTRNGYRMPSHKKSPEITSFKYENVT-APATMDWRK  113

Query  485   KGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKS-YGCDGGFP  661
             KGAVT IKDQG CG CWAF+ VAA EGI+K+KTG L+SLSEQELVDCD  S  GC+GG  
Sbjct  114   KGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEGGLM  173

Query  662   ISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVA  841
               AF+FI+ N+GLTTE NYPY+G     C   K ++ A +I+ YE VPA +E+AL++AVA
Sbjct  174   DDAFKFIIKNHGLTTESNYPYEGTDS-TCKTGKESNHAAKITSYEDVPANSESALLKAVA  232

Query  842   HQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGT  1021
             +QPV + I+     F+FY  GVF+G+C   LDH       G      G KYW++KNSWGT
Sbjct  233   NQPVSVAIDASGSDFQFYSSGVFTGECGTELDH--GVTAVGYGEASDGTKYWLVKNSWGT  290

Query  1022  RWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              WGENGY+R+QR+   ++GLCG+A  ASYPT
Sbjct  291   SWGENGYIRMQRNVDTEEGLCGIAMEASYPT  321



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   322 bits (826),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 218/339 (64%), Gaps = 16/339 (5%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             +++G WS    S      SM  R++QW+  +G+VY +  E + RF IF  NV  IE+ N 
Sbjct  18    LMMGAWSSGATSRTLQDASMYGRYEQWLTRYGRVYNNVNEKETRFKIFNENVAFIESSNK  77

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANAT-NLP  463
               NK YKL VN+FADLTN+EF+      G+ G +         ++++  F+Y N T +LP
Sbjct  78    YANKPYKLSVNQFADLTNEEFKASR--NGFKGHE--------CSTETTSFKYENVTASLP  127

Query  464   STVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR--KS  637
             +T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI +L TG L+SLSEQELVDCD   + 
Sbjct  128   ATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGED  187

Query  638   YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNE  817
              GC+GG    AFQFI  N+G++TE NYPY G     CN  K AS A +I+G+E VPA +E
Sbjct  188   QGCEGGLMDDAFQFIQQNHGISTEANYPYDGVDG-ACNAKKEASHAAKITGFEDVPANSE  246

Query  818   TALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyW  997
              AL+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G    + G KYW
Sbjct  247   KALLAAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSEDGTKYW  304

Query  998   VIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             ++KNSWG  WGE GY+R+QRD A  +GLCG+A AASYPT
Sbjct  305   LVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMAASYPT  343



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   322 bits (825),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 217/339 (64%), Gaps = 16/339 (5%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++LG WS    S      SM  R++QW+A +G++Y DT E + RF IF+ NV  IE  N 
Sbjct  7     LMLGAWSSEATSRSLQDASMYGRYKQWLARYGRIYNDTNEKETRFKIFKENVAFIEFSNK  66

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANAT-NLP  463
               NK YKL VN+FADLTN+EF+      G+ G +         ++K+  F+Y N T  LP
Sbjct  67    DANKPYKLSVNQFADLTNEEFKATR--NGFKGHE--------CSTKTSSFKYENVTVPLP  116

Query  464   STVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR--KS  637
             +T+DWR KGAVTP+KDQG CG CWAF+ VAA EGI +L TG L+SLSEQ LVDCD   + 
Sbjct  117   ATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQVLVDCDTAGED  176

Query  638   YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNE  817
              GC+GG    AFQFI  N+G++TE NYPY G     CN  K A  A +I+G+E VPA +E
Sbjct  177   QGCEGGLMDBAFQFIQQNHGISTEANYPYBGVDG-TCNTKKEAIIAAKITGFEDVPANSE  235

Query  818   TALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyW  997
              AL+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G    + G KYW
Sbjct  236   KALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSEDGTKYW  293

Query  998   VIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             ++KNSWG  WGE GY+R+QRD A  +GLCG+A +ASYPT
Sbjct  294   LVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMSASYPT  332



>gb|KHN28095.1| Thiol protease [Glycine soja]
Length=336

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 209/323 (65%), Gaps = 19/323 (6%)
 Frame = +2

Query  152   YQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFAD  331
             ++ SMR RH+QWM  +GKVY D  E D RF IF++NVE IE+FNA  NK YKLGVN  AD
Sbjct  30    HETSMRERHEQWMTEYGKVYKDAAEKDKRFQIFKDNVEFIESFNADGNKPYKLGVNHLAD  89

Query  332   LTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKD  511
             LT +EF+          R   K     S +    F+Y N T +P+ +DWR KGAVTPIKD
Sbjct  90    LTVEEFK--------ASRNGFKRPHEFSTTT---FKYENVTAIPAAIDWRTKGAVTPIKD  138

Query  512   QGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY--GCDGGFPISAFQFIV  685
             QG CGSCWAF+ +AA EGIH++ TG LVSLSEQELVDCD K    GC+GG+    F+FI+
Sbjct  139   QGQCGSCWAFSTIAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGYMEDGFEFII  198

Query  686   NNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEI  865
              N G+T+E NYPYK    + CN  K  S   +I GYE+VP  +ET L +AVA+QPV + I
Sbjct  199   KNGGITSETNYPYKAVDGK-CN--KATSPVAQIKGYEKVPPNSETTLQKAVANQPVSVSI  255

Query  866   NGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYM  1045
             +     F FY  G+++G+C   LDH    V         G  YW++KNSWGT+WGE GY+
Sbjct  256   DADGAGFMFYSSGIYNGECGTELDH---GVTAVGYGTANGTDYWIVKNSWGTQWGEKGYV  312

Query  1046  RIQRDYADKKGLCGLAKAASYPT  1114
             R+QR  A K GLCG+A  +SYPT
Sbjct  313   RMQRGIAAKHGLCGIALDSSYPT  335



>ref|XP_006582266.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=341

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 212/323 (66%), Gaps = 14/323 (4%)
 Frame = +2

Query  152   YQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFAD  331
             +Q S+R RH+ WMA +GK+Y D  E + RF IF++NVE IE+FNA  NK YKLGVN  AD
Sbjct  30    HQTSLRERHENWMAEYGKMYKDAAEKEKRFQIFKDNVEFIESFNAAGNKPYKLGVNHLAD  89

Query  332   LTNDEFR--RLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPI  505
             LT +EF+  R  L   Y  R         +  K   F+Y N T++P  +DWR KGAVTPI
Sbjct  90    LTLEEFKDSRNGLKRTYEFR--------TTTFKLNGFKYENVTDIPEAIDWRAKGAVTPI  141

Query  506   KDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSYGCDGGFPISAFQFIV  685
             K QG CGSCWAF+ +AA EGIH+++TGNLVSLSEQELVDCD   +GC GGF    F+FIV
Sbjct  142   KYQGQCGSCWAFSTIAATEGIHQIRTGNLVSLSEQELVDCDSVDHGCKGGFMEHGFEFIV  201

Query  686   NNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEI  865
              N G+T+E NYPYKG     CN    AS   +I GYE VP+ +E AL +AVA+QPV + I
Sbjct  202   KNGGITSETNYPYKGVD-GTCNTTIAASPVAQIKGYEIVPSYSEEALQKAVANQPVSVSI  260

Query  866   NGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYM  1045
             +  +  F FY  G+++G+C   LDH    V       + G  YW++KNSWGT+WGE GY+
Sbjct  261   HATNATFMFYSSGIYNGECGTDLDH---GVTAVGYGTENGTDYWIVKNSWGTQWGEKGYI  317

Query  1046  RIQRDYADKKGLCGLAKAASYPT  1114
             R+ R  A K G+CG+A  +SYPT
Sbjct  318   RMHRGIAAKHGICGIALDSSYPT  340



>ref|XP_003599736.1| Cysteine proteinase [Medicago truncatula]
 ref|XP_003607644.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89841.1| papain family cysteine protease [Medicago truncatula]
Length=340

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 211/320 (66%), Gaps = 17/320 (5%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             S++ RH+QWM  HGKVY D  E + RF IF++NVE IE+FNA  N+ YKL VN  ADLT 
Sbjct  35    SLQERHEQWMTEHGKVYEDAIEKEKRFMIFKDNVEFIESFNAADNQPYKLSVNHLADLTL  94

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKDQGN  520
             DEF+      GY     +K++   + +    F+Y N T +P+ VDWR KGAVTPIKDQG 
Sbjct  95    DEFKASR--NGY-----KKIDREFTTT---SFKYENVTAIPAAVDWRVKGAVTPIKDQGQ  144

Query  521   CGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVNNN  694
             CGSCWAF+ VAA EGI+++ TG LVSLSEQELVDCD K    GC+GG     F+FI+ N 
Sbjct  145   CGSCWAFSTVAATEGINQITTGKLVSLSEQELVDCDTKGEDQGCEGGLMEDGFEFIIKNG  204

Query  695   GLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGG  874
             G+T+E NYPYK      CN   T +   +I+GYE+VP  +E +L++AVA+QP+ + I+  
Sbjct  205   GITSETNYPYKAADGS-CN-TATTTPVAKITGYEKVPVNSEKSLLKAVANQPISVSIDAS  262

Query  875   DFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQ  1054
             D  F FY  G+++G+C   LDH    V         G  YW++KNSWGT WGE GY+R+Q
Sbjct  263   DSSFMFYSSGIYTGECGTELDH---GVTAVGYGSANGTDYWIVKNSWGTVWGEKGYIRMQ  319

Query  1055  RDYADKKGLCGLAKAASYPT  1114
             R  A K+GLCG+A  +SYPT
Sbjct  320   RGIAAKEGLCGIAMDSSYPT  339



>ref|XP_006592467.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/322 (53%), Positives = 214/322 (66%), Gaps = 17/322 (5%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             SM  RH+QWM  +GKVY D  E + RF IF+ NV  IE FN   NK YKL +N+FADLTN
Sbjct  34    SMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADLTN  93

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFRYANATNLPSTVDWRNKGAVTPIKDQ  514
             +EF         +  +N + +G M +S  ++  F+Y N T +PSTVDWR KGAVTPIKDQ
Sbjct  94    EEF---------IAPRN-RFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQ  143

Query  515   GNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY--GCDGGFPISAFQFIVN  688
             G CG CWAF+ VAA EGIH L +G L+SLSEQELVDCD K    GC+GG    AF+F++ 
Sbjct  144   GQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQ  203

Query  689   NNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEIN  868
             N+GL TE NYPYKG   + CN  + A+ A  I+GYE VPA NE AL +AVA+QPV + I+
Sbjct  204   NHGLNTEANYPYKGVDGK-CNANEAANNAATITGYEDVPANNEKALQKAVANQPVSVAID  262

Query  869   GGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMR  1048
                  F+FY+ GVF+G C   LDH       G    + G +YW++KNSWGT WGE GY+R
Sbjct  263   ASGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIR  320

Query  1049  IQRDYADKKGLCGLAKAASYPT  1114
             +QR    ++GLCG+A  ASYPT
Sbjct  321   MQRGVDSEEGLCGIAMQASYPT  342



>gb|KHN07750.1| KDEL-tailed cysteine endopeptidase CEP1 [Glycine soja]
Length=309

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/321 (53%), Positives = 210/321 (65%), Gaps = 17/321 (5%)
 Frame = +2

Query  164   MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTND  343
             M  RH+QWMA + KVY D  E + RF IF+ NV  IETFN+  NK YKL +N+FADLTN+
Sbjct  1     MYERHEQWMARYAKVYKDPQEREKRFRIFKENVNYIETFNSADNKSYKLDINQFADLTNE  60

Query  344   EFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFRYANATNLPSTVDWRNKGAVTPIKDQG  517
             EF         +  +N + +G M +S  ++  F+Y N T +PSTVDWR KGAVTPIKDQG
Sbjct  61    EF---------IAPRN-RFKGHMCSSITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQG  110

Query  518   NCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRK--SYGCDGGFPISAFQFIVNN  691
              CG CWAF+ VAA EGIH L  G L+SLSEQE+VDCD K    GC GGF   AF+FI+ N
Sbjct  111   QCGCCWAFSAVAATEGIHALNAGKLISLSEQEVVDCDTKGQDQGCAGGFMDGAFKFIIQN  170

Query  692   NGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEING  871
             +GL TE NYPYK    + CN    A+ A  I+GYE VP  NE AL +AVA+QPV + I+ 
Sbjct  171   HGLNTEPNYPYKAADGK-CNAKAAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDA  229

Query  872   GDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMRI  1051
                 F+FY+ GVF+G C   LDH       G      G +YW++KNSWGT WGE GY+R+
Sbjct  230   SGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGVSADGTEYWLVKNSWGTEWGEEGYIRM  287

Query  1052  QRDYADKKGLCGLAKAASYPT  1114
             QR    K+GLCG+A  ASYPT
Sbjct  288   QRGVKAKEGLCGIAMMASYPT  308



>ref|XP_003578808.1| PREDICTED: senescence-specific cysteine protease SAG39 [Brachypodium 
distachyon]
Length=339

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/349 (48%), Positives = 217/349 (62%), Gaps = 15/349 (4%)
 Frame = +2

Query  74    ILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             I  +SLL I   +    S L A   +   SM  RH+ WM  +G+VY D  E   +F +F+
Sbjct  3     IPKASLLAILGCLCLCGSVLAARELNDDLSMVARHENWMLQYGRVYKDAAEKAQKFEVFK  62

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              N E I +FNAG +K + LG+N+FAD+TN+EF+      G++  + +   GFM       
Sbjct  63    ANAEFINSFNAGNHK-FWLGINQFADITNEEFKATKTNKGFISNKVRVPTGFM-------  114

Query  434   FRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             +   +   LP+T+DWR KGAVTPIKDQG CG CWAF+ VAA+EGI KL TG LVSLSEQE
Sbjct  115   YENMSFDALPATIDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLVSLSEQE  174

Query  614   LVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRIS  787
             LVDCD   +  GC+GG    AF+FI+ N GLT E NYPY     +       +S A  I 
Sbjct  175   LVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTQESNYPYDAADGKC---KSGSSSAATIK  231

Query  788   GYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygt  967
              YE VPA NE ALM+AVA+QPV + ++GGD  F+FY  GV +G C   LDH       G 
Sbjct  232   SYEDVPANNEGALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDH--GIAAIGY  289

Query  968   tagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                  G K+W++KNSWGT WGENG++R+++D ADKKG+CGLA   SYPT
Sbjct  290   GTTSDGTKFWIMKNSWGTSWGENGFLRMEKDIADKKGMCGLAMEPSYPT  338



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 169/339 (50%), Positives = 217/339 (64%), Gaps = 16/339 (5%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNA  286
             ++LG WS    S      SM  R++QW+A +G+VY D  E + RF IF+ NV  IE+ N 
Sbjct  18    LMLGAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAFIESSNK  77

Query  287   GPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATN-LP  463
               N  YKL VN+FADLTN+EF+      G+ G +         ++K+  F+Y N T  LP
Sbjct  78    DANTPYKLRVNQFADLTNEEFKASR--NGFKGHE--------CSTKTTSFKYENVTAALP  127

Query  464   STVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR--KS  637
             +T+DWR KGAVTP+KDQG CG CWAF+ VAA EG+ +L TG L+SLSEQELVDCD   + 
Sbjct  128   ATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGED  187

Query  638   YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNE  817
              GC+GG    AFQFI  N+G++TE NYPY G     CN  K A  A +I+G+E VPA +E
Sbjct  188   QGCEGGLMDDAFQFIQQNHGISTETNYPYNGVDG-TCNTKKEAIIAAKITGFEDVPANSE  246

Query  818   TALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyW  997
              AL+ AVAHQPV + I+     F+FY  GVF+G C   LDH       G    + G KYW
Sbjct  247   KALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSEDGTKYW  304

Query  998   VIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             ++KNSWG  WGE GY+R+QRD A  +GLCG+A +ASYPT
Sbjct  305   LVKNSWGAEWGEAGYIRMQRDVAAPEGLCGIAMSASYPT  343



>ref|XP_002446222.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
 gb|EES10550.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
Length=340

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 168/350 (48%), Positives = 217/350 (62%), Gaps = 18/350 (5%)
 Frame = +2

Query  77    LGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRN  256
             L  S+L I  + L   + L A   +   +M  RH+QWMA + +VY D  E   RF +F+ 
Sbjct  4     LKGSILAILGLALFCGAALAARDLNDDSAMVARHEQWMAQYNRVYKDATEKAQRFEVFKA  63

Query  257   NVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHF  436
             NV+ IE+FNAG N+ + LGVN+FADLTNDEFR      G+     +   GF         
Sbjct  64    NVKFIESFNAGGNRKFWLGVNQFADLTNDEFRATKTNKGFKPSPVKVPTGF---------  114

Query  437   RYANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQ  610
             RY N +   LP+++DWR KGAVTPIKDQG CG CWAF+ VAA EGI K+ T  L+SLSEQ
Sbjct  115   RYENVSVDALPASIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTDKLISLSEQ  174

Query  611   ELVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRI  784
             ELVDCD   +  GC+GG    AF+FI+ N GLTTE +YPY     +        + A  I
Sbjct  175   ELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESSYPYTATDGKC---KSGTNSAANI  231

Query  785   SGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgyg  964
              G+E VPA +E ALM+AVA+QPV + ++GGD  F+ Y  GV +G C   LDH       G
Sbjct  232   KGFEDVPANDEAALMKAVANQPVSVAVDGGDMTFQLYSGGVMTGSCGTDLDH--GIAAIG  289

Query  965   ttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                   G KYW++KNSWGT WGENGY+R+++D +DK+G+CGLA   SYPT
Sbjct  290   YGQTSDGTKYWLLKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_004974539.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 170/351 (48%), Positives = 213/351 (61%), Gaps = 26/351 (7%)
 Frame = +2

Query  74    ILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             ILG + LF           L A       +M  RH+QWMA + +VY D  E   R  +F 
Sbjct  11    ILGCAFLFSGA--------LAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRLEVFN  62

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              NV+ IE+FNA  N+ + LGVN+FADLTNDEFR      G+     +   GF        
Sbjct  63    ANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKVPTGF--------  114

Query  434   FRYANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSE  607
              RY N +   LP+T+DWR+KGAVTPIKDQG CG CWAF+ VAA EGI K+ TG L+SLSE
Sbjct  115   -RYENVSIDALPATIDWRSKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSE  173

Query  608   QELVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVR  781
             QELVDCD   +  GC+GG    AF+FI+ N GLTTE  YPY     +       ++ A  
Sbjct  174   QELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKC---KSGSNSAAT  230

Query  782   ISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgy  961
             I GYE VPA NE ALM+AVA+QPV + ++GGD  F+FY  GV +G C   LDH       
Sbjct  231   IKGYEDVPANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDH--GIAAI  288

Query  962   gttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G      G  YW++KNSWGT WGENGY+R+++D +DK+G+CGLA   SYPT
Sbjct  289   GYGKASDGTNYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_004297571.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/349 (49%), Positives = 225/349 (64%), Gaps = 17/349 (5%)
 Frame = +2

Query  77    LGSSL-LFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             LG  L L +  ++ G WS    S      SM  R++QWMA +G+VY D  E + RF IF+
Sbjct  6     LGKCLCLALILLMFGAWSSEATSRTLQDASMYGRYEQWMARYGRVYNDINEKEKRFQIFK  65

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              NV  +E+ N   +K YKL VN+FADLTN+EF         +  +N + +G   ++K+  
Sbjct  66    ANVAIVESSNNDASKPYKLSVNQFADLTNEEF---------ITSRN-RFKGHECSTKTTS  115

Query  434   FRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             F+Y N T +P+TVDWR KGAVTP+KDQG CG CWAF+ VAA+EGI +L TG L+SLSEQE
Sbjct  116   FKYENVT-VPATVDWRQKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQE  174

Query  614   LVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRIS  787
             LVDCD   +  GC+GG   +AF FI  N+GL+TE NYPY G     CN  K AS A  I+
Sbjct  175   LVDCDVNGEDQGCEGGLMDNAFDFINQNHGLSTEANYPYTGVDG-TCNAQKEASHAASIT  233

Query  788   GYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygt  967
             G+E VPA +E+AL++AVA+QP+ + I+     F+ Y  GVF+G C   LDH       G 
Sbjct  234   GHEDVPANSESALLKAVANQPISVAIDASGSDFQLYSSGVFTGTCGTSLDH--GVTAVGY  291

Query  968   tagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                D G +YW++KNSWG +WGE GY+R+QRD    +GLCG+A AASYPT
Sbjct  292   GVSDDGTQYWLVKNSWGAQWGEEGYIRMQRDVTAPEGLCGIAMAASYPT  340



>ref|XP_003527388.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   321 bits (822),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 175/347 (50%), Positives = 219/347 (63%), Gaps = 21/347 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             +LLF     +G  ++ V        SM  RH QWMA + KVY D  E + RF IF+ NV 
Sbjct  13    ALLFC----MGFLAFQVTCRTLQDASMYERHAQWMARYAKVYKDPQEREKRFRIFKENVN  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFR  439
              IETFN+  NK YKL +N+FADLTN+EF         +  +N + +G M +S  ++  F+
Sbjct  69    YIETFNSADNKSYKLDINQFADLTNEEF---------IAPRN-RFKGHMCSSITRTTTFK  118

Query  440   YANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELV  619
             Y N T +PSTVDWR KGAVTPIKDQG CG CWAF+ VAA EGIH L  G L+SLSEQE+V
Sbjct  119   YENVTVIPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALNAGKLISLSEQEVV  178

Query  620   DCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGY  793
             DCD K    GC GGF   AF+FI+ N+GL TE NYPYK    + CN    A+ A  I+GY
Sbjct  179   DCDTKGQDQGCAGGFMDGAFKFIIQNHGLNTEPNYPYKAADGK-CNAKAAANHAATITGY  237

Query  794   ERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtta  973
             E VP  NE AL +AVA+QPV + I+     F+FY+ GVF+G C   LDH       G   
Sbjct  238   EDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGV  295

Query  974   gdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                G +YW++KNSWGT WGE GY+R+QR    ++GLCG+A  ASYPT
Sbjct  296   SADGTEYWLVKNSWGTEWGEEGYIRMQRGVKAEEGLCGIAMMASYPT  342



>ref|XP_004975184.1| PREDICTED: vignain-like [Setaria italica]
Length=340

 Score =   321 bits (822),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 213/327 (65%), Gaps = 23/327 (7%)
 Frame = +2

Query  155   QHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADL  334
               +M  RH+QWMA +G+VYVD  E   RF +FR NV  IE+ N+  N  + + VN+FADL
Sbjct  31    DQAMAARHEQWMAKYGRVYVDAAEKARRFEVFRANVAFIESVNS-QNHKFWVEVNQFADL  89

Query  335   TNDEFRRLHLVGGYVGRQNQKVEGFMSASKSK--HFRYANAT--NLPSTVDWRNKGAVTP  502
             T+DEFR                 G+  A K++   FRYAN +  +LP +VDWR KGAVTP
Sbjct  90    TDDEFRATRT-------------GYKPAGKARTTAFRYANVSLDDLPDSVDWRTKGAVTP  136

Query  503   IKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY--GCDGGFPISAFQ  676
             IKDQG CG CWAF+ VA++EGI KL TG L+SLSEQELVDCD      GC+GG   +AF+
Sbjct  137   IKDQGQCGCCWAFSTVASMEGIVKLSTGKLISLSEQELVDCDVNGMDQGCEGGEMDNAFE  196

Query  677   FIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVL  856
             FI++N GLTTE NYPY       CN  K ++ A  I GYE VPA +E +L +AVA+QPV 
Sbjct  197   FIIDNGGLTTESNYPYTASDG-TCNSNKASNDAASIKGYEDVPANDEASLRKAVANQPVS  255

Query  857   LEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGEN  1036
             + ++GGD  FRFY+ GV SG C   LDH       G      G KYW++KNSWGT WGE 
Sbjct  256   VAVDGGDSLFRFYKGGVLSGSCGTELDH--GIAAVGYGVASDGTKYWLMKNSWGTSWGEG  313

Query  1037  GYMRIQRDYADKKGLCGLAKAASYPTI  1117
             GY+R++RD AD++GLCGLA   SYPT+
Sbjct  314   GYIRMERDIADEEGLCGLAMQPSYPTV  340



>ref|XP_009617815.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=339

 Score =   320 bits (821),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/342 (49%), Positives = 224/342 (65%), Gaps = 14/342 (4%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             L F T ++LG+   LV S   Y+ S+  +H+QWM+ +G+VY D  +   R   F+ N+E 
Sbjct  9     LNFATLLVLGLCISLVTSRTLYEASITEKHEQWMSQYGRVYKDDTKKAKRLETFKQNLEY  68

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+ N    + YKLG+N+FAD+TN+EF+ +    GY     QK+       K+  F+Y N
Sbjct  69    IESTNKDVTRTYKLGINQFADMTNEEFKAIR--NGYRISSQQKI-------KNTSFQYEN  119

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T +P ++DWR KGAVT IKDQG CG CWAF+ VAA EGI+K+KTG L+SLSEQELVDCD
Sbjct  120   VT-VPYSMDWRKKGAVTKIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCD  178

Query  629   RKS-YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
               S  GC+GG    AF++I+ N+GLT+E NYPYKG     C   K ++   +ISGY+ VP
Sbjct  179   TNSNQGCEGGLMDDAFKYIIKNHGLTSESNYPYKGIDG-TCKTEKESNHIAKISGYKDVP  237

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
               +E+AL++AVA+QPV + I+     F+FY  G+F+GKC   LDH    V  G  A   G
Sbjct  238   ENSESALLKAVANQPVSVAIDASGSDFQFYSSGIFTGKCGTELDH--GVVAVGYGATKDG  295

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYP  1111
              KYW++KNSWG  WGENGY+R++RD   K GLCG+A  ASYP
Sbjct  296   TKYWIVKNSWGVSWGENGYIRMKRDIVAKTGLCGIAMKASYP  337



>ref|XP_004974541.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   320 bits (821),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 170/351 (48%), Positives = 212/351 (60%), Gaps = 26/351 (7%)
 Frame = +2

Query  74    ILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFR  253
             ILG + LF           L A       +M  RH+QWMA + +VY D  E   R  +F 
Sbjct  11    ILGCAFLFSGA--------LAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRLEVFN  62

Query  254   NNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKH  433
              NV+ IE+FNA  N+ + LGVN+FADLTNDEFR      G+     +   GF        
Sbjct  63    ANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKVPTGF--------  114

Query  434   FRYANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSE  607
              RY N +   LP+T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI K+ TG L+SLSE
Sbjct  115   -RYENVSIDALPATIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSE  173

Query  608   QELVDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVR  781
             QELVDCD   +  GC+GG    AF+FI+ N GLTTE  YPY     +       ++ A  
Sbjct  174   QELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKC---KSGSNSAAT  230

Query  782   ISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgy  961
             I GYE VPA NE ALM+AVA+QPV + ++GGD  F+FY  GV +G C   LDH       
Sbjct  231   IKGYEDVPANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDH--GIAAI  288

Query  962   gttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G      G  YW++KNSWGT WGENGY+R+++D +DK+G+CGLA   SYPT
Sbjct  289   GYGKASDGTNYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_003526208.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Glycine 
max]
Length=339

 Score =   320 bits (821),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 225/342 (66%), Gaps = 13/342 (4%)
 Frame = +2

Query  95    FITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIE  274
              I  +IL VW++ V S    +     RH++WMA +GK+Y D  E + RF IF+NNV+ IE
Sbjct  10    LILFLILTVWTFHVMSRRLSEVCTSERHEKWMAQYGKLYTDAAEKEKRFQIFKNNVQFIE  69

Query  275   TFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANAT  454
             +FNA  +K + L +N+FADL N+EF+   +         QK E  +  +    FRY + T
Sbjct  70    SFNAAGDKPFNLSINQFADLHNEEFKASLI-------NVQKKESGVETATETSFRYESIT  122

Query  455   NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDR-  631
              +P T+DWR +GAVTPIKDQGNCGSCWAF++VAA+EGIH++ TG LVSLSEQELVDC + 
Sbjct  123   KIPVTMDWRKRGAVTPIKDQGNCGSCWAFSIVAAIEGIHQITTGKLVSLSEQELVDCVKG  182

Query  632   KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAK  811
             KS GC+ G+   AF+F+  N GL +E +YPYK   ++ C   K      +I GYE VP+ 
Sbjct  183   KSEGCNFGYKEEAFEFVAKNGGLASEISYPYKA-NNKTCMVKKETQGVAQIKGYENVPSN  241

Query  812   NETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkk  991
             +E AL++AVA+QPV + I+ G    +FY  G+F+GKC    +H   A   G     GG K
Sbjct  242   SEKALLKAVANQPVSVYIDAG--ALQFYSSGIFTGKCGTAPNH--AATVIGYGKARGGAK  297

Query  992   yWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
             YW++KNSWGT+WGE GY+R++RD   K+GLCG+A  ASYPT+
Sbjct  298   YWLVKNSWGTKWGEKGYIRMKRDIRAKEGLCGIATNASYPTV  339



>gb|EYU25679.1| hypothetical protein MIMGU_mgv1a023356mg, partial [Erythranthe 
guttata]
Length=347

 Score =   321 bits (822),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 220/343 (64%), Gaps = 11/343 (3%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
              +    ++L +W     +      S+  RH+QWM  +G+ Y +  E   RFNIF++NVE 
Sbjct  14    FILAAVLVLQMWVSQATARTLPDASIVERHEQWMVQYGRTYKNDAEKAKRFNIFKDNVEY  73

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             I++ N    + YKL +NKFADLTN+EF+      GY  R   K     S+SK   + YAN
Sbjct  74    IQSVNETETRAYKLAINKFADLTNEEFQASR--NGYKMRSQSK-----SSSKVSSYMYAN  126

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              + +P ++DW  KGAVTP+KDQG CG CWAF+ VAA EGI++L TGNLVSLSEQELVDCD
Sbjct  127   VSAVPPSMDWTKKGAVTPVKDQGQCGCCWAFSAVAATEGINQLTTGNLVSLSEQELVDCD  186

Query  629   -RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVP  805
               +  GC+GG    AF+FI++NNGLTTE NYPY+G     CN  K +S   +I+GYE VP
Sbjct  187   TSEDQGCNGGLMDYAFEFIISNNGLTTESNYPYEGVDG-TCNSKKESSHVAKITGYEDVP  245

Query  806   AKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdgg  985
             + +E+AL++AV +QP+ + I+     F+FY  GVF+G+C   LDH       G       
Sbjct  246   SNSESALLKAVVNQPISVAIDASGSDFQFYSSGVFTGQCGTELDH--GVTVVGYGVTSDE  303

Query  986   kkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              KYW++KNSWGT WGENGY+R+QRD    +GLCG+A  ASYPT
Sbjct  304   TKYWLVKNSWGTSWGENGYIRMQRDIDTVEGLCGIAMQASYPT  346



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score =   320 bits (821),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 168/344 (49%), Positives = 223/344 (65%), Gaps = 14/344 (4%)
 Frame = +2

Query  89    LLFITTI-ILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             L F+  + + G+  +   S   Y+ SM  +H+QWM   G+VY +  E   RF IF++N++
Sbjct  9     LAFVAALLVFGMQDFQATSRGLYETSMVQKHEQWMTRFGRVYKNDVEKAKRFKIFKDNID  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
              I++FN    K YKL +N+FADLTNDEFR  H   GY     +K     S      F+Y 
Sbjct  69    YIDSFNKAGTKSYKLDINEFADLTNDEFRATH--NGYKMPFQKKSPEITS------FKYE  120

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T  P+T+DWR KGAVT IK+QG CG CWAF+ VAA EGI+K+KTG L+SLSEQELVDC
Sbjct  121   NVT-APATMDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDC  179

Query  626   DRKS-YGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
             D  S  GC+GG    AF+FI+ N+GLTTE NYPY+G     C   K ++ A +I+ YE V
Sbjct  180   DTSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTD-STCKTGKESNHAAKITSYEDV  238

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E++L++AVA+QPV + I+     F+FY  GVF+G+C   LDH       G      
Sbjct  239   PANSESSLLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDH--GVTAVGYGEASD  296

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT WGENGY+R+QR+   ++GLCG+A  ASYPT
Sbjct  297   GTKYWLVKNSWGTSWGENGYIRMQRNVDAEEGLCGIAMEASYPT  340



>ref|XP_006582267.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score =   320 bits (820),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 165/323 (51%), Positives = 209/323 (65%), Gaps = 19/323 (6%)
 Frame = +2

Query  152   YQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFAD  331
             ++ SMR RH+QWM  +GKVY D  E + RF IF++NVE IE+FNA  NK YKLGVN  AD
Sbjct  30    HETSMRERHEQWMTEYGKVYKDAAEKEKRFQIFKDNVEFIESFNADGNKPYKLGVNHLAD  89

Query  332   LTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKD  511
             LT +EF+          R   K     S +    F+Y N T +P+ +DWR KGAVTPIKD
Sbjct  90    LTVEEFK--------ASRNGFKRPHEFSTTT---FKYENVTAIPAAIDWRTKGAVTPIKD  138

Query  512   QGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY--GCDGGFPISAFQFIV  685
             QG CGSCWAF+ +AA EGIH++ TG LVSLSEQELVDCD K    GC+GG+    F+FI+
Sbjct  139   QGQCGSCWAFSTIAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGYMEDGFEFII  198

Query  686   NNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEI  865
              N G+T+E NYPYK    + CN  K  S   +I GYE+VP  +ET L +AVA+QPV + I
Sbjct  199   KNGGITSETNYPYKAVDGK-CN--KATSPVAQIKGYEKVPPNSETTLQKAVANQPVSVSI  255

Query  866   NGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYM  1045
             +     F FY  G+++G+C   LDH    V         G  YW++KNSWGT+WGE GY+
Sbjct  256   DADGAGFMFYSSGIYNGECGTELDH---GVTAVGYGTANGTDYWIVKNSWGTQWGEKGYV  312

Query  1046  RIQRDYADKKGLCGLAKAASYPT  1114
             R+QR  A K GLCG+A  +SYPT
Sbjct  313   RMQRGIAAKHGLCGIALDSSYPT  335



>ref|XP_004306597.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   320 bits (820),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 170/345 (49%), Positives = 225/345 (65%), Gaps = 18/345 (5%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVE  265
             SL  I  ++LG WS    S      +M  R++QWMA HG+V+    E + RF IF+ N+ 
Sbjct  11    SLALI--LMLGAWSSEATSRTLQDVTMYGRYEQWMARHGRVFSSIDEKESRFKIFKENLA  68

Query  266   RIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYA  445
              IE+ N   +K ++LGVN+FA LTN+EF  L    G+ G +        S++K+  FRY 
Sbjct  69    YIESSNNDASKTFRLGVNQFAHLTNEEFTSLS--NGFKGHE--------SSTKTSSFRYE  118

Query  446   NATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDC  625
             N T +P+T+DWR+KGAVTPIK+QG CG CWAF+ VAA+EGI +L  G L+SLSEQELVDC
Sbjct  119   NVT-VPATMDWRSKGAVTPIKNQGQCGCCWAFSAVAAMEGITQLTMGKLISLSEQELVDC  177

Query  626   DR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYER  799
             D+  +  GC+GG    AF+FI  N+GL+TE NYPY G   + CN  K AS A  I+G+E 
Sbjct  178   DKSGEDQGCEGGLMDDAFEFINQNHGLSTEANYPYTGVDGK-CNARKEASHAASITGHED  236

Query  800   VPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagd  979
             VPA +E+AL++AVA QP+ + I+     F+FY  GVF+G C   LDH       G    D
Sbjct  237   VPANSESALLKAVASQPISVAIDASGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSD  294

Query  980   ggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              G KYW++KNSWG +WGE GY+R+QRD    +GLCG+A AASYPT
Sbjct  295   DGTKYWLVKNSWGAQWGEEGYIRMQRDVDAAEGLCGIAMAASYPT  339



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   320 bits (820),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 170/344 (49%), Positives = 216/344 (63%), Gaps = 16/344 (5%)
 Frame = +2

Query  89    LLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVER  268
             ++     +LG  S    S      SM  R++QWMA +G+VY D  E + RFNIF+ NV  
Sbjct  12    IILALIFMLGALSSQATSRTLQDASMYGRYEQWMARYGRVYSDINEKEKRFNIFKENVAF  71

Query  269   IETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYAN  448
             IE+ N   NK +KL VN+FADLTN+EF+              +  G   ++K+  F+Y N
Sbjct  72    IESSNNDANKLHKLSVNQFADLTNEEFKA----------SRNRFMGHECSAKTTSFKYEN  121

Query  449   ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCD  628
              T  P T+DWR KGAVTP+KDQG CG CWAF+ VAA+EGI KL TG L+SLSEQELVDCD
Sbjct  122   VT-APPTLDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCD  180

Query  629   RKSY--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERV  802
                   GC+GG    AFQFI  N+GL+TE NYPY G     CN  K A+ A +I+G+E V
Sbjct  181   TSGVDQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVDG-TCNTKKEANHAAKITGHEDV  239

Query  803   PAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdg  982
             PA +E AL++AVA+QP+ + I+ G   F+FY  GVF+G C   LDH       G      
Sbjct  240   PANSEEALLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDH--GVTAVGYGVSAD  297

Query  983   gkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
             G KYW++KNSWGT WGE GY+R+QR    K+GLCG+A  ASYPT
Sbjct  298   GTKYWLVKNSWGTEWGEEGYIRMQRGIKAKEGLCGIAMEASYPT  341



>ref|XP_003578721.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=349

 Score =   320 bits (821),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 223/349 (64%), Gaps = 14/349 (4%)
 Frame = +2

Query  92    LFITTIILG---VWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNV  262
             +F+  ++LG   + S ++++      +M  RH+QWMA HG+VY D  E   RF  FRNNV
Sbjct  6     VFLLAVVLGCICLCSTVLSARELGDAAMVERHEQWMAQHGRVYKDGAEKARRFEAFRNNV  65

Query  263   ERIETFNAGPNK-GYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFR  439
               IE+FNA  N+  + LGVN+F DLTNDEFR      G++ R    V     AS +  FR
Sbjct  66    VFIESFNAAGNRRKFWLGVNQFTDLTNDEFRATKTNKGFIKRNAAAVN---KASPTGTFR  122

Query  440   YAN--ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQE  613
             Y+N  A  LP+ VDWR KGAVTPIK+QG CG CWAF+ VAA EGI +L TG LV LSEQE
Sbjct  123   YSNVSADALPAAVDWRAKGAVTPIKNQGQCGCCWAFSAVAATEGIVQLSTGKLVPLSEQE  182

Query  614   LVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRIS  787
             LVDCD     +GC+GG    AF+FI+ N GLT+E NYPY  +  + C    T +    I 
Sbjct  183   LVDCDANGADHGCEGGEMDDAFEFIIKNGGLTSETNYPYTAQDGQ-CKAKNTINSVATIK  241

Query  788   GYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygt  967
             GYE VPA +E +LM+AVA QPV + ++GGD  F+ Y  GV SG C   LDH    V  G 
Sbjct  242   GYEDVPANDEASLMKAVAAQPVSVAVDGGDMVFQHYAGGVLSGSCGTSLDH--GIVAVGY  299

Query  968   tagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
              A D G K+W++KNSWGT WGE+GY+R+++D AD  G+CGLA   SYPT
Sbjct  300   GAADDGTKFWLMKNSWGTTWGEDGYIRMEKDVADAGGMCGLAMQPSYPT  348



>ref|XP_003526232.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   320 bits (820),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 171/322 (53%), Positives = 210/322 (65%), Gaps = 17/322 (5%)
 Frame = +2

Query  161   SMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTN  340
             SM  RH+QWM  +GKVY D  E + RF +F+ NV  IE FN   NK YKLG+N+FADLTN
Sbjct  34    SMYERHEQWMTRYGKVYKDPQEREKRFRVFKENVNYIEAFNNAANKSYKLGINQFADLTN  93

Query  341   DEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFRYANATNLPSTVDWRNKGAVTPIKDQ  514
              EF         +  +N   +G M +S  ++  F++ N T  PSTVDWR KGAVTPIKDQ
Sbjct  94    KEF---------IAPRN-GFKGHMCSSIIRTTTFKFENVTATPSTVDWRQKGAVTPIKDQ  143

Query  515   GNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSY--GCDGGFPISAFQFIVN  688
             G CG CWAF+ VAA EGIH L  G L+SLSEQELVDCD K    GC+GG    AF+FI+ 
Sbjct  144   GQCGCCWAFSAVAATEGIHALSAGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQ  203

Query  689   NNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEIN  868
             N+GL TE NYPYKG   + CN  + A  A  I+GYE VPA NE AL +AVA+QPV + I+
Sbjct  204   NHGLNTEANYPYKGVDGK-CNANEAAKNAATITGYEDVPANNEMALQKAVANQPVSVAID  262

Query  869   GGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMR  1048
                  F+FY+ GVF+G C   LDH       G    D G +YW++KNSWGT WGE GY+R
Sbjct  263   ASGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGVSDDGTEYWLVKNSWGTEWGEEGYIR  320

Query  1049  IQRDYADKKGLCGLAKAASYPT  1114
             +QR    ++GLCG+A  ASYPT
Sbjct  321   MQRGVDSEEGLCGIAMQASYPT  342



>ref|XP_006582265.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=342

 Score =   320 bits (819),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 211/322 (66%), Gaps = 11/322 (3%)
 Frame = +2

Query  152   YQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFNAGPNKGYKLGVNKFAD  331
             +Q ++R RH+ WMA +GK+Y D  E + RF IF++NVE IE+FNA  NK YKLGVN  AD
Sbjct  30    HQTALRERHENWMAEYGKIYKDAAEKEKRFQIFKDNVEFIESFNAAGNKPYKLGVNHLAD  89

Query  332   LTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRYANATNLPSTVDWRNKGAVTPIKD  511
             LT +EF+             +  E   +  K   F+Y N T++P  +DWR KGAVTPIKD
Sbjct  90    LTLEEFKDSR------NGLKRTYEFSTTTFKLNGFKYENVTDIPEAIDWRVKGAVTPIKD  143

Query  512   QGN-CGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKSYGCDGGFPISAFQFIVN  688
             QG+ CGSCWAF+ +AA EGIH++ TGNLVSLSEQELVDCD    GC+GGF    F+FI+ 
Sbjct  144   QGDQCGSCWAFSTIAATEGIHQISTGNLVSLSEQELVDCDSVDDGCEGGFMEDGFEFIIK  203

Query  689   NNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAKNETALMQAVAHQPVLLEIN  868
             N G+T+E NYPYKG     CN    AS   +I GYE VP+ +E AL +AVA+QPV + I+
Sbjct  204   NGGITSETNYPYKGVD-GTCNTTIAASPVAQIKGYEIVPSYSEEALQKAVANQPVSVSIH  262

Query  869   GGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkkyWVIKNSWGTRWGENGYMR  1048
               +  F FY  G+++G+C   LDH    V       + G  YW++KNSWGT+WGE GY+R
Sbjct  263   ATNATFMFYSSGIYNGECGTDLDH---GVTAVGYGTENGTDYWIVKNSWGTQWGEKGYIR  319

Query  1049  IQRDYADKKGLCGLAKAASYPT  1114
             + R  A K G+CG+A  +SYPT
Sbjct  320   MHRGIAAKHGICGIALDSSYPT  341



>gb|AFW86317.1| hypothetical protein ZEAMMB73_339067 [Zea mays]
Length=433

 Score =   323 bits (827),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 220/358 (61%), Gaps = 20/358 (6%)
 Frame = +2

Query  53    HSNMASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEAD  232
              S MA+  L +S+  I        + + A        M  RH+QWMA + +VY D  E  
Sbjct  91    RSTMAT--LKASISAIIGFAFFCGAAMAARDLSDDSVMVARHEQWMAQYSRVYKDASEKA  148

Query  233   MRFNIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFM  412
              RF +F+ NV+ IE+FNAG N  + LGVN+FADLTNDEFR      G +   N K+    
Sbjct  149   RRFEVFKANVQFIESFNAGGNNKFWLGVNQFADLTNDEFRSTKTNKG-LKSSNMKIP---  204

Query  413   SASKSKHFRYAN--ATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTG  586
                    FRY N  A  LP+T+DWR KGAVTPIKDQG CG CWAF+ VAA EGI K+ TG
Sbjct  205   -----TGFRYENVSADALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTG  259

Query  587   NLVSLSEQELVDCDR--KSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMK  760
              LVSL+EQELVDCD   +  GC+GG    AF+FI+ N GLTTE +YPY     +      
Sbjct  260   KLVSLAEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESSYPYTAADGKC---KS  316

Query  761   TASKAVRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDH  940
              ++ A  I GYE VPA +E ALM+AVA+QPV + ++GGD  F+FY  GV +G C   LDH
Sbjct  317   GSNSAATIKGYEDVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDH  376

Query  941   gvtavgygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                    G      G KYW++KNSWGT WGENGY+R+++D +DK+G+CGLA   SYPT
Sbjct  377   --GIAAIGYGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  432



>ref|XP_004505498.1| PREDICTED: vignain-like [Cicer arietinum]
Length=344

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/342 (49%), Positives = 220/342 (64%), Gaps = 18/342 (5%)
 Frame = +2

Query  107   IILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNVERIETFN-  283
             + LG+W+    S      SM   H+QWM ++GKVY D+ E + R  IF  N+  I+ FN 
Sbjct  16    LCLGLWAIQGTSRTLQDDSMYESHEQWMRHYGKVYKDSQEKEKRSKIFTQNINYIQAFNN  75

Query  284   AGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS--KSKHFRYANATN  457
             AG +K YKLG+N++ADLTN+EF         +  +N K +G M +S  ++  F+Y N + 
Sbjct  76    AGNDKAYKLGINQYADLTNEEF---------ISSRN-KFKGHMCSSIIRTTTFKYENVSA  125

Query  458   LPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQELVDCDRKS  637
             +PSTVDWR KGAVTP+K+QG CG CWAF+ VAA EGIHKL TG L+SLSEQELVDCD K 
Sbjct  126   VPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKG  185

Query  638   Y--GCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISGYERVPAK  811
                GC+GG    AF+FI+ N+GL TE  YPY+G     CN  + +  A  I+GYE VP  
Sbjct  186   VDQGCEGGLMDDAFKFIIQNHGLDTEAQYPYQGVDG-TCNANEASIHAATITGYEDVPVN  244

Query  812   NETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygttagdggkk  991
             NE AL +AVA+QP+ + I+     F+FY+ GVF+G C   LDH       G    + G K
Sbjct  245   NEQALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDH--GVTAVGYGVSNDGTK  302

Query  992   yWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPTI  1117
             YW++KNSWGT WGE GY+R+QR     +GLCG+A  ASYPT+
Sbjct  303   YWLVKNSWGTDWGEQGYIRMQRGVDAAEGLCGIAMQASYPTV  344



>gb|EAY93078.1| hypothetical protein OsI_14879 [Oryza sativa Indica Group]
Length=339

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 222/348 (64%), Gaps = 20/348 (6%)
 Frame = +2

Query  86    SLLFITTIILGVWSYLVASTFDYQHS-MRLRHQQWMAYHGKVYVDTYEADMRFNIFRNNV  262
             +LLF     L + S ++A+     H+ M  RH++WM  +G+VY D  E   RF IF+ NV
Sbjct  6     ALLFAILSCLCLCSAVLAAREQSDHAAMVARHERWMEQYGRVYKDATEKARRFEIFKANV  65

Query  263   ERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSASKSKHFRY  442
               IE+FNAG +K + LGVN+FADLTN EFR      G++           +      FRY
Sbjct  66    AFIESFNAGNHK-FWLGVNQFADLTNYEFRATKTNKGFIPS---------TVRVPTTFRY  115

Query  443   ANAT--NLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSLSEQEL  616
              N +   LP+TVDWR KGAVTPIKDQG CG CWAF+ VAA+EGI KL TG L+SLSEQEL
Sbjct  116   ENVSIDTLPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQEL  175

Query  617   VDCD--RKSYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKAVRISG  790
             VDCD   +  GC+GG    AF+FI+ N GLTTE  YPY     + CN    ++ A  I G
Sbjct  176   VDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESKYPYTAADGK-CN--GGSNSAATIKG  232

Query  791   YERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtavgygtt  970
             YE VPA NE ALM+AVA+QPV + ++GGD  F+FY  GV +G C   LDH    V  G  
Sbjct  233   YEEVPANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDH--GIVAIGYG  290

Query  971   agdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
                 G +YW++KNSWGT WGENG++R+++D +DK+G+CGLA   SYPT
Sbjct  291   KDGDGTQYWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPT  338



>ref|XP_006469128.1| PREDICTED: vignain-like [Citrus sinensis]
Length=343

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/353 (48%), Positives = 227/353 (64%), Gaps = 13/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA +      L +  +IL + +  V S    + S+  +H+QWM+ +GKVY +  E + RF
Sbjct  1     MALRCQSLCKLALIFLILAIAASQVTSRKLQEASLSEKHEQWMSKYGKVYKNPEEKEKRF  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF++NVE IE+ NA  NK YKL +N+FAD TN EF+      GY     ++ +G +++ 
Sbjct  61    RIFKDNVEFIESLNAAGNKPYKLSINEFADQTNQEFKAFR--NGY-----RRPDG-LTSR  112

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             K   F+Y N  ++P+T+DWR  GAVTPIK+QG CGSCWAF+ VAA EGI +L TG L+SL
Sbjct  113   KGTSFKYENVIDVPATMDWRKNGAVTPIKNQGPCGSCWAFSAVAATEGITQLTTGKLISL  172

Query  602   SEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELV CD     +GC+GG    AF+FI++N+G+TTE NYPY+      CN    AS  
Sbjct  173   SEQELVSCDTSGVDHGCEGGEMEDAFKFIIHNDGITTEANYPYQAVDG-TCNKTNEASHV  231

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I GYE VPA +E AL++AVA+QPV + I+     F+FY  GVF+G C   LDH     
Sbjct  232   AKIKGYETVPANSEEALLKAVANQPVAVSIDASGSAFQFYSSGVFTGDCGTELDH--GVT  289

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G  A   G KYW++KNSWGT WGE GY+R++RD   K+GLCG+A  +SYPT
Sbjct  290   AVGYGATANGTKYWLVKNSWGTSWGEEGYIRMKRDIDAKEGLCGIAMDSSYPT  342



>ref|XP_006446763.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
 gb|ESR60003.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
Length=343

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/353 (47%), Positives = 222/353 (63%), Gaps = 13/353 (4%)
 Frame = +2

Query  62    MASKILGSSLLFITTIILGVWSYLVASTFDYQHSMRLRHQQWMAYHGKVYVDTYEADMRF  241
             MA +      L +  +I    +  V S    + S+  +H+QWM+ +GKVY +  E + RF
Sbjct  1     MALRCQSLCKLALIFLIFATATSQVTSRKLQEASLSEKHEQWMSKYGKVYKNPEEKEKRF  60

Query  242   NIFRNNVERIETFNAGPNKGYKLGVNKFADLTNDEFRRLHLVGGYVGRQNQKVEGFMSAS  421
              IF++NVE IE+ NA  NK YKL VN+FAD TN EF+          R   +    +++ 
Sbjct  61    RIFKDNVEFIESLNAAGNKPYKLSVNEFADQTNQEFKAF--------RNGYRRPNGLASR  112

Query  422   KSKHFRYANATNLPSTVDWRNKGAVTPIKDQGNCGSCWAFAVVAAVEGIHKLKTGNLVSL  601
             K   F+Y N  ++P+T+DWR  GAVTPIK+QG CGSCWAF+ VAA EGI +L TG L+SL
Sbjct  113   KGTSFKYENVIDVPATMDWRKNGAVTPIKNQGPCGSCWAFSAVAATEGITQLTTGKLISL  172

Query  602   SEQELVDCDRK--SYGCDGGFPISAFQFIVNNNGLTTEENYPYKGKQHRVCNFMKTASKA  775
             SEQELV CD     +GC+GG    AF+FI++N+G+TTE NYPY+      CN  K AS  
Sbjct  173   SEQELVSCDTSGVDHGCEGGEMEDAFKFIIHNDGITTEANYPYQAADG-TCNKTKEASHV  231

Query  776   VRISGYERVPAKNETALMQAVAHQPVLLEINGGDFHFRFYEKGVFSGKCKPHLDHgvtav  955
              +I GYE VPA +E AL++AVA+QPV + I+     F+FY  GVF+G C   LDH     
Sbjct  232   AKIKGYETVPANSEEALLKAVANQPVAVSIDASGSAFQFYSSGVFTGDCGTELDH--GVT  289

Query  956   gygttagdggkkyWVIKNSWGTRWGENGYMRIQRDYADKKGLCGLAKAASYPT  1114
               G  A   G KYW++KNSWGT WGE GY+R++RD   K+GLCG+A  +SYPT
Sbjct  290   AVGYGATANGTKYWLVKNSWGTSWGEEGYIRMKRDIDAKEGLCGIAMDSSYPT  342



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2953106737764