BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16958_g1_i2 len=2242 path=[1:0-1855 1857:1856-2241]

Length=2242
                                                                      Score     E

ref|XP_010320710.1|  PREDICTED: putative 1-phosphatidylinositol-3...    973   0.0      
ref|XP_009789649.1|  PREDICTED: putative 1-phosphatidylinositol-3...    970   0.0      
ref|XP_009630245.1|  PREDICTED: putative 1-phosphatidylinositol-3...    961   0.0      
ref|XP_009608884.1|  PREDICTED: putative 1-phosphatidylinositol-3...    949   0.0      
ref|XP_010319394.1|  PREDICTED: putative 1-phosphatidylinositol-3...    948   0.0      
ref|XP_009785563.1|  PREDICTED: putative 1-phosphatidylinositol-3...    942   0.0      
ref|XP_009785564.1|  PREDICTED: putative 1-phosphatidylinositol-3...    941   0.0      
emb|CDP00755.1|  unnamed protein product                                893   0.0      
gb|KDO64702.1|  hypothetical protein CISIN_1g000604mg                   876   0.0      
gb|KDO64701.1|  hypothetical protein CISIN_1g000604mg                   876   0.0      
ref|XP_011075701.1|  PREDICTED: putative 1-phosphatidylinositol-3...    878   0.0      
ref|XP_011075696.1|  PREDICTED: putative 1-phosphatidylinositol-3...    879   0.0      
ref|XP_006448284.1|  hypothetical protein CICLE_v100140271mg            863   0.0      
ref|XP_006495044.1|  PREDICTED: LOW QUALITY PROTEIN: putative 1-p...    864   0.0      
ref|XP_008243348.1|  PREDICTED: putative 1-phosphatidylinositol-3...    861   0.0      
ref|XP_009357816.1|  PREDICTED: LOW QUALITY PROTEIN: putative 1-p...    860   0.0      
gb|KDP38042.1|  hypothetical protein JCGZ_04685                         857   0.0      
ref|XP_004297361.1|  PREDICTED: uncharacterized protein LOC101297344    856   0.0      
ref|XP_008339567.1|  PREDICTED: putative 1-phosphatidylinositol-3...    852   0.0      
ref|XP_007225480.1|  hypothetical protein PRUPE_ppa000119mg             852   0.0      
ref|XP_007045106.1|  Forms aploid and binucleate cells 1c, putati...    848   0.0      
ref|XP_007045108.1|  Forms aploid and binucleate cells 1c, putati...    848   0.0      
ref|XP_010105766.1|  1-phosphatidylinositol-3-phosphate 5-kinase        842   0.0      
ref|XP_003631178.2|  PREDICTED: putative 1-phosphatidylinositol-3...    838   0.0      
ref|XP_002526008.1|  fyve finger-containing phosphoinositide kina...    832   0.0      Ricinus communis
ref|XP_008389223.1|  PREDICTED: putative 1-phosphatidylinositol-3...    822   0.0      
ref|XP_011038665.1|  PREDICTED: putative 1-phosphatidylinositol-3...    817   0.0      
ref|XP_002312432.2|  hypothetical protein POPTR_0008s127802g            811   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011070636.1|  PREDICTED: LOW QUALITY PROTEIN: putative 1-p...    810   0.0      
ref|XP_008454774.1|  PREDICTED: LOW QUALITY PROTEIN: putative 1-p...    806   0.0      
ref|XP_009356152.1|  PREDICTED: LOW QUALITY PROTEIN: putative 1-p...    806   0.0      
ref|XP_010274641.1|  PREDICTED: putative 1-phosphatidylinositol-3...    799   0.0      
gb|EYU19339.1|  hypothetical protein MIMGU_mgv1a000197mg                786   0.0      
gb|KHG05428.1|  1-phosphatidylinositol-3-phosphate 5-kinase             791   0.0      
ref|XP_011023174.1|  PREDICTED: putative 1-phosphatidylinositol-3...    786   0.0      
ref|XP_010259723.1|  PREDICTED: putative 1-phosphatidylinositol-3...    792   0.0      
ref|XP_011023165.1|  PREDICTED: putative 1-phosphatidylinositol-3...    789   0.0      
ref|XP_011023159.1|  PREDICTED: putative 1-phosphatidylinositol-3...    783   0.0      
gb|KHN43038.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        776   0.0      
gb|KEH30889.1|  phosphatidylinositol-4-phosphate 5-kinase family ...    773   0.0      
gb|AAL38344.1|  unknown protein                                         739   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010066632.1|  PREDICTED: putative 1-phosphatidylinositol-3...    767   0.0      
ref|XP_007157722.1|  hypothetical protein PHAVU_002G092900g             766   0.0      
gb|KHN32249.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        766   0.0      
ref|XP_010066631.1|  PREDICTED: putative 1-phosphatidylinositol-3...    763   0.0      
ref|XP_010681968.1|  PREDICTED: putative 1-phosphatidylinositol-3...    760   0.0      
ref|XP_010552722.1|  PREDICTED: putative 1-phosphatidylinositol-3...    755   0.0      
ref|XP_010552721.1|  PREDICTED: putative 1-phosphatidylinositol-3...    755   0.0      
ref|XP_004505260.1|  PREDICTED: putative 1-phosphatidylinositol-3...    754   0.0      
gb|KFK41525.1|  hypothetical protein AALP_AA2G140900                    741   0.0      
ref|NP_177257.3|  1-phosphatidylinositol-4-phosphate 5-kinase           736   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390816.1|  hypothetical protein EUTSA_v10018002mg             733   0.0      
ref|XP_009127840.1|  PREDICTED: putative 1-phosphatidylinositol-3...    729   0.0      
ref|XP_002887343.1|  predicted protein                                  732   0.0      
ref|XP_009106473.1|  PREDICTED: putative 1-phosphatidylinositol-3...    725   0.0      
ref|XP_010415795.1|  PREDICTED: putative 1-phosphatidylinositol-3...    723   0.0      
ref|XP_010471106.1|  PREDICTED: putative 1-phosphatidylinositol-3...    723   0.0      
ref|XP_006300582.1|  hypothetical protein CARUB_v10019654mg             721   0.0      
ref|XP_010427915.1|  PREDICTED: putative 1-phosphatidylinositol-3...    717   0.0      
emb|CDY03708.1|  BnaA02g15290D                                          667   0.0      
gb|KDO64704.1|  hypothetical protein CISIN_1g000604mg                   650   0.0      
ref|XP_002314813.2|  phosphatidylinositol-4-phosphate 5-kinase fa...    661   0.0      Populus trichocarpa [western balsam poplar]
emb|CDX72767.1|  BnaC06g32150D                                          638   0.0      
emb|CDY09508.1|  BnaC02g20500D                                          638   0.0      
ref|XP_011038666.1|  PREDICTED: putative 1-phosphatidylinositol-3...    635   0.0      
emb|CDX96293.1|  BnaA07g29040D                                          630   0.0      
ref|XP_010932596.1|  PREDICTED: putative 1-phosphatidylinositol-3...    633   0.0      
ref|XP_010932595.1|  PREDICTED: putative 1-phosphatidylinositol-3...    633   0.0      
ref|XP_007045109.1|  Forms aploid and binucleate cells 1c, putati...    624   0.0      
ref|XP_009381447.1|  PREDICTED: putative 1-phosphatidylinositol-3...    619   0.0      
ref|XP_007045107.1|  Phosphatidylinositol-4-phosphate 5-kinase fa...    616   0.0      
gb|EAZ42811.1|  hypothetical protein OsJ_27396                          612   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010909652.1|  PREDICTED: putative 1-phosphatidylinositol-3...    617   0.0      
gb|EEC83612.1|  hypothetical protein OsI_29312                          612   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001061851.1|  Os08g0428900                                       612   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010909650.1|  PREDICTED: putative 1-phosphatidylinositol-3...    614   0.0      
ref|XP_008800771.1|  PREDICTED: putative 1-phosphatidylinositol-3...    609   0.0      
ref|XP_008800770.1|  PREDICTED: putative 1-phosphatidylinositol-3...    609   0.0      
ref|XP_008800769.1|  PREDICTED: putative 1-phosphatidylinositol-3...    609   0.0      
ref|XP_006659418.1|  PREDICTED: putative 1-phosphatidylinositol-3...    602   0.0      
ref|XP_008801166.1|  PREDICTED: putative 1-phosphatidylinositol-3...    600   0.0      
gb|EMS47098.1|  1-phosphatidylinositol-3-phosphate 5-kinase fab1        601   0.0      
ref|XP_004956770.1|  PREDICTED: putative 1-phosphatidylinositol-3...    602   0.0      
gb|EMT17188.1|  1-phosphatidylinositol-3-phosphate 5-kinase fab1        601   0.0      
tpg|DAA49040.1|  TPA: putative 1-phosphatidylinositol-4-phosphate...    588   0.0      
ref|XP_010235142.1|  PREDICTED: putative 1-phosphatidylinositol-3...    600   0.0      
dbj|BAJ90327.1|  predicted protein                                      577   0.0      
ref|XP_008801162.1|  PREDICTED: putative 1-phosphatidylinositol-3...    599   0.0      
ref|XP_002462355.1|  hypothetical protein SORBIDRAFT_02g024300          595   0.0      Sorghum bicolor [broomcorn]
ref|XP_004973485.1|  PREDICTED: putative 1-phosphatidylinositol-3...    592   0.0      
ref|XP_008652690.1|  PREDICTED: putative 1-phosphatidylinositol-3...    591   0.0      
ref|XP_006841270.1|  hypothetical protein AMTR_s00135p00112810          577   0.0      
ref|XP_008664671.1|  PREDICTED: putative 1-phosphatidylinositol-3...    589   0.0      
gb|EMS52787.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        585   0.0      
ref|XP_002445523.1|  hypothetical protein SORBIDRAFT_07g020930          588   0.0      Sorghum bicolor [broomcorn]
gb|EMT15939.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        585   0.0      
ref|XP_009410073.1|  PREDICTED: LOW QUALITY PROTEIN: putative 1-p...    588   0.0      
gb|EEE69670.1|  hypothetical protein OsJ_29297                          549   1e-172   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84553.1|  hypothetical protein OsI_31305                          547   4e-172   Oryza sativa Indica Group [Indian rice]
ref|XP_004965176.1|  PREDICTED: putative 1-phosphatidylinositol-3...    545   5e-171   
ref|XP_002532951.1|  fyve finger-containing phosphoinositide kina...    545   1e-169   Ricinus communis
ref|XP_009338310.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    531   1e-164   
ref|XP_006655983.1|  PREDICTED: putative 1-phosphatidylinositol-3...    528   2e-164   
ref|XP_008380740.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    528   3e-164   
ref|XP_004303752.1|  PREDICTED: 1-phosphatidylinositol 3-phosphat...    530   7e-164   
ref|XP_006369088.1|  phosphatidylinositol-4-phosphate 5-kinase fa...    527   4e-163   
ref|XP_006342901.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    526   6e-163   
ref|XP_008380739.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    527   6e-163   
gb|KDP40633.1|  hypothetical protein JCGZ_24632                         525   6e-162   
ref|XP_011072684.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    524   9e-162   
ref|XP_006342900.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    523   2e-161   
ref|XP_002303331.2|  hypothetical protein POPTR_0003s06990g             522   3e-161   Populus trichocarpa [western balsam poplar]
ref|XP_009766673.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    521   4e-161   
ref|XP_010227777.1|  PREDICTED: putative 1-phosphatidylinositol-3...    518   4e-161   
ref|XP_009338309.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    522   6e-161   
gb|EEC80352.1|  hypothetical protein OsI_22436                          518   1e-160   Oryza sativa Indica Group [Indian rice]
ref|XP_010654371.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    521   1e-160   
gb|EEE65479.1|  hypothetical protein OsJ_20877                          517   1e-160   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006828631.1|  hypothetical protein AMTR_s00129p00092160          521   1e-160   
ref|NP_001061943.1|  Os08g0450800                                       497   2e-160   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD46198.1|  finger-containing phosphoinositide kinase-like         518   2e-160   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009596386.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    518   5e-160   
ref|XP_007214898.1|  hypothetical protein PRUPE_ppa000102mg             519   5e-160   
ref|XP_002438189.1|  hypothetical protein SORBIDRAFT_10g009370          515   7e-160   Sorghum bicolor [broomcorn]
ref|XP_010096542.1|  1-phosphatidylinositol-3-phosphate 5-kinase        518   1e-159   
ref|XP_004235530.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    517   2e-159   
ref|XP_011015189.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    517   3e-159   
ref|XP_011036541.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    517   3e-159   
ref|XP_011015187.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    517   4e-159   
ref|XP_011036539.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    517   4e-159   
gb|KHN17761.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        516   5e-159   
ref|XP_010273819.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    516   6e-159   
gb|KHN01471.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        516   7e-159   
ref|XP_006583188.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    515   1e-158   
ref|XP_003529857.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    515   1e-158   
ref|XP_011079346.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    515   2e-158   
ref|XP_010318454.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    513   5e-158   
ref|XP_011048623.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    513   6e-158   
ref|XP_011048619.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    513   8e-158   
ref|XP_011048624.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    513   9e-158   
ref|XP_010033658.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    513   1e-157   
ref|XP_004510566.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    512   2e-157   
ref|XP_009766672.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    511   3e-157   
ref|XP_010314342.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    509   4e-157   
gb|EYU21277.1|  hypothetical protein MIMGU_mgv1a000104mg                510   5e-157   
ref|XP_010314341.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    509   5e-157   
ref|XP_010314340.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    509   6e-157   
dbj|BAJ98373.1|  predicted protein                                      510   8e-157   
ref|XP_010314339.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    509   1e-156   
emb|CBI35800.3|  unnamed protein product                                507   2e-156   
gb|KEH18518.1|  1-phosphatidylinositol-3-phosphate 5-kinase             509   2e-156   
ref|XP_003627444.1|  1-phosphatidylinositol-3-phosphate 5-kinase        509   2e-156   
ref|XP_008797353.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    509   3e-156   
gb|EYU45914.1|  hypothetical protein MIMGU_mgv1a000120mg                507   4e-156   
ref|XP_009776139.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    508   5e-156   
ref|XP_009776138.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    508   5e-156   
ref|XP_010314338.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    507   7e-156   
gb|KDO53776.1|  hypothetical protein CISIN_1g0002782mg                  504   7e-156   
ref|XP_007012515.1|  Phosphatidylinositol-4-phosphate 5-kinase fa...    508   7e-156   
ref|XP_004252409.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    507   8e-156   
ref|XP_007012516.1|  Phosphatidylinositol-4-phosphate 5-kinase fa...    508   9e-156   
ref|XP_009596384.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    506   1e-155   
ref|XP_009609632.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    506   2e-155   
gb|EYU30054.1|  hypothetical protein MIMGU_mgv1a0181643mg               468   3e-155   
gb|KHN45046.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        506   4e-155   
ref|XP_009601607.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    504   6e-155   
ref|XP_006465809.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    505   6e-155   
ref|XP_009601608.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    504   6e-155   
ref|XP_008797354.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    504   1e-154   
ref|XP_008797351.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    505   1e-154   
ref|XP_006593969.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    504   2e-154   
ref|XP_009357937.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    504   2e-154   
ref|XP_008647401.1|  PREDICTED: uncharacterized protein LOC100193...    500   3e-154   
gb|KHN39576.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        502   9e-154   
ref|XP_010323385.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    501   1e-153   
ref|XP_009766174.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    499   2e-153   
ref|XP_010261689.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    501   2e-153   
ref|XP_003547898.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    500   4e-153   
ref|XP_002867192.1|  hypothetical protein ARALYDRAFT_491361             499   5e-153   
ref|XP_002277309.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    500   6e-153   Vitis vinifera
ref|XP_010432594.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    498   7e-153   
ref|XP_010656079.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    499   8e-153   
ref|XP_009766171.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    499   1e-152   
emb|CDX68958.1|  BnaC01g04950D                                          497   1e-152   
ref|XP_006426793.1|  hypothetical protein CICLE_v10027324mg             498   2e-152   
ref|XP_006282992.1|  hypothetical protein CARUB_v10003977mg             497   2e-152   
ref|XP_010487226.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    497   3e-152   
gb|KHG26950.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        496   3e-152   
ref|XP_009417532.1|  PREDICTED: LOW QUALITY PROTEIN: 1-phosphatid...    498   4e-152   
ref|XP_006659465.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    497   5e-152   
ref|XP_006344562.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    497   6e-152   
ref|XP_010432591.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    496   6e-152   
ref|XP_010432593.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    496   6e-152   
gb|KHG22978.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        497   7e-152   
ref|XP_010432592.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    496   7e-152   
ref|XP_010432587.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    496   7e-152   
ref|XP_010543031.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    495   1e-151   
ref|XP_007135367.1|  hypothetical protein PHAVU_010G123500g             496   1e-151   
ref|NP_188044.1|  phosphatidylinositol-3P 5-kinase-like                 495   2e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002444449.1|  hypothetical protein SORBIDRAFT_07g022110          494   4e-151   Sorghum bicolor [broomcorn]
emb|CDO97796.1|  unnamed protein product                                494   7e-151   
ref|NP_001078484.4|  1-phosphatidylinositol-3-phosphate 5-kinase ...    493   1e-150   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36798.1|  putative protein                                       493   1e-150   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195050.6|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1A     493   1e-150   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD08735.1|  1-phosphatidylinositol-3-phosphate 5-kinase-like       493   2e-150   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010685217.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    493   2e-150   
ref|XP_002882874.1|  phosphatidylinositol-4-phosphate 5-kinase fa...    493   2e-150   
ref|XP_006344558.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    492   3e-150   
gb|EAZ42938.1|  hypothetical protein OsJ_27527                          493   3e-150   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83663.1|  hypothetical protein OsI_29434                          492   4e-150   Oryza sativa Indica Group [Indian rice]
emb|CDX75341.1|  BnaA01g03610D                                          489   9e-150   
ref|XP_010465319.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    491   9e-150   
ref|XP_010917369.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    491   1e-149   
ref|NP_001190899.1|  1-phosphatidylinositol-3-phosphate 5-kinase ...    490   1e-149   
ref|XP_009404098.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    490   1e-149   
ref|XP_010687594.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    490   2e-149   
ref|XP_009404097.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    490   2e-149   
ref|XP_010687592.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    489   3e-149   
ref|XP_009124093.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    488   3e-149   
ref|XP_009123916.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    488   3e-149   
ref|XP_008228111.1|  PREDICTED: LOW QUALITY PROTEIN: 1-phosphatid...    489   6e-149   
emb|CDP03026.1|  unnamed protein product                                488   6e-149   
ref|XP_006296819.1|  hypothetical protein CARUB_v10012801mg             487   2e-148   
ref|XP_009391204.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    483   2e-148   
ref|XP_008462242.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    487   3e-148   
ref|XP_004973590.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    486   4e-148   
ref|XP_009391203.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    484   6e-148   
ref|XP_004141731.1|  PREDICTED: 1-phosphatidylinositol 3-phosphat...    485   1e-147   
ref|XP_006407097.1|  hypothetical protein EUTSA_v10019882mg             484   1e-147   
gb|KGN45440.1|  hypothetical protein Csa_7G448020                       485   2e-147   
gb|EMS57448.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        481   2e-147   
ref|XP_006474562.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    484   2e-147   
ref|XP_004287678.1|  PREDICTED: 1-phosphatidylinositol 3-phosphat...    484   4e-147   
ref|XP_006452907.1|  hypothetical protein CICLE_v10010149mg             484   4e-147   
gb|KDO73752.1|  hypothetical protein CISIN_1g000222mg                   484   4e-147   
ref|XP_008800515.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    484   4e-147   
ref|XP_009391198.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    483   5e-147   
gb|KDO73753.1|  hypothetical protein CISIN_1g000222mg                   483   6e-147   
ref|XP_009391201.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    483   6e-147   
ref|XP_009359681.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    483   8e-147   
gb|EMT29808.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        478   9e-147   
ref|XP_006412375.1|  hypothetical protein EUTSA_v10024198mg             482   9e-147   
ref|XP_009359680.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    482   1e-146   
ref|XP_008337796.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    482   1e-146   
ref|XP_008462241.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    482   1e-146   
ref|XP_009135374.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    481   2e-146   
gb|EPS70417.1|  hypothetical protein M569_04338                         480   3e-146   
gb|KFK38794.1|  hypothetical protein AALP_AA3G161200                    477   7e-145   
emb|CDY33237.1|  BnaC01g37100D                                          476   8e-145   
ref|XP_009117010.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    476   1e-144   
ref|XP_004155896.1|  PREDICTED: LOW QUALITY PROTEIN: 1-phosphatid...    476   2e-144   
ref|XP_007203059.1|  hypothetical protein PRUPE_ppa000098mg             476   2e-144   
ref|XP_010534978.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    476   2e-144   
emb|CBI26914.3|  unnamed protein product                                470   6e-144   
ref|XP_008242150.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    473   2e-143   
gb|AAP12926.1|  putative phosphatidylinositol 3,5-kinase                473   4e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002978230.1|  hypothetical protein SELMODRAFT_152378             466   6e-141   
ref|XP_002966331.1|  hypothetical protein SELMODRAFT_144057             465   9e-141   
ref|XP_010228523.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    463   1e-140   
ref|XP_002465163.1|  hypothetical protein SORBIDRAFT_01g033120          463   1e-139   Sorghum bicolor [broomcorn]
ref|XP_010228521.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    462   2e-139   
gb|EEE59213.1|  hypothetical protein OsJ_11169                          461   5e-139   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008656654.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    461   8e-139   
ref|XP_008443752.1|  PREDICTED: LOW QUALITY PROTEIN: 1-phosphatid...    449   9e-135   
ref|XP_009117025.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    442   3e-132   
gb|EPS72335.1|  hypothetical protein M569_02422                         433   1e-130   
ref|XP_007012517.1|  Phosphatidylinositol-4-phosphate 5-kinase fa...    433   3e-129   
ref|XP_009766173.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    424   3e-126   
ref|NP_001132050.1|  uncharacterized protein LOC100193462               392   7e-126   Zea mays [maize]
dbj|BAK02868.1|  predicted protein                                      389   1e-124   
ref|XP_003574573.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    419   3e-124   
ref|XP_009117033.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    419   3e-124   
ref|XP_007154537.1|  hypothetical protein PHAVU_003G127000g             417   1e-123   
ref|XP_011093896.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    417   2e-123   
ref|XP_011093897.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    416   2e-123   
ref|XP_011015190.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    415   6e-123   
ref|XP_011036542.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    415   6e-123   
ref|XP_006362099.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    414   2e-122   
ref|XP_010937258.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    414   3e-122   
gb|ADE76895.1|  unknown                                                 380   4e-122   
ref|XP_010049310.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    413   4e-122   
ref|XP_010049309.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    413   5e-122   
ref|XP_010049305.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    413   5e-122   
ref|XP_008678482.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    412   7e-122   
ref|XP_004508047.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    412   9e-122   
ref|XP_004508046.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    412   1e-121   
ref|XP_004508043.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    412   1e-121   
ref|XP_008783268.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    410   3e-121   
gb|AES92138.2|  1-phosphatidylinositol-3-phosphate 5-kinase             410   4e-121   
gb|EPS70672.1|  hypothetical protein M569_04087                         391   6e-121   
ref|XP_003609941.1|  1-phosphatidylinositol-3-phosphate 5-kinase-...    409   1e-120   
ref|XP_002516199.1|  fyve finger-containing phosphoinositide kina...    409   1e-120   
ref|XP_007024761.1|  Phosphatidylinositol-4-phosphate 5-kinase fa...    408   2e-120   
ref|XP_010939855.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    408   3e-120   
gb|KHF97654.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        407   4e-120   
gb|KHF97653.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        407   4e-120   
emb|CBI27745.3|  unnamed protein product                                406   8e-120   
ref|NP_001063125.1|  Os09g0402300                                       374   1e-119   
dbj|BAK00464.1|  predicted protein                                      379   2e-119   
gb|EYU25796.1|  hypothetical protein MIMGU_mgv1a000111mg                401   5e-118   
ref|XP_010444990.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    399   1e-117   
emb|CAN62134.1|  hypothetical protein VITISV_043718                     400   2e-117   
ref|XP_010451064.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    399   2e-117   
ref|XP_010107086.1|  1-phosphatidylinositol-3-phosphate 5-kinase        399   3e-117   
gb|KHG24593.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        367   1e-115   
ref|XP_008391859.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    394   2e-115   
gb|KFK44391.1|  hypothetical protein AALP_AA1G251400                    385   5e-115   
ref|XP_009369728.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    391   2e-114   
gb|KDP33967.1|  hypothetical protein JCGZ_07538                         390   5e-114   
emb|CDX82488.1|  BnaA03g33330D                                          388   9e-114   
gb|AAK55470.1|AC084295_3  putative phosphoinositide kinase              388   1e-113   
emb|CDX75762.1|  BnaC03g38450D                                          387   2e-113   
ref|XP_006840480.1|  hypothetical protein AMTR_s00045p00187010          387   3e-113   
emb|CDY60692.1|  BnaA01g37040D                                          385   1e-112   
gb|KHG15460.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        384   2e-112   
gb|KGN66716.1|  hypothetical protein Csa_1G662800                       385   3e-112   
ref|XP_006650173.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    384   7e-112   
ref|NP_001050308.2|  Os03g0399500                                       379   1e-110   
ref|XP_004970746.1|  PREDICTED: putative 1-phosphatidylinositol-3...    376   1e-109   
ref|XP_004970745.1|  PREDICTED: putative 1-phosphatidylinositol-3...    376   1e-109   
ref|XP_001764065.1|  predicted protein                                  374   2e-108   
ref|XP_001759204.1|  predicted protein                                  370   2e-107   
ref|XP_004496391.1|  PREDICTED: putative 1-phosphatidylinositol-3...    364   1e-105   
gb|KHN17069.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        357   3e-103   
ref|XP_006589466.1|  PREDICTED: putative 1-phosphatidylinositol-3...    357   4e-103   
ref|XP_010312807.1|  PREDICTED: putative 1-phosphatidylinositol-3...    358   4e-103   
ref|XP_006589464.1|  PREDICTED: putative 1-phosphatidylinositol-3...    357   5e-103   
ref|XP_006606199.1|  PREDICTED: putative 1-phosphatidylinositol-3...    356   8e-103   
ref|XP_006606196.1|  PREDICTED: putative 1-phosphatidylinositol-3...    355   2e-102   
gb|KDP34673.1|  hypothetical protein JCGZ_11021                         355   3e-102   
ref|XP_006351186.1|  PREDICTED: putative 1-phosphatidylinositol-3...    354   8e-102   
ref|XP_006859220.1|  hypothetical protein AMTR_s00070p00199150          353   1e-101   
gb|KHN00780.1|  1-phosphatidylinositol-3-phosphate 5-kinase             351   5e-101   
ref|XP_010256247.1|  PREDICTED: putative 1-phosphatidylinositol-3...    347   5e-99    
ref|XP_009757782.1|  PREDICTED: putative 1-phosphatidylinositol-3...    340   6e-97    
gb|EMT13918.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        324   8e-97    
ref|XP_009757781.1|  PREDICTED: putative 1-phosphatidylinositol-3...    338   4e-96    
gb|EMS52479.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        322   4e-96    
ref|XP_007024762.1|  Phosphatidylinositol-4-phosphate 5-kinase fa...    335   6e-95    
ref|XP_002326011.2|  phosphatidylinositol-4-phosphate 5-kinase fa...    324   7e-92    
ref|XP_010910307.1|  PREDICTED: putative 1-phosphatidylinositol-3...    326   8e-92    
ref|XP_008781570.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    324   8e-92    
ref|XP_006376330.1|  hypothetical protein POPTR_0013s12070g             325   1e-91    
ref|XP_010910903.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    326   1e-91    
ref|XP_008781571.1|  PREDICTED: putative 1-phosphatidylinositol-3...    323   1e-91    
ref|XP_008781569.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    324   2e-91    
ref|XP_008783365.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    324   3e-91    
ref|XP_010277658.1|  PREDICTED: putative 1-phosphatidylinositol-3...    324   4e-91    
ref|XP_010277655.1|  PREDICTED: putative 1-phosphatidylinositol-3...    324   4e-91    
ref|XP_008783363.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    324   4e-91    
ref|XP_008783362.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    324   4e-91    
emb|CDP19435.1|  unnamed protein product                                322   8e-91    
ref|XP_001757150.1|  predicted protein                                  320   1e-90    
ref|XP_009764027.1|  PREDICTED: putative 1-phosphatidylinositol-3...    318   5e-90    
ref|XP_009764026.1|  PREDICTED: putative 1-phosphatidylinositol-3...    319   6e-90    
ref|XP_009764024.1|  PREDICTED: putative 1-phosphatidylinositol-3...    318   2e-89    
ref|XP_011002507.1|  PREDICTED: putative 1-phosphatidylinositol-3...    318   3e-89    
emb|CAN65296.1|  hypothetical protein VITISV_042325                     317   4e-89    
ref|XP_010665036.1|  PREDICTED: putative 1-phosphatidylinositol-3...    317   6e-89    
emb|CBI38138.3|  unnamed protein product                                315   6e-89    
ref|XP_009588125.1|  PREDICTED: putative 1-phosphatidylinositol-3...    316   1e-88    
gb|KDO83973.1|  hypothetical protein CISIN_1g000298mg                   308   3e-88    
ref|XP_009414616.1|  PREDICTED: putative 1-phosphatidylinositol-3...    314   6e-88    
ref|XP_009399248.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    314   7e-88    
ref|XP_009414618.1|  PREDICTED: putative 1-phosphatidylinositol-3...    314   7e-88    
ref|XP_009414615.1|  PREDICTED: putative 1-phosphatidylinositol-3...    314   7e-88    
ref|XP_009414617.1|  PREDICTED: putative 1-phosphatidylinositol-3...    314   8e-88    
ref|XP_007143620.1|  hypothetical protein PHAVU_007G087000g             313   1e-87    
ref|XP_011038183.1|  PREDICTED: putative 1-phosphatidylinositol-3...    313   2e-87    
dbj|BAJ95953.1|  predicted protein                                      304   2e-87    
gb|EEC82770.1|  hypothetical protein OsI_27507                          311   7e-87    
ref|NP_001060780.1|  Os08g0104700                                       311   7e-87    
gb|EMT18364.1|  1-phosphatidylinositol-3-phosphate 5-kinase             310   1e-86    
gb|EMS49481.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        309   2e-86    
ref|XP_006473230.1|  PREDICTED: putative 1-phosphatidylinositol-3...    310   2e-86    
gb|KDO83972.1|  hypothetical protein CISIN_1g000298mg                   310   2e-86    
gb|KDO83966.1|  hypothetical protein CISIN_1g000298mg                   310   3e-86    
gb|KDO83971.1|  hypothetical protein CISIN_1g000298mg                   310   3e-86    
ref|XP_006434650.1|  hypothetical protein CICLE_v10000021mg             310   3e-86    
gb|KDO83970.1|  hypothetical protein CISIN_1g000298mg                   310   3e-86    
ref|XP_006473227.1|  PREDICTED: putative 1-phosphatidylinositol-3...    310   3e-86    
ref|XP_006473229.1|  PREDICTED: putative 1-phosphatidylinositol-3...    309   4e-86    
ref|XP_008381022.1|  PREDICTED: putative 1-phosphatidylinositol-3...    307   1e-85    
ref|XP_006659026.1|  PREDICTED: putative 1-phosphatidylinositol-3...    307   2e-85    
ref|XP_010094837.1|  1-phosphatidylinositol-3-phosphate 5-kinase        307   2e-85    
ref|XP_009339742.1|  PREDICTED: putative 1-phosphatidylinositol-3...    306   4e-85    
gb|KEH43594.1|  phosphatidylinositol-4-phosphate 5-kinase family ...    306   5e-85    
gb|KCW69091.1|  hypothetical protein EUGRSUZ_F02638                     303   5e-85    
gb|KHG19683.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        305   7e-85    
gb|EAY96166.1|  hypothetical protein OsI_18048                          303   8e-85    
ref|XP_010261692.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    305   9e-85    
gb|EEE61970.1|  hypothetical protein OsJ_16746                          303   1e-84    
emb|CAE05780.2|  OSJNBb0020J19.9                                        303   1e-84    
ref|NP_001054363.1|  Os04g0691900                                       303   1e-84    
ref|XP_007020232.1|  Forms aploid and binucleate cells 1a, putative     305   1e-84    
ref|XP_009339070.1|  PREDICTED: putative 1-phosphatidylinositol-3...    304   2e-84    
ref|XP_009375246.1|  PREDICTED: putative 1-phosphatidylinositol-3...    303   3e-84    
ref|XP_009589126.1|  PREDICTED: putative 1-phosphatidylinositol-3...    303   3e-84    
ref|XP_004292497.1|  PREDICTED: uncharacterized protein LOC101303674    303   3e-84    
ref|XP_004959937.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    302   4e-84    
ref|XP_004959936.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    302   4e-84    
ref|XP_011097420.1|  PREDICTED: putative 1-phosphatidylinositol-3...    303   4e-84    
ref|XP_010062024.1|  PREDICTED: putative 1-phosphatidylinositol-3...    303   5e-84    
ref|XP_002444867.1|  hypothetical protein SORBIDRAFT_07g000590          301   7e-84    
ref|XP_008237356.1|  PREDICTED: putative 1-phosphatidylinositol-3...    302   8e-84    
ref|XP_008674769.1|  PREDICTED: LOW QUALITY PROTEIN: putative 1-p...    302   1e-83    
ref|XP_006660485.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    302   1e-83    
gb|AFW61470.1|  putative 1-phosphatidylinositol-4-phosphate 5-kin...    300   1e-83    
ref|XP_011074908.1|  PREDICTED: putative 1-phosphatidylinositol-3...    302   1e-83    
gb|EMT16171.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        301   1e-83    
ref|XP_007201769.1|  hypothetical protein PRUPE_ppa000155mg             301   2e-83    
ref|XP_002456722.1|  hypothetical protein SORBIDRAFT_03g041400          301   2e-83    
ref|XP_010240677.1|  PREDICTED: putative 1-phosphatidylinositol-3...    300   3e-83    
ref|XP_008678353.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    301   3e-83    
ref|XP_008678352.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    301   3e-83    
ref|XP_010240676.1|  PREDICTED: putative 1-phosphatidylinositol-3...    300   3e-83    
ref|XP_010234247.1|  PREDICTED: putative 1-phosphatidylinositol-3...    300   3e-83    
ref|XP_002533319.1|  phosphatidylinositol-4-phosphate 5-kinase, p...    300   4e-83    
ref|XP_008648351.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    300   4e-83    
ref|XP_010232631.1|  PREDICTED: putative 1-phosphatidylinositol-3...    300   5e-83    
gb|EMT13577.1|  1-phosphatidylinositol-3-phosphate 5-kinase             298   1e-82    
tpg|DAA36809.1|  TPA: putative 1-phosphatidylinositol-4-phosphate...    296   1e-82    
tpg|DAA36808.1|  TPA: putative 1-phosphatidylinositol-4-phosphate...    296   1e-82    
ref|XP_008669131.1|  PREDICTED: putative 1-phosphatidylinositol-3...    296   2e-82    
ref|XP_004139862.1|  PREDICTED: uncharacterized protein LOC101202759    298   2e-82    
ref|XP_002447383.1|  hypothetical protein SORBIDRAFT_06g034080          297   2e-82    
gb|KGN44142.1|  hypothetical protein Csa_7G206930                       297   3e-82    
ref|XP_008669129.1|  PREDICTED: putative 1-phosphatidylinositol-3...    296   3e-82    
ref|XP_008669130.1|  PREDICTED: putative 1-phosphatidylinositol-3...    296   3e-82    
ref|XP_009114746.1|  PREDICTED: putative 1-phosphatidylinositol-3...    296   3e-82    
dbj|BAD36309.1|  putative phosphatidylinositol 3,5-kinase               272   7e-82    
gb|EMS46825.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1        295   1e-81    
gb|EYU22891.1|  hypothetical protein MIMGU_mgv1a000228mg                294   2e-81    
gb|KDO83969.1|  hypothetical protein CISIN_1g000298mg                   295   2e-81    
ref|XP_006396074.1|  hypothetical protein EUTSA_v10006561mg             294   3e-81    
ref|XP_006282991.1|  hypothetical protein CARUB_v10003977mg             293   6e-81    
ref|XP_004972428.1|  PREDICTED: 1-phosphatidylinositol-3-phosphat...    293   9e-81    
ref|XP_010673144.1|  PREDICTED: putative 1-phosphatidylinositol-3...    293   1e-80    
ref|NP_001062754.1|  Os09g0278300                                       292   2e-80    
gb|EEE52995.1|  hypothetical protein OsJ_35674                          292   2e-80    
gb|EEC69059.1|  hypothetical protein OsI_37911                          292   2e-80    
dbj|BAD26014.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1...    292   2e-80    
ref|NP_001176862.1|  Os12g0236700                                       292   3e-80    
ref|XP_006306586.1|  hypothetical protein CARUB_v10008090mg             290   5e-80    
ref|XP_010322750.1|  PREDICTED: putative 1-phosphatidylinositol-3...    290   1e-79    
ref|XP_001759269.1|  predicted protein                                  268   1e-79    
ref|XP_010499968.1|  PREDICTED: putative 1-phosphatidylinositol-3...    287   2e-79    
ref|XP_010478859.1|  PREDICTED: putative 1-phosphatidylinositol-3...    288   3e-79    
ref|XP_010478858.1|  PREDICTED: putative 1-phosphatidylinositol-3...    288   3e-79    
ref|XP_006353641.1|  PREDICTED: putative 1-phosphatidylinositol-3...    288   5e-79    
ref|XP_010499972.1|  PREDICTED: putative 1-phosphatidylinositol-3...    287   7e-79    
ref|XP_002891093.1|  phosphatidylinositol-4-phosphate 5-kinase fa...    286   2e-78    
ref|XP_010555713.1|  PREDICTED: putative 1-phosphatidylinositol-3...    284   8e-78    
ref|NP_174686.1|  putative 1-phosphatidylinositol-3-phosphate 5-k...    283   2e-77    
gb|AFK41922.1|  unknown                                                 248   3e-73    
ref|XP_006680273.1|  hypothetical protein BATDEDRAFT_17199              249   4e-71    
gb|KDD77007.1|  phosphatidylinositol-4-phosphate 5-kinase               243   1e-69    
ref|XP_453267.1|  hypothetical protein                                  261   2e-69    
ref|XP_009631803.1|  PREDICTED: putative 1-phosphatidylinositol-3...    255   1e-68    
gb|EKC97625.1|  hypothetical protein A1Q2_08084                         253   5e-68    
ref|XP_009773254.1|  PREDICTED: LOW QUALITY PROTEIN: putative 1-p...    253   7e-68    
gb|AGS58192.1|  hypothetical protein                                    231   1e-67    
emb|CCA39223.1|  1-phosphatidylinositol-3-phosphate 5-kinase            253   5e-67    
ref|XP_002556421.1|  KLTH0H12804p                                       253   5e-67    
emb|CDO92951.1|  unnamed protein product                                252   1e-66    
emb|CEG82272.1|  Putative 1-phosphatidylinositol-3-phosphate 5-ki...    248   1e-66    
gb|AGS58194.1|  hypothetical protein                                    228   1e-66    
ref|XP_007298804.1|  hypothetical protein STEHIDRAFT_143737             252   2e-66    
gb|AGS58193.1|  hypothetical protein                                    227   4e-66    
gb|EPB86667.1|  1-phosphatidylinositol-3-phosphate 5-kinase             251   5e-66    
gb|KDR20319.1|  1-phosphatidylinositol-3-phosphate 5-kinase             250   7e-66    
ref|XP_007312981.1|  hypothetical protein SERLADRAFT_353741             250   7e-66    
dbj|BAP70463.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1       250   8e-66    
gb|EGO05244.1|  hypothetical protein SERLA73DRAFT_82824                 250   8e-66    
gb|EJU00051.1|  hypothetical protein DACRYDRAFT_117647                  250   9e-66    
dbj|BAO38931.1|  1-phosphatidylinositol-3-phosphate 5-kinase FAB1       249   1e-65    
emb|CEG72455.1|  Putative 1-phosphatidylinositol-3-phosphate 5-ki...    249   1e-65    
gb|KDQ31277.1|  hypothetical protein PLEOSDRAFT_1063197                 249   1e-65    
gb|EMD32532.1|  hypothetical protein CERSUDRAFT_118584                  249   1e-65    
gb|ESX01904.1|  1-phosphatidylinositol-3-phosphate 5-kinase             247   4e-65    
ref|XP_007796318.1|  putative 1-phosphatidylinositol-3-phosphate ...    234   4e-65    
ref|XP_006454218.1|  hypothetical protein AGABI2DRAFT_113973            248   4e-65    
gb|EIF48311.1|  1-phosphatidylinositol-3-phosphate 5-kinase             242   5e-65    
ref|XP_007325737.1|  hypothetical protein AGABI1DRAFT_124322            248   5e-65    
ref|XP_009540810.1|  hypothetical protein HETIRDRAFT_307813             247   5e-65    
gb|KGK40761.1|  hypothetical protein JL09_g278                          246   8e-65    
ref|XP_007860617.1|  hypothetical protein GLOTRDRAFT_134891             247   8e-65    
ref|XP_001732692.1|  hypothetical protein MGL_0467                      247   9e-65    
ref|XP_007007254.1|  hypothetical protein TREMEDRAFT_34462              246   1e-64    
emb|CDK25179.1|  unnamed protein product                                246   1e-64    
gb|KEP53422.1|  1-phosphatidylinositol-3-phosphate 5-kinase             246   1e-64    
gb|EUC63876.1|  1-phosphatidylinositol-3-phosphate 5-kinase             246   1e-64    
emb|CCA68733.1|  probable FAB1-phosphatidylinositol 3-phosphate 5...    246   1e-64    
ref|XP_007340033.1|  hypothetical protein AURDEDRAFT_181710             246   1e-64    
emb|CCM03779.1|  predicted protein                                      246   2e-64    
ref|XP_784176.2|  PREDICTED: 1-phosphatidylinositol 3-phosphate 5...    229   2e-64    
ref|XP_002948113.1|  hypothetical protein VOLCADRAFT_88405              246   2e-64    
gb|KDE07858.1|  hypothetical protein MVLG_01952                         246   2e-64    
gb|KDQ63031.1|  hypothetical protein JAAARDRAFT_120591                  245   3e-64    
gb|ACN58641.1|  FYVE finger-containing phosphoinositide kinase          235   3e-64    



>ref|XP_010320710.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Solanum lycopersicum]
Length=1738

 Score =   973 bits (2516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/748 (65%), Positives = 577/748 (77%), Gaps = 4/748 (1%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYGCGSM+A FRY+PIDILSVRLPP  LEF+  +EQ W+ KE AELL KAK+LYA
Sbjct  950   RDCLRYYGCGSMVAFFRYTPIDILSVRLPPLTLEFSGYTEQEWLRKEAAELLCKAKALYA  1009

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EISSA +++EEK   V C+ ++   LH+CI+ELK++LMKEKN ++D  Q   +ET +  Q
Sbjct  1010  EISSAFRRVEEKSYPVECEPSDTTQLHDCIVELKELLMKEKNDYHDFLQLDEDETFDPRQ  1069

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               ID+LELNRLRHSL+   H WD RL  M+S    +  S   E+  SC    +W  +   
Sbjct  1070  GAIDILELNRLRHSLVIASHVWDRRLLSMKSFLQKSSGSVGSEDCGSCNELIDWRRDMFL  1129

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K+ +LEH YEE+V EF +SEE P + L SE +   V        + S  TS   +   E 
Sbjct  1130  KNDTLEHVYEESVPEFSDSEEYPEKALQSEQEGTGVSPYGSGELESSMLTSSESETMQEM  1189

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
             +   EN  N++ LERAPSA S+LSD+ID AW+G D S +  Q+   LQ      A   Q 
Sbjct  1190  QTEGENTFNQTSLERAPSAASVLSDQIDFAWSGTDCSPKKAQL---LQGDRSEAAPLRQP  1246

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S +D P  +RLK PARV+SFDSA+R+Q+RI K LPPS  +LS+++SFHA GDY+NMIRDP
Sbjct  1247  SQLDLPPFRRLKLPARVHSFDSAMRLQDRIRKGLPPSSLHLSSIRSFHASGDYKNMIRDP  1306

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VS++Q   SQ  P EA K NLL  SS +F S+AS++P+G+RLMVP NG  DVV+AVYDNE
Sbjct  1307  VSSVQRTYSQMSPSEAHKFNLLMGSSPSFISYASLIPDGSRLMVPLNGSIDVVLAVYDNE  1366

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             PTSIISYAL SK Y DWVTDK  +SE  W  SDTNKE+ +A  LSTWQ FGSLD DYMH+
Sbjct  1367  PTSIISYALCSKVYSDWVTDKSSVSERSWNTSDTNKEAGVAFSLSTWQSFGSLDTDYMHY  1426

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
             GS+GSEDAS  I  LFSD K SPH RISF+DES ++GGKVKFSVTCYFAKQFDALR+KCC
Sbjct  1427  GSHGSEDASSTITSLFSDSKTSPHLRISFDDESSSSGGKVKFSVTCYFAKQFDALRRKCC  1486

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             P ELDF+RSLSRCKRWSAQGGKSNVYFAKS DERFIIKQ+QKTELDSFEEFAP+YF+YLT
Sbjct  1487  PDELDFVRSLSRCKRWSAQGGKSNVYFAKSFDERFIIKQVQKTELDSFEEFAPEYFKYLT  1546

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             +S +S SPTCLAKV+GI+QV+VKHLKGG+ETKMDLIVMEN+F+ R ISRVYDLKGS+RSR
Sbjct  1547  NSINSRSPTCLAKVLGIFQVSVKHLKGGRETKMDLIVMENIFFERKISRVYDLKGSLRSR  1606

Query  1982  YNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YN+DT  ANKVLLD+N LE+L TKPIFLGSKAKRSLERAVWNDTSFLA V VMDYSLLVG
Sbjct  1607  YNADTTGANKVLLDMNLLETLHTKPIFLGSKAKRSLERAVWNDTSFLASVDVMDYSLLVG  1666

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VDEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1667  VDEERKELVLGIIDFMRQYTWDKHLETW  1694



>ref|XP_009789649.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Nicotiana sylvestris]
Length=1734

 Score =   970 bits (2507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/748 (66%), Positives = 581/748 (78%), Gaps = 4/748 (1%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYGCGSM+A FRYSPIDILSVRLPP  LEF+  +EQ W+ KE AELL KAK+LYA
Sbjct  946   RDCLRYYGCGSMVAFFRYSPIDILSVRLPPLTLEFSGYTEQEWLRKEAAELLCKAKALYA  1005

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EISSA +++EEK +S+ C+ ++   L++CI+ELK++LMKEKN + D  QP  EET +  Q
Sbjct  1006  EISSAFRRIEEKSSSLECELSDTTQLNDCIMELKELLMKEKNDYYDFLQPDDEETFDPRQ  1065

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               ID+LELNRLRHSL+   H WD RL  ++S  + + SS   E++ SC    +W  +   
Sbjct  1066  AAIDILELNRLRHSLVIASHVWDRRLLSVKSFLEKSSSSVGSEDSGSCNELIDWRRDMFL  1125

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K+ +LEH YEE+V EF + EE   + L SE +E  V        + S  TS   ++T E 
Sbjct  1126  KNDTLEHVYEESVPEFSDLEEYTEKALQSEQEETRVSPYGSVKIESSMLTSSESERTQEM  1185

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
             ++  EN V ++ L RAPSA S LSD+ID AWTG D S +  Q+   LQ      ASF   
Sbjct  1186  QMEGENVVTETSLARAPSAASALSDQIDSAWTGTDRSPKKGQLFLMLQGEGSEAASFRPP  1245

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S +D P  ++L+SPARV+SFDSALR+QERI K LPPS  +LST++SFHA GDYRNMIRDP
Sbjct  1246  SQLDFPPFRKLRSPARVHSFDSALRLQERIRKGLPPSSLHLSTIRSFHASGDYRNMIRDP  1305

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VS++Q   SQ  P EA K NLL  SS +F S+AS++P+GARLMV    Q DVV+AVYDNE
Sbjct  1306  VSSVQRSYSQMSPSEAHKFNLLMGSSPSFISYASLIPDGARLMV---SQGDVVVAVYDNE  1362

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             PTSIISYAL SK Y D +TDK  +S  GW  SD NKE+ +A +LS WQ FGSLD+DYMH+
Sbjct  1363  PTSIISYALCSKVYNDCITDKSSVSGRGWNTSDINKEAGVAPRLSAWQSFGSLDMDYMHY  1422

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
             GSYGSEDAS  I  LF+D K SPH R+SF+DES + GGKVKFSVTCYFAKQFDALR+KCC
Sbjct  1423  GSYGSEDASSTITSLFADSKSSPHLRVSFDDESSSAGGKVKFSVTCYFAKQFDALRRKCC  1482

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             P ELDF+RSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQ+QKTELDSFEEFAP+YF+Y+T
Sbjct  1483  PDELDFVRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQVQKTELDSFEEFAPEYFKYIT  1542

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             DS +S SPTCLAKV+GI+QV+VKHLKGG+ETKMDLIVMENLF+ R ISRVYDLKGS+RSR
Sbjct  1543  DSINSRSPTCLAKVLGIFQVSVKHLKGGRETKMDLIVMENLFFERKISRVYDLKGSLRSR  1602

Query  1982  YNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YN+DT  ANKVLLD+N LE+L TKPIFLGSKAKRSLERAVWNDTSFLA V VMDYSLLVG
Sbjct  1603  YNADTTGANKVLLDMNLLETLHTKPIFLGSKAKRSLERAVWNDTSFLASVDVMDYSLLVG  1662

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VDEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1663  VDEERKELVLGIIDFMRQYTWDKHLETW  1690



>ref|XP_009630245.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Nicotiana tomentosiformis]
Length=1692

 Score =   961 bits (2483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/748 (66%), Positives = 578/748 (77%), Gaps = 17/748 (2%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YGCGS IA FRYSPIDILSVRLPPS L+F+S +EQ W+ KE AELL KAK+LYA
Sbjct  917   RDCLRFYGCGSTIAFFRYSPIDILSVRLPPSTLDFSSYTEQEWLRKETAELLCKAKALYA  976

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EISSA +++EEK +S+  + ++   LH+CI+ELKD+LMKEK+ ++DL Q    ETSE GQ
Sbjct  977   EISSAFRRIEEKSSSLEHEPSDKIELHDCIMELKDLLMKEKSDYHDLLQTADTETSERGQ  1036

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
                D+LELNRLRHSL+   H WD RL  +ES+   +  S   E++ SC    +W  +   
Sbjct  1037  AAADILELNRLRHSLVIASHVWDRRLLSVESLLQESSGSVGSEDSGSCSELMDWRNDMFL  1096

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K+  LEH YEE   +F N EE P    H E  E P         +GS  TSC  +KT + 
Sbjct  1097  KNDPLEHVYEETEIDFSNLEEYPE---HEETHESP-----YGLVEGSMFTSCEFEKTQDM  1148

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
             R+  ENAVNK+ LERAPSA S+LSDKID AWTG D S +  Q++  LQ      A F QL
Sbjct  1149  RMEGENAVNKTSLERAPSAASVLSDKIDSAWTGTDRSPKKAQINMILQRNGSEAAPFRQL  1208

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
                D P   RLKSPARV SFDSALR+Q+RI K LPPS  +L+ ++SFHA GDYRNMIRDP
Sbjct  1209  ---DYPPFARLKSPARVNSFDSALRLQDRIKKGLPPSSMHLTAIRSFHASGDYRNMIRDP  1265

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VS +Q   SQ  P EAQK+NLL S S +F S+AS++ +GARL+V   G  D+V+AVYDNE
Sbjct  1266  VSYVQRTYSQISPSEAQKVNLLMSPSPSFISYASLVHDGARLVV---GYNDIVLAVYDNE  1322

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             PTSIISYALSSKEYKD VTDKP + E GW  SD  KE+  AS +  W+ FGSLD+DY+H+
Sbjct  1323  PTSIISYALSSKEYKDRVTDKPNVPERGWNTSDIKKENGAASNV--WKSFGSLDMDYIHY  1380

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
             GSYGSEDASG I  LF+D K SPH RISFEDES N GGKVKFSVTCYFAKQFDALRK  C
Sbjct  1381  GSYGSEDASGTISSLFADSKTSPHLRISFEDESSNAGGKVKFSVTCYFAKQFDALRKNYC  1440

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             P ELDFIRS+SRCKRW+AQGGKSNVYFAKSLDERFIIKQ+QKTEL+SFEEF P YF+YLT
Sbjct  1441  PDELDFIRSISRCKRWTAQGGKSNVYFAKSLDERFIIKQVQKTELESFEEFGPDYFKYLT  1500

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             DS SS SPT LAKV+GIYQV+VK +KGG+ETKMDLIVMENLF+GR+IS+VYDLKGS+RSR
Sbjct  1501  DSVSSRSPTSLAKVLGIYQVSVKQMKGGRETKMDLIVMENLFFGRTISKVYDLKGSLRSR  1560

Query  1982  YNSD-TKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YN+D T ANKVLLD+N LE+L+TKPIFLGSKAKR+LERAVWNDTSFLA V VMDYSLLVG
Sbjct  1561  YNADKTGANKVLLDMNLLETLRTKPIFLGSKAKRNLERAVWNDTSFLASVDVMDYSLLVG  1620

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VDEERKELV+GIID+MRQYTWDKHLETW
Sbjct  1621  VDEERKELVVGIIDFMRQYTWDKHLETW  1648



>ref|XP_009608884.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Nicotiana tomentosiformis]
Length=1733

 Score =   949 bits (2454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/748 (65%), Positives = 571/748 (76%), Gaps = 5/748 (1%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYGCGSM+A FRYSPIDILSVRLPP  LEF+  +EQ W+ KE AELL KAK+LYA
Sbjct  946   RDCLRYYGCGSMVAFFRYSPIDILSVRLPPLTLEFSGYTEQEWLRKEAAELLCKAKALYA  1005

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EISSA +++EEK +S+ C       L++CI+ELKD+LMKEKN + D  QP  EET +  Q
Sbjct  1006  EISSAFRRIEEKSSSLECQIYTTQ-LNDCIVELKDLLMKEKNDYYDFLQPDDEETFDSRQ  1064

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               ID+LELN LRHSL+   H WD RL  ++S  + + SS   E++ SC    +W  +   
Sbjct  1065  AAIDILELNHLRHSLVIASHVWDRRLLSVKSFLEKSSSSVGSEDSGSCNELIDWRRDMFL  1124

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K+ +LEH YEE+V  F + EE   + L SE +E  V        + S  TS + ++T E 
Sbjct  1125  KNDTLEHVYEESVPGFSDLEEYTEKALQSEQEETRVSPYGSGELESSMLTSSDSERTQEM  1184

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
             ++  EN   ++ L R PSA S+LSD+ID AWTG D S +  Q+   LQ      ASF   
Sbjct  1185  QMEGENVATETSLARTPSAASVLSDQIDSAWTGTDRSPKKGQLLLMLQGEGSEAASFRPP  1244

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S +D P  ++L+SPARV+SFDSALR+QERI K LPPS  +LST++SFHA GDYRNMIRDP
Sbjct  1245  SQLDYPPFRKLRSPARVHSFDSALRLQERIRKGLPPSSLHLSTIRSFHASGDYRNMIRDP  1304

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VS++Q   SQ  P EA K NLL  SS +F S+AS++P+GARLMV      DVV+AVYDNE
Sbjct  1305  VSSVQRSYSQMSPSEAHKFNLLMGSSPSFISYASLIPDGARLMV---SHGDVVVAVYDNE  1361

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             PTSIISYAL SK Y D VTDK  +   GW  SD NKE+ +A +LS WQ FGSLD+DYMH+
Sbjct  1362  PTSIISYALCSKAYNDCVTDKASVYGRGWNTSDINKEAGVAPRLSAWQSFGSLDMDYMHY  1421

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
             GSYGSEDAS  I  LF D K SPH R+SF+DES   G KVKFSVTCYFAKQFDALR+KCC
Sbjct  1422  GSYGSEDASSTITSLFVDSKSSPHLRVSFDDESSIAGRKVKFSVTCYFAKQFDALRRKCC  1481

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             P ELDF+RSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQ+QKTELDSFEEFAP+YF+Y+T
Sbjct  1482  PDELDFVRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQVQKTELDSFEEFAPEYFKYIT  1541

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             DS SS SPTCLAKV+GI+QV+VKHLKGG+ETKMDLIVMENLF+ R ISRVYDLKGS+RSR
Sbjct  1542  DSISSQSPTCLAKVLGIFQVSVKHLKGGRETKMDLIVMENLFFERKISRVYDLKGSLRSR  1601

Query  1982  YNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YN+DT  ANKVLLD+N LE+L TKPIFLGSKAKRSLERAVWNDTSFLA V VMDYSLLVG
Sbjct  1602  YNADTTGANKVLLDMNLLETLHTKPIFLGSKAKRSLERAVWNDTSFLASVDVMDYSLLVG  1661

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VDEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1662  VDEERKELVLGIIDFMRQYTWDKHLETW  1689



>ref|XP_010319394.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Solanum lycopersicum]
Length=1681

 Score =   948 bits (2450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/748 (66%), Positives = 573/748 (77%), Gaps = 7/748 (1%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YGCGSMIA F YSPIDILSV LPPS L F+S  EQ W+ KE  ELL KAK+LYA
Sbjct  896   RDCLRFYGCGSMIAFFHYSPIDILSVCLPPSTLMFSSYEEQEWLRKETDELLCKAKALYA  955

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EISSA++++EEK +S+  D ++   L +CI+ELKD+LMKEK+ ++DL Q    ETSE+ Q
Sbjct  956   EISSAIRRIEEKRSSLEHDLSDKPELDDCIMELKDLLMKEKSDYHDLLQTADAETSEQAQ  1015

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LELNRLRHSL+   H WD RL  +ES+F     S++     SC    +W      
Sbjct  1016  AVVDILELNRLRHSLVIASHVWDRRLLSVESLFQETSGSEY---TGSCSELIDWRNNVFL  1072

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K+G LEH YEE   EF N +E P +   SE +E       L   + S  TSC   KT + 
Sbjct  1073  KNGPLEHVYEETEPEFSNLDEYPQKPFQSEEEETHGSPYRL---EESMFTSCEFKKTQDK  1129

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
              +  ENAVN +PLERAPSAGS+LSD+ID AWTG D S +   +   LQ      ASF QL
Sbjct  1130  HMEGENAVNGTPLERAPSAGSVLSDQIDSAWTGTDRSPKKALLDMKLQRNGSEAASFRQL  1189

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S +D P   R+KSPARV SFDSALR+QERI K LPPS  +LS ++SFHA GDYRNMIRDP
Sbjct  1190  SQLDYPPIARVKSPARVNSFDSALRLQERIRKGLPPSSLHLSAIRSFHASGDYRNMIRDP  1249

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             V ++Q   S   P EAQK NLL +SS +F S+AS++ +G RLMVP NG  D+VIAVYDNE
Sbjct  1250  VISVQRTYSLMSPNEAQKFNLLMNSSPSFISYASLIHDGPRLMVPHNGFNDIVIAVYDNE  1309

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             PTSIISYAL+SK+YK+ VTDKP +SE GW  +D  KE+ +A  +S WQ FGSLD+DY+H 
Sbjct  1310  PTSIISYALASKQYKERVTDKPNVSERGWNTNDIRKENGVACNVSRWQSFGSLDMDYIHH  1369

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
             GS+GSEDAS  I  +F+D K SPH RISFEDES N GGKVKFSVTCYFAKQFDALRK+ C
Sbjct  1370  GSHGSEDASSTISSIFADSKTSPHLRISFEDESSNAGGKVKFSVTCYFAKQFDALRKRYC  1429

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             P ELDFIRSLSRCKRWSAQGGKSN YFAKSLDERFIIKQ+QKTEL+SFEEF P YF+YLT
Sbjct  1430  PDELDFIRSLSRCKRWSAQGGKSNAYFAKSLDERFIIKQVQKTELESFEEFGPNYFKYLT  1489

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             DS SS SPTCLAKV+GIYQV+VKHL GG+ETKMDLIVMENLF+GR IS+VYDLKGS+RSR
Sbjct  1490  DSVSSRSPTCLAKVLGIYQVSVKHLTGGRETKMDLIVMENLFFGRKISKVYDLKGSLRSR  1549

Query  1982  YNSD-TKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YN+D T AN VLLDLN LE L+TKPIFLGSKAKRSLERA+WNDTSFLA V VMDYSLLVG
Sbjct  1550  YNADKTGANSVLLDLNLLEILRTKPIFLGSKAKRSLERAIWNDTSFLASVDVMDYSLLVG  1609

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VDEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1610  VDEERKELVLGIIDFMRQYTWDKHLETW  1637



>ref|XP_009785563.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Nicotiana sylvestris]
Length=1682

 Score =   942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/748 (65%), Positives = 575/748 (77%), Gaps = 23/748 (3%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YGCGS IA FRYSPIDILSVRLPPS L+F+S +E+ W+ KE AELL KAK+LYA
Sbjct  913   RDCLRFYGCGSTIAFFRYSPIDILSVRLPPSTLDFSSYTEKEWLRKETAELLCKAKALYA  972

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EISSA +++EEK      + +    +H+CI+ELKD+LMKEK+ ++DL Q    ETSE+GQ
Sbjct  973   EISSAFRRIEEKSIH---EPSGKTEVHDCIMELKDLLMKEKSDYHDLLQTADAETSEQGQ  1029

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LELNRLRHSL+   H WDHRL  +ES+   +  S   E++ SC    +W  + I 
Sbjct  1030  VAVDILELNRLRHSLVISSHVWDHRLLSVESLLQESSGSVGSEDSGSCNELTDWRNDMIL  1089

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K+  LEH YEE   +F N EE P +     H+ P          +GS  TSC  +KT +T
Sbjct  1090  KNDPLEHVYEETEIDFSNLEEYPEQ--EETHESP------YGLVEGSMFTSCEFEKTQDT  1141

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
             ++  ENAVNK+ LERAPSA S+LSDKID AWTG D S +  Q+   LQ      A F QL
Sbjct  1142  QMEGENAVNKTSLERAPSAASVLSDKIDSAWTGTDRSPKKAQI---LQRNGSEAAPFRQL  1198

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
                D P   RLKSPARV SFDSALR+Q+RI K LPPS   L+ ++SFHA GDYRNMIRDP
Sbjct  1199  ---DYPPFSRLKSPARVNSFDSALRLQDRIKKGLPPSSMQLTAIRSFHASGDYRNMIRDP  1255

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VS +Q   SQ  P EAQK+NLL SSS +F S+AS++ +GARLMV   G  D++I+VYDNE
Sbjct  1256  VSCVQRTYSQISPSEAQKVNLLMSSSPSFISYASLVHDGARLMV---GYNDLIISVYDNE  1312

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             PTSIISYALSSKEYKD VTDKP ++E GW  +   +E+  AS +  WQ FGS D+DY+++
Sbjct  1313  PTSIISYALSSKEYKDRVTDKPNVTEMGWNTNGIRRENGAASNV--WQSFGSSDMDYINY  1370

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
             GSYGSEDAS  I  LF+D K SPH RISFEDES N GGKVKFSVTCYFAKQFDALRK  C
Sbjct  1371  GSYGSEDASSTISSLFADSKTSPHLRISFEDESSNAGGKVKFSVTCYFAKQFDALRKNYC  1430

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             P ELDFIRS+SRCKRW+AQGGKSNVYFAKSLDERFIIKQ+QKTEL+SFEEF P YF+YLT
Sbjct  1431  PDELDFIRSISRCKRWTAQGGKSNVYFAKSLDERFIIKQVQKTELESFEEFGPDYFKYLT  1490

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             DS SS SPT LAKV+GIYQV+VK +KGG+ETKMDLIVMENLF+GR+IS+VYDLKGS+RSR
Sbjct  1491  DSVSSRSPTSLAKVLGIYQVSVKQMKGGRETKMDLIVMENLFFGRTISKVYDLKGSLRSR  1550

Query  1982  YNSD-TKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YN+D T ANKVLLD+N LE+L+TKPIFLGSKAKRSLERAVWNDT+FLA V VMDYSLLVG
Sbjct  1551  YNADKTGANKVLLDMNLLETLRTKPIFLGSKAKRSLERAVWNDTAFLASVDVMDYSLLVG  1610

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VDEE KELV+GIID+MRQYTWDKHLETW
Sbjct  1611  VDEECKELVVGIIDFMRQYTWDKHLETW  1638



>ref|XP_009785564.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X2 [Nicotiana sylvestris]
Length=1678

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/748 (65%), Positives = 575/748 (77%), Gaps = 23/748 (3%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YGCGS IA FRYSPIDILSVRLPPS L+F+S +E+ W+ KE AELL KAK+LYA
Sbjct  909   RDCLRFYGCGSTIAFFRYSPIDILSVRLPPSTLDFSSYTEKEWLRKETAELLCKAKALYA  968

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EISSA +++EEK      + +    +H+CI+ELKD+LMKEK+ ++DL Q    ETSE+GQ
Sbjct  969   EISSAFRRIEEKSIH---EPSGKTEVHDCIMELKDLLMKEKSDYHDLLQTADAETSEQGQ  1025

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LELNRLRHSL+   H WDHRL  +ES+   +  S   E++ SC    +W  + I 
Sbjct  1026  VAVDILELNRLRHSLVISSHVWDHRLLSVESLLQESSGSVGSEDSGSCNELTDWRNDMIL  1085

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K+  LEH YEE   +F N EE P +     H+ P          +GS  TSC  +KT +T
Sbjct  1086  KNDPLEHVYEETEIDFSNLEEYPEQ--EETHESP------YGLVEGSMFTSCEFEKTQDT  1137

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
             ++  ENAVNK+ LERAPSA S+LSDKID AWTG D S +  Q+   LQ      A F QL
Sbjct  1138  QMEGENAVNKTSLERAPSAASVLSDKIDSAWTGTDRSPKKAQI---LQRNGSEAAPFRQL  1194

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
                D P   RLKSPARV SFDSALR+Q+RI K LPPS   L+ ++SFHA GDYRNMIRDP
Sbjct  1195  ---DYPPFSRLKSPARVNSFDSALRLQDRIKKGLPPSSMQLTAIRSFHASGDYRNMIRDP  1251

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VS +Q   SQ  P EAQK+NLL SSS +F S+AS++ +GARLMV   G  D++I+VYDNE
Sbjct  1252  VSCVQRTYSQISPSEAQKVNLLMSSSPSFISYASLVHDGARLMV---GYNDLIISVYDNE  1308

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             PTSIISYALSSKEYKD VTDKP ++E GW  +   +E+  AS +  WQ FGS D+DY+++
Sbjct  1309  PTSIISYALSSKEYKDRVTDKPNVTEMGWNTNGIRRENGAASNV--WQSFGSSDMDYINY  1366

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
             GSYGSEDAS  I  LF+D K SPH RISFEDES N GGKVKFSVTCYFAKQFDALRK  C
Sbjct  1367  GSYGSEDASSTISSLFADSKTSPHLRISFEDESSNAGGKVKFSVTCYFAKQFDALRKNYC  1426

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             P ELDFIRS+SRCKRW+AQGGKSNVYFAKSLDERFIIKQ+QKTEL+SFEEF P YF+YLT
Sbjct  1427  PDELDFIRSISRCKRWTAQGGKSNVYFAKSLDERFIIKQVQKTELESFEEFGPDYFKYLT  1486

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             DS SS SPT LAKV+GIYQV+VK +KGG+ETKMDLIVMENLF+GR+IS+VYDLKGS+RSR
Sbjct  1487  DSVSSRSPTSLAKVLGIYQVSVKQMKGGRETKMDLIVMENLFFGRTISKVYDLKGSLRSR  1546

Query  1982  YNSD-TKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YN+D T ANKVLLD+N LE+L+TKPIFLGSKAKRSLERAVWNDT+FLA V VMDYSLLVG
Sbjct  1547  YNADKTGANKVLLDMNLLETLRTKPIFLGSKAKRSLERAVWNDTAFLASVDVMDYSLLVG  1606

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VDEE KELV+GIID+MRQYTWDKHLETW
Sbjct  1607  VDEECKELVVGIIDFMRQYTWDKHLETW  1634



>emb|CDP00755.1| unnamed protein product [Coffea canephora]
Length=1712

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/748 (61%), Positives = 560/748 (75%), Gaps = 19/748 (3%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GS++A FRYSPI+ILSV LPPS+L+FN+ S Q WI +E +ELLRK+++LYA
Sbjct  939   RDCLRYYGYGSVVAFFRYSPIEILSVHLPPSILDFNA-SGQDWIRREASELLRKSEALYA  997

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  +  +EEK  S G +++ ++ LHN ++ELKD+L+KE N +N + +   +ET E  +
Sbjct  998   EMSGVLHNIEEKLLSFGHEFSGVSELHNHVIELKDLLIKENNSYNSMLRIAEKETLELAE  1057

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LE+NRLRHSLL   H WD RL+ +  +   + SS+ P+ +           ET  
Sbjct  1058  ASLDILEINRLRHSLLIGSHVWDRRLFSLNCLLTRSSSSRAPQKS-----------ETFV  1106

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K  S EH +EE V E    +ECP E + SE +E  +    LS  + S+S     ++  E 
Sbjct  1107  KRSSSEH-WEEVVPEVSKFQECPMESVKSEQEETNMLLHRLSISEDSASYEPRREE--EM  1163

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                 +NAVN   LERA +A + LS+ ID AWTG    S   Q+H   Q        F Q+
Sbjct  1164  LKDSKNAVNTPALERASTAATALSETIDSAWTGSGQVSGKAQLHNMCQPDGAEDVPFKQI  1223

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             +  + P  KR+ SPARVYSFDSA+R+QERISK L PS S+L  LKSFHA GDYR+MIRDP
Sbjct  1224  NQGEIPPLKRVMSPARVYSFDSAVRLQERISKGLSPSSSHLLMLKSFHASGDYRSMIRDP  1283

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             V+N+Q + SQ LP +AQK +LL ++S TFTS  S+L +GAR+M+P+N Q D+VIAVYD+E
Sbjct  1284  VANVQRMYSQMLPCDAQKCDLLQNASPTFTSSTSLLSDGARMMIPQNSQNDLVIAVYDDE  1343

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             PTSIISYALSSKE+++WV+ KP    G     D N +    S +S WQ FGSLD DY+H+
Sbjct  1344  PTSIISYALSSKEHEEWVSGKPLEPGGSLNAGDLNNDHSTTSNISGWQSFGSLDFDYIHY  1403

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
             GSYGSEDAS  +G +F+D K SPH RISFE++S N  G+VKFSV CYFAKQFDALRKKCC
Sbjct  1404  GSYGSEDASTAVGSIFTDNKTSPHLRISFENKSSNVWGEVKFSVACYFAKQFDALRKKCC  1463

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             PSE+DFIRSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTEL+SFEEFAP YF+YL 
Sbjct  1464  PSEVDFIRSLSRCRRWSAQGGKSNVYFAKSLDERFIIKQITKTELESFEEFAPDYFKYLK  1523

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             D   SGSPTCLAKV+G+YQV VKHLKGGKETKMDL++MENLF+GR ISRVYDLKGS RSR
Sbjct  1524  D---SGSPTCLAKVLGMYQVGVKHLKGGKETKMDLMIMENLFFGRKISRVYDLKGSKRSR  1580

Query  1982  YNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YN+DT  ANKVLLD+N LE+L+TKPIFLGSKAKRSLERAVWNDTSFLA V VMDYSLLVG
Sbjct  1581  YNADTTGANKVLLDMNLLETLRTKPIFLGSKAKRSLERAVWNDTSFLASVDVMDYSLLVG  1640

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             +D+E KELVLGIID+MRQYTWDKHLETW
Sbjct  1641  IDDENKELVLGIIDFMRQYTWDKHLETW  1668



>gb|KDO64702.1| hypothetical protein CISIN_1g000604mg [Citrus sinensis]
 gb|KDO64703.1| hypothetical protein CISIN_1g000604mg [Citrus sinensis]
Length=1397

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/757 (61%), Positives = 552/757 (73%), Gaps = 36/757 (5%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSMIA FRYSPIDILSV LPPSVLEFN   +Q WI KE  EL  K ++LYA
Sbjct  623   RDCLRYYGFGSMIAIFRYSPIDILSVHLPPSVLEFNGLLQQEWIRKEAEELKVKMETLYA  682

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS+ ++ +E++  S+GC+ ++   L + ILELK  L  E+N +  L QP   ETSE GQ
Sbjct  683   EISNVLEVMEQRSNSIGCEMSDSTDLKSHILELKVQLESERNDYIGLLQPVVMETSEPGQ  742

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             T +D+LELNRLR +LL   HAWD +LY + S+      ++  +   S     E   +   
Sbjct  743   TAVDILELNRLRRALLIGSHAWDRQLYSLNSLLKKGSIAKAKQGNASYAQLKELRTDLFC  802

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLH-SEHDEPPVPKDALSYQQGSSSTSCNGDKTLE  718
             KD  L+H  EENV    +S E P   LH  + +E  +P                   TLE
Sbjct  803   KDSKLDHDNEENVSGSLDSLESPANDLHLQQKEELNLP-------------------TLE  843

Query  719   TRLGLENAVNKSPL----ERAPSAGSI---LSDKIDCAWTGIDPSSQDMQVHASLQEGER  877
                G EN+   S L    E   S G I   LS+KID AWTG D      QV   + + +R
Sbjct  844   P-FGSENSKLTSFLHNREEDVHSDGEITSTLSEKIDSAWTGTD------QVVPLVSQTDR  896

Query  878   RVASF-GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYG  1054
               A F GQ+S +D+   KRL SP RV+SFDSALR QERI++ LP S  +LS+++SFHA G
Sbjct  897   PQAGFVGQISKIDNSPFKRLASPVRVHSFDSALRFQERIARGLPHSLLHLSSIRSFHASG  956

Query  1055  DYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKD  1234
             DYR+M+RDPVSN+    SQ LP EAQKLNL+ SS+ +F S AS + EGARL++P+ G  D
Sbjct  957   DYRSMVRDPVSNVMRTYSQILPLEAQKLNLILSSTPSFISSASRMVEGARLLLPQRGDND  1016

Query  1235  VVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFG  1414
             VVIAV+D++PTSIISYALSSKEY+DWV DK Y ++G W   + +KE    S  S WQ FG
Sbjct  1017  VVIAVFDDDPTSIISYALSSKEYEDWVADKLYDNDGSWSAGEIHKEGSAVSSFSAWQSFG  1076

Query  1415  SLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQ  1594
             SLDLDY+H+GSYGSEDAS  +G LF+DPK SPH  ISF DES   GGKVKFSVT YFAKQ
Sbjct  1077  SLDLDYIHYGSYGSEDASSSVGTLFTDPKKSPHLTISFGDESSTAGGKVKFSVTSYFAKQ  1136

Query  1595  FDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEF  1774
             FD+LRKKCCPS +DF+RSLSR ++WSAQGGKSNV+FAKSLDERFIIKQ++KTEL+SFEEF
Sbjct  1137  FDSLRKKCCPSGVDFVRSLSRSRKWSAQGGKSNVFFAKSLDERFIIKQVKKTELESFEEF  1196

Query  1775  APKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVY  1954
             AP+YF+YLTDS +S SPTCLAK++GIYQV+VKHLKGGKETK+DL+VMENLF+ RSISRVY
Sbjct  1197  APEYFKYLTDSLNSRSPTCLAKILGIYQVSVKHLKGGKETKIDLMVMENLFFRRSISRVY  1256

Query  1955  DLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVY  2131
             DLKGS RSRYN+DT   NKVLLD+N LE+L+T+P+FLGSKAKRSLERA+WNDTSFLA V 
Sbjct  1257  DLKGSARSRYNTDTTGTNKVLLDMNLLENLRTEPLFLGSKAKRSLERAIWNDTSFLASVD  1316

Query  2132  VMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VMDYSLLVGVDEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1317  VMDYSLLVGVDEERKELVLGIIDFMRQYTWDKHLETW  1353



>gb|KDO64701.1| hypothetical protein CISIN_1g000604mg [Citrus sinensis]
Length=1398

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/757 (61%), Positives = 552/757 (73%), Gaps = 36/757 (5%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSMIA FRYSPIDILSV LPPSVLEFN   +Q WI KE  EL  K ++LYA
Sbjct  624   RDCLRYYGFGSMIAIFRYSPIDILSVHLPPSVLEFNGLLQQEWIRKEAEELKVKMETLYA  683

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS+ ++ +E++  S+GC+ ++   L + ILELK  L  E+N +  L QP   ETSE GQ
Sbjct  684   EISNVLEVMEQRSNSIGCEMSDSTDLKSHILELKVQLESERNDYIGLLQPVVMETSEPGQ  743

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             T +D+LELNRLR +LL   HAWD +LY + S+      ++  +   S     E   +   
Sbjct  744   TAVDILELNRLRRALLIGSHAWDRQLYSLNSLLKKGSIAKAKQGNASYAQLKELRTDLFC  803

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLH-SEHDEPPVPKDALSYQQGSSSTSCNGDKTLE  718
             KD  L+H  EENV    +S E P   LH  + +E  +P                   TLE
Sbjct  804   KDSKLDHDNEENVSGSLDSLESPANDLHLQQKEELNLP-------------------TLE  844

Query  719   TRLGLENAVNKSPL----ERAPSAGSI---LSDKIDCAWTGIDPSSQDMQVHASLQEGER  877
                G EN+   S L    E   S G I   LS+KID AWTG D      QV   + + +R
Sbjct  845   P-FGSENSKLTSFLHNREEDVHSDGEITSTLSEKIDSAWTGTD------QVVPLVSQTDR  897

Query  878   RVASF-GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYG  1054
               A F GQ+S +D+   KRL SP RV+SFDSALR QERI++ LP S  +LS+++SFHA G
Sbjct  898   PQAGFVGQISKIDNSPFKRLASPVRVHSFDSALRFQERIARGLPHSLLHLSSIRSFHASG  957

Query  1055  DYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKD  1234
             DYR+M+RDPVSN+    SQ LP EAQKLNL+ SS+ +F S AS + EGARL++P+ G  D
Sbjct  958   DYRSMVRDPVSNVMRTYSQILPLEAQKLNLILSSTPSFISSASRMVEGARLLLPQRGDND  1017

Query  1235  VVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFG  1414
             VVIAV+D++PTSIISYALSSKEY+DWV DK Y ++G W   + +KE    S  S WQ FG
Sbjct  1018  VVIAVFDDDPTSIISYALSSKEYEDWVADKLYDNDGSWSAGEIHKEGSAVSSFSAWQSFG  1077

Query  1415  SLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQ  1594
             SLDLDY+H+GSYGSEDAS  +G LF+DPK SPH  ISF DES   GGKVKFSVT YFAKQ
Sbjct  1078  SLDLDYIHYGSYGSEDASSSVGTLFTDPKKSPHLTISFGDESSTAGGKVKFSVTSYFAKQ  1137

Query  1595  FDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEF  1774
             FD+LRKKCCPS +DF+RSLSR ++WSAQGGKSNV+FAKSLDERFIIKQ++KTEL+SFEEF
Sbjct  1138  FDSLRKKCCPSGVDFVRSLSRSRKWSAQGGKSNVFFAKSLDERFIIKQVKKTELESFEEF  1197

Query  1775  APKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVY  1954
             AP+YF+YLTDS +S SPTCLAK++GIYQV+VKHLKGGKETK+DL+VMENLF+ RSISRVY
Sbjct  1198  APEYFKYLTDSLNSRSPTCLAKILGIYQVSVKHLKGGKETKIDLMVMENLFFRRSISRVY  1257

Query  1955  DLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVY  2131
             DLKGS RSRYN+DT   NKVLLD+N LE+L+T+P+FLGSKAKRSLERA+WNDTSFLA V 
Sbjct  1258  DLKGSARSRYNTDTTGTNKVLLDMNLLENLRTEPLFLGSKAKRSLERAIWNDTSFLASVD  1317

Query  2132  VMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VMDYSLLVGVDEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1318  VMDYSLLVGVDEERKELVLGIIDFMRQYTWDKHLETW  1354



>ref|XP_011075701.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X2 [Sesamum indicum]
Length=1703

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/748 (61%), Positives = 557/748 (74%), Gaps = 4/748 (1%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPI+ILSV LPPSVLEF    EQ+WI KE  ELL KA++LYA
Sbjct  912   RDCLRFYGFGSMVAFFRYSPINILSVHLPPSVLEFGGPGEQSWIRKEAYELLSKARALYA  971

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +++++ K +S   ++++ + LHN +LEL  ML  E++++ D+ Q   +E  E+ Q
Sbjct  972   EISRVLEEVKSKSSSSIDEFSDASELHNHVLELNSMLSGERSHYEDMLQLADKEIPEQDQ  1031

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LE+NRLRHSLL   H W+ RLY ++S+   + SS+ P+   S    G    +T  
Sbjct  1032  AAVDILEINRLRHSLLIRSHVWEQRLYLLDSLLKKSSSSEAPDGVPSLT--GLKDCDTDL  1089

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             +D SL+ ++E+N+ E P  EE P E + S ++ P   +     Q+  +  +    +  + 
Sbjct  1090  RDCSLDLSHEDNMSEHPTLEEFPDEVVPSNNEGPNYSRLGPHLQETYALPTSPHKEGEDM  1149

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                 E AVN   LER PSA SILSDKID AW+G D    +  + ASL        SF Q+
Sbjct  1150  CQDDEIAVNIPSLERHPSAASILSDKIDSAWSGADQPPTEAHLPASLNLDVSESFSFRQI  1209

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             +  D+P+ +RL  P RVYSFDSA R+QERI K LPPS  YLS L+SFHA GDYR+M+RDP
Sbjct  1210  NQKDNPSFRRLMGPTRVYSFDSAQRLQERIKKGLPPSSLYLSALRSFHASGDYRHMVRDP  1269

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             V+N+Q   SQ  PREA+KL+L  S+  +F S  SILPEGARLMV +N Q D+V+ VYDNE
Sbjct  1270  VTNVQRTYSQVSPREAEKLSLPSSAPPSFISSVSILPEGARLMVQQNSQNDIVLTVYDNE  1329

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             PTSIISYALSSKEY+DWV  +P   EG   +   NK + +AS LSTWQ FGSLDLD+ + 
Sbjct  1330  PTSIISYALSSKEYEDWVAGRPNGLEGRSNIRLLNKVNSLASDLSTWQSFGSLDLDHTNH  1389

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
              SY SEDAS  +G +F+D   SPH RISFEDES N  GKVKFSVTCYF K+FDALR++CC
Sbjct  1390  ASYSSEDASATVGSVFADHSSSPHLRISFEDESSNAAGKVKFSVTCYFVKEFDALRRRCC  1449

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             PSE+DF+RSLSRCKRWSAQGGKSNVYFAKS D+RFIIKQ+ KTELDSFEEFAP+YF+YLT
Sbjct  1450  PSEVDFLRSLSRCKRWSAQGGKSNVYFAKSFDDRFIIKQVTKTELDSFEEFAPQYFKYLT  1509

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             D+ SSGSPTCLAKV+GIYQV VKH+KGGKE KM+L+VMENLFYG++ISRVYDLKGS RSR
Sbjct  1510  DALSSGSPTCLAKVLGIYQVTVKHMKGGKEVKMELMVMENLFYGKNISRVYDLKGSERSR  1569

Query  1982  YNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YNSDT  ANKVLLD+N LE+L T PIFLGSKAKRSLERAVWNDTSFLA V VMD SLLVG
Sbjct  1570  YNSDTTGANKVLLDMNLLETLTTNPIFLGSKAKRSLERAVWNDTSFLASVDVMD-SLLVG  1628

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VDEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1629  VDEERKELVLGIIDFMRQYTWDKHLETW  1656



>ref|XP_011075696.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Sesamum indicum]
Length=1730

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/748 (61%), Positives = 557/748 (74%), Gaps = 4/748 (1%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPI+ILSV LPPSVLEF    EQ+WI KE  ELL KA++LYA
Sbjct  939   RDCLRFYGFGSMVAFFRYSPINILSVHLPPSVLEFGGPGEQSWIRKEAYELLSKARALYA  998

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +++++ K +S   ++++ + LHN +LEL  ML  E++++ D+ Q   +E  E+ Q
Sbjct  999   EISRVLEEVKSKSSSSIDEFSDASELHNHVLELNSMLSGERSHYEDMLQLADKEIPEQDQ  1058

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LE+NRLRHSLL   H W+ RLY ++S+   + SS+ P+   S    G    +T  
Sbjct  1059  AAVDILEINRLRHSLLIRSHVWEQRLYLLDSLLKKSSSSEAPDGVPSLT--GLKDCDTDL  1116

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             +D SL+ ++E+N+ E P  EE P E + S ++ P   +     Q+  +  +    +  + 
Sbjct  1117  RDCSLDLSHEDNMSEHPTLEEFPDEVVPSNNEGPNYSRLGPHLQETYALPTSPHKEGEDM  1176

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                 E AVN   LER PSA SILSDKID AW+G D    +  + ASL        SF Q+
Sbjct  1177  CQDDEIAVNIPSLERHPSAASILSDKIDSAWSGADQPPTEAHLPASLNLDVSESFSFRQI  1236

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             +  D+P+ +RL  P RVYSFDSA R+QERI K LPPS  YLS L+SFHA GDYR+M+RDP
Sbjct  1237  NQKDNPSFRRLMGPTRVYSFDSAQRLQERIKKGLPPSSLYLSALRSFHASGDYRHMVRDP  1296

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             V+N+Q   SQ  PREA+KL+L  S+  +F S  SILPEGARLMV +N Q D+V+ VYDNE
Sbjct  1297  VTNVQRTYSQVSPREAEKLSLPSSAPPSFISSVSILPEGARLMVQQNSQNDIVLTVYDNE  1356

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             PTSIISYALSSKEY+DWV  +P   EG   +   NK + +AS LSTWQ FGSLDLD+ + 
Sbjct  1357  PTSIISYALSSKEYEDWVAGRPNGLEGRSNIRLLNKVNSLASDLSTWQSFGSLDLDHTNH  1416

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
              SY SEDAS  +G +F+D   SPH RISFEDES N  GKVKFSVTCYF K+FDALR++CC
Sbjct  1417  ASYSSEDASATVGSVFADHSSSPHLRISFEDESSNAAGKVKFSVTCYFVKEFDALRRRCC  1476

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             PSE+DF+RSLSRCKRWSAQGGKSNVYFAKS D+RFIIKQ+ KTELDSFEEFAP+YF+YLT
Sbjct  1477  PSEVDFLRSLSRCKRWSAQGGKSNVYFAKSFDDRFIIKQVTKTELDSFEEFAPQYFKYLT  1536

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             D+ SSGSPTCLAKV+GIYQV VKH+KGGKE KM+L+VMENLFYG++ISRVYDLKGS RSR
Sbjct  1537  DALSSGSPTCLAKVLGIYQVTVKHMKGGKEVKMELMVMENLFYGKNISRVYDLKGSERSR  1596

Query  1982  YNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YNSDT  ANKVLLD+N LE+L T PIFLGSKAKRSLERAVWNDTSFLA V VMD SLLVG
Sbjct  1597  YNSDTTGANKVLLDMNLLETLTTNPIFLGSKAKRSLERAVWNDTSFLASVDVMD-SLLVG  1655

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VDEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1656  VDEERKELVLGIIDFMRQYTWDKHLETW  1683



>ref|XP_006448284.1| hypothetical protein CICLE_v100140271mg, partial [Citrus clementina]
 gb|ESR61524.1| hypothetical protein CICLE_v100140271mg, partial [Citrus clementina]
Length=1622

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/757 (60%), Positives = 548/757 (72%), Gaps = 36/757 (5%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSMIA FRYSPIDILSV LPPSVLEFN   +Q WI KE  EL  K ++ YA
Sbjct  848   RDCLRYYGFGSMIAIFRYSPIDILSVHLPPSVLEFNGLLQQEWIRKEAEELKVKMETFYA  907

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS+ ++ +E++  S+GC+ ++   L + ILELK  L  E+N +  L QP   ETSE   
Sbjct  908   EISNVLEVMEQRSNSIGCEMSDSTDLKSHILELKVQLESERNDYIGLLQPVVMETSEPCL  967

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             T +D+LELNRLR +LL   HAWD +LY + S+      ++  +   S         +   
Sbjct  968   TAVDILELNRLRRALLIGSHAWDRQLYSLNSLLKKGSIAKAKQGNASYAQLKGLRTDLFC  1027

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLH-SEHDEPPVPKDALSYQQGSSSTSCNGDKTLE  718
             KD  L+H  EENV    +S E P   LH  + +E  +P                   TLE
Sbjct  1028  KDSKLDHDNEENVSGSLDSLESPANDLHLQQKEELNLP-------------------TLE  1068

Query  719   TRLGLENAVNKSPL----ERAPSAGSI---LSDKIDCAWTGIDPSSQDMQVHASLQEGER  877
                G EN+   S L    E   S G I   LS+KID AWTG D      QV     + +R
Sbjct  1069  P-FGSENSKLTSFLHNREEDVHSDGEITSTLSEKIDSAWTGTD------QVVPLASQTDR  1121

Query  878   RVASF-GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYG  1054
               A F GQ+S +D+   KRL SP RV+SFDSALR QERI++ LP S  +LS+++SFHA G
Sbjct  1122  PQAGFVGQISKIDNSPFKRLASPVRVHSFDSALRFQERIARGLPHSSLHLSSIRSFHASG  1181

Query  1055  DYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKD  1234
             DYR+M+RDPVSN+    SQ LP EAQKLNL+ SS+ +F S AS + EGARL++P+ G  D
Sbjct  1182  DYRSMVRDPVSNVMRTYSQILPLEAQKLNLILSSTPSFISSASRMVEGARLLLPQRGDND  1241

Query  1235  VVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFG  1414
             VVIAV+D++PTSIISYALSSKEY+DWV D+ Y ++G W   + +KE    S  S WQ FG
Sbjct  1242  VVIAVFDDDPTSIISYALSSKEYEDWVADRLYDNDGSWSAGEIHKEGSAVSTFSAWQSFG  1301

Query  1415  SLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQ  1594
             SLDLDY+H+GSYGSEDAS  +G LF+DPK SPH  ISF DES + GGKVKFSVT YFAKQ
Sbjct  1302  SLDLDYIHYGSYGSEDASSSVGTLFTDPKKSPHLTISFGDESSSAGGKVKFSVTSYFAKQ  1361

Query  1595  FDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEF  1774
             FD+LRKKCCPS +DF+RSLSR ++WSAQGGKSNV+FAKSLDERFIIKQ++KTEL+SFEEF
Sbjct  1362  FDSLRKKCCPSGVDFVRSLSRSRKWSAQGGKSNVFFAKSLDERFIIKQVKKTELESFEEF  1421

Query  1775  APKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVY  1954
             AP+YF+YLTDS +S SPTCLAK++GIYQV+VKHLKGGKETK+DL+VMENLF+ RSISRVY
Sbjct  1422  APEYFKYLTDSLNSRSPTCLAKILGIYQVSVKHLKGGKETKIDLMVMENLFFRRSISRVY  1481

Query  1955  DLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVY  2131
             DLKGS RSRYN+DT   NKVLLD+N LE+L+T+P+FLGSKAKRSLERA+WNDTSFLA V 
Sbjct  1482  DLKGSARSRYNTDTTGTNKVLLDMNLLENLRTEPLFLGSKAKRSLERAIWNDTSFLASVD  1541

Query  2132  VMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VMDYSLLVGVDEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1542  VMDYSLLVGVDEERKELVLGIIDFMRQYTWDKHLETW  1578



>ref|XP_006495044.1| PREDICTED: LOW QUALITY PROTEIN: putative 1-phosphatidylinositol-3-phosphate 
5-kinase FAB1C-like [Citrus sinensis]
Length=1725

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/757 (60%), Positives = 550/757 (73%), Gaps = 36/757 (5%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSMIA FRYSPIDILSV LPPSVLEFN   +Q WI KE  EL  K ++ YA
Sbjct  965   RDCLRYYGFGSMIAIFRYSPIDILSVHLPPSVLEFNGLLQQEWIRKEAEELKVKMETFYA  1024

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS+ ++ +E++  S+GC+ ++   L + ILELK  L  E+N +  L QP   ETSE  Q
Sbjct  1025  EISNVLEVMEQRSNSIGCEMSDSTDLKSHILELKVQLESERNDYIGLLQPVVMETSEPCQ  1084

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             T +D+LELNRLR +LL   HAWD +LY + S+      ++  +   S     E   +   
Sbjct  1085  TAVDILELNRLRRALLIGSHAWDRQLYSLNSLLKKGSIAKAKQGNASYAQLKELRTDLFC  1144

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLH-SEHDEPPVPKDALSYQQGSSSTSCNGDKTLE  718
             KD  L+H  EENV    +S E P   LH  + +E  +P                   TLE
Sbjct  1145  KDSKLDHDNEENVSGSLDSLESPANDLHLQQKEELNLP-------------------TLE  1185

Query  719   TRLGLENAVNKSPL----ERAPSAGSI---LSDKIDCAWTGIDPSSQDMQVHASLQEGER  877
                G EN+   S L    E   S G I   LS+KID AWTG D      QV     + +R
Sbjct  1186  P-FGSENSKLTSFLHNREEDVHSDGEITSTLSEKIDSAWTGTD------QVVPLASQTDR  1238

Query  878   RVASF-GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYG  1054
               A F GQ+S +D+   KRL SP RV+SFDSALR QERI++ LP S  +LS+++SFHA G
Sbjct  1239  PQAGFVGQISKIDNSPFKRLASPVRVHSFDSALRFQERIARGLPHSLLHLSSIRSFHASG  1298

Query  1055  DYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKD  1234
             DYR+M+RDPVSN+    SQ LP EAQKLNL+ SS+ +F S AS + EGARL++P+ G  D
Sbjct  1299  DYRSMVRDPVSNVMRTYSQILPLEAQKLNLILSSTPSFISSASRMVEGARLLLPQRGDND  1358

Query  1235  VVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFG  1414
             VVIAV+D++PTSIISYALSSKEY+DWV D+ Y ++G W   + +KE    S  S WQ FG
Sbjct  1359  VVIAVFDDDPTSIISYALSSKEYEDWVADRLYDNDGSWSAGEIHKEGSAVSTFSAWQSFG  1418

Query  1415  SLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQ  1594
             SLDLDY+H+GSYGSEDAS  +G LF+DPK SPH  ISF DES + GGKVKFSVT YFAKQ
Sbjct  1419  SLDLDYIHYGSYGSEDASSSVGTLFTDPKKSPHLTISFGDESSSAGGKVKFSVTSYFAKQ  1478

Query  1595  FDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEF  1774
             FD+LRKKCCPS +DF+RSLSR ++WSAQGGKSNV+FAKSLDERFIIKQ++KTEL+SFEEF
Sbjct  1479  FDSLRKKCCPSGVDFVRSLSRSRKWSAQGGKSNVFFAKSLDERFIIKQVKKTELESFEEF  1538

Query  1775  APKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVY  1954
             AP+YF+YLTDS +S SPTCLAK++GIYQV+VKHLKGGKETK+DL+VMENLF+ RSISRVY
Sbjct  1539  APEYFKYLTDSLNSRSPTCLAKILGIYQVSVKHLKGGKETKIDLMVMENLFFRRSISRVY  1598

Query  1955  DLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVY  2131
             DLKGS RSRYN+DT   NKVLLD+N LE+L+T+P+FLGSKAKRSLERA+WNDTSFLA V 
Sbjct  1599  DLKGSARSRYNTDTTGTNKVLLDMNLLENLRTEPLFLGSKAKRSLERAIWNDTSFLASVD  1658

Query  2132  VMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VMDYSLLVGVDEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1659  VMDYSLLVGVDEERKELVLGIIDFMRQYTWDKHLETW  1695



>ref|XP_008243348.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Prunus mume]
Length=1762

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/749 (60%), Positives = 547/749 (73%), Gaps = 7/749 (1%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSM+A FRYSPIDILSV LPPSVLEFN Q +  WI KE  EL+ K ++LYA
Sbjct  975   RDCLRYYGFGSMVAFFRYSPIDILSVHLPPSVLEFNGQVQPEWIRKEATELMGKMETLYA  1034

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +EEK  S G + +  + L N I+ELKD+L KE+N +    QP   ETSE GQ
Sbjct  1035  EISDVLDCMEEKNRSFGREMSGASELQNHIVELKDLLKKERNDYIGFLQPAFVETSEPGQ  1094

Query  362   -TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
                +D+LELNRLR SLL   H WD +LY ++S+   N +S   E  VS ++  E   ++ 
Sbjct  1095  MAVVDILELNRLRRSLLIGSHVWDRQLYSLDSLLRKNPASMATEGGVSFVHLQELTSDSS  1154

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLE  718
              KDG  ++++E+NV E    +  PG  L S   EP +P    S  +     SC+  +  E
Sbjct  1155  SKDGRFDYSHEDNVSESSKLQVRPGNDL-SLDKEPTIPTHEPS--EDPMLVSCHYSREDE  1211

Query  719   TRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQ  898
                  E  VNK+  E +PS  S LS++ID AWTG D      Q   +   G    ++  +
Sbjct  1212  IHADRE-IVNKTSCESSPSHKSTLSERIDSAWTGTDHLLVKAQPLHTSAVG-LPASAVKR  1269

Query  899   LSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRD  1078
              S  D P  +RL S  RV+SFDSA+R+QERI K LPPS  +LST++SFHA GDY++M+RD
Sbjct  1270  TSQNDDPPLRRLMSSMRVHSFDSAVRVQERIRKGLPPSSLHLSTIRSFHASGDYKSMVRD  1329

Query  1079  PVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDN  1258
             PVS+++   SQA PREA KL+ + S + +  S AS + +G RL++ +    D+V+ VYD+
Sbjct  1330  PVSSVRRTHSQAFPREAPKLDSILSFTPSLISSASQIADGVRLLLSQTSSNDIVVGVYDS  1389

Query  1259  EPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMH  1438
             EPTSIISYALSSK+Y+DWV D     +GGW   D+ KE    S  S WQ FGS+DLDY+H
Sbjct  1390  EPTSIISYALSSKDYEDWVADNLNDHQGGWSNHDSYKEDSAPSIFSPWQSFGSMDLDYIH  1449

Query  1439  FGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKC  1618
             +GSYGSEDA+  +G LFSD K SPH RISFEDES N  GKVKFSVTCYFAKQFD+LRK C
Sbjct  1450  YGSYGSEDAASSMGNLFSDAKRSPHLRISFEDESSNAVGKVKFSVTCYFAKQFDSLRKMC  1509

Query  1619  CPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYL  1798
             CPSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLD+RFI+KQ+ KTEL+SF+EFAP+YF+YL
Sbjct  1510  CPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDDRFIVKQVTKTELESFQEFAPEYFKYL  1569

Query  1799  TDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRS  1978
             ++S  SGSPTCLAKV+GIYQV VKHLKGGKETKMDL+VMENLF+ R+ISRVYDLKGS RS
Sbjct  1570  SESLGSGSPTCLAKVLGIYQVTVKHLKGGKETKMDLMVMENLFFKRNISRVYDLKGSARS  1629

Query  1979  RYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLV  2155
             RYNSDT   NKVLLD+N LESL+TKP+FLGSKAKRSLERA+WNDTSFLA V VMDYSLLV
Sbjct  1630  RYNSDTSGGNKVLLDMNLLESLRTKPMFLGSKAKRSLERAIWNDTSFLASVDVMDYSLLV  1689

Query  2156  GVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             GVD+ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1690  GVDDERKELVLGIIDFMRQYTWDKHLETW  1718



>ref|XP_009357816.1| PREDICTED: LOW QUALITY PROTEIN: putative 1-phosphatidylinositol-3-phosphate 
5-kinase FAB1C [Pyrus x bretschneideri]
Length=1756

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/752 (59%), Positives = 547/752 (73%), Gaps = 15/752 (2%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSM+A FRY+ IDILSV LPPSVLEFN Q +  WI KE  EL+ K +++YA
Sbjct  971   RDCLRYYGFGSMVAVFRYAAIDILSVHLPPSVLEFNGQVQPEWIRKEATELMGKMETVYA  1030

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +EEK  S GC+ +    L + ILELKD+L KE+NY+    QP   ETSE G+
Sbjct  1031  EISDVLDFMEEKNRSFGCEMSGTIELQHHILELKDLLKKERNYYIGFLQPAFVETSEPGK  1090

Query  362   T-TIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
                +DVLELNRLR SLL   H WD +LY ++S+      S   +  VS  +  E   +  
Sbjct  1091  MPVVDVLELNRLRRSLLIGSHVWDRQLYSLDSLLKKTPVSMATDGDVSFAHLQELISDPS  1150

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDE--PPV-PKDALSYQQGSSSTSCNGDK  709
              KDGSL++ YE++V E    +  PG  L ++ +   PP+ P + +S+   S     + DK
Sbjct  1151  GKDGSLDYGYEDHVPESSKFQVPPGSDLPTDKEPIVPPLEPSEDVSHHY-SREDEMHSDK  1209

Query  710   TLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVAS  889
              +         VNK+  +   S  S LS+KID AWTG D      Q   +    E +  +
Sbjct  1210  EI---------VNKTSCKGLSSLKSTLSEKIDSAWTGTDQLLVKAQPLGTSCLTEVQACA  1260

Query  890   FGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNM  1069
             F   S  D P  +RL SP RV SFDSALR ++RI K LPPS  +LSTL+SFHAYGDYR+M
Sbjct  1261  FEHTSQNDDPPLRRLMSPVRVQSFDSALRFRDRIRKGLPPSSLHLSTLRSFHAYGDYRSM  1320

Query  1070  IRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAV  1249
             +RDPVS+++   SQALP EAQKL+ + +S+ +F S AS + +G RL++ +    ++V+ V
Sbjct  1321  VRDPVSSVRRALSQALPHEAQKLDSILNSTPSFVSSASQIADGVRLLLSQTSSNEIVVGV  1380

Query  1250  YDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLD  1429
             YD+EPTSIISYALSSK+Y+DWV D     + GW + ++ KE   AS  + WQ FGS+DLD
Sbjct  1381  YDSEPTSIISYALSSKDYEDWVADSLNERQAGWSIHESFKEDSAASIFAPWQSFGSMDLD  1440

Query  1430  YMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALR  1609
             Y+H+G+YGSEDASG +G LF+D K SPH RISF DES N  GKV+FSVTCYFAKQFD LR
Sbjct  1441  YIHYGNYGSEDASGSMGNLFADAKRSPHLRISFGDESSNGVGKVRFSVTCYFAKQFDTLR  1500

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             KKCCPSE+DFIRSLSRC+RWSAQGGKSNVYFAKSLD+RFIIKQ+ KTEL+SF+E+AP+YF
Sbjct  1501  KKCCPSEVDFIRSLSRCQRWSAQGGKSNVYFAKSLDDRFIIKQVTKTELESFQEYAPEYF  1560

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
              YLTDS  SGSPTCLAKV+G+YQV VK LKGGKETKMDL+VMENLF+ R+ISRVYDLKGS
Sbjct  1561  NYLTDSLKSGSPTCLAKVLGMYQVTVKQLKGGKETKMDLMVMENLFFKRNISRVYDLKGS  1620

Query  1970  VRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
              RSRYNSDT   +KVLLD+N LESL+T+PIFLGSKAKRSLERAVWNDTSFLA V VMDYS
Sbjct  1621  TRSRYNSDTTGGDKVLLDMNLLESLRTQPIFLGSKAKRSLERAVWNDTSFLASVDVMDYS  1680

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVGVD+ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1681  LLVGVDDERKELVLGIIDFMRQYTWDKHLETW  1712



>gb|KDP38042.1| hypothetical protein JCGZ_04685 [Jatropha curcas]
Length=1715

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/753 (59%), Positives = 539/753 (72%), Gaps = 14/753 (2%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPIDIL+V LPPSVLEFN   +Q WI KE AELL   ++ YA
Sbjct  927   RDCLRFYGFGNMVAFFRYSPIDILNVHLPPSVLEFNGHVQQEWITKEAAELLGNVEAFYA  986

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEK-NYWNDLHQPTHEETSEEG  358
             EIS  V  +E++  S G + ++MN L N I+ELKD + KE+ NY   LH    E  S   
Sbjct  987   EISDVVDSMEQRSKSFGSELSDMNELQNHIMELKDQVRKERDNYIGVLHGAVME-NSNLS  1045

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q+T+D+LELN LR +LL + HAWD +LY ++S+   N       +A +     +   ++ 
Sbjct  1046  QSTLDILELNHLRQALLINSHAWDRQLYSLDSLLKTNSVKAVHRDAYNA--QLKESSQSS  1103

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSC----NGD  706
              KD  L+    EN   +   ++  G  L SE       K +LS Q   +  S     + +
Sbjct  1104  CKDCKLDDDQVENFPGYSKPQDYVGNDLLSEQH-----KHSLSLQHFVTEDSVLSLYHHN  1158

Query  707   KTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVA  886
             +  E     E  V+ +  +  PS  S LSD+ID AWTG D     +Q H + Q    +V 
Sbjct  1159  REEEGHPDGEITVDNTRFDDIPSKASNLSDRIDSAWTGTDQLVAKIQSHHASQTDALQVG  1218

Query  887   SFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRN  1066
             +  Q+S  D+P  KR+ +P RV+SFDSALRIQERI K LPPS  YLSTLKSFHA GDYR+
Sbjct  1219  TIKQISICDNPPLKRMVAPVRVHSFDSALRIQERIRKGLPPSSLYLSTLKSFHASGDYRS  1278

Query  1067  MIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIA  1246
             M+RDP SN     SQ LP EAQKLNLLPS + +FTS    +  GARL++P+    D+V+ 
Sbjct  1279  MVRDPTSNTMRTYSQILPLEAQKLNLLPSYAPSFTSSLYHMTGGARLLLPQRSHNDIVVG  1338

Query  1247  VYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDL  1426
             VYD++P SI+SYALSSK+Y+DWV DK   +EG WGV++  K+    S  S WQ FGSLDL
Sbjct  1339  VYDDDPASIVSYALSSKKYEDWVADKSNENEGDWGVNEHCKDDSATSTFSAWQSFGSLDL  1398

Query  1427  DYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDAL  1606
             DY+ +GSYGSED S  IG L  D + SPH  IS+ D S + GGKVKFSVTCYFAKQFD+L
Sbjct  1399  DYIRYGSYGSEDPSSSIGTLSMDSRRSPHLTISYGDNSSSAGGKVKFSVTCYFAKQFDSL  1458

Query  1607  RKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKY  1786
             RKKCCPSE+DFIRSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ++KTELDSFEEFA +Y
Sbjct  1459  RKKCCPSEVDFIRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVKKTELDSFEEFASEY  1518

Query  1787  FEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKG  1966
             F+YLTDS SSGSPTCLAKV+GIYQV VKHLKGGKETKMDL+VMENLF+ RSI+RVYDLKG
Sbjct  1519  FKYLTDSLSSGSPTCLAKVLGIYQVTVKHLKGGKETKMDLMVMENLFFKRSIARVYDLKG  1578

Query  1967  SVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDY  2143
             S RSRYN DT   NKVLLD+N +E+L+T+PIFLGSKAKRSLERA+WNDTSFLA V VMDY
Sbjct  1579  SARSRYNPDTNGQNKVLLDMNLVETLRTEPIFLGSKAKRSLERAIWNDTSFLASVDVMDY  1638

Query  2144  SLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             SLLVGVD ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1639  SLLVGVDNERKELVLGIIDFMRQYTWDKHLETW  1671



>ref|XP_004297361.1| PREDICTED: uncharacterized protein LOC101297344 [Fragaria vesca 
subsp. vesca]
Length=1719

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/751 (60%), Positives = 543/751 (72%), Gaps = 28/751 (4%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSM+A FRYSPIDILSV LPPSVLEFN Q +  WI KE  EL+ K ++LYA
Sbjct  949   RDCLRYYGFGSMVAFFRYSPIDILSVHLPPSVLEFNGQVQPDWIRKEATELMGKMETLYA  1008

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +EEK  S GC+ +   GL N I+ELKD L KE+N +    QP   ETS+ GQ
Sbjct  1009  EISDVLDHMEEKNRSFGCEMSGAGGLQNHIVELKDQLKKERNDYIGFLQPAIVETSDPGQ  1068

Query  362   -TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
                +DVLELNRLR SLL   H WD +LY ++S+   N  S+     VS     E   +  
Sbjct  1069  MAVVDVLELNRLRRSLLIGSHVWDRQLYSLDSLIQKNPVSRATNGVVSAGYLQELSTDPS  1128

Query  539   FKDGSLEHAYE-ENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTL  715
              KD  L+ A+E  +V E P     PG  L S+ +    P++ +           + D+ +
Sbjct  1129  SKDDRLDFAHEGSDVSESPKFLVPPGNDLLSDKE----PEEDM-----------HSDRDI  1173

Query  716   ETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQ-VHASLQEGERRVASF  892
                      V+++  E  PS  S LS++ID AWTG D      Q +HAS Q    + A+ 
Sbjct  1174  --------VVDETSFESLPSHNSTLSERIDSAWTGTDQLLVKAQPLHAS-QADVVQPAAV  1224

Query  893   GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMI  1072
                S  D P  ++L SP RV+SFDSA+R QERI K LPPS  +LSTL+SFHA GDYR+M+
Sbjct  1225  RPTSQFDDPPFRKLVSPMRVHSFDSAVRFQERIRKGLPPSSLHLSTLRSFHASGDYRSMM  1284

Query  1073  RDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVY  1252
             RDP+ ++    SQALP EAQKLN++ SS+ +F S AS + +G RL++ +    +VV+ VY
Sbjct  1285  RDPLYSVTRTYSQALPSEAQKLNVILSSTPSFISSASQIADGVRLLLSQTTNNNVVVGVY  1344

Query  1253  DNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDY  1432
             D+EPTSIISYALSSK+Y+DW+ DK    EG W + ++ KE   A   S WQ FGS+DLDY
Sbjct  1345  DSEPTSIISYALSSKDYEDWIGDKLNEHEGTWNIHESFKEDSAAPTFSPWQSFGSMDLDY  1404

Query  1433  MHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRK  1612
             +H GSYGSEDAS  +  LF+DPK SPH RISF DES N GGKVKFSVTCYFAK FD+LRK
Sbjct  1405  IHHGSYGSEDASSSMSNLFADPKKSPHLRISFGDESSNAGGKVKFSVTCYFAKHFDSLRK  1464

Query  1613  KCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFE  1792
              CCP+E+DF+RSLSRC+RWSAQGGKSNVYFAKSLD+RFIIKQ+ KTEL+SF+EFAP+YF+
Sbjct  1465  ICCPNEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDDRFIIKQVTKTELESFQEFAPEYFK  1524

Query  1793  YLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSV  1972
             YLTDS  SGSPTCLAK++GIYQV VKHLKGGKETKMDL+VMENLF+ R+ISRVYDLKGS 
Sbjct  1525  YLTDSLGSGSPTCLAKILGIYQVTVKHLKGGKETKMDLMVMENLFFKRNISRVYDLKGSA  1584

Query  1973  RSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSL  2149
             RSRYNSDT  ANKVLLD+N LESL+TKPIFLGSKAKRSLER++WNDT+FLA V VMDYSL
Sbjct  1585  RSRYNSDTTGANKVLLDMNLLESLRTKPIFLGSKAKRSLERSIWNDTNFLASVDVMDYSL  1644

Query  2150  LVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LVGVD+ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1645  LVGVDDERKELVLGIIDFMRQYTWDKHLETW  1675



>ref|XP_008339567.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Malus domestica]
Length=1715

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/752 (59%), Positives = 546/752 (73%), Gaps = 15/752 (2%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSM+A FRYS IDILSV LPPSVLEFN Q +  WI KE  EL+ K +++YA
Sbjct  930   RDCLRYYGFGSMVAFFRYSAIDILSVHLPPSVLEFNGQVQPEWIRKEATELMGKMETIYA  989

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +EEK  S GC+ +    L + ILELKD+L KE+N +    QP   ETSE GQ
Sbjct  990   EISDVLDCMEEKNRSFGCEMSGTIELQHHILELKDLLKKERNDYIGFLQPAFVETSEPGQ  1049

Query  362   T-TIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
                +DVLELNRLR SLL   H WD +LY ++S+      S   +  VS  +  E   +  
Sbjct  1050  MPVVDVLELNRLRRSLLIGSHVWDRQLYSLDSLLKRTPVSMATDEDVSFAHLQELISDPS  1109

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHS--EHDEPPV-PKDALSYQQGSSSTSCNGDK  709
              KD SL++ +E++V E    +  PG  L +  E + PP+ P + +S+   S     + DK
Sbjct  1110  GKDVSLDYGHEDHVSESSKFQVPPGNDLPTDKEPNVPPLEPSEDVSHHY-SRDDEMHSDK  1168

Query  710   TLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVAS  889
              +         VNK+  +   S  S LS++ID AWTG D      Q   +    E +  +
Sbjct  1169  EI---------VNKTSCKGFSSLKSTLSERIDSAWTGTDQLVVKAQPLGTSHLTEVQARA  1219

Query  890   FGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNM  1069
                 S  D P  +RL SP RV+SFDSALR ++RI K LPPS  +LSTL+SFHA GDYR+M
Sbjct  1220  VKHTSQNDDPPLRRLMSPVRVHSFDSALRFRDRIRKGLPPSSLHLSTLRSFHASGDYRSM  1279

Query  1070  IRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAV  1249
             +RDPVS+++   SQALPREAQKL+ + +S+ +F S AS + +G RL++ +    D+V+ V
Sbjct  1280  VRDPVSSVRRTLSQALPREAQKLDSILNSTPSFVSSASQIADGVRLLLSQTSSNDIVVGV  1339

Query  1250  YDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLD  1429
             YD+EPTSIISYALSSK+Y+DWV D     + GW + ++ KE   AS  S WQ FGS+DLD
Sbjct  1340  YDSEPTSIISYALSSKDYEDWVADNLNEHQAGWSIHESFKEDSAASIFSPWQSFGSMDLD  1399

Query  1430  YMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALR  1609
             Y+H+G+YGSEDASG +G LF+D K SPH RISF DES N  GKV+FSVTCYFAKQFD+ R
Sbjct  1400  YIHYGNYGSEDASGSMGNLFADAKRSPHLRISFGDESSNGVGKVRFSVTCYFAKQFDSFR  1459

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             KKCCPSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLD+RFIIKQ+ KTEL+SF+E+AP+YF
Sbjct  1460  KKCCPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDDRFIIKQVTKTELESFQEYAPEYF  1519

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
              YLTDS +SGSPTCLAKV+G+YQV VK LKGGKETKMDL+VMENLF+ R+ISRVYDLKGS
Sbjct  1520  NYLTDSLNSGSPTCLAKVLGMYQVTVKQLKGGKETKMDLMVMENLFFKRNISRVYDLKGS  1579

Query  1970  VRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
              RSRYNSDT   +KVLLD+N LESL+T+PIFLGSKAKRSLERAVWNDTSFLA V VMDYS
Sbjct  1580  TRSRYNSDTTGVDKVLLDMNLLESLRTQPIFLGSKAKRSLERAVWNDTSFLASVDVMDYS  1639

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVGVD+ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1640  LLVGVDDERKELVLGIIDFMRQYTWDKHLETW  1671



>ref|XP_007225480.1| hypothetical protein PRUPE_ppa000119mg [Prunus persica]
 gb|EMJ26679.1| hypothetical protein PRUPE_ppa000119mg [Prunus persica]
Length=1735

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/749 (59%), Positives = 535/749 (71%), Gaps = 33/749 (4%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSM+A FRYSPIDILSV LPPSVLEFN Q +  WI KE  EL+ K ++LYA
Sbjct  974   RDCLRYYGFGSMVAFFRYSPIDILSVHLPPSVLEFNGQVQPEWIRKEATELMGKMETLYA  1033

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +EEK  S G + +  + L N I+ELKD+L KE+N +    QP    TSE GQ
Sbjct  1034  EISDVLDCMEEKNRSFGREMSGASELQNHIMELKDLLKKERNDYIGFLQPAFVGTSEPGQ  1093

Query  362   -TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
                +D+LELNRLR SLL   H WD +LY ++S+   N +S   E  VS +   E   ++ 
Sbjct  1094  MAVVDILELNRLRRSLLIGSHVWDRQLYSLDSLLRKNPASMATEGGVSFVRLQELISDSS  1153

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLE  718
              KDG  ++ +E+NV E    +  PG  L S   EP +P    S                 
Sbjct  1154  SKDGRFDYGHEDNVSESSKLQVHPGNNL-SPDKEPNIPTHEPS-----------------  1195

Query  719   TRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQ  898
                       + P+  +PS  S LS++ID AWTG D          +   G     +  Q
Sbjct  1196  ----------EDPI--SPSHKSTLSERIDSAWTGTDQLLVKALPLCTSAVG-LPAGAVKQ  1242

Query  899   LSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRD  1078
              S  D P  +RL S  RV+SFDSA+R++ERI K LPPS  +LSTL+SFHA GDY++M+RD
Sbjct  1243  TSQNDDPPFRRLMSSMRVHSFDSAVRVEERIRKGLPPSSLHLSTLRSFHASGDYKSMVRD  1302

Query  1079  PVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDN  1258
             PVS+++   SQA PREAQKL+ + S + +F S AS + +G RL++      D+V+ VYD+
Sbjct  1303  PVSSVRRSHSQAFPREAQKLDSILSFTPSFVSSASQIADGVRLLLSRTSNNDIVVGVYDS  1362

Query  1259  EPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMH  1438
             EPTSIISYALSSK+Y+DWV D     +GGW   D+ KE    S  S WQ FGS+DLDY+H
Sbjct  1363  EPTSIISYALSSKDYEDWVADNLNDHQGGWSNHDSYKEDSAPSIFSPWQSFGSMDLDYIH  1422

Query  1439  FGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKC  1618
             +GSYGSEDA+  +G LF+D K SPH RISF DES NT GKVKFSVTCYFAKQFD+LRKKC
Sbjct  1423  YGSYGSEDAASSMGNLFADAKRSPHLRISFGDESSNTVGKVKFSVTCYFAKQFDSLRKKC  1482

Query  1619  CPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYL  1798
             CPSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLD+RFI+KQ+ KTEL+SF+EFAP+YF+YL
Sbjct  1483  CPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDDRFIVKQVTKTELESFQEFAPEYFKYL  1542

Query  1799  TDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRS  1978
             TDS  SGSPTCLAKV+GIYQV VKHLKGGKETKMDL+VMENLF+ R+ISRVYDLKGS RS
Sbjct  1543  TDSLGSGSPTCLAKVLGIYQVTVKHLKGGKETKMDLMVMENLFFKRNISRVYDLKGSARS  1602

Query  1979  RYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLV  2155
             RYNSDT   NKVLLD+N LESL+TKPIFLGSKAKRSLERA+WNDTSFLA V VMDYSLLV
Sbjct  1603  RYNSDTTGGNKVLLDMNLLESLRTKPIFLGSKAKRSLERAIWNDTSFLASVDVMDYSLLV  1662

Query  2156  GVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             GVD+ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1663  GVDDERKELVLGIIDFMRQYTWDKHLETW  1691



>ref|XP_007045106.1| Forms aploid and binucleate cells 1c, putative isoform 1 [Theobroma 
cacao]
 gb|EOY00938.1| Forms aploid and binucleate cells 1c, putative isoform 1 [Theobroma 
cacao]
Length=1745

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/751 (58%), Positives = 539/751 (72%), Gaps = 33/751 (4%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPIDILSV LPPS+LEF+  ++Q WI K+ AEL+ K + LYA
Sbjct  980   RDCLRFYGFGNMVAFFRYSPIDILSVHLPPSMLEFSGDAKQEWIRKDAAELMVKMEMLYA  1039

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             +IS  +  +E+K  S  C  +N + L N I+EL+D L KE+N +N L QP   ETS  G 
Sbjct  1040  DISDVLDHIEQKSNSASCQSSNASELPNHIMELRDQLRKERNDYNGLLQPVVMETSPLGL  1099

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LELNRLR SLL   H WD +L+ ++S+     + +   + +              
Sbjct  1100  AAVDILELNRLRRSLLIGSHVWDRQLHSLDSLLKKGSAVKADVDHI--------------  1145

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             KDG  E       HE       P     S+  EPP  K+ +  +Q SS T+       E+
Sbjct  1146  KDGKPE------AHE-------PNACRSSDSQEPP--KNDIGLEQNSSLTTLESVVPEES  1190

Query  722   RLGL---ENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASF  892
              L L   +   +  P E  PS  S LS+KID AWTG D  +  +Q   + Q    +  S 
Sbjct  1191  NLALCHQKREEDVHPDESIPSPASTLSEKIDSAWTGTDLLTLKVQPPEASQGDGPQAGSI  1250

Query  893   GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMI  1072
                S +D+   +++ SP R++SFDS LR QERI K L PS  +  TL+SFHA G+YR+M+
Sbjct  1251  RPTSKIDNLALRKIASPMRLHSFDSVLRFQERIQKGLYPSSLHFLTLRSFHASGEYRSMV  1310

Query  1073  RDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVY  1252
             RDPVSN+    S  LP EAQKLNLL SS+ T  + AS + EGARL++P+ G  D+VIAVY
Sbjct  1311  RDPVSNVMSTYSYTLPLEAQKLNLLLSSTPTLITSASHMAEGARLLLPQRGHSDIVIAVY  1370

Query  1253  DNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDY  1432
             D++P SII+YALSSKEY++WV DK + + GGW VSD +KE  +AS  S WQ FGSLDLDY
Sbjct  1371  DSDPASIIAYALSSKEYEEWVADKSHENGGGWSVSDRSKEDSVASNFSPWQSFGSLDLDY  1430

Query  1433  MHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRK  1612
             +H+ S+GSEDAS  +G LF+D K SPH  +SF D+S   GGKVKFSVTCYFAKQFD+LR+
Sbjct  1431  IHYRSFGSEDASSSVGALFADTKRSPHLTVSFGDDSSAAGGKVKFSVTCYFAKQFDSLRR  1490

Query  1613  KCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFE  1792
             KCCPSELDF+ SLSRC++WSAQGGKSNVYFAKSLDERFIIKQ+QKTEL+SF+EFAP+YF+
Sbjct  1491  KCCPSELDFLCSLSRCQKWSAQGGKSNVYFAKSLDERFIIKQVQKTELESFDEFAPEYFK  1550

Query  1793  YLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSV  1972
             YLTDS SSGSPTCLAK++GIYQV+VKHLKGGKETKMD +VMENLF+ RSISRVYDLKGS 
Sbjct  1551  YLTDSLSSGSPTCLAKILGIYQVSVKHLKGGKETKMDFMVMENLFFRRSISRVYDLKGSA  1610

Query  1973  RSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSL  2149
             RSRYN DT   NKVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDTSFLA V VMDYSL
Sbjct  1611  RSRYNPDTTGTNKVLLDMNLLEALRTEPIFLGSKAKRSLERAIWNDTSFLASVAVMDYSL  1670

Query  2150  LVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LVGVDEER+ELVLGIIDYMRQYTWDKHLETW
Sbjct  1671  LVGVDEEREELVLGIIDYMRQYTWDKHLETW  1701



>ref|XP_007045108.1| Forms aploid and binucleate cells 1c, putative isoform 3 [Theobroma 
cacao]
 gb|EOY00940.1| Forms aploid and binucleate cells 1c, putative isoform 3 [Theobroma 
cacao]
Length=1773

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/751 (58%), Positives = 539/751 (72%), Gaps = 33/751 (4%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPIDILSV LPPS+LEF+  ++Q WI K+ AEL+ K + LYA
Sbjct  1008  RDCLRFYGFGNMVAFFRYSPIDILSVHLPPSMLEFSGDAKQEWIRKDAAELMVKMEMLYA  1067

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             +IS  +  +E+K  S  C  +N + L N I+EL+D L KE+N +N L QP   ETS  G 
Sbjct  1068  DISDVLDHIEQKSNSASCQSSNASELPNHIMELRDQLRKERNDYNGLLQPVVMETSPLGL  1127

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LELNRLR SLL   H WD +L+ ++S+     + +   + +              
Sbjct  1128  AAVDILELNRLRRSLLIGSHVWDRQLHSLDSLLKKGSAVKADVDHI--------------  1173

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             KDG  E       HE       P     S+  EPP  K+ +  +Q SS T+       E+
Sbjct  1174  KDGKPE------AHE-------PNACRSSDSQEPP--KNDIGLEQNSSLTTLESVVPEES  1218

Query  722   RLGL---ENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASF  892
              L L   +   +  P E  PS  S LS+KID AWTG D  +  +Q   + Q    +  S 
Sbjct  1219  NLALCHQKREEDVHPDESIPSPASTLSEKIDSAWTGTDLLTLKVQPPEASQGDGPQAGSI  1278

Query  893   GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMI  1072
                S +D+   +++ SP R++SFDS LR QERI K L PS  +  TL+SFHA G+YR+M+
Sbjct  1279  RPTSKIDNLALRKIASPMRLHSFDSVLRFQERIQKGLYPSSLHFLTLRSFHASGEYRSMV  1338

Query  1073  RDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVY  1252
             RDPVSN+    S  LP EAQKLNLL SS+ T  + AS + EGARL++P+ G  D+VIAVY
Sbjct  1339  RDPVSNVMSTYSYTLPLEAQKLNLLLSSTPTLITSASHMAEGARLLLPQRGHSDIVIAVY  1398

Query  1253  DNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDY  1432
             D++P SII+YALSSKEY++WV DK + + GGW VSD +KE  +AS  S WQ FGSLDLDY
Sbjct  1399  DSDPASIIAYALSSKEYEEWVADKSHENGGGWSVSDRSKEDSVASNFSPWQSFGSLDLDY  1458

Query  1433  MHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRK  1612
             +H+ S+GSEDAS  +G LF+D K SPH  +SF D+S   GGKVKFSVTCYFAKQFD+LR+
Sbjct  1459  IHYRSFGSEDASSSVGALFADTKRSPHLTVSFGDDSSAAGGKVKFSVTCYFAKQFDSLRR  1518

Query  1613  KCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFE  1792
             KCCPSELDF+ SLSRC++WSAQGGKSNVYFAKSLDERFIIKQ+QKTEL+SF+EFAP+YF+
Sbjct  1519  KCCPSELDFLCSLSRCQKWSAQGGKSNVYFAKSLDERFIIKQVQKTELESFDEFAPEYFK  1578

Query  1793  YLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSV  1972
             YLTDS SSGSPTCLAK++GIYQV+VKHLKGGKETKMD +VMENLF+ RSISRVYDLKGS 
Sbjct  1579  YLTDSLSSGSPTCLAKILGIYQVSVKHLKGGKETKMDFMVMENLFFRRSISRVYDLKGSA  1638

Query  1973  RSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSL  2149
             RSRYN DT   NKVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDTSFLA V VMDYSL
Sbjct  1639  RSRYNPDTTGTNKVLLDMNLLEALRTEPIFLGSKAKRSLERAIWNDTSFLASVAVMDYSL  1698

Query  2150  LVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LVGVDEER+ELVLGIIDYMRQYTWDKHLETW
Sbjct  1699  LVGVDEEREELVLGIIDYMRQYTWDKHLETW  1729



>ref|XP_010105766.1| 1-phosphatidylinositol-3-phosphate 5-kinase [Morus notabilis]
 gb|EXC06051.1| 1-phosphatidylinositol-3-phosphate 5-kinase [Morus notabilis]
Length=1755

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/752 (59%), Positives = 541/752 (72%), Gaps = 22/752 (3%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             +DCLRYYG G+M+  FRYSPIDILSV LPPS+LEFN   +  W+ KE  +L+RK ++LYA
Sbjct  977   KDCLRYYGFGNMVVFFRYSPIDILSVHLPPSMLEFNGDVQPEWLRKEATQLMRKMETLYA  1036

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +E+K  S G + ++ + L N I+ELKD++ KE+N +  + QP   E S+  Q
Sbjct  1037  EISDVLDVMEDKSKSFGHELSDTSELLNHIMELKDLVKKERNDYIAMLQPAIMEISQPDQ  1096

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D LELNRLR SLL   H WD R Y ++S+   N  S+  +  +S   P E   ++  
Sbjct  1097  MSVDALELNRLRRSLLIGSHVWDRRFYSLDSLLKRNSLSRFSQGDLSFAQPLELKSDSSC  1156

Query  542   KDGSLEHAYEENVHE---FPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKT  712
             KD  ++H  + NV E    P+S E       S+H EP +P       + S   SC+    
Sbjct  1157  KD-DIDHGNDGNVSESLKLPDSLE---NDPLSDHREPNIPPCEPCAPEDSKLISCHHSGQ  1212

Query  713   LETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHA-SLQEGERRVAS  889
              ET    E A N +  E  PS  + LS++ID AWTG DP     Q     LQ G  R   
Sbjct  1213  EETHTDGEIAKNVALSENTPSDETTLSERIDFAWTGTDPLPVKAQFCVDGLQNGPIR---  1269

Query  890   FGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNM  1069
               Q S  D+P  +RL  PARV+SFDSALR+QERI K LPPS  ++STL+SFHA GDYRNM
Sbjct  1270  --QASQSDNPPFRRLALPARVHSFDSALRVQERIRKGLPPS-LHVSTLRSFHASGDYRNM  1326

Query  1070  IRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAV  1249
             IRDPVS++    SQ LP+EAQKLNL+ SS+ +F S AS + EG R+++P+  Q+D+V+AV
Sbjct  1327  IRDPVSSVMRTYSQVLPQEAQKLNLILSSTPSFISSASHVAEGVRMLLPQTSQEDIVVAV  1386

Query  1250  YDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLD  1429
             YDNEPTS+ISYALSSKEY DWV DK    E GW   ++NKE   AS  S WQ FGS+DLD
Sbjct  1387  YDNEPTSVISYALSSKEYDDWVADKSNEQEVGWSTHESNKEDSAASTFSAWQSFGSMDLD  1446

Query  1430  YMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALR  1609
             Y+ +GS G+ED    +  LF+D K SPH R+SF D+      KVKFSVTCYFA+ FD+LR
Sbjct  1447  YICYGS-GTEDVPSSMSSLFTDTKKSPHLRLSFGDD------KVKFSVTCYFAELFDSLR  1499

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             KKCCPSE+DF+RSLSRCKRWSAQGGKSNVYFAKSLD+RFI+KQ+ KTEL+SFEEFAP+YF
Sbjct  1500  KKCCPSEVDFLRSLSRCKRWSAQGGKSNVYFAKSLDDRFIVKQVTKTELESFEEFAPEYF  1559

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +YLT S +SGSPTCLAK++GIYQV  KHLKGGKETKMDL+VMENLF+ R ISR+YDLKGS
Sbjct  1560  KYLTHSLNSGSPTCLAKILGIYQVTTKHLKGGKETKMDLMVMENLFFKRRISRIYDLKGS  1619

Query  1970  VRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
              RSRYN DT  ANKVLLD+N LE+L+TKPIFLGSKAKRSLERA+WNDT+FLA V VMDYS
Sbjct  1620  ARSRYNPDTTGANKVLLDMNLLETLRTKPIFLGSKAKRSLERAIWNDTAFLASVDVMDYS  1679

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVGVD+ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1680  LLVGVDDERKELVLGIIDFMRQYTWDKHLETW  1711



>ref|XP_003631178.2| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Vitis vinifera]
Length=1759

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/757 (58%), Positives = 546/757 (72%), Gaps = 26/757 (3%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPIDILSV LPP++LEFN Q +Q WI KE +ELL K +++Y 
Sbjct  975   RDCLRFYGFGSMVAFFRYSPIDILSVHLPPAMLEFNGQVQQEWIRKEASELLSKIETVYV  1034

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             +IS  + ++E+K  S   + ++ + LHN I++LKD+L +E+N +N+L QP+    S  GQ
Sbjct  1035  KISDVLDRIEQKTTSFRNESSDKSELHNHIMDLKDLLNRERNDYNNLLQPSGVGASPSGQ  1094

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFS-SQHPENAVSCINPGEWGGETI  538
               +D+LELN LR SLL   H WD RL  ++S+ +   S S++ +   S         ++ 
Sbjct  1095  VAVDILELNCLRRSLLIGSHVWDQRLSSLDSLLETRISISKNKQGEASHAEMKGCSTDSF  1154

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDE--------PPVPKDALSYQQGSSSTS  694
               +  L+H +EENV +    ++     +  EH E        P VP++++        TS
Sbjct  1155  LMNSKLDHYHEENVTQSSKIQDSHRNDMLLEHKEEINPSLFEPQVPENSML-------TS  1207

Query  695   CNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGE  874
              + ++  E  +   +  NK+ LE  PS  S LSDKID AWTG D      Q   +L    
Sbjct  1208  GHDNRKEEAYV---DEKNKTLLESIPSPASNLSDKIDSAWTGTDQLLMKPQFVHTLHADG  1264

Query  875   RRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYG  1054
              +  S  Q++ +D+P  +R  SP RVYSFDSA+R+QERI K LPPS  +LSTL+SFHA G
Sbjct  1265  NQAGSVRQINQIDTPPFRRPMSPVRVYSFDSAVRVQERIRKGLPPSSLHLSTLRSFHASG  1324

Query  1055  DYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKD  1234
             DYRNM+RDPVS++    SQ  PREAQK+    +SS   +SH +   EGARL++P+ G  +
Sbjct  1325  DYRNMVRDPVSSVMRTYSQLSPREAQKVGS--TSSFFSSSHVA---EGARLLLPQTGHGN  1379

Query  1235  VVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFG  1414
             +VIAVYDNEPTSIISYALSSK+Y+DWV DK    EGGW  +++NKE    S  +    FG
Sbjct  1380  LVIAVYDNEPTSIISYALSSKKYEDWVADKLNEHEGGWSANESNKEDSSVSTSAW-SSFG  1438

Query  1415  SLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQ  1594
              LDLDY+H+GSYGSED+   +G LF+D K SPH RISF DES N GGKVKFSVTCYFAKQ
Sbjct  1439  PLDLDYIHYGSYGSEDSLSAVGTLFTDTKKSPHLRISFGDESSNAGGKVKFSVTCYFAKQ  1498

Query  1595  FDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEF  1774
             FD LRKKCCP+E+DF+RSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQ+ KTEL SFE+F
Sbjct  1499  FDTLRKKCCPNEVDFVRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQVTKTELVSFEKF  1558

Query  1775  APKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVY  1954
             A +YF+YLT S SSGSPTCLAK++GIYQV VK+LKGGKETKMDL+VMENLF+ R+ISRVY
Sbjct  1559  AHEYFKYLTHSLSSGSPTCLAKILGIYQVTVKNLKGGKETKMDLMVMENLFFKRNISRVY  1618

Query  1955  DLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVY  2131
             DLKGS R RYN+DT  ANKVLLD N LE+L TKPIFLGSKAKRSLERA+WNDTSFLA V 
Sbjct  1619  DLKGSARCRYNADTTGANKVLLDTNLLETLCTKPIFLGSKAKRSLERAIWNDTSFLASVD  1678

Query  2132  VMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VMDYSLLVGVD ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1679  VMDYSLLVGVDNERKELVLGIIDFMRQYTWDKHLETW  1715



>ref|XP_002526008.1| fyve finger-containing phosphoinositide kinase, fyv1, putative 
[Ricinus communis]
 gb|EEF36348.1| fyve finger-containing phosphoinositide kinase, fyv1, putative 
[Ricinus communis]
Length=1651

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/752 (59%), Positives = 534/752 (71%), Gaps = 17/752 (2%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPIDIL+V LPP VLEFN   +Q WI KE AELL   ++ YA
Sbjct  882   RDCLRFYGFGSMVAFFRYSPIDILNVYLPPPVLEFNGHIQQEWIKKEAAELLGNMEAFYA  941

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +E+K  S G + +++N L N I+ELKD L KE+N++  + Q     +S+ GQ
Sbjct  942   EISDVLDGMEQKSKSFGNELSDLNELQNHIVELKDQLRKERNHYKGILQVYIGGSSQLGQ  1001

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             T +D+LELN LR +LL   H WD +LY ++S+   N   +      S     E   +T  
Sbjct  1002  TPLDILELNSLRRALLVGSHVWDRQLYSLDSLLKTNSVIKAIHGDASNARLKELRSDTC-  1060

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQ----GSSSTSCNGDK  709
             KD   E+ + EN   +   E+  G GL  E +     K++LS++Q     S ST  + ++
Sbjct  1061  KDCKPENGHVENACGYAKQEDPVGNGLLLEQN-----KNSLSFEQYIAEDSMSTLHHHNR  1115

Query  710   TLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVAS  889
               E     E  VN++  +  PS  S LS++ID AWTG D     +Q  +  Q    +V  
Sbjct  1116  EEEAHSDGEITVNRTCFDDIPSKASTLSERIDSAWTGTDQLLNKIQPPSVSQIDGFQVGP  1175

Query  890   FGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNM  1069
               Q+S  D+   K++ +P RV SFDSALRIQERI K LPPS  YLSTLKSFHA GDYR+M
Sbjct  1176  VKQMSICDNHPLKKMLAPVRVNSFDSALRIQERIRKGLPPSSLYLSTLKSFHASGDYRSM  1235

Query  1070  IRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAV  1249
             +RDPV N    CSQ LP EAQKLNLLPSSS++F S AS +  GARL++P  GQ D+ I V
Sbjct  1236  VRDPVLNAMRACSQTLPPEAQKLNLLPSSSSSFISSASHMTGGARLLLPPRGQNDIAIGV  1295

Query  1250  YDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLD  1429
             YDN+P SI+SYALSSKEY DWV DK   ++G WG+++  KE    S LSTWQ FGSLD+D
Sbjct  1296  YDNDPASIVSYALSSKEYDDWVADKSNENQGSWGMNEHYKEESATSTLSTWQSFGSLDMD  1355

Query  1430  YMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALR  1609
             Y+ +GSYGSED S  IG LF D K SPH  ISF D+S    GKVKFSVTCYFAKQFD+LR
Sbjct  1356  YIRYGSYGSEDPSSSIGTLFMDSKRSPHLAISFGDDSSTAAGKVKFSVTCYFAKQFDSLR  1415

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             KKCCP+E+DF+RSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ++KTELDSFEEFA +YF
Sbjct  1416  KKCCPNEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVKKTELDSFEEFASEYF  1475

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +YLTDS SS SPTCLAKV+GIYQV VKHLKGGKE K         F+ RSI+RVYDLKGS
Sbjct  1476  KYLTDSLSSRSPTCLAKVLGIYQVTVKHLKGGKEMKX------XXFFKRSIARVYDLKGS  1529

Query  1970  VRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
              RSRYN DT   NKVLLD+N +E+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDYS
Sbjct  1530  ARSRYNPDTTGENKVLLDMNLVETLRTEPIFLGSKAKRSLERAIWNDTNFLASVDVMDYS  1589

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVGVD ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1590  LLVGVDHERKELVLGIIDFMRQYTWDKHLETW  1621



>ref|XP_008389223.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Malus domestica]
Length=1727

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/749 (58%), Positives = 521/749 (70%), Gaps = 39/749 (5%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSM+A FRYSPIDILSV LPPSVLEFN Q +  WI +E  EL+ K +++YA
Sbjct  972   RDCLRYYGFGSMVAFFRYSPIDILSVHLPPSVLEFNGQVQPEWIRQEATELMGKMETIYA  1031

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +EEK  S G   +    L N I+ELKD+L KE+N +    QP   ETSE GQ
Sbjct  1032  EISDVLDCMEEKNRSXGHQMSGAIELQNHIMELKDLLKKERNDYIGFLQPAFVETSEPGQ  1091

Query  362   TTI-DVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
               + D+LELNRLR SLL   H WD +LY ++S+      S   +  VS  +  E      
Sbjct  1092  MPVSDILELNRLRRSLLIGSHVWDRQLYSLDSLLKGXPVSMATDGVVSFAHLQELISGPF  1151

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLE  718
              KDGSL++  E+NV E                        +  +Q  S   SC+  +  E
Sbjct  1152  DKDGSLDYGSEDNVSE------------------------SSKFQVPSXDISCHYSREEE  1187

Query  719   TRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQ  898
                  E  V ++  E   S  S LS++ID AWTG D      Q   +    E +  +   
Sbjct  1188  MHSDKE-IVGETSYEGLSSLKSTLSERIDSAWTGTDQLLVKAQPLDASHLTELQAGAVKH  1246

Query  899   LSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRD  1078
              S  D P  KRL SP RV SFDS L  Q+RI K             SFHA GDYR+M+R 
Sbjct  1247  TSQSDDPPFKRLMSPVRVQSFDSVLGFQDRIRK------------GSFHASGDYRSMVRH  1294

Query  1079  PVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDN  1258
             PVS ++   SQALPREAQKL+ + +S+ +F S AS + +G RL++ +    D+V+ VYD+
Sbjct  1295  PVSRVRRTLSQALPREAQKLDSILNSTPSFVSSASQIADGVRLLLSQTSNNDIVVGVYDS  1354

Query  1259  EPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMH  1438
             EPTSIISYALSSK+Y+DWVTD     + GW + ++ KE P AS  S WQ FGS+DLDY+H
Sbjct  1355  EPTSIISYALSSKDYEDWVTDNLNEHQAGWSIHESLKEDPTASIFSPWQSFGSMDLDYIH  1414

Query  1439  FGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKC  1618
             +G+YGSED S  +G LF++ K SPH RISF DES N  GKV+FSVTCYFAKQFD+LRKKC
Sbjct  1415  YGTYGSEDTSASMGNLFAEAKRSPHLRISFGDESSNGVGKVRFSVTCYFAKQFDSLRKKC  1474

Query  1619  CPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYL  1798
             CPSE+DF+RSLSRCKRWSAQGGKSNVYFAKSLD+RFIIKQ+ KTEL+SF+EFAPKYF+YL
Sbjct  1475  CPSEVDFVRSLSRCKRWSAQGGKSNVYFAKSLDDRFIIKQVTKTELESFQEFAPKYFKYL  1534

Query  1799  TDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRS  1978
             TDS SSGSPTC+AKV+GIYQV VKHLKGGKETKMDL+VMENLF+ R+ISRVYDLKGS RS
Sbjct  1535  TDSLSSGSPTCIAKVLGIYQVTVKHLKGGKETKMDLMVMENLFFKRNISRVYDLKGSTRS  1594

Query  1979  RYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLV  2155
             RYNSDT   +KVLLD+N LESL+T+P+FLGSKAKRSLERA+WNDTSFLA V VMDYSLLV
Sbjct  1595  RYNSDTTGEDKVLLDMNLLESLRTQPMFLGSKAKRSLERAIWNDTSFLASVDVMDYSLLV  1654

Query  2156  GVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             GVD+ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1655  GVDDERKELVLGIIDFMRQYTWDKHLETW  1683



>ref|XP_011038665.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Populus euphratica]
Length=1756

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/756 (56%), Positives = 536/756 (71%), Gaps = 22/756 (3%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPIDIL+V LPPSVLEFNS  +  WI KE +ELL K ++ Y 
Sbjct  970   RDCLRFYGFGSMVAFFRYSPIDILNVHLPPSVLEFNSTIQHEWIRKEASELLGKMETFYG  1029

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +E++    G + ++ N L + I+ELKD L+KEK+ +N + Q    E+S+  Q
Sbjct  1030  EISGVLDSMEQRSKYFGGELSDTNELQSYIMELKDQLLKEKDDYNVMLQLAVMESSD--Q  1087

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             T +D+LELNRLR +LL   H WD +L+ ++S+   N   +  E  VS     ++  +   
Sbjct  1088  TVVDILELNRLRRALLIGSHVWDQKLFSLDSVLKTNSLIKAKEGGVSYTELKDFRNDIFC  1147

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPP------VPKDALSYQQGSSSTSCNG  703
             KD   +  +EEN+  +  S+E       SE  E        +P+ +L     ++    + 
Sbjct  1148  KDSKFDRDHEENISGYSKSKEIVWNDFQSEKKETSPSFEIFLPEHSLLPLHHNTEDEVHA  1207

Query  704   DKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQ-VHASLQEGER-  877
             D            VNK+     PS  S LSD+ID AWTG +     +Q +HA   E +  
Sbjct  1208  DG---------ETVNKTFFNDIPSHASNLSDRIDSAWTGTNQLPIKVQPLHAPQAEADGF  1258

Query  878   RVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGD  1057
             +  S  Q +  D+P  +R+ +P RV+SFDSALR+QERI K LPPS  +LST++SFHA GD
Sbjct  1259  QPGSVRQPNLYDNPPFRRMMAPLRVHSFDSALRVQERIQKGLPPS-LHLSTIRSFHASGD  1317

Query  1058  YRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDV  1237
             YR+M+RDPVS +    SQ LP EAQKLNL+P+S+ T  S A+ +  GARL++P     D+
Sbjct  1318  YRSMLRDPVS-VMRTYSQTLPLEAQKLNLIPNSTGTLISSAANMAGGARLLLPMRTSSDI  1376

Query  1238  VIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGS  1417
             VI VYDN+P S++SYALSSKEY+DWVTD    + G W   + +KE+  AS  + WQ FGS
Sbjct  1377  VIGVYDNDPASVVSYALSSKEYEDWVTDSSNENGGIWSTFERSKEASAASSFTAWQSFGS  1436

Query  1418  LDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQF  1597
             +DLD++ +G YGSED S  +G LF   K SPH  IS+ D+S   GGKVKFSVTCYFAKQF
Sbjct  1437  VDLDHISYGGYGSEDPSSSLGNLFMVSKKSPHLTISYGDDSSFAGGKVKFSVTCYFAKQF  1496

Query  1598  DALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFA  1777
             D+LRKKCCPS++DF+RSLSRC++WSAQGGKSNVYFAKSLDERFIIKQ++KTEL+SFEEFA
Sbjct  1497  DSLRKKCCPSDVDFVRSLSRCQKWSAQGGKSNVYFAKSLDERFIIKQIKKTELESFEEFA  1556

Query  1778  PKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYD  1957
              +YF+YLTDS  SGSPTCLAK++GIYQV VKHL GGKETKMDL+VMENLF+ R+I+RVYD
Sbjct  1557  LEYFKYLTDSLKSGSPTCLAKILGIYQVTVKHLGGGKETKMDLMVMENLFFNRNIARVYD  1616

Query  1958  LKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYV  2134
             LKGS RSRYN DT   NKVLLD+N +E+L+T PIFLGSKAKRSLERA+WNDTSFLA V V
Sbjct  1617  LKGSSRSRYNPDTSGPNKVLLDMNLVETLRTDPIFLGSKAKRSLERAIWNDTSFLASVDV  1676

Query  2135  MDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             MDYSLLVGVD+ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1677  MDYSLLVGVDDERKELVLGIIDFMRQYTWDKHLETW  1712



>ref|XP_002312432.2| hypothetical protein POPTR_0008s127802g, partial [Populus trichocarpa]
 gb|EEE89799.2| hypothetical protein POPTR_0008s127802g, partial [Populus trichocarpa]
Length=1559

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/750 (56%), Positives = 522/750 (70%), Gaps = 34/750 (5%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+  FRYSPIDIL+V LPPS+LEFN   +Q W  KE AELL K ++ Y 
Sbjct  787   RDCLRFYGFGSMVVFFRYSPIDILNVHLPPSMLEFNGIVQQEWTRKEAAELLGKMETFYG  846

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EI   +  +E++    G + ++ N L N I+ELKD L+KEKN ++ + Q    E+ +  Q
Sbjct  847   EIFGVLDSMEQRSKYFGSELSDTNELQNRIMELKDQLVKEKNNYSGILQLAVMESLQLDQ  906

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             T +D+LELNRLR +LL   H W  +LY ++ +   N+  +  E  VS     +   +   
Sbjct  907   TAMDILELNRLRRTLLIGSHVWYRKLYSLDCLLKTNYLVKAKEGDVSYTELKDLKNDIFC  966

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             KD  L+H +EEN+  +  S+E  G    SE  E                    G++T   
Sbjct  967   KDSKLDHDHEENISGYSKSQEHVGNDFQSEKKE-------------------TGEETASK  1007

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV-HASLQEGER-RVASFG  895
              L  +N          PS  S LSD+ID AWTG D     +Q  HAS  E +  +  S  
Sbjct  1008  TLFSDN----------PSHASNLSDRIDSAWTGTDQLPIKVQPPHASQAEADGFQPVSVR  1057

Query  896   QLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIR  1075
             Q +  D+P  +R+ +P RV+SFDSALR QERI K LPP   +LST++SFHA GDYR+M+R
Sbjct  1058  QPNLFDNPPFRRMVAPKRVHSFDSALRAQERIQKGLPPL--HLSTIRSFHASGDYRSMVR  1115

Query  1076  DPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYD  1255
             DPVSN     SQ LP EA KLNL+ SS+ +F S A+ +  GARL++P     D+VI VYD
Sbjct  1116  DPVSNAMRTYSQTLPLEAHKLNLMHSSTHSFISSAANMAGGARLLLPVRANSDLVIGVYD  1175

Query  1256  NEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYM  1435
             N+P S++SYALSSKE++DWVTD+   S G W     +KE   AS  ++WQ   S+DLDYM
Sbjct  1176  NDPASVVSYALSSKEHEDWVTDRSNESAGIWSTIKHSKEDSAASSFTSWQSLDSMDLDYM  1235

Query  1436  HFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKK  1615
              +GSYGSED    +G LF D K SPH  IS+ED S    GKV+FSVTCYFAKQFD LRKK
Sbjct  1236  SYGSYGSEDPFSTLGTLFMDSKKSPHLTISYEDASSIAEGKVRFSVTCYFAKQFDFLRKK  1295

Query  1616  CCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEY  1795
             CCPS++DF+RSLSRC++WSAQGGKSNVYFAKSLDERFIIKQ++KTEL+SFE+FAP+YF+Y
Sbjct  1296  CCPSDVDFVRSLSRCQKWSAQGGKSNVYFAKSLDERFIIKQVKKTELESFEKFAPEYFKY  1355

Query  1796  LTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVR  1975
             L DS +SGSPTCLAK++GIYQV VKHL+G KETKMDL+VMENLF+ R+I RVYDLKGS R
Sbjct  1356  LIDSLNSGSPTCLAKILGIYQVTVKHLRGVKETKMDLMVMENLFFNRNIGRVYDLKGSSR  1415

Query  1976  SRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLL  2152
             SRYN+DT  +NKVLLD N +E L+T+PIFLGSKAKRSLERA+WNDTSFLA V VMDYSLL
Sbjct  1416  SRYNTDTSGSNKVLLDTNLVERLRTEPIFLGSKAKRSLERAIWNDTSFLASVDVMDYSLL  1475

Query  2153  VGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VGVD+ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1476  VGVDDERKELVLGIIDFMRQYTWDKHLETW  1505



>ref|XP_011070636.1| PREDICTED: LOW QUALITY PROTEIN: putative 1-phosphatidylinositol-3-phosphate 
5-kinase FAB1C [Sesamum indicum]
Length=1649

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/748 (57%), Positives = 515/748 (69%), Gaps = 81/748 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPI+ILSVRLPPS+LEF+S  EQ+W+ KE +ELL KA++LYA
Sbjct  938   RDCLRFYGFGSMVAFFRYSPINILSVRLPPSILEFSSPKEQSWLRKEASELLSKAEALYA  997

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS+ +Q++ E+ +S   ++ + N LH  IL+L DML  EK+Y+ D  Q   EE  E  +
Sbjct  998   EISAVLQEINERSSSFMHEFTDANDLHGHILDLNDMLANEKSYYKDSLQLADEEILEHDR  1057

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LE+NRLRHSLL   H WD RLY + S+   + S +  E            G+ ++
Sbjct  1058  AEVDILEINRLRHSLLIGSHVWDRRLYLLNSLLKRSSSPKAKE------------GDGVY  1105

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K       YEEN     + E  P                        S+ S   DK    
Sbjct  1106  K-------YEENAINITSLERLP------------------------SAASILSDK----  1130

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                                       ID AW G   +    Q+  +L        S   +
Sbjct  1131  --------------------------IDSAWCGTGQALMTAQLTNTLSADLSEAISVVPV  1164

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             +  D+P+ +RL SP RVYSFDSA R+QER++K  PPS  +LSTL+SFHA GDY+ M++DP
Sbjct  1165  NQKDNPSFRRLLSPTRVYSFDSAQRLQERMTKVQPPS-LHLSTLRSFHASGDYKYMLKDP  1223

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+Q   SQ  P EA+KLNL  ++S +F S  S+LP+GAR M+ +NGQ D+VIAVYDNE
Sbjct  1224  VSNVQRTYSQVSPHEAEKLNLTSNASPSFISSISLLPQGARSMIQQNGQYDIVIAVYDNE  1283

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             PTS+ISYAL+SKEY DW+ DKP   E G   S  NK + +AS LSTW+ FGSLDLDY H+
Sbjct  1284  PTSLISYALTSKEYVDWIADKPNGPERGSNASLINKMNSVASDLSTWRSFGSLDLDY-HY  1342

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
              +Y SEDAS  +G L +DPK SP+ RISFEDES  T GKVKFSVTCYFAK+FDALR+KCC
Sbjct  1343  ANYSSEDASATVGSLIADPKNSPNLRISFEDESSLTLGKVKFSVTCYFAKEFDALRRKCC  1402

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             PSE+D +RSLSRCKRWSAQGGK      KS DERFIIKQ+ KTEL+SF EFAP+YF+YLT
Sbjct  1403  PSEVDIVRSLSRCKRWSAQGGK-----XKSFDERFIIKQVTKTELESFNEFAPEYFKYLT  1457

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             D+ SSGSPTCLAKV+GIYQV+VKH K  KETKMDL+VMENLF+ RSIS+VYDLKGS RSR
Sbjct  1458  DALSSGSPTCLAKVLGIYQVSVKHAKTAKETKMDLMVMENLFFKRSISKVYDLKGSARSR  1517

Query  1982  YNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YNSDT  ANKVLLD+N LE+L T PIFLGSKAKR LERAVWNDTSFLA V VMDYSLLVG
Sbjct  1518  YNSDTTGANKVLLDMNLLETLHTNPIFLGSKAKRRLERAVWNDTSFLASVDVMDYSLLVG  1577

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VDEERKELVLGIIDYMRQYTWDKHLETW
Sbjct  1578  VDEERKELVLGIIDYMRQYTWDKHLETW  1605



>ref|XP_008454774.1| PREDICTED: LOW QUALITY PROTEIN: putative 1-phosphatidylinositol-3-phosphate 
5-kinase FAB1C [Cucumis melo]
Length=1747

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/752 (57%), Positives = 542/752 (72%), Gaps = 20/752 (3%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYS IDILSV LPPSVLEFNS  +Q WI  E +E++ K +SLYA
Sbjct  967   RDCLRFYGYGSMVAFFRYSTIDILSVNLPPSVLEFNSHVQQEWISNEASEIIGKMESLYA  1026

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  V ++E+K      + ++ + + + I +LK++L KE++ +  L QP   + S  G 
Sbjct  1027  EISDVVDRMEQKSKLPMQESSDSSDVQSHITQLKELLQKERSDYIGLLQPFMMKPSLMGM  1086

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR SLL   H WDHRLY ++S+     +S+     VS     +   ++  
Sbjct  1087  ISVDILELNRLRRSLLMHTHYWDHRLYSLDSLLKKILNSK---TDVSSSIMRDLKSDSAH  1143

Query  542   KDGSLEHAYEENVHEFPNSEE-CPGEGLHSEHDEPPVPKDALSYQQGSSST--SCNGDKT  712
              DG LE  + EN+HE   + E    + +HS+  E     ++ +Y++ +S++  +C  +  
Sbjct  1144  SDGKLESGHNENIHESSLAHEFAENDDIHSDRKE-----ESTAYERSTSTSHQACREETH  1198

Query  713   LETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASF  892
              +  L    A      E  PS  S LS++IDCAW+G + S +     ++LQ  E    + 
Sbjct  1199  TDGELTTSMA-----FESIPSYESTLSERIDCAWSGTEQSMKKHPTVSALQAEEPNDGAV  1253

Query  893   GQLSHVDSPTCKR-LKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNM  1069
              Q+S  D P  +R L SP RV+SFDSA+R+QERI K L PS   LS+++SFHA  DY  M
Sbjct  1254  KQMSQNDHPQMRRVLMSPVRVHSFDSAIRMQERIRKGLYPSTFQLSSIRSFHASADYSTM  1313

Query  1070  IRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAV  1249
             +RDP+SN+    SQ LP E QK NLL SS+T++ S AS +PEG RL++P+ G  D+VIAV
Sbjct  1314  LRDPISNLTRTHSQMLPLEVQKSNLLLSSTTSYIS-ASHVPEGVRLLLPQTGNNDIVIAV  1372

Query  1250  YDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLD  1429
             YDNEPTSII+YAL+S+EY DWV DK  ++EGG  V   N E    S LS WQ FG LDLD
Sbjct  1373  YDNEPTSIIAYALNSREYDDWVADKFSVNEGGRSVPRINIEDSRPSPLSAWQSFGGLDLD  1432

Query  1430  YMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALR  1609
             Y+H+G+YGSED+S  +  LFSDPK SPH R+SF DES  +GGKVKFSVTCYFAKQFD LR
Sbjct  1433  YIHYGNYGSEDSST-MRTLFSDPKKSPHLRLSFVDESSISGGKVKFSVTCYFAKQFDLLR  1491

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             KKCCP  +DF+RSLSRC RWSAQGGKSNVYFAKSLDERFIIKQ+ +TELDSFEEFAP+YF
Sbjct  1492  KKCCPKGVDFVRSLSRCCRWSAQGGKSNVYFAKSLDERFIIKQVTRTELDSFEEFAPEYF  1551

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +YL+ + + GSPTCLAK++GIYQV VKHLKGGKE KMDL+VMENLF+ R+IS+VYDLKGS
Sbjct  1552  KYLSQALTYGSPTCLAKILGIYQVTVKHLKGGKEMKMDLMVMENLFFMRNISKVYDLKGS  1611

Query  1970  VRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
              RSRYN DT  ANKVLLDLN LE+L+TKPIFLGSKAKR LERA+WNDTSFLA + VMDYS
Sbjct  1612  SRSRYNPDTSGANKVLLDLNLLEALRTKPIFLGSKAKRILERAIWNDTSFLASIDVMDYS  1671

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVG+DEERKELVLGIID+MRQYTWDK LETW
Sbjct  1672  LLVGIDEERKELVLGIIDFMRQYTWDKQLETW  1703



>ref|XP_009356152.1| PREDICTED: LOW QUALITY PROTEIN: putative 1-phosphatidylinositol-3-phosphate 
5-kinase FAB1C [Pyrus x bretschneideri]
Length=1742

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/758 (57%), Positives = 522/758 (69%), Gaps = 43/758 (6%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSM+A FRYSPIDILSV LPPSVLEFN Q +  WI +E  EL+ K +++YA
Sbjct  973   RDCLRYYGFGSMVAFFRYSPIDILSVHLPPSVLEFNGQVQPEWIRQEATELMGKMETIYA  1032

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  +  +EEK  S G        L N I+ELKD+L KE+N +    QP   ETSE GQ
Sbjct  1033  EVSDVLDCMEEKNRSFGHQMPGTIELQNHIMELKDLLKKERNNYIGFLQPAFVETSEPGQ  1092

Query  362   TTI-DVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
               + D+LELNRLR SLL   H WD +LY ++S+   N  S   +  VS  +  E    + 
Sbjct  1093  MPVSDILELNRLRRSLLIGSHVWDRQLYSLDSLLKRNPVSMATDGVVSFAHLQELISGSS  1152

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLE  718
              KDGSL++  E+NV                         D+  +Q  S   SC+  +  E
Sbjct  1153  GKDGSLDYGSEDNV------------------------SDSSKFQVPSEDISCHYSREEE  1188

Query  719   TRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQ  898
                  E  V ++  E   S  S LS++ID AWTG D      Q   +    E +  +   
Sbjct  1189  MHSDKE-IVGQTSCEGLSSLKSTLSERIDSAWTGTDQLLVKAQPLDASHLTELQAGAVMH  1247

Query  899   LSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRD  1078
                 D P  KRL SP RV SFDS LR ++  S    PS  +LSTL+SFHA GDYR+M+RD
Sbjct  1248  TRQSDDPPFKRLMSPVRVQSFDSVLRFRKGFS----PSSLHLSTLRSFHASGDYRSMVRD  1303

Query  1079  PVSNIQMIC---------SQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQK  1231
             PVS ++            SQALP EAQKL+ + +S+ +F S AS + +G RL++ +    
Sbjct  1304  PVSRVRRTLPRRGLXXXXSQALPLEAQKLDSILNSTPSFVSSASQIADGVRLLLSQTSNN  1363

Query  1232  DVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRF  1411
             D+V+ VYD+EPTSIISYALSSK+Y+DWV D     + GW + ++ KE   AS  S WQ F
Sbjct  1364  DIVVGVYDSEPTSIISYALSSKDYEDWVADNLNEHQAGWSIRESLKEDSTASIFSPWQSF  1423

Query  1412  GSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAK  1591
             GS+DLDY+    YGSED S  +G LF++ K SPH RISF DES N  GKVKFSVTCYFA+
Sbjct  1424  GSMDLDYI---PYGSEDTSASMGNLFANAKRSPHLRISFGDESSNGVGKVKFSVTCYFAE  1480

Query  1592  QFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEE  1771
             QFD+LRKKCCPSE+DF+RSLSRCKRWSAQGGKSNVYFAKSLD+RFIIKQ+ KTEL+SF+E
Sbjct  1481  QFDSLRKKCCPSEVDFVRSLSRCKRWSAQGGKSNVYFAKSLDDRFIIKQVTKTELESFQE  1540

Query  1772  FAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRV  1951
             FAP+YF+YLTDS SSGSPTCLAKV+GIYQV VKHLKGGKETKMDL+VMENLF+ R+ISRV
Sbjct  1541  FAPEYFKYLTDSLSSGSPTCLAKVLGIYQVTVKHLKGGKETKMDLMVMENLFFKRNISRV  1600

Query  1952  YDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGV  2128
             YDLKGS RSRYNSDT   +KVLLD+N LESL+T+P+FLGSKAKRSLERA+WNDTSFLA V
Sbjct  1601  YDLKGSTRSRYNSDTAGGDKVLLDMNLLESLRTQPMFLGSKAKRSLERAIWNDTSFLASV  1660

Query  2129  YVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
              VMDYSLLVGVDEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1661  DVMDYSLLVGVDEERKELVLGIIDFMRQYTWDKHLETW  1698



>ref|XP_010274641.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Nelumbo nucifera]
Length=1799

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/780 (55%), Positives = 528/780 (68%), Gaps = 35/780 (4%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSM+A FRYSPIDILS+ LPPS+LEFN   +Q W+ +E  ELL K + LY 
Sbjct  978   RDCLRYYGFGSMVAFFRYSPIDILSICLPPSMLEFNGHIQQEWVRQEAVELLTKMELLYT  1037

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+  A+  +E+K  S G +  N +  HN I+ELKD+L KE++ ++ L QP   +    GQ
Sbjct  1038  EVFDALHNIEQKGMSFGHEPTNKSEFHNHIMELKDLLKKERHEYDGLVQPARLDDIHPGQ  1097

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFS----SQHPENAVSCINPGEWGG  529
               +D+LELNRLR  L  D + WD RL  + SIF    S        + A +C    E   
Sbjct  1098  IAVDILELNRLRRYLFIDCYIWDRRLCSLNSIFGVKSSISKVDSRMQEAATCSKMAELKS  1157

Query  530   ETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEP------PVPKDALSYQQGSSST  691
             E+  KDG    A++EN  +  +  +     L+SEH E          K+  +    S+ST
Sbjct  1158  ESFRKDGRFRCAHDENSSK--SLVKNLKHALYSEHREEHSLEYLEPTKNQPAEVDSSNST  1215

Query  692   SCNGDKTLE---------TRLGLENAVN--KSPLERAPSAGSILSDKIDCAWTGIDPSSQ  838
                G + LE          R+  +  V   K  +E  PS  S LS+ ID AWTG      
Sbjct  1216  DDYGHEDLELATFHLHKLNRMHADGEVTGQKVSMESIPSPTSNLSETIDLAWTGTGKQPM  1275

Query  839   DMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPS  1018
              +Q+    Q    +  S G ++ +++ + +RL SP RVYSFDSALR+QERI K   P+  
Sbjct  1276  KVQLLQPFQTDRHQTGSAGFINQMNNQSYRRLMSPVRVYSFDSALRVQERICKGQSPTSL  1335

Query  1019  YLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTF-TSHASILPE  1195
              L+++KSFHA GDYR+MIRDP+ N+     Q LPR+A+ LN + SS  +F TS +S+  E
Sbjct  1336  RLTSVKSFHASGDYRSMIRDPIPNMLKTYPQVLPRQAKNLNFMFSSPPSFITSASSMAGE  1395

Query  1196  GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKES  1375
             G RL++P+ G  ++V+AVYD+EPTS+ISYALS K+Y DW+  K   + GGW V+D +KE 
Sbjct  1396  GVRLLLPQTGHNNIVVAVYDSEPTSVISYALSCKDYDDWIAGKSSENGGGWSVNDNSKED  1455

Query  1376  PIAS----------KLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRIS  1525
              ++S          + S  Q FGSLD D  H+ SY  +D S  IG L SD K SPH RIS
Sbjct  1456  ELSSLSGYLYVSGSEFSARQSFGSLDSDDHHYISYRFDDRSSSIGSLPSDSKKSPHLRIS  1515

Query  1526  FEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFA  1705
             F DES + G KVKFSVTCYFAKQF  LRKKCCPSE+DFIRSLSRCKRW AQGGKSN YFA
Sbjct  1516  FGDESSSPGSKVKFSVTCYFAKQFHVLRKKCCPSEVDFIRSLSRCKRWHAQGGKSNAYFA  1575

Query  1706  KSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGG  1885
             KSLDERFI+KQ+ KTELDSFEEFAPKYF+YL DS +SGSPTCLAKV+GIYQV++KHLKGG
Sbjct  1576  KSLDERFIVKQVTKTELDSFEEFAPKYFKYLIDSLTSGSPTCLAKVLGIYQVSIKHLKGG  1635

Query  1886  KETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFL  2062
             KE KMDL+VMENLFY R+ISRVYDLKGS RSRYN DT   N VLLD+N LE+L+TKPIFL
Sbjct  1636  KEMKMDLMVMENLFYKRNISRVYDLKGSARSRYNPDTTGKNNVLLDMNLLEALRTKPIFL  1695

Query  2063  GSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             GSKAKRSLERAVWNDTSFLA V VMDYSLLVGVD ++KELV+GIID+MRQYTWDKHLETW
Sbjct  1696  GSKAKRSLERAVWNDTSFLASVDVMDYSLLVGVDNDQKELVIGIIDFMRQYTWDKHLETW  1755



>gb|EYU19339.1| hypothetical protein MIMGU_mgv1a000197mg [Erythranthe guttata]
Length=1446

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/752 (55%), Positives = 523/752 (70%), Gaps = 77/752 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YGCGSM+A FRYS I++LSVRLPPS+LEF    EQ WI +E  EL  KA+ L+A
Sbjct  722   RDCLRFYGCGSMVAFFRYSTINVLSVRLPPSILEFGGTGEQMWIRREAYELSSKARDLHA  781

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +++ + K  S   ++++ + LH  +LEL D+L +EK+Y+ ++ Q   E   E+ Q
Sbjct  782   EISDFLEEFKAKSLSAMDEFSDASELHRHVLELDDILFEEKSYYQNMLQIADENIREQDQ  841

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LE+NRLRHSL+     WD R+Y ++S+   + S     N V+ +   +   +T F
Sbjct  842   AALDILEINRLRHSLVISSQVWDRRIYSLDSLLKRSSSL----NDVASLARSKEYSDTYF  897

Query  542   KDGSLE-HAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLE  718
             KD + +    E+++ E+   E+                                      
Sbjct  898   KDSTTDVLGSEDSIFEYAKPEDYSSN----------------------------------  923

Query  719   TRLGLENAV--NKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASF  892
                  EN V  N +PLER PSA SILSDKID AW+G D +  ++    +         SF
Sbjct  924   -----ENYVDENTAPLERLPSAASILSDKIDSAWSGADVAPPNVDPAETTTP-----PSF  973

Query  893   GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMI  1072
              ++SH      +   +P RVYSFDSA R+QER+SK LPPS  YLSTL+SFHA GDYR+M+
Sbjct  974   ARISHT-----RPNMAPTRVYSFDSAQRLQERMSKGLPPSSLYLSTLRSFHASGDYRSMV  1028

Query  1073  RDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVY  1252
             RDPV+++Q   SQ   RE+++LNL PSS    +S  S+LP+GARLMVP+N   DVV+ V+
Sbjct  1029  RDPVAHVQRTFSQGSLRESERLNLSPSS--FISSATSLLPDGARLMVPQN---DVVLTVF  1083

Query  1253  DNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDY  1432
             D EPTSIISYALSSK+Y+DW++D+P             K + +AS LSTW  FGS+DLDY
Sbjct  1084  DKEPTSIISYALSSKKYEDWISDRPN--------GPIRKVNSLASNLSTWHSFGSMDLDY  1135

Query  1433  MHFG-SYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALR  1609
             +++  SY SE+A+            SPH RISFEDES N   KVKFSVTCY+AK+FD+LR
Sbjct  1136  INYTRSYTSEEATDH------SSNSSPHVRISFEDESSNLATKVKFSVTCYYAKRFDSLR  1189

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
              +CCP E+DFIRSLSRC+RWSAQGGKSNVYFAKS DERF+IKQ+ KTELDSFEEFAP+YF
Sbjct  1190  GECCPGEVDFIRSLSRCRRWSAQGGKSNVYFAKSFDERFVIKQVTKTELDSFEEFAPEYF  1249

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +YLTD+ SSGSPT LAKV+GIYQV VKH++GGKE KMDL+VMENLF+GRSIS+VYDLKGS
Sbjct  1250  KYLTDALSSGSPTSLAKVLGIYQVTVKHMRGGKEVKMDLMVMENLFFGRSISKVYDLKGS  1309

Query  1970  VRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
             VRSRYNSDT  ANKVLLD N LE+L+T PIFLGSKAKR LERAVWNDTSFLA V VMDYS
Sbjct  1310  VRSRYNSDTTGANKVLLDTNLLETLRTNPIFLGSKAKRILERAVWNDTSFLASVDVMDYS  1369

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVGVDEERKE+V+GIID+MRQYTWDKHLETW
Sbjct  1370  LLVGVDEERKEMVIGIIDFMRQYTWDKHLETW  1401



>gb|KHG05428.1| 1-phosphatidylinositol-3-phosphate 5-kinase [Gossypium arboreum]
 gb|KHG13279.1| 1-phosphatidylinositol-3-phosphate 5-kinase [Gossypium arboreum]
 gb|KHG18351.1| 1-phosphatidylinositol-3-phosphate 5-kinase [Gossypium arboreum]
Length=1614

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/751 (56%), Positives = 521/751 (69%), Gaps = 38/751 (5%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+MIA FRY+PIDILSV LP S+LEF+   ++ WI KE AEL+ K + LYA
Sbjct  854   RDCLRFYGFGNMIAFFRYTPIDILSVHLPLSMLEFSGDIQREWIRKEAAELMVKVEILYA  913

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   +  +E+K  S     +N + L N I+EL+D + KE+N +  L QPT  ETS    
Sbjct  914   EVLDVLDNIEQKNNS-----SNASDLSNHIMELRDQIQKERNDYISLLQPTAIETSHLDL  968

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             TT+D+LELN L+ SLL  LH WD RL        N+  S   + +     PG      + 
Sbjct  969   TTMDILELNCLKRSLLIGLHVWDRRL--------NSLDSHLGKGSAFKGKPG------LS  1014

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGD--KTL  715
             KDG L+ AY +  ++  +S E               PK     +Q SS  +   D  + L
Sbjct  1015  KDGKLD-AYRQKTYKSTDSLE--------------PPKSDARLEQNSSLPTFESDVPEEL  1059

Query  716   ETRLGLENAVNKSPLERAP-SAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASF  892
             +  L +EN V     +++  S  S LS++ID AW G D  +  +Q   + Q  E +    
Sbjct  1060  DLALCIENKVENEETDKSVHSPTSTLSERIDSAWIGTDLLTLKVQYPEAYQGNELQTRLV  1119

Query  893   GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMI  1072
                S +D+   +++ SP RV+SFDS LR+Q RI K L PS  +LSTLKSFHA  DYR M+
Sbjct  1120  KPTSKIDNLPLRKVASPMRVHSFDSVLRLQARIQKGLHPSTLHLSTLKSFHATRDYRTMV  1179

Query  1073  RDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVY  1252
             RDPVSN+    S  LP EAQKLNL   S+ T  + AS + EGARL++ +    D+VIAVY
Sbjct  1180  RDPVSNVTSTYSYTLPFEAQKLNLSLRSTPTLINCASHVAEGARLLLVQRVHSDIVIAVY  1239

Query  1253  DNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDY  1432
             DN+P SIISYALSSKEY++WV DK     GGW + D +K+    S  S WQ FGSLD DY
Sbjct  1240  DNDPASIISYALSSKEYEEWVDDKSIKMGGGWSIIDRSKKDSATSSFSPWQPFGSLDTDY  1299

Query  1433  MHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRK  1612
              HFGS+GSED S  IG +F+D K SPH  +SF D+S   GG VKFSVTCYFAKQF +LR+
Sbjct  1300  THFGSFGSEDTSSSIGAMFTDTKRSPHLIVSFGDDSYVGGGIVKFSVTCYFAKQFYSLRR  1359

Query  1613  KCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFE  1792
             KCCP+E+DF+RSLSRC++WSAQGGKSNVYFAKSLDERFIIKQ+QKTEL+SF EFAP+YF+
Sbjct  1360  KCCPNEVDFVRSLSRCQKWSAQGGKSNVYFAKSLDERFIIKQVQKTELESFNEFAPEYFK  1419

Query  1793  YLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSV  1972
             YL+DS SSGSPTCLAK++GIYQV+VKHLKGGKETKMDL+VMENLF+ RSISR+YDLKGS 
Sbjct  1420  YLSDSLSSGSPTCLAKILGIYQVSVKHLKGGKETKMDLVVMENLFFRRSISRIYDLKGSA  1479

Query  1973  RSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSL  2149
             RSRYN DT   NKVLLD+N LE+L+T+PIFLGSKAKR LERA+WNDTSFLA + VMDYSL
Sbjct  1480  RSRYNPDTSGRNKVLLDMNLLETLRTEPIFLGSKAKRILERAIWNDTSFLASIAVMDYSL  1539

Query  2150  LVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LVG+DEE  ELVLGIID+MRQYTWDKHLETW
Sbjct  1540  LVGLDEEHNELVLGIIDFMRQYTWDKHLETW  1570



>ref|XP_011023174.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X3 [Populus euphratica]
Length=1505

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/759 (55%), Positives = 519/759 (68%), Gaps = 20/759 (3%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+  F+YSPIDIL+V LPPSVLEFN   +Q W  KE  ELL K ++ Y 
Sbjct  701   RDCLRFYGFGSMVVFFQYSPIDILNVSLPPSVLEFNGIVQQEWTRKEAVELLGKMETFYG  760

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWND-----LHQPTHEET  346
             EI   +  +E++    G +  + N L N I+ELKD L+KEKN ++      + Q    E+
Sbjct  761   EIFGVLDSMEQRSKYFGSELADTNELQNRIMELKDQLVKEKNNYSSPCKQGMLQLAVMES  820

Query  347   SEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWG  526
              +  QT +D+LELNRLR +LL   H W+ +LY ++ +   N+  +  E  VS     +  
Sbjct  821   LQLDQTAMDILELNRLRRTLLIGSHVWNRKLYSLDCLIKTNYLVKAKEGDVSYTELKDLK  880

Query  527   GETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQ----QGSSSTS  694
              +   +D  L+  +EEN+  +  S+E  G    SE  E       LS++    + S   S
Sbjct  881   NDIFCEDSKLDRDHEENISGYSKSQEHVGNDFQSEKKEA-----GLSFEHRVLEHSMLPS  935

Query  695   CNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQ-VHASLQEG  871
             C  +   E     E A +K+     PS  S LSD+ID AWTG D     +Q +HAS  E 
Sbjct  936   CYHNTEDEVHADEETA-SKTLFSDIPSHASNLSDRIDSAWTGTDQLPIKVQPLHASQAEA  994

Query  872   ER-RVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHA  1048
             +  +  S  Q +  D+   +R+ +P RV+SFDSALR QER  K LPP   +L T +SFHA
Sbjct  995   DGFQPVSVRQPNLFDNAPFRRMVAPERVHSFDSALRAQERTQKGLPPL--HLLTARSFHA  1052

Query  1049  YGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQ  1228
              GDYR+M+RDPVSN     SQ LP EA KLN + SS+ +F S A+ +  GARL++P    
Sbjct  1053  SGDYRSMVRDPVSNAMRTYSQILPLEAHKLNSMHSSTHSFISSAANMAGGARLLLPVRAN  1112

Query  1229  KDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQR  1408
             +D+VI VYDN+P S++SYALSSKEY+DWVTD+   S G W     +KE   AS  + WQ 
Sbjct  1113  RDLVIGVYDNDPASVVSYALSSKEYEDWVTDRSNESGGIWSTIKHSKEDSAASSFTAWQS  1172

Query  1409  FGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFA  1588
               S+DLDYM +GSYGS D    +G LF D K SPH  IS+ED S    GKV+FSVTCYFA
Sbjct  1173  LDSMDLDYMSYGSYGSGDPFSTLGTLFMDSKKSPHLTISYEDASSIAEGKVRFSVTCYFA  1232

Query  1589  KQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFE  1768
             KQFD LRKKCCPS++DF+RSLSRC++WSAQGGKSNVYFAKSL ERFIIK+++KTEL+SFE
Sbjct  1233  KQFDFLRKKCCPSDVDFVRSLSRCQKWSAQGGKSNVYFAKSLGERFIIKEVKKTELESFE  1292

Query  1769  EFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISR  1948
             +FAP+YFEYL DS +SGSPTCLAK++GIYQV VKHL+G KE KMDL+VMENLF+ R+I R
Sbjct  1293  KFAPEYFEYLIDSLNSGSPTCLAKILGIYQVTVKHLRGVKEKKMDLMVMENLFFNRNIVR  1352

Query  1949  VYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAG  2125
             VYDLKGS RSRYN DT  +NKVLLD N +E L+T+PIFLGSKAKRSLERA+WNDTSFLA 
Sbjct  1353  VYDLKGSSRSRYNPDTSGSNKVLLDTNLVERLRTEPIFLGSKAKRSLERAIWNDTSFLAS  1412

Query  2126  VYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             V VMDYSLLVGVD ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1413  VDVMDYSLLVGVDGERKELVLGIIDFMRQYTWDKHLETW  1451



>ref|XP_010259723.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Nelumbo nucifera]
Length=1814

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/776 (56%), Positives = 542/776 (70%), Gaps = 35/776 (5%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSM+A FRYSPIDILSVRLPPSVLEFN+  +Q W+ +E  ELL K + LYA
Sbjct  1001  RDCLRYYGFGSMVAFFRYSPIDILSVRLPPSVLEFNAHIQQEWVRQEAIELLNKMEFLYA  1060

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EI   +  +E+K  S G +  NM+  H+ I+ELK++L KE+N ++ L QP   +     Q
Sbjct  1061  EIFDVLHSIEQKGISFGYELTNMSEFHSHIIELKELLKKERNEYDGLLQPDGLDNMHPDQ  1120

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFS----SQHPENAVSCINPGEWGG  529
             T +D+LELNRLR  LL   + WD RL  ++S+     S      +  +A +C    E   
Sbjct  1121  TAVDILELNRLRRYLLIGCYIWDRRLCSLDSLLRAKSSISKVDSYMHDATACAKRVELIS  1180

Query  530   ETIFKDGSL--EHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNG  703
             E+  KDG L  E    + + E P  +    E    +H EP       S++    + + +G
Sbjct  1181  ESFCKDGKLNREDNSSKPLGERPALKSEQTEEHSPQHFEPAQDHLVDSFK----AVNYDG  1236

Query  704   DKTLETRLGLEN----------AVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVH  853
              + LE  LG  N             K+P+E    + S LSD ID AWTG        Q  
Sbjct  1237  FEDLELALGHGNKHEMFIDGEVTSQKTPVECVLPSTSNLSDTIDLAWTGTGHQLIKNQFQ  1296

Query  854   ASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTL  1033
             AS  +G++ + S G L+ + +P+C RL SP RVYSF+SALR+Q++I K L P+   L++ 
Sbjct  1297  ASQPDGQQ-MGSAG-LNQMGNPSCTRLMSPVRVYSFNSALRVQDKIHKGLSPTSLSLTSF  1354

Query  1034  KSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTF-TSHASILPEGARLM  1210
             +SFHA GDYRNMIRDP+ N+    SQ  PRE +KLN + SS  +F TS +++  EG RL+
Sbjct  1355  RSFHASGDYRNMIRDPIPNMLRTYSQVSPREVKKLNSIFSSPPSFITSASNMAGEGVRLL  1414

Query  1211  VPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSD-TNKESPIA-  1384
             +P+ G  ++V+AVYDNEPTS+ISY LSSK+++DWV DK     GG G +D  NKE   + 
Sbjct  1415  LPQTGHNNIVVAVYDNEPTSLISYVLSSKDHEDWVADKLDEHGGGCGANDFINKEDEFSN  1474

Query  1385  ---------SKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDE  1537
                      S  S WQ  GSLD D +++ SYGS+D+S  IG LFSD K SPH ++SFED+
Sbjct  1475  LSGYPNLAGSAFSVWQSLGSLDSDDLYYRSYGSDDSSSTIGSLFSDSKRSPHFKVSFEDD  1534

Query  1538  SCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLD  1717
             S +  GK+KFSVTCYFAKQFDALRKKCCPSE++FIRSLSRCKRWSAQGGKSNVYFAKSLD
Sbjct  1535  SSSPAGKMKFSVTCYFAKQFDALRKKCCPSEVNFIRSLSRCKRWSAQGGKSNVYFAKSLD  1594

Query  1718  ERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETK  1897
             ERFIIKQ+ KTELDSFEEF+P+YF+YLTDS +SGSPTCLAKVVGIYQV++KHLKGG+ETK
Sbjct  1595  ERFIIKQVTKTELDSFEEFSPEYFKYLTDSLTSGSPTCLAKVVGIYQVSIKHLKGGRETK  1654

Query  1898  MDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKAN-KVLLDLNFLESLQTKPIFLGSKA  2074
             MDL+VMENLF+ RSISRVYDLKGS RSRYN DT     VLLDLN LE+L+TKPIFLGSKA
Sbjct  1655  MDLMVMENLFFRRSISRVYDLKGSARSRYNPDTTGKNNVLLDLNLLETLRTKPIFLGSKA  1714

Query  2075  KRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             KRSLERAVWNDTSFLA V VMDYSLLVGVD++RKELVLGIID+MRQYTWDKHLETW
Sbjct  1715  KRSLERAVWNDTSFLASVDVMDYSLLVGVDDDRKELVLGIIDFMRQYTWDKHLETW  1770



>ref|XP_011023165.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X2 [Populus euphratica]
Length=1761

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/754 (55%), Positives = 519/754 (69%), Gaps = 15/754 (2%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+  F+YSPIDIL+V LPPSVLEFN   +Q W  KE  ELL K ++ Y 
Sbjct  962   RDCLRFYGFGSMVVFFQYSPIDILNVSLPPSVLEFNGIVQQEWTRKEAVELLGKMETFYG  1021

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EI   +  +E++    G +  + N L N I+ELKD L+KEKN ++ + Q    E+ +  Q
Sbjct  1022  EIFGVLDSMEQRSKYFGSELADTNELQNRIMELKDQLVKEKNNYSGMLQLAVMESLQLDQ  1081

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             T +D+LELNRLR +LL   H W+ +LY ++ +   N+  +  E  VS     +   +   
Sbjct  1082  TAMDILELNRLRRTLLIGSHVWNRKLYSLDCLIKTNYLVKAKEGDVSYTELKDLKNDIFC  1141

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQ----QGSSSTSCNGDK  709
             +D  L+  +EEN+  +  S+E  G    SE  E       LS++    + S   SC  + 
Sbjct  1142  EDSKLDRDHEENISGYSKSQEHVGNDFQSEKKEA-----GLSFEHRVLEHSMLPSCYHNT  1196

Query  710   TLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQ-VHASLQEGER-RV  883
               E     E A +K+     PS  S LSD+ID AWTG D     +Q +HAS  E +  + 
Sbjct  1197  EDEVHADEETA-SKTLFSDIPSHASNLSDRIDSAWTGTDQLPIKVQPLHASQAEADGFQP  1255

Query  884   ASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYR  1063
              S  Q +  D+   +R+ +P RV+SFDSALR QER  K LPP   +L T +SFHA GDYR
Sbjct  1256  VSVRQPNLFDNAPFRRMVAPERVHSFDSALRAQERTQKGLPPL--HLLTARSFHASGDYR  1313

Query  1064  NMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVI  1243
             +M+RDPVSN     SQ LP EA KLN + SS+ +F S A+ +  GARL++P    +D+VI
Sbjct  1314  SMVRDPVSNAMRTYSQILPLEAHKLNSMHSSTHSFISSAANMAGGARLLLPVRANRDLVI  1373

Query  1244  AVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLD  1423
              VYDN+P S++SYALSSKEY+DWVTD+   S G W     +KE   AS  + WQ   S+D
Sbjct  1374  GVYDNDPASVVSYALSSKEYEDWVTDRSNESGGIWSTIKHSKEDSAASSFTAWQSLDSMD  1433

Query  1424  LDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDA  1603
             LDYM +GSYGS D    +G LF D K SPH  IS+ED S    GKV+FSVTCYFAKQFD 
Sbjct  1434  LDYMSYGSYGSGDPFSTLGTLFMDSKKSPHLTISYEDASSIAEGKVRFSVTCYFAKQFDF  1493

Query  1604  LRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPK  1783
             LRKKCCPS++DF+RSLSRC++WSAQGGKSNVYFAKSL ERFIIK+++KTEL+SFE+FAP+
Sbjct  1494  LRKKCCPSDVDFVRSLSRCQKWSAQGGKSNVYFAKSLGERFIIKEVKKTELESFEKFAPE  1553

Query  1784  YFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLK  1963
             YFEYL DS +SGSPTCLAK++GIYQV VKHL+G KE KMDL+VMENLF+ R+I RVYDLK
Sbjct  1554  YFEYLIDSLNSGSPTCLAKILGIYQVTVKHLRGVKEKKMDLMVMENLFFNRNIVRVYDLK  1613

Query  1964  GSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMD  2140
             GS RSRYN DT  +NKVLLD N +E L+T+PIFLGSKAKRSLERA+WNDTSFLA V VMD
Sbjct  1614  GSSRSRYNPDTSGSNKVLLDTNLVERLRTEPIFLGSKAKRSLERAIWNDTSFLASVDVMD  1673

Query  2141  YSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             YSLLVGVD ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1674  YSLLVGVDGERKELVLGIIDFMRQYTWDKHLETW  1707



>ref|XP_011023159.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Populus euphratica]
Length=1766

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/759 (55%), Positives = 519/759 (68%), Gaps = 20/759 (3%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+  F+YSPIDIL+V LPPSVLEFN   +Q W  KE  ELL K ++ Y 
Sbjct  962   RDCLRFYGFGSMVVFFQYSPIDILNVSLPPSVLEFNGIVQQEWTRKEAVELLGKMETFYG  1021

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWND-----LHQPTHEET  346
             EI   +  +E++    G +  + N L N I+ELKD L+KEKN ++      + Q    E+
Sbjct  1022  EIFGVLDSMEQRSKYFGSELADTNELQNRIMELKDQLVKEKNNYSSPCKQGMLQLAVMES  1081

Query  347   SEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWG  526
              +  QT +D+LELNRLR +LL   H W+ +LY ++ +   N+  +  E  VS     +  
Sbjct  1082  LQLDQTAMDILELNRLRRTLLIGSHVWNRKLYSLDCLIKTNYLVKAKEGDVSYTELKDLK  1141

Query  527   GETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQ----QGSSSTS  694
              +   +D  L+  +EEN+  +  S+E  G    SE  E       LS++    + S   S
Sbjct  1142  NDIFCEDSKLDRDHEENISGYSKSQEHVGNDFQSEKKEA-----GLSFEHRVLEHSMLPS  1196

Query  695   CNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQ-VHASLQEG  871
             C  +   E     E A +K+     PS  S LSD+ID AWTG D     +Q +HAS  E 
Sbjct  1197  CYHNTEDEVHADEETA-SKTLFSDIPSHASNLSDRIDSAWTGTDQLPIKVQPLHASQAEA  1255

Query  872   ER-RVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHA  1048
             +  +  S  Q +  D+   +R+ +P RV+SFDSALR QER  K LPP   +L T +SFHA
Sbjct  1256  DGFQPVSVRQPNLFDNAPFRRMVAPERVHSFDSALRAQERTQKGLPPL--HLLTARSFHA  1313

Query  1049  YGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQ  1228
              GDYR+M+RDPVSN     SQ LP EA KLN + SS+ +F S A+ +  GARL++P    
Sbjct  1314  SGDYRSMVRDPVSNAMRTYSQILPLEAHKLNSMHSSTHSFISSAANMAGGARLLLPVRAN  1373

Query  1229  KDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQR  1408
             +D+VI VYDN+P S++SYALSSKEY+DWVTD+   S G W     +KE   AS  + WQ 
Sbjct  1374  RDLVIGVYDNDPASVVSYALSSKEYEDWVTDRSNESGGIWSTIKHSKEDSAASSFTAWQS  1433

Query  1409  FGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFA  1588
               S+DLDYM +GSYGS D    +G LF D K SPH  IS+ED S    GKV+FSVTCYFA
Sbjct  1434  LDSMDLDYMSYGSYGSGDPFSTLGTLFMDSKKSPHLTISYEDASSIAEGKVRFSVTCYFA  1493

Query  1589  KQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFE  1768
             KQFD LRKKCCPS++DF+RSLSRC++WSAQGGKSNVYFAKSL ERFIIK+++KTEL+SFE
Sbjct  1494  KQFDFLRKKCCPSDVDFVRSLSRCQKWSAQGGKSNVYFAKSLGERFIIKEVKKTELESFE  1553

Query  1769  EFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISR  1948
             +FAP+YFEYL DS +SGSPTCLAK++GIYQV VKHL+G KE KMDL+VMENLF+ R+I R
Sbjct  1554  KFAPEYFEYLIDSLNSGSPTCLAKILGIYQVTVKHLRGVKEKKMDLMVMENLFFNRNIVR  1613

Query  1949  VYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAG  2125
             VYDLKGS RSRYN DT  +NKVLLD N +E L+T+PIFLGSKAKRSLERA+WNDTSFLA 
Sbjct  1614  VYDLKGSSRSRYNPDTSGSNKVLLDTNLVERLRTEPIFLGSKAKRSLERAIWNDTSFLAS  1673

Query  2126  VYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             V VMDYSLLVGVD ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1674  VDVMDYSLLVGVDGERKELVLGIIDFMRQYTWDKHLETW  1712



>gb|KHN43038.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1 [Glycine soja]
Length=1755

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/753 (56%), Positives = 524/753 (70%), Gaps = 35/753 (5%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPIDILSV LPPSVLEF    E+ WI KE  EL  K ++LY 
Sbjct  988   RDCLRFYGYGSMVAFFRYSPIDILSVHLPPSVLEFGHIQEE-WIRKEAEELFIKVETLYV  1046

Query  182   EISSAVQKLEEKCAS--VGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             EIS+ ++ LE K  S  +G + ++   + N IL+LKDML +E+  ++ L Q +   T++ 
Sbjct  1047  EISNVLEWLEMKIVSPGIGNESSDTCDIQNHILDLKDMLQRERTDYHCLLQ-SGSVTTQP  1105

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             G+ T+D+LELNRLR SL    H WDHRLY ++S+   +FSS+  +    C +  E   ++
Sbjct  1106  GKMTLDILELNRLRRSLHIGSHVWDHRLYSLDSLIKRSFSSKVKQEDELCADVKELRVDS  1165

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPV--PKDAL-SYQQGSSSTSCNGD  706
             + K+ + +   E+N              LH  H+   +  P DAL +   GS +    G 
Sbjct  1166  LHKERNFDCGLEQNNARLSK--------LHESHESHMLAEPDDALETCASGSFTCYLEGK  1217

Query  707   KTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVA  886
             K        +  +N++  E  P   S LS++ID AWTG D    +     S+Q   +   
Sbjct  1218  KVHS-----DGELNRTLSECFPPNESNLSERIDSAWTGTDQPQANAVPAGSIQRSNQH--  1270

Query  887   SFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRN  1066
                     DSP  +R+  P RV+SFDSA+R+QERI K LP S  +LSTL+SFHA GDY N
Sbjct  1271  --------DSPPFRRVSQPMRVHSFDSAVRVQERIRKVLPSS-LHLSTLRSFHASGDYGN  1321

Query  1067  MIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIA  1246
             M+RDPVSNI     Q LP E QKLNL+ SS+ +F S  S + EGARL++ +    D VIA
Sbjct  1322  MVRDPVSNILRSYFQMLPWETQKLNLILSSTPSFISSVSGIAEGARLLLSQTYHGDRVIA  1381

Query  1247  VYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDL  1426
             VYD++ +SIISYALSSKEY+DWV+ K  M E  W   + +KE   AS  S W   GSLDL
Sbjct  1382  VYDDDYSSIISYALSSKEYEDWVSGKSDMQESNWIARERSKEDLAASSFSAW---GSLDL  1438

Query  1427  DYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDAL  1606
             DY+++GSYGSED    +G L  D K S H +ISF D+S   GGKV FSVTCYFA+QF++L
Sbjct  1439  DYINYGSYGSEDVPSSVGSLLRDSKKSLHLQISFGDDSVGAGGKVNFSVTCYFAQQFESL  1498

Query  1607  RKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKY  1786
             RKKCCP+E+DF+RS+SRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTEL+SFEEFAP+Y
Sbjct  1499  RKKCCPNEVDFVRSMSRCRRWSAQGGKSNVYFAKSLDERFIIKQVTKTELESFEEFAPQY  1558

Query  1787  FEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKG  1966
             F+YL D+ +SG PTCLAK++GIYQV VK+ KGGKETK+DL+VMENLFY R ISR+YDLKG
Sbjct  1559  FKYLMDALNSGGPTCLAKILGIYQVTVKYPKGGKETKIDLMVMENLFYKRKISRIYDLKG  1618

Query  1967  SVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDY  2143
             S RSRYN DT   NKV+LD+N LE+L+TKPIFLGS+AKR LERAVWNDTSFLA V VMDY
Sbjct  1619  SERSRYNPDTTGTNKVMLDMNLLETLRTKPIFLGSRAKRILERAVWNDTSFLASVDVMDY  1678

Query  2144  SLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             SLLVGVD+ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1679  SLLVGVDDERKELVLGIIDFMRQYTWDKHLETW  1711



>gb|KEH30889.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Medicago 
truncatula]
Length=1726

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/752 (56%), Positives = 529/752 (70%), Gaps = 44/752 (6%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+  FRYSPID+LSV LPPSVLEF    E+ WI K   EL  K ++LY 
Sbjct  970   RDCLRFYGFGSMVVFFRYSPIDVLSVHLPPSVLEFGYIQEK-WIRKVAGELFSKVETLYV  1028

Query  182   EISSAVQKLEEKCAS--VGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             EIS+ +++LE    S  +G +  +   +HN IL+LKDML+KEK  ++ L +  +E T+E 
Sbjct  1029  EISNVLEQLETNVLSPGIGNELADAYDIHNHILDLKDMLLKEKMDYHSLLKSANE-TAEP  1087

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             G  T+D+LELNRLR SLL   H WDHRL  ++S+   + SS+  +   S  +  E   ++
Sbjct  1088  GNMTLDILELNRLRRSLLIGSHVWDHRLNSLDSLIKKSLSSKVKQETESFADGKELRVDS  1147

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPV--PKDALSYQQGSSSTSCNGDK  709
             + KD S +   E+N     NS+  P + LH  H+   +  P D    ++ S +++C+ D 
Sbjct  1148  LHKDQSFDSWLEQN-----NSQ--PSK-LHESHESHKLVEPDDQPKSRRASEASACSLDG  1199

Query  710   TLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVAS  889
               E     E   NK+  E  P   S LS+KID AWTG D   Q +QV+AS+         
Sbjct  1200  E-EPHSDAEFVSNKTSSECMPPNESNLSEKIDLAWTGTD---QPVQVNASV---------  1246

Query  890   FGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNM  1069
                         KRL  P RV+SFDSALR+Q+RI K LP S  ++STL+SFHA GDYRNM
Sbjct  1247  ------------KRLAQPMRVHSFDSALRVQDRIKKDLPLS-LHMSTLRSFHASGDYRNM  1293

Query  1070  IRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAV  1249
             +RDP+SN+     Q LP E+Q++NL+ SS+ +F S  S + EGARL++P+    + VIAV
Sbjct  1294  VRDPISNVLQNYFQMLPWESQRINLILSSTPSFISSISHIAEGARLLLPQTCHSNRVIAV  1353

Query  1250  YDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLD  1429
             YDN+ +SIISYALSSK+Y+D V+ K  + +G W   + NKE    S LS W    +LDLD
Sbjct  1354  YDNDYSSIISYALSSKDYEDCVSGKSDVRDGSWNAHERNKEDLTNSSLSAW---ATLDLD  1410

Query  1430  YMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALR  1609
             Y+++GSYGS++    I  L  D K S H  ISF D+S   GGKV FSVTCYFAKQFD+LR
Sbjct  1411  YINYGSYGSDEVPSSISSLIRDKKTSLHLPISFGDDSLGAGGKVNFSVTCYFAKQFDSLR  1470

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             KKCCP+E+DF+RSLSR +RWSAQGGKSNVYFAKSLDERFIIKQ+ KTEL+SFEEFAP+YF
Sbjct  1471  KKCCPNEVDFVRSLSRGRRWSAQGGKSNVYFAKSLDERFIIKQVTKTELESFEEFAPQYF  1530

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +Y+ D+ +SG PTCLAK++GIYQV VK+ KGGKETK+DL+VMENLFY R+ISRVYDLKGS
Sbjct  1531  KYMMDATNSGGPTCLAKILGIYQVTVKYPKGGKETKIDLMVMENLFYKRNISRVYDLKGS  1590

Query  1970  VRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
              RSRYN+DT   NKV+LD+N LE+L+TKPIFLGS+AKR LERAVWNDTSFLA V VMDYS
Sbjct  1591  ERSRYNADTTGTNKVMLDMNLLETLRTKPIFLGSRAKRKLERAVWNDTSFLASVDVMDYS  1650

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVGVD+E+KELVLGIIDYMRQYTWDKHLETW
Sbjct  1651  LLVGVDDEKKELVLGIIDYMRQYTWDKHLETW  1682



>gb|AAL38344.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ56792.1| At1g71010 [Arabidopsis thaliana]
Length=793

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/752 (53%), Positives = 511/752 (68%), Gaps = 77/752 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +Q WI  E AEL+ K +++Y 
Sbjct  70    RDCLRFYGFGNMVAFFRYSPINILTVLLPPSMLEFNSHPQQEWIRTEAAELVGKMRTMYT  129

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + ++EEK + +  + +    LH+ I+ L D L+KEK+ ++D  QP  EE + + Q
Sbjct  130   EISDMLNRMEEKSSLLEPEQSEACDLHSRIIGLIDQLVKEKDEYDDALQPIFEE-NLQIQ  188

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+LY + S                     +    ++F
Sbjct  189   GSLDILELNRLRRALMIGAHAWDHQLYLLNS---------------------QLKKASVF  227

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K G         +H+ P  +    EG   E DE           Q  + +  NGD     
Sbjct  228   KTGDDNAPRNPEMHDPPKIDRRMQEG-SDERDE-----------QSHTDSEANGD-----  270

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                     NK P E  PS G+ LS++ID AW G   S Q+++   ++ E E         
Sbjct  271   --------NKDP-ENIPSPGTSLSERIDSAWLG---SFQNLEKAETIAETE-------GF  311

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S V+S + +RL  P RV SFDSA+R QERI K LPPS  YLSTL+SFHA G+YRNM+RDP
Sbjct  312   SAVNS-SLRRLARPIRVQSFDSAIRFQERIQKGLPPSSLYLSTLRSFHASGEYRNMVRDP  370

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+    SQ LP E QKL+L+  S+ T+ S AS + +GAR+++P+ G  D+V+ VYD++
Sbjct  371   VSNVMRTYSQMLPLEVQKLDLIVGSAPTYISSASQMADGARMLIPQRGLNDIVVPVYDDD  430

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYA++SKEYK+W+ +K  ++      +  N+ES   S  STW+   S+D+DY+  
Sbjct  431   PASVVSYAINSKEYKEWIVNKG-LASSSSSSNLNNRESE-PSAFSTWRSL-SMDVDYIQH  487

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDES----CNTGGKVKFSVTCYFAKQFDALR  1609
               YGS            D + SPH  ISF D +      T GKVKFSVTCYFA QFD LR
Sbjct  488   AVYGSS----------QDDRKSPHLTISFSDRASSSSTATEGKVKFSVTCYFATQFDTLR  537

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             K CCPSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FAP+YF
Sbjct  538   KTCCPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFAPEYF  597

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +YL +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKGS
Sbjct  598   KYLKESLSSGSPTCLAKILGIYQVSIKHPKGGKETKMDLMVMENLFYNRRISRIYDLKGS  657

Query  1970  VRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
              RSRYN +T  A+KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDYS
Sbjct  658   ARSRYNPNTSGADKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLASVDVMDYS  717

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVG DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  718   LLVGFDEERKELVLGIIDFMRQYTWDKHLETW  749



>ref|XP_010066632.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X2 [Eucalyptus grandis]
 gb|KCW64603.1| hypothetical protein EUGRSUZ_G02192 [Eucalyptus grandis]
Length=1758

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/755 (55%), Positives = 524/755 (69%), Gaps = 26/755 (3%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPIDILSV LPPS LEFN   +Q W+ KE A L  K + LY 
Sbjct  976   RDCLRFYGLGSMVAFFRYSPIDILSVHLPPSKLEFNGL-QQEWLRKEAAALTDKVEKLYL  1034

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  V   E+K   +G +  + + L N I  LKD+L KE++ +++L +    E+S++GQ
Sbjct  1035  EMSDVVDNFEQKSMFLGHESLDKSDLQNQIKTLKDLLKKERSDYDELLELATMESSQQGQ  1094

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             TTID+LE+NR   SL+     WD RL+ +  +   N       +A+  +   E   + ++
Sbjct  1095  TTIDILEMNRALRSLIIGSRVWDRRLHTLNLLLGRNSPKTMQGDALY-VQLKELRNDLLY  1153

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDE-------PPVPKDALSYQQGSSSTSCN  700
             KDGS+      NV +          G   E  +       P VPK++       +ST  N
Sbjct  1154  KDGSV------NVSDSSELTSVSASGFLLEQADTNPSSLGPCVPKNS-----ALASTHHN  1202

Query  701   GDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDP-SSQDMQVHASLQEGER  877
               + + +  G+      S  E  P+    LS++IDCAWTG D  ++++   H+SL +G  
Sbjct  1203  TQEDVLSNGGINYTNTIS--ETIPTEEPNLSERIDCAWTGSDHLTTENQPFHSSLADGA-  1259

Query  878   RVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGD  1057
               AS G ++  +SP  +RL SP RV SFDS +R+++R  K LPPS  +LSTL SFHA GD
Sbjct  1260  -TASSGHINESNSPPFRRLMSPVRVQSFDSVMRVRDRQRKGLPPSSLHLSTLGSFHASGD  1318

Query  1058  YRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDV  1237
             YRNM+RDPVSN+    SQ LP EAQKLNL  SS  +    +S L EGA L++P+ G  D+
Sbjct  1319  YRNMLRDPVSNVIRTYSQMLPLEAQKLNLAVSSPPSLIPSSSRLAEGAHLLLPQTGHNDI  1378

Query  1238  VIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGS  1417
             VIAVYD EPTS+ISYAL SKE++DWV+       G W   D +K+  +AS  +TWQ FG+
Sbjct  1379  VIAVYDEEPTSVISYALCSKEHEDWVSSPSREHGGDWSGDDIDKDDVVASSFATWQSFGT  1438

Query  1418  LDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQF  1597
             LD D+ ++GS+GSEDA   +G +F D   SPH RI F DES   GGK KFSVTCYFAKQF
Sbjct  1439  LDFDHANYGSFGSEDALSSMGTIFKDSNKSPHLRIPFGDESSTAGGKAKFSVTCYFAKQF  1498

Query  1598  DALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFA  1777
             D+LR+KCCPSE+DF+RSLSRC+RWSAQGGKSNVYFAKS+DERFI+KQ+ KTEL+SFEEFA
Sbjct  1499  DSLRRKCCPSEVDFVRSLSRCRRWSAQGGKSNVYFAKSMDERFIVKQVTKTELESFEEFA  1558

Query  1778  PKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYD  1957
               YFEYLT S SSGSPTCLAKV+G+YQV VK LKGGKETKMDL+VMENLF+ R+ISRVYD
Sbjct  1559  SGYFEYLTGSISSGSPTCLAKVLGLYQVTVKSLKGGKETKMDLMVMENLFFNRNISRVYD  1618

Query  1958  LKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYV  2134
             LKGS R+RYN DT   +KVLLDLN LE+L+TKPIFLGSKAKRSLERA+WNDT+FLA V V
Sbjct  1619  LKGSARARYNPDTSGKDKVLLDLNLLEALRTKPIFLGSKAKRSLERAIWNDTNFLASVDV  1678

Query  2135  MDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLET  2239
             MDYSLLVGVD+ERKELVLGIID+MRQYTWDK LET
Sbjct  1679  MDYSLLVGVDDERKELVLGIIDFMRQYTWDKQLET  1713



>ref|XP_007157722.1| hypothetical protein PHAVU_002G092900g [Phaseolus vulgaris]
 gb|ESW29716.1| hypothetical protein PHAVU_002G092900g [Phaseolus vulgaris]
Length=1751

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/751 (56%), Positives = 516/751 (69%), Gaps = 30/751 (4%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSM+A FRYSPIDILSV LPPSVLEF    E+ WI KE  EL  K ++LY 
Sbjct  984   RDCLRYYGFGSMVAFFRYSPIDILSVHLPPSVLEFGHIREE-WIGKEAEELFIKVETLYG  1042

Query  182   EISSAVQKLEEKCASV--GCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             EIS+ + +LE K  S   G + ++   + N IL+LKDML +E+  ++ L Q +   T + 
Sbjct  1043  EISNVLGRLETKIVSPSPGSESSDTCDIQNHILDLKDMLRRERTDYHCLLQ-SGIVTPQP  1101

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             G+  +D+LELNRLR SLL   H WDHRLY ++S+   +FSS+  +    C +  E   ++
Sbjct  1102  GKMALDILELNRLRRSLLIGSHVWDHRLYSLDSLIKRSFSSKVKQENELCADFKELTVDS  1161

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTL  715
               KD +++   E+N        E     + +E D+   P        GS +    G+K  
Sbjct  1162  FHKDQNIDCGPEQNSTRLSKLHESHKSHMLAEPDDTVEP-----CASGSLTCYIEGEKVH  1216

Query  716   ETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFG  895
                   +  +NK+  E      S LS+KID AWTG D    +     S+Q   +      
Sbjct  1217  S-----DGELNKTFSECFSPNESNLSEKIDSAWTGTDQPQANAVPAGSIQPCNQH-----  1266

Query  896   QLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIR  1075
                  DSP  +RL  P RV+SFDSA+R+QERI K LP S  +LSTL+SFHA GDY NM+R
Sbjct  1267  -----DSPPLRRLTQPMRVHSFDSAVRVQERIRKVLPSS-LHLSTLRSFHASGDYGNMVR  1320

Query  1076  DPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYD  1255
             DPVSNI     Q LP E QKLNL+ SS+ TF S  S + EGARL++ +    D VIAVYD
Sbjct  1321  DPVSNILQSYVQMLPWETQKLNLILSSTPTFISSVSGIAEGARLLLSQTYHGDRVIAVYD  1380

Query  1256  NEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYM  1435
             N+ +S+ISYALSSKEY+DWV+ K  + E  W   + +KE    S  S W   G+LDLDY+
Sbjct  1381  NDYSSVISYALSSKEYEDWVSGKSDLPESSWIARERSKEDLATSSFSAW---GTLDLDYI  1437

Query  1436  HFGS-YGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRK  1612
             ++GS YG ED     G L  D K S H +ISF D+S   GGKV FSVTCYFAKQF++LRK
Sbjct  1438  NYGSSYGPEDVPSSAGSLLRDSKKSVHLQISFGDDSVGAGGKVNFSVTCYFAKQFESLRK  1497

Query  1613  KCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFE  1792
             KCCPSE+DF+RS+SRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTEL+SF EFAP+YF+
Sbjct  1498  KCCPSEVDFVRSMSRCRRWSAQGGKSNVYFAKSLDERFIIKQVTKTELESFVEFAPQYFK  1557

Query  1793  YLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSV  1972
             YL D+ +SG PTCLAK++GIYQV VK+ KGGKETK+DL+VMENLFY R+ISRVYDLKGS 
Sbjct  1558  YLMDALNSGGPTCLAKILGIYQVTVKYPKGGKETKIDLMVMENLFYKRNISRVYDLKGSE  1617

Query  1973  RSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSL  2149
             RSRYN DT   NKV+LD+N LESL+TKPIFLGS+AKR LERAVWNDTSFLA V VMDYSL
Sbjct  1618  RSRYNPDTTGTNKVMLDMNLLESLRTKPIFLGSRAKRKLERAVWNDTSFLASVDVMDYSL  1677

Query  2150  LVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LVGVD+ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1678  LVGVDDERKELVLGIIDFMRQYTWDKHLETW  1708



>gb|KHN32249.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1 [Glycine soja]
Length=1754

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/753 (55%), Positives = 521/753 (69%), Gaps = 36/753 (5%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPIDILSV LPPSVLEF    E+ WI+KE  EL  K ++LY 
Sbjct  988   RDCLRFYGFGSMVAFFRYSPIDILSVHLPPSVLEFGHIQEE-WIIKEAGELFIKVETLYV  1046

Query  182   EISSAVQKLEEKCAS--VGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             EIS+ +++LE K  S  +G +  +   + N IL+LKDML +E+  ++ L Q     T + 
Sbjct  1047  EISNVLERLETKIVSPGIGNESADTCDIQNYILDLKDMLQRERTDYHCLLQSGSVAT-QP  1105

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             G   +D+LELNRLR SLL   H WDHRL+ ++S+   +FSS+  +    C +  E   ++
Sbjct  1106  GMMKLDILELNRLRRSLLIGSHVWDHRLFSLDSLIKRSFSSKVKQENELCADVKELRVDS  1165

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPV--PKDALS-YQQGSSSTSCNGD  706
             + K+ + +   E+N              LH  H+   +  P D L     GS +    G+
Sbjct  1166  LHKEQNFDCGLEQNNTRLSK--------LHESHESHMLAEPDDTLEPCASGSFTCYLEGE  1217

Query  707   KTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVA  886
             K        +  +N++  E  PS  S LS++ID AWTG D    +     S+Q   +   
Sbjct  1218  KVHS-----DGELNRTLSECFPSNESNLSERIDSAWTGTDQPQANAVPAGSIQRPNQH--  1270

Query  887   SFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRN  1066
                     DSP  +R+  P RV+SFDSA+R+QERI K LP S  +LSTL+SFHA GDY N
Sbjct  1271  --------DSPPFRRVSQPVRVHSFDSAVRVQERIRKILPSS-LHLSTLRSFHASGDYGN  1321

Query  1067  MIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIA  1246
             M+RDP+SNI     Q LP E QKLNL+ SS+ +F S  S + EGARL++ +    D VIA
Sbjct  1322  MVRDPLSNILRSYFQMLPWETQKLNLILSSTPSFISSVSGIAEGARLLLSQTYHGDRVIA  1381

Query  1247  VYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDL  1426
             VYDN+ +SIISYALSSKEY+DWV+ K  M E      + +KE    S  S W   GSLDL
Sbjct  1382  VYDNDYSSIISYALSSKEYEDWVSGKSDMQESRIA-RERSKEDLATSGFSAW---GSLDL  1437

Query  1427  DYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDAL  1606
             DY+++GSYGSED    +G L  D K S H +ISF D+S   GGKV FSVTCYFA+QF++L
Sbjct  1438  DYINYGSYGSEDVPSSVGSLLRDSKKSLHLQISFGDDSVGAGGKVNFSVTCYFAQQFESL  1497

Query  1607  RKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKY  1786
             RKKCCP+E+DF+RS+SRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTEL+SFE+FAP+Y
Sbjct  1498  RKKCCPNEVDFVRSMSRCRRWSAQGGKSNVYFAKSLDERFIIKQVTKTELESFEKFAPQY  1557

Query  1787  FEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKG  1966
             F+YL D+ +SG PTCLAK++GIYQV VK+ KGGKETK+DL+VMENLFY R+ISRVYDLKG
Sbjct  1558  FKYLMDALNSGGPTCLAKILGIYQVTVKYPKGGKETKIDLMVMENLFYKRNISRVYDLKG  1617

Query  1967  SVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDY  2143
             S RSRYN DT   NKV+LD+N LE+L+TKPIFLGS+AKR LERAVWNDTSFLA VYVMDY
Sbjct  1618  SERSRYNPDTTGTNKVMLDMNLLETLRTKPIFLGSRAKRRLERAVWNDTSFLASVYVMDY  1677

Query  2144  SLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             SLLVGVD++ KELVLGIID+MRQYTWDKHLETW
Sbjct  1678  SLLVGVDDDSKELVLGIIDFMRQYTWDKHLETW  1710



>ref|XP_010066631.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Eucalyptus grandis]
Length=1759

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/756 (55%), Positives = 523/756 (69%), Gaps = 27/756 (4%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPIDILSV LPPS LEFN   +Q W+ KE A L  K + LY 
Sbjct  976   RDCLRFYGLGSMVAFFRYSPIDILSVHLPPSKLEFNGL-QQEWLRKEAAALTDKVEKLYL  1034

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEK-NYWNDLHQPTHEETSEEG  358
             E+S  V   E+K   +G +  + + L N I  LKD+L KE+ +Y  +L +    E+S++G
Sbjct  1035  EMSDVVDNFEQKSMFLGHESLDKSDLQNQIKTLKDLLKKERSDYDQELLELATMESSQQG  1094

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             QTTID+LE+NR   SL+     WD RL+ +  +   N       +A+  +   E   + +
Sbjct  1095  QTTIDILEMNRALRSLIIGSRVWDRRLHTLNLLLGRNSPKTMQGDALY-VQLKELRNDLL  1153

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDE-------PPVPKDALSYQQGSSSTSC  697
             +KDGS+      NV +          G   E  +       P VPK++       +ST  
Sbjct  1154  YKDGSV------NVSDSSELTSVSASGFLLEQADTNPSSLGPCVPKNS-----ALASTHH  1202

Query  698   NGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDP-SSQDMQVHASLQEGE  874
             N  + + +  G+      S  E  P+    LS++IDCAWTG D  ++++   H+SL +G 
Sbjct  1203  NTQEDVLSNGGINYTNTIS--ETIPTEEPNLSERIDCAWTGSDHLTTENQPFHSSLADGA  1260

Query  875   RRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYG  1054
                AS G ++  +SP  +RL SP RV SFDS +R+++R  K LPPS  +LSTL SFHA G
Sbjct  1261  --TASSGHINESNSPPFRRLMSPVRVQSFDSVMRVRDRQRKGLPPSSLHLSTLGSFHASG  1318

Query  1055  DYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKD  1234
             DYRNM+RDPVSN+    SQ LP EAQKLNL  SS  +    +S L EGA L++P+ G  D
Sbjct  1319  DYRNMLRDPVSNVIRTYSQMLPLEAQKLNLAVSSPPSLIPSSSRLAEGAHLLLPQTGHND  1378

Query  1235  VVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFG  1414
             +VIAVYD EPTS+ISYAL SKE++DWV+       G W   D +K+  +AS  +TWQ FG
Sbjct  1379  IVIAVYDEEPTSVISYALCSKEHEDWVSSPSREHGGDWSGDDIDKDDVVASSFATWQSFG  1438

Query  1415  SLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQ  1594
             +LD D+ ++GS+GSEDA   +G +F D   SPH RI F DES   GGK KFSVTCYFAKQ
Sbjct  1439  TLDFDHANYGSFGSEDALSSMGTIFKDSNKSPHLRIPFGDESSTAGGKAKFSVTCYFAKQ  1498

Query  1595  FDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEF  1774
             FD+LR+KCCPSE+DF+RSLSRC+RWSAQGGKSNVYFAKS+DERFI+KQ+ KTEL+SFEEF
Sbjct  1499  FDSLRRKCCPSEVDFVRSLSRCRRWSAQGGKSNVYFAKSMDERFIVKQVTKTELESFEEF  1558

Query  1775  APKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVY  1954
             A  YFEYLT S SSGSPTCLAKV+G+YQV VK LKGGKETKMDL+VMENLF+ R+ISRVY
Sbjct  1559  ASGYFEYLTGSISSGSPTCLAKVLGLYQVTVKSLKGGKETKMDLMVMENLFFNRNISRVY  1618

Query  1955  DLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVY  2131
             DLKGS R+RYN DT   +KVLLDLN LE+L+TKPIFLGSKAKRSLERA+WNDT+FLA V 
Sbjct  1619  DLKGSARARYNPDTSGKDKVLLDLNLLEALRTKPIFLGSKAKRSLERAIWNDTNFLASVD  1678

Query  2132  VMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLET  2239
             VMDYSLLVGVD+ERKELVLGIID+MRQYTWDK LET
Sbjct  1679  VMDYSLLVGVDDERKELVLGIIDFMRQYTWDKQLET  1714



>ref|XP_010681968.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Beta vulgaris subsp. vulgaris]
Length=1735

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/750 (55%), Positives = 515/750 (69%), Gaps = 55/750 (7%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A F YSPIDIL+V LPPSVLEFN QS Q W+ KEV EL  K ++ YA
Sbjct  994   RDCLRFYGFGSMVAFFHYSPIDILTVHLPPSVLEFNGQSNQDWMEKEVEELKSKMETFYA  1053

Query  182   EISSAVQKLEEK-CASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEG  358
             E+S  +  +E+K  AS  C  ++ + LH  ILE +D+L +E+N + D  Q   E+  +  
Sbjct  1054  EVSDVLHVMEQKSTASRHCAMDSTD-LHKHILESEDLLDRERNQYYDSLQQATEDKQQLV  1112

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
               T D+LELN+LR SLL D HAWD R Y+++S+   N SS   E A      G+ G   +
Sbjct  1113  VGTYDILELNQLRRSLLMDSHAWDRRFYFLDSLL--NSSSFKFEAA------GDTGSHAV  1164

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALS-YQQGSSSTSCNGDKTL  715
              KD     +   ++ +F    +  G+ +    +   +  D++   QQG       GD  +
Sbjct  1165  LKD-----SKNNSIQDF----KVVGDQVGGYAESGFLFSDSMEPSQQGE----VYGDGKI  1211

Query  716   ETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFG  895
                     +V +  L   PS  S LSDKID AWTG D       V AS           G
Sbjct  1212  --------SVKEKSLAAVPSPASNLSDKIDSAWTGTD-------VDAS------ESVPVG  1250

Query  896   QLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIR  1075
             Q+  +D+   KRL +P RV+SFDSA+R++E+  +RL  S S  ST++SFHA GDYRNM+R
Sbjct  1251  QVEKIDNLPLKRLMAPVRVHSFDSAMRLEEKTHRRLH-SLSQFSTIRSFHASGDYRNMVR  1309

Query  1076  DPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYD  1255
             DP ++I    SQ  P E Q    +PS  +T  SH +   E  RL++P  GQ+D+VIAVYD
Sbjct  1310  DPTADIMRTFSQINPHEVQ---FVPSFIST--SHTA---ESPRLLLPHTGQRDLVIAVYD  1361

Query  1256  NEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYM  1435
             +EPTSIISYALSSKEY+ WV+D+    EG     D ++E    S   +WQ FGSL+LDYM
Sbjct  1362  DEPTSIISYALSSKEYEGWVSDRWSQKEGSCIAKDVHREDSTVSSFLSWQSFGSLELDYM  1421

Query  1436  HFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKK  1615
             ++G YGSED   R     +DPK SPH +ISF+D+S   GGKVKFSVTCYFAKQFD L++K
Sbjct  1422  NYGGYGSEDTLLRSNTTVNDPKKSPHLQISFDDDSSVAGGKVKFSVTCYFAKQFDMLQEK  1481

Query  1616  CCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEY  1795
             CCP +LDF+RSLSRC+RWSAQGGKSNVYFAKS+DERFIIKQ+ KTEL+SF+EFA +YF+Y
Sbjct  1482  CCPRKLDFVRSLSRCRRWSAQGGKSNVYFAKSMDERFIIKQVTKTELESFQEFAAEYFKY  1541

Query  1796  LTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVR  1975
             L DS  SGSPTCLAKV+GI+QV VKHLKGG+E KMDL+VMENLF+ R IS++YDLKGS R
Sbjct  1542  LNDSLDSGSPTCLAKVLGIFQVTVKHLKGGREIKMDLMVMENLFFNRKISKIYDLKGSSR  1601

Query  1976  SRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLL  2152
             SRYN DT  ANKVLLD+N LE+L+T PIFLGSKAKR LERAVWNDTSFLA V VMDYSLL
Sbjct  1602  SRYNPDTTGANKVLLDMNLLETLRTNPIFLGSKAKRRLERAVWNDTSFLASVDVMDYSLL  1661

Query  2153  VGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VGVDEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1662  VGVDEERKELVLGIIDFMRQYTWDKHLETW  1691



>ref|XP_010552722.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X2 [Tarenaya hassleriana]
Length=1649

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/748 (54%), Positives = 506/748 (68%), Gaps = 80/748 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPIDIL+V LPPSVLEFNS  +  WI KE AEL+ K +++Y 
Sbjct  937   RDCLRFYGFGSMVAFFRYSPIDILTVCLPPSVLEFNSHHQHGWIRKEAAELMSKMQTMYT  996

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +EEK +S+  + ++   L +CI++LKD L+KEK+ ++D  QP   E  +E Q
Sbjct  997   EISETLNSMEEKSSSIEQELSDAYDLQSCIMDLKDQLLKEKDEYDDALQPIFVENIQESQ  1056

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             +T+D+LELNRLR +LL   +AWDH+L  + S      + +  +  VS             
Sbjct  1057  STLDILELNRLRRALLIGSYAWDHQLCLLNSRLRKACAIKASDGDVS-------------  1103

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
                     + E  H  P +   P EG       P   +D LS  +  +    +G+     
Sbjct  1104  -------GHPELQHR-PKTGLGPNEG-------PYDREDVLSDSEAITDNKDSGNTL---  1145

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                              S  S LS++ID AW G   S ++ Q    + E E         
Sbjct  1146  -----------------SPASSLSERIDSAWLGTCKSLENAQ---PMPEAE-------GF  1178

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S V+SP  +RL  P RV+SFDS LR QERI K LPPS  YLSTL+SFHA G+YRNM+RDP
Sbjct  1179  SAVNSPL-QRLARPIRVHSFDSVLRYQERIQKGLPPSSLYLSTLRSFHASGEYRNMVRDP  1237

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             V+N+    +Q LP E ++LNL+  ++ T+ S AS + +GAR ++ ++   D+VI VYD++
Sbjct  1238  VTNVMRTYTQMLPLEVKRLNLIVGTTPTYISSASHMADGARFLISQDCLNDIVIPVYDDD  1297

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S+ISYALSSKEY  WV DK      G G+    + SP      +W+  GS+D+D++H+
Sbjct  1298  PASVISYALSSKEYGGWVADK------GGGIDRNRQTSP---AFMSWRSLGSVDVDFIHY  1348

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
              +YGS+D            K SPH  ISF D+S  T GKVKFSVTCYFAK FD+LR KCC
Sbjct  1349  TAYGSQD-----------DKKSPHLTISFIDDSSATEGKVKFSVTCYFAKLFDSLRNKCC  1397

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             PSE+DF+RSLSRC+RW AQGGKSNVYFAKSLDERFIIKQ+ KTEL+SFEEFAP+YF+YLT
Sbjct  1398  PSEVDFVRSLSRCQRWRAQGGKSNVYFAKSLDERFIIKQVIKTELESFEEFAPEYFKYLT  1457

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             DS SSGSPTCLAKV+GIYQV++KHL GGKE KMDL+VMENLFY R I+R+YDLKGS RSR
Sbjct  1458  DSLSSGSPTCLAKVLGIYQVSIKHLNGGKEMKMDLMVMENLFYRRGITRIYDLKGSARSR  1517

Query  1982  YNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YN++T   NKVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDTSFLA V VMDYSLLVG
Sbjct  1518  YNANTSGGNKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTSFLASVDVMDYSLLVG  1577

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             +DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1578  IDEERKELVLGIIDFMRQYTWDKHLETW  1605



>ref|XP_010552721.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Tarenaya hassleriana]
Length=1650

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/748 (54%), Positives = 506/748 (68%), Gaps = 80/748 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPIDIL+V LPPSVLEFNS  +  WI KE AEL+ K +++Y 
Sbjct  938   RDCLRFYGFGSMVAFFRYSPIDILTVCLPPSVLEFNSHHQHGWIRKEAAELMSKMQTMYT  997

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +EEK +S+  + ++   L +CI++LKD L+KEK+ ++D  QP   E  +E Q
Sbjct  998   EISETLNSMEEKSSSIEQELSDAYDLQSCIMDLKDQLLKEKDEYDDALQPIFVENIQESQ  1057

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             +T+D+LELNRLR +LL   +AWDH+L  + S      + +  +  VS             
Sbjct  1058  STLDILELNRLRRALLIGSYAWDHQLCLLNSRLRKACAIKASDGDVS-------------  1104

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
                     + E  H  P +   P EG       P   +D LS  +  +    +G+     
Sbjct  1105  -------GHPELQHR-PKTGLGPNEG-------PYDREDVLSDSEAITDNKDSGNTL---  1146

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                              S  S LS++ID AW G   S ++ Q    + E E         
Sbjct  1147  -----------------SPASSLSERIDSAWLGTCKSLENAQ---PMPEAE-------GF  1179

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S V+SP  +RL  P RV+SFDS LR QERI K LPPS  YLSTL+SFHA G+YRNM+RDP
Sbjct  1180  SAVNSPL-QRLARPIRVHSFDSVLRYQERIQKGLPPSSLYLSTLRSFHASGEYRNMVRDP  1238

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             V+N+    +Q LP E ++LNL+  ++ T+ S AS + +GAR ++ ++   D+VI VYD++
Sbjct  1239  VTNVMRTYTQMLPLEVKRLNLIVGTTPTYISSASHMADGARFLISQDCLNDIVIPVYDDD  1298

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S+ISYALSSKEY  WV DK      G G+    + SP      +W+  GS+D+D++H+
Sbjct  1299  PASVISYALSSKEYGGWVADK------GGGIDRNRQTSP---AFMSWRSLGSVDVDFIHY  1349

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
              +YGS+D            K SPH  ISF D+S  T GKVKFSVTCYFAK FD+LR KCC
Sbjct  1350  TAYGSQD-----------DKKSPHLTISFIDDSSATEGKVKFSVTCYFAKLFDSLRNKCC  1398

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             PSE+DF+RSLSRC+RW AQGGKSNVYFAKSLDERFIIKQ+ KTEL+SFEEFAP+YF+YLT
Sbjct  1399  PSEVDFVRSLSRCQRWRAQGGKSNVYFAKSLDERFIIKQVIKTELESFEEFAPEYFKYLT  1458

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             DS SSGSPTCLAKV+GIYQV++KHL GGKE KMDL+VMENLFY R I+R+YDLKGS RSR
Sbjct  1459  DSLSSGSPTCLAKVLGIYQVSIKHLNGGKEMKMDLMVMENLFYRRGITRIYDLKGSARSR  1518

Query  1982  YNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YN++T   NKVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDTSFLA V VMDYSLLVG
Sbjct  1519  YNANTSGGNKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTSFLASVDVMDYSLLVG  1578

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
             +DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1579  IDEERKELVLGIIDFMRQYTWDKHLETW  1606



>ref|XP_004505260.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C-like isoform X1 [Cicer arietinum]
 ref|XP_004505261.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C-like isoform X2 [Cicer arietinum]
Length=1734

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/751 (55%), Positives = 516/751 (69%), Gaps = 46/751 (6%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+  FRYSPIDILSV LPPSVLEF    E+ WI KE  EL  K K+LY 
Sbjct  982   RDCLRFYGFGSMVVFFRYSPIDILSVHLPPSVLEFGYTQEK-WIRKEAGELFNKVKTLYV  1040

Query  182   EISSAVQKLEEKCAS--VGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             EIS  +++ E K  S  +G + ++ N +H+ IL+LK ML++EK  ++ L +P  EE +E 
Sbjct  1041  EISDVLERFETKILSPGIGKEVSDANDIHSHILDLKGMLLREKKDYHSLLKPA-EEIAEP  1099

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
                 +D+LELNRLR SLL   H WDHRLY ++S    +FSS+  E   S  +  +    +
Sbjct  1100  RNMALDILELNRLRRSLLIGSHVWDHRLYSLDSHIKRSFSSKVKEENASFADVYD----S  1155

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTL  715
             +  D + +   E+N     NS+  P +   S      V  D     +GS ++ C  D   
Sbjct  1156  LHTDQNFDSGLEQN-----NSQ--PSKLQESRESHKLVEPDDQLESRGSEASVCYFDGE-  1207

Query  716   ETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFG  895
             E     E   NK+  E  P   S LS+KID AWTG +   Q +  H+S            
Sbjct  1208  EPYSADELISNKTISEFVPPKESNLSEKIDLAWTGTE---QPVHSHSSF-----------  1253

Query  896   QLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIR  1075
                       KRL    RV+SFDSALR+QE+I K LP S  ++STL+SFHA GDYRNM+R
Sbjct  1254  ----------KRLTQTMRVHSFDSALRVQEKIRKDLPSS-LHMSTLRSFHASGDYRNMVR  1302

Query  1076  DPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYD  1255
             DPVSN+     Q LP E+Q++NL+ SS+ +F S  S + EGARL++ +    D VIAVYD
Sbjct  1303  DPVSNVLQNHFQMLPWESQRINLILSSTPSFISSVSHIAEGARLLLSQTCHGDRVIAVYD  1362

Query  1256  NEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYM  1435
             N+ +SIISYALSSK+Y+DWV+ K  + +G W   + N     +S  S W    +LDLDY+
Sbjct  1363  NDYSSIISYALSSKDYEDWVSGKSELHDGSWNSRERNNSDLASSSFSAW---ATLDLDYI  1419

Query  1436  HFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDES-CNTGGKVKFSVTCYFAKQFDALRK  1612
             ++GSYGS+DA   I  L  D K S H +ISF D+S    GGKV FSVTCYFAKQFD+LRK
Sbjct  1420  NYGSYGSDDAPSSISSLIRDNKKSIHLQISFGDDSLAAAGGKVNFSVTCYFAKQFDSLRK  1479

Query  1613  KCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFE  1792
             KCCP+E+DF+RSLSR +RWSAQGGKSNVYFAKSLDERFIIKQ+ KTEL+SFEEFAP+YF+
Sbjct  1480  KCCPNEVDFVRSLSRGRRWSAQGGKSNVYFAKSLDERFIIKQVTKTELESFEEFAPQYFK  1539

Query  1793  YLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSV  1972
             Y+ D+ +SG PTCLAK++GIYQV  K+ KGGKETK+DL+VMENLFY R+ISRVYDLKGS 
Sbjct  1540  YMMDALNSGGPTCLAKILGIYQVTAKYPKGGKETKIDLMVMENLFYKRNISRVYDLKGSE  1599

Query  1973  RSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSL  2149
             RSRYN+DT   NKV+LD+N LE+L+TKP+FLGS+AKR LERAVWNDTSFLA V VMDYSL
Sbjct  1600  RSRYNADTTGTNKVMLDMNLLETLRTKPMFLGSRAKRRLERAVWNDTSFLASVDVMDYSL  1659

Query  2150  LVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LVGVD+E+KELVLGIID+MRQYTWDKHLETW
Sbjct  1660  LVGVDDEKKELVLGIIDFMRQYTWDKHLETW  1690



>gb|KFK41525.1| hypothetical protein AALP_AA2G140900 [Arabis alpina]
Length=1632

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/751 (52%), Positives = 506/751 (67%), Gaps = 81/751 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +  WI  E AE++RK +++Y 
Sbjct  915   RDCLRFYGFGNMVAFFRYSPINILTVFLPPSMLEFNSHPQPEWIRTEAAEIMRKMRNMYE  974

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EISS + ++EEKC+ +  + +  + LH+ I+ LK+ L+KEK+ ++D  QP   E  +   
Sbjct  975   EISSMLNRMEEKCSLLEPEHSEASDLHSRIIGLKEQLLKEKDEYDDALQPIFVENLQ-NH  1033

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+LY + S                     +    + F
Sbjct  1034  GSLDILELNRLRRALMIGSHAWDHQLYLLNS---------------------QLKKASEF  1072

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K G  +HA ++           P +    +H +P                    D+  ++
Sbjct  1073  KAGD-DHASQD-----------PSKVDFRQHQDPE-------------------DRERKS  1101

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                 E   +   L++  S GS LS++ID AW G          H +L++ E    + G  
Sbjct  1102  HSDAEANCDNKDLDKMLSPGSSLSERIDSAWLG--------SFH-TLEKAETTAETEG-F  1151

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             +  +SP  +RL  P RV SFDSA+R QERI K LPPS  YLSTL+SFHA G+YRNM+RDP
Sbjct  1152  TATNSPL-RRLARPIRVQSFDSAIRFQERIQKGLPPSSLYLSTLRSFHASGEYRNMVRDP  1210

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+    SQ LP E QKL+L+  S+ T+ S AS + +GAR+++P+ G  D+VI VYD++
Sbjct  1211  VSNVMRTYSQMLPLEVQKLDLIVGSTPTYISSASQMADGARMLIPQRGLNDIVIPVYDDD  1270

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYAL+SKEYK+WV +K   S  G   S+ N      S  ++W+  G++D+DY+H 
Sbjct  1271  PASVVSYALNSKEYKEWVANKGIASSSG---SNWNNRESEPSGFASWRSLGAMDVDYIHH  1327

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDE----SCNTGGKVKFSVTCYFAKQFDALR  1609
               YGS            D K SPH  ISF D     S  T GKVKFSVTCYFA QFD LR
Sbjct  1328  AVYGSS----------QDDKRSPHLTISFTDRAPASSGATEGKVKFSVTCYFATQFDTLR  1377

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             K CCPSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FA +YF
Sbjct  1378  KTCCPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFASEYF  1437

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +Y+ +S  SGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKGS
Sbjct  1438  KYMKESLCSGSPTCLAKILGIYQVSIKHSKGGKETKMDLMVMENLFYNRRISRIYDLKGS  1497

Query  1970  VRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSL  2149
              RSRYN++T  +KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDYSL
Sbjct  1498  ARSRYNANTSIDKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLASVDVMDYSL  1557

Query  2150  LVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LVG DE+RKELVLGIID+MRQYTWDKHLETW
Sbjct  1558  LVGFDEDRKELVLGIIDFMRQYTWDKHLETW  1588



>ref|NP_177257.3| 1-phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis thaliana]
 sp|Q9SSJ8.1|FAB1C_ARATH RecName: Full=Putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C; Short=Phosphatidylinositol 3-phosphate 5-kinase; 
AltName: Full=Phosphatidylinositol 3-phosphate 5-kinase type 
III; Short=PIPkin-III; Short=Type III PIP kinase; AltName: 
Full=Protein FORMS APLOID AND BINUCLEATE CELLS 1C [Arabidopsis 
thaliana]
 gb|AAD55502.1|AC008148_12 Unknown protein [Arabidopsis thaliana]
 gb|AEE35150.1| 1-phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis thaliana]
Length=1648

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/752 (53%), Positives = 510/752 (68%), Gaps = 77/752 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +Q WI  E AEL+ K +++Y 
Sbjct  925   RDCLRFYGFGNMVAFFRYSPINILTVLLPPSMLEFNSHPQQEWIRTEAAELVGKMRTMYT  984

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + ++EEK + +  + +    LH+ I+ L D L+KEK+ ++D  QP  EE  +  Q
Sbjct  985   EISDMLNRMEEKSSLLEPEQSEACDLHSRIIGLIDQLVKEKDEYDDALQPIFEENLQ-IQ  1043

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+LY + S                     +    ++F
Sbjct  1044  GSLDILELNRLRRALMIGAHAWDHQLYLLNS---------------------QLKKASVF  1082

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K G         +H+ P  +    EG   E DE           Q  + +  NGD     
Sbjct  1083  KTGDDNAPRNPEMHDPPKIDRRMQEG-SDERDE-----------QSHTDSEANGD-----  1125

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                     NK P E  PS G+ LS++ID AW G   S Q+++   ++ E E         
Sbjct  1126  --------NKDP-ENIPSPGTSLSERIDSAWLG---SFQNLEKAETIAETE-------GF  1166

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S V+S + +RL  P RV SFDSA+R QERI K LPPS  YLSTL+SFHA G+YRNM+RDP
Sbjct  1167  SAVNS-SLRRLARPIRVQSFDSAIRFQERIQKGLPPSSLYLSTLRSFHASGEYRNMVRDP  1225

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+    SQ LP E QKL+L+  S+ T+ S AS + +GAR+++P+ G  D+V+ VYD++
Sbjct  1226  VSNVMRTYSQMLPLEVQKLDLIVGSAPTYISSASQMADGARMLIPQRGLNDIVVPVYDDD  1285

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYA++SKEYK+W+ +K  ++      +  N+ES   S  STW+   S+D+DY+  
Sbjct  1286  PASVVSYAINSKEYKEWIVNKG-LASSSSSSNLNNRESE-PSAFSTWRSL-SMDVDYIQH  1342

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDES----CNTGGKVKFSVTCYFAKQFDALR  1609
               YGS            D + SPH  ISF D +      T GKVKFSVTCYFA QFD LR
Sbjct  1343  AVYGSS----------QDDRKSPHLTISFSDRASSSSTATEGKVKFSVTCYFATQFDTLR  1392

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             K CCPSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FAP+YF
Sbjct  1393  KTCCPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFAPEYF  1452

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +YL +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKGS
Sbjct  1453  KYLKESLSSGSPTCLAKILGIYQVSIKHPKGGKETKMDLMVMENLFYNRRISRIYDLKGS  1512

Query  1970  VRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
              RSRYN +T  A+KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDYS
Sbjct  1513  ARSRYNPNTSGADKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLASVDVMDYS  1572

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVG DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1573  LLVGFDEERKELVLGIIDFMRQYTWDKHLETW  1604



>ref|XP_006390816.1| hypothetical protein EUTSA_v10018002mg [Eutrema salsugineum]
 gb|ESQ28102.1| hypothetical protein EUTSA_v10018002mg [Eutrema salsugineum]
Length=1644

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/754 (53%), Positives = 506/754 (67%), Gaps = 77/754 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +Q WI  E AEL+ K +S+YA
Sbjct  917   RDCLRFYGFGNMVAFFRYSPINILTVFLPPSMLEFNSHPQQDWIRTEAAELMSKMRSMYA  976

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + ++EEK + +  D +  + L + I+ LKD L+KEK+ ++D  QP   E  +  Q
Sbjct  977   EISGMLNRMEEKSSLLEADQSEASDLQSRIVGLKDQLVKEKDEYDDALQPIFLENLQI-Q  1035

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+LY + S                     +    ++ 
Sbjct  1036  GSLDILELNRLRRALMIGSHAWDHQLYLLNS---------------------QLKKASVL  1074

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K G    +    + + P ++    EGL +   +             S + + N +K LE 
Sbjct  1075  KTGGDNASRNPEMQDPPKTDRRRQEGLEAGEGK----------ASQSDAEANNDNKDLEN  1124

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
              L               S GS LS++ID AW G          H +L++ E  +A     
Sbjct  1125  ML---------------SPGSSLSERIDSAWLG--------SFH-TLEKAET-IAETEGF  1159

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S  +SP  +RL  P RV SFDSA+R QERI K LPPS  YLSTL+SFHA G+YRNM+RDP
Sbjct  1160  SAANSPL-RRLARPIRVQSFDSAIRFQERIQKGLPPSSLYLSTLRSFHASGEYRNMVRDP  1218

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+    SQ LP E +KL+L+  S+ T+ S AS + +GAR+++P+ G  D+VI VYD++
Sbjct  1219  VSNVMRTYSQMLPLEVKKLDLIVGSALTYISSASQMADGARMLIPQRGLNDIVIPVYDDD  1278

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYAL+SKEYK+WV ++   S    G +  N+ES   S  STW+  G++D+DY+H 
Sbjct  1279  PASVVSYALNSKEYKEWVVNRGIPSSTS-GSNWNNRESE-PSTFSTWRSLGAMDVDYIHH  1336

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDES------CNTGGKVKFSVTCYFAKQFDA  1603
               YGS            D K SPH  ISF D S        T GKVKFSVTCYFA QFD 
Sbjct  1337  AVYGSS----------QDDKKSPHLTISFSDRSSSSSSPAATDGKVKFSVTCYFATQFDT  1386

Query  1604  LRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPK  1783
             LRK CCPSE+DF+RSLSRC+RW AQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FAP+
Sbjct  1387  LRKTCCPSEVDFVRSLSRCQRWCAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFAPE  1446

Query  1784  YFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLK  1963
             YF+Y+ +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLK
Sbjct  1447  YFKYMKESLSSGSPTCLAKILGIYQVSIKHSKGGKETKMDLMVMENLFYNRRISRIYDLK  1506

Query  1964  GSVRSRYNSD-TKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMD  2140
             GS RSRYN + +  +KVLLD+N LE+L+T PIFLGSKAKRSLERA+WNDT+FLA V VMD
Sbjct  1507  GSARSRYNPNKSGTDKVLLDMNLLETLRTDPIFLGSKAKRSLERAIWNDTNFLASVDVMD  1566

Query  2141  YSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             YSLLVG DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1567  YSLLVGFDEERKELVLGIIDFMRQYTWDKHLETW  1600



>ref|XP_009127840.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Brassica rapa]
Length=1539

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/749 (52%), Positives = 503/749 (67%), Gaps = 96/749 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +  WI  E AEL+ K +++YA
Sbjct  841   RDCLRFYGFGNMVAFFRYSPINILTVFLPPSMLEFNSHPQPEWIRTEAAELMSKMRTMYA  900

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + ++EEK + +  + +  + L + I  LKD L+KEK+ +ND  QP   E  +   
Sbjct  901   EISGMLNRMEEKSSLLEPEHSEASDLQSRITGLKDQLVKEKDEYNDALQPVFVENLQ-SH  959

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+L+ + +                             
Sbjct  960   GSLDILELNRLRRALMIGSHAWDHQLFLLNTQLKKA------------------------  995

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
              DG+   + E  +HE P S++ P EG     DE          ++G++ +          
Sbjct  996   SDGNASRSLE--IHEPPKSDQRPHEG----SDE----------REGNAHSDAEA------  1033

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                  N  NK P ++  S GS LS++ID AW G                      SF   
Sbjct  1034  -----NDDNKYP-DKLLSPGSSLSERIDSAWLG----------------------SFHSE  1065

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             +   SP  KRL  P RV SFDSA+R QERI K LPPS  YL+TL+SFHA G+YRNM+RDP
Sbjct  1066  ADAKSPL-KRLARPIRVQSFDSAIRFQERIQKGLPPSSLYLNTLRSFHASGEYRNMVRDP  1124

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             +SN+    SQ LP E QKL+L+  S+ T+ S AS + +GAR+++P+ G  D+VI VYD++
Sbjct  1125  LSNVMRTYSQMLPLEVQKLDLIVGSAPTYISSASQMADGARMLIPQRGLNDIVIPVYDDD  1184

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYAL+SKEYK+WV  +        G+  +N++S  +S  STW+  G++D+DY+H 
Sbjct  1185  PASVVSYALNSKEYKEWVVKR--------GIPRSNRDSEPSSTFSTWRSLGAMDVDYIHH  1236

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTG-GKVKFSVTCYFAKQFDALRKKC  1618
               YGS            D K SPH  ISF D S ++  GKVKFSVTCYFA QFD LRK C
Sbjct  1237  AVYGSS----------QDDKKSPHLTISFSDRSSSSSEGKVKFSVTCYFATQFDTLRKTC  1286

Query  1619  CPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYL  1798
             CPSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLD+RFIIKQ+ KTELDSFE+FAP+YF+Y+
Sbjct  1287  CPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDQRFIIKQVVKTELDSFEDFAPEYFKYM  1346

Query  1799  TDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRS  1978
              +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKGS RS
Sbjct  1347  KESLSSGSPTCLAKILGIYQVSIKHSKGGKETKMDLMVMENLFYNRKISRIYDLKGSARS  1406

Query  1979  RYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLV  2155
             RYN +T   +KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDYSLLV
Sbjct  1407  RYNPNTSGKDKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLASVDVMDYSLLV  1466

Query  2156  GVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             G DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1467  GFDEERKELVLGIIDFMRQYTWDKHLETW  1495



>ref|XP_002887343.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63602.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1653

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/752 (53%), Positives = 507/752 (67%), Gaps = 77/752 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +Q WI  E AEL  K +++YA
Sbjct  930   RDCLRFYGFGNMVAFFRYSPINILTVLLPPSMLEFNSHPQQEWIRTEAAELAGKMRTMYA  989

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + ++EEK + +  + +    L + ++ LKD L+KEK+ ++D  QP  EE + + Q
Sbjct  990   EISGMLNRMEEKSSLLEPEQSEACDLQSRVIGLKDQLVKEKDEYDDALQPIFEE-NLQIQ  1048

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+LY + S                     +    ++F
Sbjct  1049  GSLDILELNRLRRALMIGAHAWDHQLYLLNS---------------------QLKKASVF  1087

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K G    +    + + P  +    EG  S+  E          +Q  + +  NGD     
Sbjct  1088  KTGDDNASRNPEMQDPPKIDRKMQEG--SDERE----------EQAHTDSEANGD-----  1130

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                     NK P E  PS G+ LS++ID AW G   S Q+++   ++ E E         
Sbjct  1131  --------NKDP-ESMPSPGTSLSERIDSAWLG---SFQNLEKAETIAETE-------GF  1171

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S V+SP  +RL  P RV SFDSA+R QERI K  PPS  YLSTL+SFHA G+YRNM+RDP
Sbjct  1172  SAVNSPL-RRLARPIRVQSFDSAIRFQERIRKGWPPSSLYLSTLRSFHASGEYRNMVRDP  1230

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+    SQ LP E QKL+L+  S+ T+ S AS + +GAR+++P+ G  D+V+ VYD++
Sbjct  1231  VSNVMRTYSQMLPLEVQKLDLIVGSTPTYISSASQMADGARMLIPQRGLNDIVVPVYDDD  1290

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYA++SKEYK+W+ +K  ++      +  NKES   S  STW+   S+D+DY+  
Sbjct  1291  PASVVSYAINSKEYKEWIVNKG-LASSSSSSNLNNKESE-PSTFSTWRSL-SMDVDYIQH  1347

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRI----SFEDESCNTGGKVKFSVTCYFAKQFDALR  1609
               YGS            D + SPH  I         S  T GKVKFSVTCYFA QFD LR
Sbjct  1348  AVYGSS----------QDDRKSPHLTISFSDRASSSSTATEGKVKFSVTCYFATQFDTLR  1397

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             K CCPSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FAP+YF
Sbjct  1398  KTCCPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFAPEYF  1457

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +YL +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKGS
Sbjct  1458  KYLKESLSSGSPTCLAKILGIYQVSIKHPKGGKETKMDLMVMENLFYNRRISRIYDLKGS  1517

Query  1970  VRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
              RSRYN +T   +KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDYS
Sbjct  1518  ARSRYNPNTSGTDKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLASVDVMDYS  1577

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVG DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1578  LLVGFDEERKELVLGIIDFMRQYTWDKHLETW  1609



>ref|XP_009106473.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Brassica rapa]
Length=1577

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/754 (53%), Positives = 501/754 (66%), Gaps = 98/754 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +  WI  E AEL+ K +++Y 
Sbjct  871   RDCLRFYGFGNMVAFFRYSPINILTVFLPPSMLEFNSHPQPDWIRTEAAELMGKMRTMYE  930

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  ++++EEK + +  +    + LH+ I+ LKD L+KEK+ ++D  QP  EE S + Q
Sbjct  931   EVSGMIKRMEEKSSLLEPEQPGASELHSRIVGLKDQLVKEKDEYDDALQPIFEE-SLQNQ  989

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+LY + S                             
Sbjct  990   GSLDILELNRLRRALMIGSHAWDHQLYLLNSQLKKA------------------------  1025

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSY--QQGSSSTSCNGDKTL  715
              DG+   + E                      EPP P   L+    +G   T  +G    
Sbjct  1026  SDGNASRSLETQ--------------------EPPKPDHRLNEGGDEGEGKTHSDG----  1061

Query  716   ETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFG  895
             E   G +N +         S GS LS++ID AW G            S  E     +S  
Sbjct  1062  EANNGDDNKL---------SPGSSLSERIDSAWLG------------SFHEKAETDSS--  1098

Query  896   QLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIR  1075
                 V+SP  +RL  P RV SFDSA+R QERI K LPPS  YLS ++SFHA GDYRNM+R
Sbjct  1099  ---AVNSPL-RRLAKPVRVQSFDSAIRFQERIQKGLPPSSLYLSGIRSFHASGDYRNMVR  1154

Query  1076  DPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYD  1255
             DPVSN+    SQ LP E QKL+L+  S+ T+ S AS + +GAR+++P+ G  D+V+ VYD
Sbjct  1155  DPVSNVMRTYSQMLPLEVQKLDLIVGSAPTYISSASQMADGARMLIPQRGVNDIVVPVYD  1214

Query  1256  NEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYM  1435
             ++P S++SYAL+SKEYK+WV ++     G    S +NKES  +S  STW+  GS+D+DY+
Sbjct  1215  DDPASVVSYALNSKEYKEWVVNR-----GIANSSTSNKESEPSSTFSTWRSLGSMDVDYI  1269

Query  1436  HFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTG----GKVKFSVTCYFAKQFDA  1603
             H   YGS            D K SPH  ISF D S ++     GKVKFSVTCYFA QFDA
Sbjct  1270  HHAVYGSS----------QDDKKSPHLTISFSDRSSSSSGASEGKVKFSVTCYFATQFDA  1319

Query  1604  LRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPK  1783
             LRK CCP+E+DF+RSLSRC+RW AQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FA +
Sbjct  1320  LRKTCCPTEVDFVRSLSRCQRWCAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFATE  1379

Query  1784  YFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLK  1963
             YF+Y+ +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLK
Sbjct  1380  YFKYMKESLSSGSPTCLAKILGIYQVSIKHSKGGKETKMDLMVMENLFYNRRISRIYDLK  1439

Query  1964  GSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMD  2140
             GS RSRYN +T   +KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMD
Sbjct  1440  GSARSRYNPNTSGTDKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLATVDVMD  1499

Query  2141  YSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             YSLLVG DE+RKELVLGIID+MRQYTWDKHLETW
Sbjct  1500  YSLLVGFDEDRKELVLGIIDFMRQYTWDKHLETW  1533



>ref|XP_010415795.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Camelina sativa]
Length=1653

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/752 (52%), Positives = 497/752 (66%), Gaps = 77/752 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +  WI  E AEL  K +++Y 
Sbjct  930   RDCLRFYGFGNMVAFFRYSPINILTVLLPPSMLEFNSHPQPEWIRTEAAELAGKMRTMYG  989

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + ++EEK + +  + +  + L + IL LKD L+KEK+ ++D  QP   E   + Q
Sbjct  990   EISGMLNRMEEKSSLLEPEQSEASDLQSRILGLKDQLVKEKDEYDDALQPIFVE-DLQVQ  1048

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+LY + S     +                     + 
Sbjct  1049  GSLDILELNRLRRALMIGAHAWDHQLYLLNSQLKKAY---------------------VC  1087

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K G    +    VH+ P  +    EG           KD    ++  + +  NGD     
Sbjct  1088  KTGDGNASRNPEVHDAPKIDHRQQEG----------QKDG--EEKAHTDSEANGD-----  1130

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                     NK   +   S G+ LS++ID AW G   S Q++       E    +A+    
Sbjct  1131  --------NKD-TDNMLSPGTSLSERIDSAWLG---SFQNL-------EKAETIANTEGF  1171

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S  +SP  +RL  P RV SFDSA+R QERI K  PPS  YLSTL+SFHA G+YRNM+RDP
Sbjct  1172  SAANSP-LRRLARPIRVQSFDSAIRFQERIQKGWPPSSLYLSTLRSFHASGEYRNMVRDP  1230

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+    SQ LP E QKL+L+  S  T+ S AS + +GAR+++P+ G  D+V+ VYD++
Sbjct  1231  VSNVMRTYSQMLPLEVQKLDLIVGSVPTYISSASQMADGARMLIPQRGLNDIVVPVYDDD  1290

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYA++SKEYK+W+ ++   +       +  +  P  S  STW+   S+D+DY+  
Sbjct  1291  PASVVSYAINSKEYKEWIVNRGITTSSSSNNLNNRESEP--STFSTWRSL-SMDVDYIQH  1347

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDE----SCNTGGKVKFSVTCYFAKQFDALR  1609
               YGS            D K SPH  ISF D     S  T GKVKFSVTCYFA QF+ LR
Sbjct  1348  AVYGSS----------QDDKKSPHLTISFSDRATSSSSATEGKVKFSVTCYFATQFETLR  1397

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             K CCPSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FAP+YF
Sbjct  1398  KTCCPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFAPEYF  1457

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +YL +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKGS
Sbjct  1458  KYLKESLSSGSPTCLAKILGIYQVSIKHPKGGKETKMDLMVMENLFYNRRISRIYDLKGS  1517

Query  1970  VRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
              RSRYN +T   +KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDYS
Sbjct  1518  ARSRYNPNTSGTDKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLASVDVMDYS  1577

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVG DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1578  LLVGFDEERKELVLGIIDFMRQYTWDKHLETW  1609



>ref|XP_010471106.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Camelina sativa]
Length=1659

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/752 (52%), Positives = 499/752 (66%), Gaps = 77/752 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +  WI  E AEL  K +++Y 
Sbjct  936   RDCLRFYGFGNMVAFFRYSPINILTVLLPPSMLEFNSHPQPEWIRTEAAELAGKMRTMYG  995

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + ++EEK + +  + +  + L + I+ LKD L+KEK+ ++D+ QP   E   + Q
Sbjct  996   EISGMLNRMEEKSSLLEPEQSEASDLQSRIMGLKDQLVKEKDEYDDVLQPIFVE-DLQVQ  1054

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+LY + S                             
Sbjct  1055  GSLDILELNRLRRALMIGAHAWDHQLYLLNSQL---------------------------  1087

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K  S+    + NV   P  ++ P      +H +    KD    ++  + +  NGD     
Sbjct  1088  KKASVCKTGDGNVSRNPEVQDAP----KIDHRQQEGQKDG--EEKAHTDSEANGD-----  1136

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                     NK   +   S G+ LS++ID AW G   S Q++       E    +A+    
Sbjct  1137  --------NKD-TDNMLSPGTSLSERIDSAWLG---SFQNL-------EKAETIANTEGF  1177

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S  +SP  +RL  P RV SFDSA+R QERI K  PPS  YLSTL+SFHA G+YRNM+RDP
Sbjct  1178  SAANSP-LRRLARPIRVQSFDSAIRFQERIQKGWPPSSLYLSTLRSFHASGEYRNMVRDP  1236

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+    SQ LP E QKL+L+  S  T+ S AS + +GAR+++P+ G  D+V+ VYD++
Sbjct  1237  VSNVMRTYSQMLPLEVQKLDLIVGSVPTYISSASQMADGARMLIPQRGLNDIVVPVYDDD  1296

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYA++SKEYK+W+ ++   +       +  +  P  S  STW+   S+D+DY+  
Sbjct  1297  PASVVSYAINSKEYKEWIVNRGITTSSSSNNLNNRESEP--STFSTWRSL-SMDVDYIQH  1353

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDE----SCNTGGKVKFSVTCYFAKQFDALR  1609
               YGS            D K SPH  ISF D     S  T GKVKFSVTCYFA QF+ LR
Sbjct  1354  AVYGSS----------QDDKKSPHLTISFSDRATSSSSATEGKVKFSVTCYFATQFETLR  1403

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             K CCPSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FAP+YF
Sbjct  1404  KTCCPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFAPEYF  1463

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +YL +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKGS
Sbjct  1464  KYLKESLSSGSPTCLAKILGIYQVSIKHPKGGKETKMDLMVMENLFYNRRISRIYDLKGS  1523

Query  1970  VRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
              RSRYN +T   +KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDYS
Sbjct  1524  ARSRYNPNTSGTDKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLASVDVMDYS  1583

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVG DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1584  LLVGFDEERKELVLGIIDFMRQYTWDKHLETW  1615



>ref|XP_006300582.1| hypothetical protein CARUB_v10019654mg [Capsella rubella]
 ref|XP_006300583.1| hypothetical protein CARUB_v10019654mg [Capsella rubella]
 gb|EOA33480.1| hypothetical protein CARUB_v10019654mg [Capsella rubella]
 gb|EOA33481.1| hypothetical protein CARUB_v10019654mg [Capsella rubella]
Length=1651

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/752 (52%), Positives = 502/752 (67%), Gaps = 77/752 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +Q WI  E AEL+ K +++YA
Sbjct  928   RDCLRFYGFGNMVAFFRYSPINILTVLLPPSMLEFNSHPQQEWIRTEAAELVGKMRTMYA  987

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + ++EEK + +  + +  + L + I+ LKD L+KEK+ ++D  QP   E  +  Q
Sbjct  988   EISGVLNRMEEKSSLLEPEQSEASDLQSRIMGLKDQLVKEKDEYDDALQPIFVEDLQV-Q  1046

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+LY + S                     +    ++ 
Sbjct  1047  GSLDILELNRLRRALMIGAHAWDHQLYLLNS---------------------QLKKASVC  1085

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K G    +    V + P  E    EG     DE          ++  + +  NGD     
Sbjct  1086  KSGDGNASRNPEVQDAPKIEPIQQEG----QDE--------GEEKAHTDSEANGD-----  1128

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                     NK   E  PS G+ LS++ID AW G   S Q+++   ++ + E         
Sbjct  1129  --------NKD-TENMPSPGTSLSERIDSAWLG---SFQNLEKAETIADTE-------GF  1169

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S  +SP  +RL  P RV SFDSA+R QERI K  PPS  YLSTL+SFHA G+YRNM+RDP
Sbjct  1170  SAANSP-LRRLARPIRVQSFDSAIRFQERIQKGWPPSSLYLSTLRSFHASGEYRNMVRDP  1228

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+    SQ LP E QKL+L+  S  T+ S AS + +GAR+++P+ G  D+V+ VYD++
Sbjct  1229  VSNVMRTYSQMLPLEVQKLDLIVGSVPTYISSASQMADGARMLIPQRGLNDIVVPVYDDD  1288

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYA++SKEYK+W+ ++   +       +  +  P  S  STW+   S+D+DY+  
Sbjct  1289  PASVVSYAINSKEYKEWIVNRGIATSSSSSNLNNRESEP--STFSTWRSL-SMDVDYIQH  1345

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDES----CNTGGKVKFSVTCYFAKQFDALR  1609
               YGS            D + SPH  ISF D +      T GKVKFSVTCYFA QF+ LR
Sbjct  1346  AVYGSS----------QDDRKSPHLTISFSDRASSSSTATEGKVKFSVTCYFATQFETLR  1395

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             K CCP+E+DF+RSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FAP+YF
Sbjct  1396  KTCCPTEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFAPEYF  1455

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +Y+ +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKGS
Sbjct  1456  KYMKESLSSGSPTCLAKILGIYQVSIKHPKGGKETKMDLMVMENLFYNRRISRIYDLKGS  1515

Query  1970  VRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYS  2146
              RSRYN +T   +KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDYS
Sbjct  1516  ARSRYNPNTSGTDKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLASVDVMDYS  1575

Query  2147  LLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LLVG DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1576  LLVGFDEERKELVLGIIDFMRQYTWDKHLETW  1607



>ref|XP_010427915.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Camelina sativa]
Length=1659

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/753 (51%), Positives = 501/753 (67%), Gaps = 78/753 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +  WI  E AEL  K +++Y 
Sbjct  935   RDCLRFYGFGNMVAFFRYSPINILTVLLPPSMLEFNSHPQPEWIRTEAAELAGKMRTMYG  994

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + ++E+K + +  + +  + L + I+ LKD L+KEK+ ++D  QP   E   + Q
Sbjct  995   EISGMLNRMEDKSSLLEPEQSEASDLQSRIMGLKDQLVKEKDEYDDALQPIFVE-DLQVQ  1053

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+LY + S                     +    ++ 
Sbjct  1054  GSLDILELNRLRRALMIGAHAWDHQLYLLNS---------------------QLKKASVC  1092

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             K G    +    VH+ P  +    EG     D+          ++  + +  NGD T +T
Sbjct  1093  KTGDGNASRNPEVHDAPKIDHRQQEG----QDD--------GEEKSHTDSEANGD-TKDT  1139

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                 +N +         S G+ LS++ID AW G   S Q++       E    +A+    
Sbjct  1140  ----DNML---------SPGTSLSERIDSAWLG---SFQNL-------EKAETIANTEGF  1176

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S  +SP  +RL  P RV SFDSA+R QERI K  PPS  YLSTL+SFHA G+YRNM+RDP
Sbjct  1177  SAANSPL-RRLARPIRVQSFDSAIRFQERIQKGWPPSSLYLSTLRSFHASGEYRNMVRDP  1235

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+    SQ LP E QKL+L+  S  T+ S AS + +GAR+++P+ G  D+V+ VYD++
Sbjct  1236  VSNVMRTYSQMLPLEVQKLDLIVGSVPTYISSASQMADGARMLIPQRGLNDIVVPVYDDD  1295

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYA++SKEYK+W+ ++   +       +  +  P  S  STW+   S+D+DY+  
Sbjct  1296  PASVVSYAINSKEYKEWIVNRGITTSSSSNNLNNRESEP--STFSTWRSL-SMDVDYIQH  1352

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCN-----TGGKVKFSVTCYFAKQFDAL  1606
               YGS            D K SPH  ISF D + +     T GKVKFSVTCYFA QF+ L
Sbjct  1353  AVYGSS----------QDDKKSPHLTISFSDRASSSSSSSTEGKVKFSVTCYFATQFETL  1402

Query  1607  RKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKY  1786
             RK CCPSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FAP Y
Sbjct  1403  RKTCCPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFAPNY  1462

Query  1787  FEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKG  1966
             F+YL +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKG
Sbjct  1463  FKYLKESLSSGSPTCLAKILGIYQVSIKHPKGGKETKMDLMVMENLFYNRRISRIYDLKG  1522

Query  1967  SVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDY  2143
             S RSRYN +T   +KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDY
Sbjct  1523  SARSRYNPNTSGTDKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLASVDVMDY  1582

Query  2144  SLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             SLLVG DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1583  SLLVGFDEERKELVLGIIDFMRQYTWDKHLETW  1615



>emb|CDY03708.1| BnaA02g15290D [Brassica napus]
Length=1500

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/749 (50%), Positives = 473/749 (63%), Gaps = 134/749 (18%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +  WI  E AEL+ K +++YA
Sbjct  840   RDCLRFYGFGNMVAFFRYSPINILTVFLPPSMLEFNSHPQPEWIRTEAAELMSKMRTMYA  899

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + ++EEK + +  + + ++ LH+ I+ LKD L+KEK+ +ND  QP   E  +   
Sbjct  900   EISGMLNRMEEKSSLLEPEHSEVSDLHSRIMGLKDQLVKEKDEYNDALQPVFVENLQ-SH  958

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+++    + +         NA               
Sbjct  959   GSLDILELNRLRRALMIGSHAWDHQIF----LLNTQLKKASDTNASR-------------  1001

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
                SLE      +HE   +++ P                    Q+GS     N     E 
Sbjct  1002  ---SLE------IHEPLKNDQRP--------------------QEGSDEREGNAHSDAEA  1032

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                  N   K P ++  S GS LS++ID AW                             
Sbjct  1033  -----NDDTKYP-DKLLSPGSSLSERIDSAW-----------------------------  1057

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
                          P RV SFDSA+R QERI K LPPS                     DP
Sbjct  1058  -------------PIRVQSFDSAIRFQERIQKGLPPSS-------------------LDP  1085

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             +SN+    SQ LP E QKL+L+  S+ T+ S AS + +GAR+++P+ G  D+VI VYD++
Sbjct  1086  LSNVMRTYSQMLPLEVQKLDLIVGSAPTYISSASQMADGARMLIPQRGLNDIVIPVYDDD  1145

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYAL+SKEYK+WV  +        G+  +N+ES  +S  STW+  G++D+DY+H 
Sbjct  1146  PASVVSYALNSKEYKEWVVKR--------GIPRSNRESEPSSTFSTWRSLGAMDVDYIHH  1197

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTG-GKVKFSVTCYFAKQFDALRKKC  1618
               YGS            D K SPH  ISF D S ++  GKVKFSVTCYFA QFD LRK C
Sbjct  1198  AVYGSS----------QDDKKSPHLTISFSDRSSSSSEGKVKFSVTCYFATQFDTLRKTC  1247

Query  1619  CPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYL  1798
             CPSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FAP+YF+Y+
Sbjct  1248  CPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFAPEYFKYM  1307

Query  1799  TDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRS  1978
              +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKGS RS
Sbjct  1308  KESLSSGSPTCLAKILGIYQVSIKHSKGGKETKMDLMVMENLFYNRKISRIYDLKGSARS  1367

Query  1979  RYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLV  2155
             RYN +T   +KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDYSLLV
Sbjct  1368  RYNPNTSGKDKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLASVDVMDYSLLV  1427

Query  2156  GVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             G DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1428  GFDEERKELVLGIIDFMRQYTWDKHLETW  1456



>gb|KDO64704.1| hypothetical protein CISIN_1g000604mg [Citrus sinensis]
 gb|KDO64705.1| hypothetical protein CISIN_1g000604mg [Citrus sinensis]
Length=1247

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/629 (56%), Positives = 432/629 (69%), Gaps = 35/629 (6%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLRYYG GSMIA FRYSPIDILSV LPPSVLEFN   +Q WI KE  EL  K ++LYA
Sbjct  623   RDCLRYYGFGSMIAIFRYSPIDILSVHLPPSVLEFNGLLQQEWIRKEAEELKVKMETLYA  682

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS+ ++ +E++  S+GC+ ++   L + ILELK  L  E+N +  L QP   ETSE GQ
Sbjct  683   EISNVLEVMEQRSNSIGCEMSDSTDLKSHILELKVQLESERNDYIGLLQPVVMETSEPGQ  742

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             T +D+LELNRLR +LL   HAWD +LY + S+      ++  +   S     E   +   
Sbjct  743   TAVDILELNRLRRALLIGSHAWDRQLYSLNSLLKKGSIAKAKQGNASYAQLKELRTDLFC  802

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLH-SEHDEPPVPKDALSYQQGSSSTSCNGDKTLE  718
             KD  L+H  EENV    +S E P   LH  + +E  +P                   TLE
Sbjct  803   KDSKLDHDNEENVSGSLDSLESPANDLHLQQKEELNLP-------------------TLE  843

Query  719   TRLGLENAVNKSPL----ERAPSAGSI---LSDKIDCAWTGIDPSSQDMQVHASLQEGER  877
                G EN+   S L    E   S G I   LS+KID AWTG D      QV   + + +R
Sbjct  844   P-FGSENSKLTSFLHNREEDVHSDGEITSTLSEKIDSAWTGTD------QVVPLVSQTDR  896

Query  878   RVASF-GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYG  1054
               A F GQ+S +D+   KRL SP RV+SFDSALR QERI++ LP S  +LS+++SFHA G
Sbjct  897   PQAGFVGQISKIDNSPFKRLASPVRVHSFDSALRFQERIARGLPHSLLHLSSIRSFHASG  956

Query  1055  DYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKD  1234
             DYR+M+RDPVSN+    SQ LP EAQKLNL+ SS+ +F S AS + EGARL++P+ G  D
Sbjct  957   DYRSMVRDPVSNVMRTYSQILPLEAQKLNLILSSTPSFISSASRMVEGARLLLPQRGDND  1016

Query  1235  VVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFG  1414
             VVIAV+D++PTSIISYALSSKEY+DWV DK Y ++G W   + +KE    S  S WQ FG
Sbjct  1017  VVIAVFDDDPTSIISYALSSKEYEDWVADKLYDNDGSWSAGEIHKEGSAVSSFSAWQSFG  1076

Query  1415  SLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQ  1594
             SLDLDY+H+GSYGSEDAS  +G LF+DPK SPH  ISF DES   GGKVKFSVT YFAKQ
Sbjct  1077  SLDLDYIHYGSYGSEDASSSVGTLFTDPKKSPHLTISFGDESSTAGGKVKFSVTSYFAKQ  1136

Query  1595  FDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEF  1774
             FD+LRKKCCPS +DF+RSLSR ++WSAQGGKSNV+FAKSLDERFIIKQ++KTEL+SFEEF
Sbjct  1137  FDSLRKKCCPSGVDFVRSLSRSRKWSAQGGKSNVFFAKSLDERFIIKQVKKTELESFEEF  1196

Query  1775  APKYFEYLTDSHSSGSPTCLAKVVGIYQV  1861
             AP+YF+YLTDS +S SPTCLAK++GIYQV
Sbjct  1197  APEYFKYLTDSLNSRSPTCLAKILGIYQV  1225



>ref|XP_002314813.2| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
 gb|EEF00984.2| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
Length=1684

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/504 (65%), Positives = 400/504 (79%), Gaps = 5/504 (1%)
 Frame = +2

Query  740   AVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQ-VHASLQEGER-RVASFGQLSHVD  913
              VNK+     PS  S LSD+ID AWTG +     +Q +HA   E +  +     Q +  D
Sbjct  1139  TVNKTFFNDIPSHASNLSDRIDSAWTGTNQLPIKVQPLHALQAEADGFQPGPVRQPNLFD  1198

Query  914   SPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNI  1093
             +P  +R+ +P RV+SFDSALR+QERI K LPPS  +LST++SFHA GDYR+M+RDPVS +
Sbjct  1199  NPPFRRMMAPLRVHSFDSALRVQERIQKGLPPS-MHLSTIRSFHASGDYRSMLRDPVSAM  1257

Query  1094  QMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSI  1273
             +   SQ LP EAQKLNL+P+S+ TF S A+ +  GARL++P     D+VI VYDN+P S+
Sbjct  1258  RTY-SQTLPLEAQKLNLIPNSTRTFISSAANMAGGARLLLPMRTNSDIVIGVYDNDPASV  1316

Query  1274  ISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYG  1453
             +SYALSSKEY+DWVTD+   + G W   + +KE   AS  + WQ FGS+DLDY+ +G YG
Sbjct  1317  VSYALSSKEYEDWVTDRSNENGGIWSTFERSKEGSAASSFTAWQSFGSVDLDYISYGGYG  1376

Query  1454  SEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSEL  1633
             SED S  +G LF   K SPH  IS+ D+S   GGKVKFSVTCYFAKQFD+LR+KCCPS++
Sbjct  1377  SEDPSSSLGNLFMVSKKSPHLTISYGDDSSFAGGKVKFSVTCYFAKQFDSLRRKCCPSDV  1436

Query  1634  DFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHS  1813
             DF+RSLSRC++WSAQGGKSNVYFAKSLDERFIIKQ++KTEL+SFEEFA +YF+YLTDS +
Sbjct  1437  DFVRSLSRCQKWSAQGGKSNVYFAKSLDERFIIKQIKKTELESFEEFALEYFKYLTDSLN  1496

Query  1814  SGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD  1993
             SGSPTCLAK++GIYQV VKHL+GGKETKMDL+VMENLF+ R+I+RVYDLKGS RSRYN D
Sbjct  1497  SGSPTCLAKILGIYQVTVKHLRGGKETKMDLMVMENLFFNRNIARVYDLKGSSRSRYNPD  1556

Query  1994  TK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEE  2170
             T  +NKVLLD N +E+L+T PIFLGSKAKRSLERA+WNDTSFLA V VMDYSLLVGVD+E
Sbjct  1557  TSGSNKVLLDTNLVETLRTDPIFLGSKAKRSLERAIWNDTSFLASVDVMDYSLLVGVDDE  1616

Query  2171  RKELVLGIIDYMRQYTWDKHLETW  2242
             RKELVLGIID+MRQYTWDKHLETW
Sbjct  1617  RKELVLGIIDFMRQYTWDKHLETW  1640


 Score =   159 bits (401),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 117/183 (64%), Gaps = 5/183 (3%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPIDIL+V LPPSVLEFNS  +  WI KE +ELL K ++ Y 
Sbjct  969   RDCLRFYGFGSMVAFFRYSPIDILNVHLPPSVLEFNSTIQHEWIRKEASELLGKMETFYG  1028

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +E++    G + ++ N L + I+ELKD L+KEK+ +N + Q    E+S+  Q
Sbjct  1029  EISGVLDSMEQRSKYFGGELSDTNELQSHIMELKDQLLKEKDDYNVMLQLAVMESSD--Q  1086

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFD-NNFSSQHPENAVSCINPGEWGGETI  538
             T +D+LELNR+R +LL     WD +L+ ++S+   N+      E+ V     GE   +T 
Sbjct  1087  TVVDILELNRIRRALLIGSRVWDQKLFSLDSVLKTNSLVKAKEEDEVHA--DGETVNKTF  1144

Query  539   FKD  547
             F D
Sbjct  1145  FND  1147



>emb|CDX72767.1| BnaC06g32150D [Brassica napus]
Length=1471

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/751 (48%), Positives = 460/751 (61%), Gaps = 141/751 (19%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +  WI  E AEL+ K +++Y 
Sbjct  814   RDCLRFYGFGNMVAFFRYSPINILTVFLPPSMLEFNSHPQPEWIRTEAAELMGKMRTMYE  873

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  ++++EEK + +  +    + L + I+ LKD L+KEK+ ++D  QP  EE S   Q
Sbjct  874   EVSGMIKRMEEKSSLLAPEQPGASELQSRIMGLKDQLVKEKDEYDDALQPIFEE-SLRNQ  932

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HA                                W  +   
Sbjct  933   GSLDILELNRLRRALMIGSHA--------------------------------WDHQLYL  960

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
                 L+ A                +G   E  EPP              T   G   +E 
Sbjct  961   LSSQLKKA---------------SDGQRLEMQEPP-------------KTDQEGADEVEG  992

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
             R   +   N    + +P  GS LS++ID AW G                      SF   
Sbjct  993   RAHSDGEANGDDNKLSP--GSSLSERIDSAWLG----------------------SFQTD  1028

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             S   S   +RL  P RV SFDSA+R QERI K LPPS                     DP
Sbjct  1029  SSAVSSPLRRLAKPIRVQSFDSAMRFQERIQKGLPPSS-------------------LDP  1069

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+    SQ LP E QKL+L+  S+ T+ S AS + +GAR+++P+ G  D+V+ VYD++
Sbjct  1070  VSNVMRTYSQMLPLEVQKLDLIVGSAPTYISSASQMADGARMLIPQRGLNDIVVPVYDDD  1129

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYAL+SKEYK+WV ++        G+++++                S+D+DY+H 
Sbjct  1130  PASVVSYALNSKEYKEWVVNR--------GIANSSSSR-------------SMDVDYIHH  1168

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGG----KVKFSVTCYFAKQFDALR  1609
               YGS            D K SPH  ISF D S ++ G    KVKFSVTCYFAKQFDALR
Sbjct  1169  AVYGSS----------QDDKKSPHLTISFSDRSSSSSGANEGKVKFSVTCYFAKQFDALR  1218

Query  1610  KKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYF  1789
             K CCP+E+DF+RSLSRC+RW AQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FA +YF
Sbjct  1219  KTCCPTEVDFVRSLSRCQRWCAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFATEYF  1278

Query  1790  EYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGS  1969
             +Y+ +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKGS
Sbjct  1279  KYMKESLSSGSPTCLAKILGIYQVSIKHSKGGKETKMDLMVMENLFYNRRISRIYDLKGS  1338

Query  1970  VRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSL  2149
              RSRYN +T    VLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDTSFLA V VMDYSL
Sbjct  1339  ARSRYNPNTSG--VLLDMNLLEALRTEPIFLGSKAKRSLERAIWNDTSFLATVDVMDYSL  1396

Query  2150  LVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LVG DE+RKELVLGIID+MRQYTWDKHLETW
Sbjct  1397  LVGFDEDRKELVLGIIDFMRQYTWDKHLETW  1427



>emb|CDY09508.1| BnaC02g20500D [Brassica napus]
Length=1490

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/748 (48%), Positives = 450/748 (60%), Gaps = 149/748 (20%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +  WI  E AEL+ K +++YA
Sbjct  847   RDCLRFYGFGNMVAFFRYSPINILTVFLPPSMLEFNSHPQPEWIRTEAAELMGKMRTMYA  906

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + ++EEK + +  +    + L + I+ LKD L+KEK+ +ND  QP   E  +   
Sbjct  907   EISGMLNRIEEKSSLLEPEQPEASDLQSRIMGLKDQLVKEKDEYNDAFQPVFVENLQ-SH  965

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HAWDH+L+    + +        +NA               
Sbjct  966   GSLDILELNRLRRALMIGSHAWDHQLF----LLNTQLKKASDDNASR-------------  1008

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
                SLE      +HE P +++ P                    Q+GS     N     E 
Sbjct  1009  ---SLE------MHEPPKTDQRP--------------------QEGSDGREGNAHSDAEA  1039

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
                  N  NK P  +  S GS LS++ID AW G                      SF   
Sbjct  1040  -----NDDNKYP-NKLLSPGSSLSERIDSAWLG----------------------SFHSE  1071

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
             +   SP  KRL  P RV SFDSA+R QERI K LPPS                     DP
Sbjct  1072  ADAKSPL-KRLARPIRVQSFDSAIRFQERIQKGLPPSS-------------------LDP  1111

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+    SQ LP E QKL+L+  S+ T+ S AS + +GAR+++P+              
Sbjct  1112  VSNVMRTYSQMLPLEVQKLDLIVGSAPTYISSASQMADGARMLIPQR-------------  1158

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
                                           +  +N+ES  +S  STW+  G++D+DY+H 
Sbjct  1159  ------------------------------IPRSNRESEPSSTFSTWRSLGAMDVDYIHH  1188

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
               YGS            D K SPH  ISF D S    GKVKFSVTCYFA QFD LRK CC
Sbjct  1189  AVYGSS----------QDDKKSPHLTISFSDRSGAAEGKVKFSVTCYFATQFDTLRKTCC  1238

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             PSE+DF+RSLSRC+RWSAQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FAP+YF+Y+ 
Sbjct  1239  PSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFAPEYFKYMK  1298

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKGS RSR
Sbjct  1299  ESLSSGSPTCLAKILGIYQVSIKHSKGGKETKMDLMVMENLFYNRKISRIYDLKGSARSR  1358

Query  1982  YNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YN +T   +KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDYSLLVG
Sbjct  1359  YNPNTSGKDKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLASVDVMDYSLLVG  1418

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
              DEERKELVLGIID+MRQYTWDKHLETW
Sbjct  1419  FDEERKELVLGIIDFMRQYTWDKHLETW  1446



>ref|XP_011038666.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X2 [Populus euphratica]
Length=1650

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/467 (67%), Positives = 377/467 (81%), Gaps = 4/467 (1%)
 Frame = +2

Query  848   VHASLQEGER-RVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYL  1024
             +HA   E +  +  S  Q +  D+P  +R+ +P RV+SFDSALR+QERI K LPPS  +L
Sbjct  1142  LHAPQAEADGFQPGSVRQPNLYDNPPFRRMMAPLRVHSFDSALRVQERIQKGLPPS-LHL  1200

Query  1025  STLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGAR  1204
             ST++SFHA GDYR+M+RDPVS +    SQ LP EAQKLNL+P+S+ T  S A+ +  GAR
Sbjct  1201  STIRSFHASGDYRSMLRDPVS-VMRTYSQTLPLEAQKLNLIPNSTGTLISSAANMAGGAR  1259

Query  1205  LMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA  1384
             L++P     D+VI VYDN+P S++SYALSSKEY+DWVTD    + G W   + +KE+  A
Sbjct  1260  LLLPMRTSSDIVIGVYDNDPASVVSYALSSKEYEDWVTDSSNENGGIWSTFERSKEASAA  1319

Query  1385  SKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVK  1564
             S  + WQ FGS+DLD++ +G YGSED S  +G LF   K SPH  IS+ D+S   GGKVK
Sbjct  1320  SSFTAWQSFGSVDLDHISYGGYGSEDPSSSLGNLFMVSKKSPHLTISYGDDSSFAGGKVK  1379

Query  1565  FSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQ  1744
             FSVTCYFAKQFD+LRKKCCPS++DF+RSLSRC++WSAQGGKSNVYFAKSLDERFIIKQ++
Sbjct  1380  FSVTCYFAKQFDSLRKKCCPSDVDFVRSLSRCQKWSAQGGKSNVYFAKSLDERFIIKQIK  1439

Query  1745  KTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENL  1924
             KTEL+SFEEFA +YF+YLTDS  SGSPTCLAK++GIYQV VKHL GGKETKMDL+VMENL
Sbjct  1440  KTELESFEEFALEYFKYLTDSLKSGSPTCLAKILGIYQVTVKHLGGGKETKMDLMVMENL  1499

Query  1925  FYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVW  2101
             F+ R+I+RVYDLKGS RSRYN DT   NKVLLD+N +E+L+T PIFLGSKAKRSLERA+W
Sbjct  1500  FFNRNIARVYDLKGSSRSRYNPDTSGPNKVLLDMNLVETLRTDPIFLGSKAKRSLERAIW  1559

Query  2102  NDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             NDTSFLA V VMDYSLLVGVD+ERKELVLGIID+MRQYTWDKHLETW
Sbjct  1560  NDTSFLASVDVMDYSLLVGVDDERKELVLGIIDFMRQYTWDKHLETW  1606


 Score =   162 bits (411),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 108/156 (69%), Gaps = 2/156 (1%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPIDIL+V LPPSVLEFNS  +  WI KE +ELL K ++ Y 
Sbjct  970   RDCLRFYGFGSMVAFFRYSPIDILNVHLPPSVLEFNSTIQHEWIRKEASELLGKMETFYG  1029

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  +  +E++    G + ++ N L + I+ELKD L+KEK+ +N + Q    E+S+  Q
Sbjct  1030  EISGVLDSMEQRSKYFGGELSDTNELQSYIMELKDQLLKEKDDYNVMLQLAVMESSD--Q  1087

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNN  469
             T +D+LELNRLR +LL   H WD +L+ ++S+   N
Sbjct  1088  TVVDILELNRLRRALLIGSHVWDQKLFSLDSVLKTN  1123



>emb|CDX96293.1| BnaA07g29040D [Brassica napus]
Length=1514

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/748 (47%), Positives = 456/748 (61%), Gaps = 139/748 (19%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPI+IL+V LPPS+LEFNS  +  WI  E AEL+ K +++Y 
Sbjct  861   RDCLRFYGFGNMVAFFRYSPINILTVFLPPSMLEFNSHPQPEWIRTEAAELMGKMRNMYE  920

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+SS ++++EE+ + +  +    + L + I+ LKD L+KEK+ ++D  QP  EE S + Q
Sbjct  921   EVSSMIKRMEERSSLLEPEQPGASELQSRIMGLKDQLVKEKDEYDDALQPIFEE-SLQNQ  979

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              ++D+LELNRLR +L+   HA                                W  +   
Sbjct  980   GSLDILELNRLRRALMIGSHA--------------------------------WDHQLYL  1007

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
              +  L+ A                +G   E  EPP              T   G   +E 
Sbjct  1008  LNSQLKKA---------------SDGQRLETQEPP-------------KTDQEGADEVEG  1039

Query  722   RLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQL  901
             R   +   N    + +P  GS LS++ID AW G            S  E     +S    
Sbjct  1040  RAHSDGEANGDDNKLSP--GSSLSERIDSAWLG------------SFHEKAETDSS----  1081

Query  902   SHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDP  1081
               V+SP  +RL  P RV SFDSA+R                             NM+RDP
Sbjct  1082  -AVNSPL-RRLAKPIRVQSFDSAIR-----------------------------NMVRDP  1110

Query  1082  VSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNE  1261
             VSN+    SQ LP E QKL+L+  S+ T+ S AS + +GAR+++P+ G  D+V+ VYD++
Sbjct  1111  VSNVMRTYSQMLPLEVQKLDLIVGSAPTYISSASQMADGARMLIPQRGVNDIVVPVYDDD  1170

Query  1262  PTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHF  1441
             P S++SYAL+SKEYK+WV ++      G   S +NKES  +S  STW+  GS+D      
Sbjct  1171  PASVVSYALNSKEYKEWVANR------GIANSSSNKESEPSSTFSTWRSLGSMD------  1218

Query  1442  GSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCC  1621
                               P L+          S  + GKVKFSVTCYFA QFDALRK CC
Sbjct  1219  ----------------KSPHLTISFSDRSSSSSGASEGKVKFSVTCYFATQFDALRKTCC  1262

Query  1622  PSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLT  1801
             P+E+DF+RSLSRC+RW AQGGKSNVYFAKSLDERFIIKQ+ KTELDSFE+FA +YF+Y+ 
Sbjct  1263  PTEVDFVRSLSRCQRWCAQGGKSNVYFAKSLDERFIIKQVVKTELDSFEDFATEYFKYMK  1322

Query  1802  DSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSR  1981
             +S SSGSPTCLAK++GIYQV++KH KGGKETKMDL+VMENLFY R ISR+YDLKGS RSR
Sbjct  1323  ESLSSGSPTCLAKILGIYQVSIKHSKGGKETKMDLMVMENLFYNRRISRIYDLKGSARSR  1382

Query  1982  YNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVG  2158
             YN +T   +KVLLD+N LE+L+T+PIFLGSKAKRSLERA+WNDT+FLA V VMDYSLLVG
Sbjct  1383  YNPNTSGTDKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDTNFLATVDVMDYSLLVG  1442

Query  2159  VDEERKELVLGIIDYMRQYTWDKHLETW  2242
              DE+RKELVLGIID+MRQYTWDKHLETW
Sbjct  1443  FDEDRKELVLGIIDFMRQYTWDKHLETW  1470



>ref|XP_010932596.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X2 [Elaeis guineensis]
Length=1743

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/781 (48%), Positives = 491/781 (63%), Gaps = 46/781 (6%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+D+LSV LPPS L+F  Q +Q  + KE A++  K + L+A
Sbjct  932   RDCLRFYGIGSMVAFFRYSPVDVLSVNLPPSTLDFTCQIQQELVRKEAAKISNKVEFLHA  991

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   ++ +E K  +   +      +   I ELK++L  E+N +  L Q    E  +   
Sbjct  992   EVFDLLRGIENKITTSE-NEPLKESIDKHITELKNLLKMERNEYEVLLQAVKTENIQLFN  1050

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI-----FDNNFSSQHPENAVSCINPGEWG  526
              ++D+LELNRLR SLL + + WD RLY ++S+     +      + P+   S     EW 
Sbjct  1051  ASVDILELNRLRRSLLLNAYMWDRRLYLLDSLSKAESYTAKVDPKLPD-IFSLTKLKEWK  1109

Query  527   GETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEP----------------PVPKD  658
              E   KDG L ++ E+           P + + S+  E                  +  +
Sbjct  1110  AELFSKDGQLGNSSEKITTRPLTLLGTPRKSMLSKQHEELSLQVVECNSSNMVEMDLSIE  1169

Query  659   ALSYQQGSSSTS-----CNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGI  823
             ++    G +S S     CNG    E ++  E ++  S  E  PS  S LSD+ID AWTG 
Sbjct  1170  SIEGYVGPASLSLVSGQCNGHD--ERKVVAEASMESSSAENLPSPSSNLSDQIDLAWTG-  1226

Query  824   DPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRL  1003
                    Q+     +      S G  S +D P CK+   P RVYSFDSAL+ ++R+   L
Sbjct  1227  -----SGQLVTDPPKDGTEADSVGSSSLLDYPCCKKEMFPVRVYSFDSALKFRDRVHGGL  1281

Query  1004  PPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS  1183
              PS   L++ +SF A GD  +  +D + N++   SQ   R+ Q+LN+L S +  + S AS
Sbjct  1282  SPSSLQLTSFRSFDAAGDVVSTFKDRILNMRRAYSQRSHRDIQRLNILLSQTPIYISSAS  1341

Query  1184  -ILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT------DKPYMSEG  1342
              ++ +GARL++P+ G  DVV+AVYD+EPTSIISYA++S+EY D++T      D+    E 
Sbjct  1342  HMVSDGARLLLPQTGLNDVVVAVYDDEPTSIISYAMTSQEYVDFITSRLDQHDELNGKEK  1401

Query  1343  GWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRI  1522
                + +      +A   +  +      L+ +    YGSE+       L SDPK S H RI
Sbjct  1402  ICSLRNQMSYHAVAMNFADQESVAQYQLNDIQSWCYGSEETQLSREKL-SDPKES-HFRI  1459

Query  1523  SFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYF  1702
              F DE      K K+SVTCYFA+QFDALRKKCCP+ELD+IRSLSRCKRWSAQGGKSNVYF
Sbjct  1460  YFGDECSFPADKAKYSVTCYFARQFDALRKKCCPNELDYIRSLSRCKRWSAQGGKSNVYF  1519

Query  1703  AKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKG  1882
             AKSLDERFIIKQ+ KTELDSFE+FAP+YF+Y+T+S +SGSPTCLAK++GIYQV VKH KG
Sbjct  1520  AKSLDERFIIKQVTKTELDSFEDFAPEYFKYVTESITSGSPTCLAKILGIYQVTVKHSKG  1579

Query  1883  GKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKANK-VLLDLNFLESLQTKPIF  2059
             G+E +MDL+VMENLF+ R+ISRVYDLKGS+RSRYN DT  N  VLLD+N LE+L TKPIF
Sbjct  1580  GREVRMDLMVMENLFFRRNISRVYDLKGSLRSRYNPDTSGNNGVLLDVNLLETLSTKPIF  1639

Query  2060  LGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLET  2239
             LGS AKR LERA+WNDT FLA V VMDYSLLVG+DE+RKELV+GIID+MRQYTWDKHLET
Sbjct  1640  LGSNAKRRLERAIWNDTFFLASVDVMDYSLLVGIDEDRKELVIGIIDFMRQYTWDKHLET  1699

Query  2240  W  2242
             W
Sbjct  1700  W  1700



>ref|XP_010932595.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Elaeis guineensis]
Length=1774

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/781 (48%), Positives = 491/781 (63%), Gaps = 46/781 (6%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+D+LSV LPPS L+F  Q +Q  + KE A++  K + L+A
Sbjct  963   RDCLRFYGIGSMVAFFRYSPVDVLSVNLPPSTLDFTCQIQQELVRKEAAKISNKVEFLHA  1022

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   ++ +E K  +   +      +   I ELK++L  E+N +  L Q    E  +   
Sbjct  1023  EVFDLLRGIENKITTSE-NEPLKESIDKHITELKNLLKMERNEYEVLLQAVKTENIQLFN  1081

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI-----FDNNFSSQHPENAVSCINPGEWG  526
              ++D+LELNRLR SLL + + WD RLY ++S+     +      + P+   S     EW 
Sbjct  1082  ASVDILELNRLRRSLLLNAYMWDRRLYLLDSLSKAESYTAKVDPKLPD-IFSLTKLKEWK  1140

Query  527   GETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEP----------------PVPKD  658
              E   KDG L ++ E+           P + + S+  E                  +  +
Sbjct  1141  AELFSKDGQLGNSSEKITTRPLTLLGTPRKSMLSKQHEELSLQVVECNSSNMVEMDLSIE  1200

Query  659   ALSYQQGSSSTS-----CNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGI  823
             ++    G +S S     CNG    E ++  E ++  S  E  PS  S LSD+ID AWTG 
Sbjct  1201  SIEGYVGPASLSLVSGQCNGHD--ERKVVAEASMESSSAENLPSPSSNLSDQIDLAWTG-  1257

Query  824   DPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRL  1003
                    Q+     +      S G  S +D P CK+   P RVYSFDSAL+ ++R+   L
Sbjct  1258  -----SGQLVTDPPKDGTEADSVGSSSLLDYPCCKKEMFPVRVYSFDSALKFRDRVHGGL  1312

Query  1004  PPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS  1183
              PS   L++ +SF A GD  +  +D + N++   SQ   R+ Q+LN+L S +  + S AS
Sbjct  1313  SPSSLQLTSFRSFDAAGDVVSTFKDRILNMRRAYSQRSHRDIQRLNILLSQTPIYISSAS  1372

Query  1184  -ILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT------DKPYMSEG  1342
              ++ +GARL++P+ G  DVV+AVYD+EPTSIISYA++S+EY D++T      D+    E 
Sbjct  1373  HMVSDGARLLLPQTGLNDVVVAVYDDEPTSIISYAMTSQEYVDFITSRLDQHDELNGKEK  1432

Query  1343  GWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRI  1522
                + +      +A   +  +      L+ +    YGSE+       L SDPK S H RI
Sbjct  1433  ICSLRNQMSYHAVAMNFADQESVAQYQLNDIQSWCYGSEETQLSREKL-SDPKES-HFRI  1490

Query  1523  SFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYF  1702
              F DE      K K+SVTCYFA+QFDALRKKCCP+ELD+IRSLSRCKRWSAQGGKSNVYF
Sbjct  1491  YFGDECSFPADKAKYSVTCYFARQFDALRKKCCPNELDYIRSLSRCKRWSAQGGKSNVYF  1550

Query  1703  AKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKG  1882
             AKSLDERFIIKQ+ KTELDSFE+FAP+YF+Y+T+S +SGSPTCLAK++GIYQV VKH KG
Sbjct  1551  AKSLDERFIIKQVTKTELDSFEDFAPEYFKYVTESITSGSPTCLAKILGIYQVTVKHSKG  1610

Query  1883  GKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKANK-VLLDLNFLESLQTKPIF  2059
             G+E +MDL+VMENLF+ R+ISRVYDLKGS+RSRYN DT  N  VLLD+N LE+L TKPIF
Sbjct  1611  GREVRMDLMVMENLFFRRNISRVYDLKGSLRSRYNPDTSGNNGVLLDVNLLETLSTKPIF  1670

Query  2060  LGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLET  2239
             LGS AKR LERA+WNDT FLA V VMDYSLLVG+DE+RKELV+GIID+MRQYTWDKHLET
Sbjct  1671  LGSNAKRRLERAIWNDTFFLASVDVMDYSLLVGIDEDRKELVIGIIDFMRQYTWDKHLET  1730

Query  2240  W  2242
             W
Sbjct  1731  W  1731



>ref|XP_007045109.1| Forms aploid and binucleate cells 1c, putative isoform 4 [Theobroma 
cacao]
 gb|EOY00941.1| Forms aploid and binucleate cells 1c, putative isoform 4 [Theobroma 
cacao]
Length=1580

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/623 (53%), Positives = 421/623 (68%), Gaps = 32/623 (5%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPIDILSV LPPS+LEF+  ++Q WI K+ AEL+ K + LYA
Sbjct  980   RDCLRFYGFGNMVAFFRYSPIDILSVHLPPSMLEFSGDAKQEWIRKDAAELMVKMEMLYA  1039

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             +IS  +  +E+K  S  C  +N + L N I+EL+D L KE+N +N L QP   ETS  G 
Sbjct  1040  DISDVLDHIEQKSNSASCQSSNASELPNHIMELRDQLRKERNDYNGLLQPVVMETSPLGL  1099

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LELNRLR SLL   H WD +L+ ++S+     + +   + +              
Sbjct  1100  AAVDILELNRLRRSLLIGSHVWDRQLHSLDSLLKKGSAVKADVDHI--------------  1145

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             KDG  E       HE       P     S+  EPP  K+ +  +Q SS T+       E+
Sbjct  1146  KDGKPE------AHE-------PNACRSSDSQEPP--KNDIGLEQNSSLTTLESVVPEES  1190

Query  722   RLGL---ENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASF  892
              L L   +   +  P E  PS  S LS+KID AWTG D  +  +Q   + Q    +  S 
Sbjct  1191  NLALCHQKREEDVHPDESIPSPASTLSEKIDSAWTGTDLLTLKVQPPEASQGDGPQAGSI  1250

Query  893   GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMI  1072
                S +D+   +++ SP R++SFDS LR QERI K L PS  +  TL+SFHA G+YR+M+
Sbjct  1251  RPTSKIDNLALRKIASPMRLHSFDSVLRFQERIQKGLYPSSLHFLTLRSFHASGEYRSMV  1310

Query  1073  RDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVY  1252
             RDPVSN+    S  LP EAQKLNLL SS+ T  + AS + EGARL++P+ G  D+VIAVY
Sbjct  1311  RDPVSNVMSTYSYTLPLEAQKLNLLLSSTPTLITSASHMAEGARLLLPQRGHSDIVIAVY  1370

Query  1253  DNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDY  1432
             D++P SII+YALSSKEY++WV DK + + GGW VSD +KE  +AS  S WQ FGSLDLDY
Sbjct  1371  DSDPASIIAYALSSKEYEEWVADKSHENGGGWSVSDRSKEDSVASNFSPWQSFGSLDLDY  1430

Query  1433  MHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRK  1612
             +H+ S+GSEDAS  +G LF+D K SPH  +SF D+S   GGKVKFSVTCYFAKQFD+LR+
Sbjct  1431  IHYRSFGSEDASSSVGALFADTKRSPHLTVSFGDDSSAAGGKVKFSVTCYFAKQFDSLRR  1490

Query  1613  KCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFE  1792
             KCCPSELDF+ SLSRC++WSAQGGKSNVYFAKSLDERFIIKQ+QKTEL+SF+EFAP+YF+
Sbjct  1491  KCCPSELDFLCSLSRCQKWSAQGGKSNVYFAKSLDERFIIKQVQKTELESFDEFAPEYFK  1550

Query  1793  YLTDSHSSGSPTCLAKVVGIYQV  1861
             YLTDS SSGSPTCLAK++GIYQV
Sbjct  1551  YLTDSLSSGSPTCLAKILGIYQV  1573



>ref|XP_009381447.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Musa acuminata subsp. malaccensis]
Length=1734

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/772 (47%), Positives = 480/772 (62%), Gaps = 54/772 (7%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A F YSP+DILSV LPPSVL+F  Q +Q W+  E   +  K  +L+ 
Sbjct  948   RDCLRFYGFGSMVAFFHYSPVDILSVCLPPSVLDFTFQIQQEWLKPEAVLVFNKINALHG  1007

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             +IS  +   E K  +   D      +H  I++LK++L  E++ ++ L QP     ++  +
Sbjct  1008  KISDVLHATERKIMTSE-DEPLKASIHRHIIKLKELLEMERHDFDVLLQPVIVGNTQPLR  1066

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYM--------ESIFDNNFSSQHPENAVSCINPG  517
               +D+LELNRLR  +L D + WD RLY +         +I D+  +     +  S  N  
Sbjct  1067  VMVDILELNRLRREILFDSYTWDRRLYSLGLLSKEKGRTIIDSQLT-----DISSKTNLR  1121

Query  518   EWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHD------------EPPVPKDA  661
             EW  E + KDG+      +    F  +++      H E              E  +  ++
Sbjct  1122  EWREEMLGKDGTFGREVTDKSSYFSATQKSSFSKQHEELSLRVMECNTNNMVEMDLSIES  1181

Query  662   LSYQQGSSST---SCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPS  832
             +    GS+S+   S N D   +T   + +    + LE + S  S LSDKID AW+G+   
Sbjct  1182  VEGFAGSASSNFVSSNNDGWDDT--SIFDDTESTFLENSTSPLSSLSDKIDLAWSGLG--  1237

Query  833   SQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPS  1012
                 Q+     +G     + G L  +++P   RLKSP RVYSFDSALR ++ +  R  P+
Sbjct  1238  ----QLMTDQPKGGSEADTSGPL--MENPCYSRLKSPLRVYSFDSALRFRKGVHGRFLPA  1291

Query  1013  PSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLN-LLPSSSTTFTSHASIL  1189
               +L + KSF   G   +M +DP++ ++   SQ+ P   Q+L+ LL       +S    +
Sbjct  1292  SLHLPSAKSFDFSGGLASMPKDPITIMRRAYSQSSPSTVQRLDDLLNHIPLRISSSLEKI  1351

Query  1190  PEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNK  1369
              EGARL++P+N   D+V+AVYD+EPTSIISYA++S+EY D++   P + E    +    K
Sbjct  1352  AEGARLLLPQNALDDIVVAVYDDEPTSIISYAITSQEYNDYIM--PSLDETVSCM--LRK  1407

Query  1370  ESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNT  1549
              S + + +    +  +L     H      E    R+  L  DPK + H RISF+D+    
Sbjct  1408  GSSVVNIVGAATQQSNLQF---HSDVGPDEPQLSRVNPL--DPKET-HFRISFDDDYSIP  1461

Query  1550  GGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFI  1729
               K KFSVTCYFAKQF ALRK CCPSELD+IRSLSRCKRWSAQGGKSNVYFAKSLDERFI
Sbjct  1462  SDKAKFSVTCYFAKQFHALRKICCPSELDYIRSLSRCKRWSAQGGKSNVYFAKSLDERFI  1521

Query  1730  IKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLI  1909
             IKQ+ KTELDSFE+FA +YF+YLT S +SGSPTCLAKV+GIYQVAVKH KGG+E KMD++
Sbjct  1522  IKQVTKTELDSFEDFALEYFKYLTQSITSGSPTCLAKVLGIYQVAVKHSKGGREVKMDVM  1581

Query  1910  VMENLFYGRSISRVYDLKGSVRSRYNSDTKANK-VLLDLNFLESLQTKPIFLGSKAKRSL  2086
             VMENLF+ R++SRVYDLKGS+R RYN D+  N  VLLDLN LE   TKPIFLGSKAKR L
Sbjct  1582  VMENLFFKRNVSRVYDLKGSLRCRYNPDSSGNNTVLLDLNLLE---TKPIFLGSKAKRRL  1638

Query  2087  ERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             ERAVWNDTSFLA +YVMDYSLLVG+DE  KELV+GIID+MRQYTWDK LETW
Sbjct  1639  ERAVWNDTSFLASIYVMDYSLLVGIDETHKELVIGIIDFMRQYTWDKQLETW  1690



>ref|XP_007045107.1| Phosphatidylinositol-4-phosphate 5-kinase family protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY00939.1| Phosphatidylinositol-4-phosphate 5-kinase family protein, putative 
isoform 2 [Theobroma cacao]
Length=1600

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/620 (52%), Positives = 418/620 (67%), Gaps = 32/620 (5%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSPIDILSV LPPS+LEF+  ++Q WI K+ AEL+ K + LYA
Sbjct  980   RDCLRFYGFGNMVAFFRYSPIDILSVHLPPSMLEFSGDAKQEWIRKDAAELMVKMEMLYA  1039

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             +IS  +  +E+K  S  C  +N + L N I+EL+D L KE+N +N L QP   ETS  G 
Sbjct  1040  DISDVLDHIEQKSNSASCQSSNASELPNHIMELRDQLRKERNDYNGLLQPVVMETSPLGL  1099

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LELNRLR SLL   H WD +L+ ++S+     + +   + +              
Sbjct  1100  AAVDILELNRLRRSLLIGSHVWDRQLHSLDSLLKKGSAVKADVDHI--------------  1145

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             KDG  E       HE       P     S+  EPP  K+ +  +Q SS T+       E+
Sbjct  1146  KDGKPE------AHE-------PNACRSSDSQEPP--KNDIGLEQNSSLTTLESVVPEES  1190

Query  722   RLGL---ENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASF  892
              L L   +   +  P E  PS  S LS+KID AWTG D  +  +Q   + Q    +  S 
Sbjct  1191  NLALCHQKREEDVHPDESIPSPASTLSEKIDSAWTGTDLLTLKVQPPEASQGDGPQAGSI  1250

Query  893   GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMI  1072
                S +D+   +++ SP R++SFDS LR QERI K L PS  +  TL+SFHA G+YR+M+
Sbjct  1251  RPTSKIDNLALRKIASPMRLHSFDSVLRFQERIQKGLYPSSLHFLTLRSFHASGEYRSMV  1310

Query  1073  RDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVY  1252
             RDPVSN+    S  LP EAQKLNLL SS+ T  + AS + EGARL++P+ G  D+VIAVY
Sbjct  1311  RDPVSNVMSTYSYTLPLEAQKLNLLLSSTPTLITSASHMAEGARLLLPQRGHSDIVIAVY  1370

Query  1253  DNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDY  1432
             D++P SII+YALSSKEY++WV DK + + GGW VSD +KE  +AS  S WQ FGSLDLDY
Sbjct  1371  DSDPASIIAYALSSKEYEEWVADKSHENGGGWSVSDRSKEDSVASNFSPWQSFGSLDLDY  1430

Query  1433  MHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRK  1612
             +H+ S+GSEDAS  +G LF+D K SPH  +SF D+S   GGKVKFSVTCYFAKQFD+LR+
Sbjct  1431  IHYRSFGSEDASSSVGALFADTKRSPHLTVSFGDDSSAAGGKVKFSVTCYFAKQFDSLRR  1490

Query  1613  KCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFE  1792
             KCCPSELDF+ SLSRC++WSAQGGKSNVYFAKSLDERFIIKQ+QKTEL+SF+EFAP+YF+
Sbjct  1491  KCCPSELDFLCSLSRCQKWSAQGGKSNVYFAKSLDERFIIKQVQKTELESFDEFAPEYFK  1550

Query  1793  YLTDSHSSGSPTCLAKVVGI  1852
             YLTDS SSGSPTCLAK++G+
Sbjct  1551  YLTDSLSSGSPTCLAKILGL  1570



>gb|EAZ42811.1| hypothetical protein OsJ_27396 [Oryza sativa Japonica Group]
Length=1544

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/770 (46%), Positives = 479/770 (62%), Gaps = 73/770 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSP+DILSV LPPSVL+FN +S Q W+ +   E+  K ++L++
Sbjct  781   RDCLRFYGYGNMVAFFRYSPVDILSVNLPPSVLDFNCRSRQDWMRRMAVEIYSKMETLHS  840

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   +   E    S   D     G+   I+E+KD+L  E+N +  L  P   +++   Q
Sbjct  841   EVYDFLHHNENSVTSE--DEPVKAGVQRQIIEMKDLLKMERNGYEILLLPVITDSNHSVQ  898

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              +IDVLELNRLR  LL D + WD RL Y++S+   +    +P+  +  +   EW  + + 
Sbjct  899   VSIDVLELNRLRRGLLLDAYIWDRRLCYIDSLLKKDSHVSNPDIFLD-VRLKEWKADLLV  957

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNG------  703
              D  +  +          S   P + L S         +   Y+ G +++  +       
Sbjct  958   GDTKIGKSTN-----LSQSSGSPRKSLLSREG----CLNDTEYRMGETNSQIDLVTHPVD  1008

Query  704   -----DKTL-----ETRLGLENA-VNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV  850
                  DK       ET   +  A + K P+ER PS  SI SDKID AWTG        ++
Sbjct  1009  DAEDLDKVFRRFNGETEQPVTTATMGKEPVERLPSLASIFSDKIDLAWTG------SSEI  1062

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
                L +G  ++  +G  +  D+P+     +P R++SFDS   I +R    L P+  +LS+
Sbjct  1063  QDDLLQGFTKIDEYGSFNFPDNPSYGNSVTPVRIHSFDSKFAIHQRERNGLAPTSLHLSS  1122

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS-ILPEGARL  1207
              +S   +GD+ ++++DP+ NI+  CSQ  P   +KLN++ + + T+ S AS ++ +GARL
Sbjct  1123  FRSAEYFGDFTSILKDPMPNIRRACSQRSPGAVEKLNVVLTRTLTYISSASHMIDDGARL  1182

Query  1208  MVPENG-QKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA  1384
             ++P+ G + D VIAVYD+EPTSI+SYA++S+EY   VT K                  + 
Sbjct  1183  LLPQIGYEDDAVIAVYDDEPTSIVSYAMTSQEYVQQVTRK------------------LN  1224

Query  1385  SKLSTWQRFGSLDLDYMHFGSYGSE----DASGRIGFLFSDPKLSPHPRISFEDESCNTG  1552
             S LS      ++D  +   G+  S+    D+ G             H + SF+DES  + 
Sbjct  1225  SSLSFLHLPNAIDSSHGLDGTLLSQEDHLDSKG------------THFKFSFDDESPLSE  1272

Query  1553  GKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFII  1732
              K KFS+TCYFAK F ALRKKCCP ++DFIRSLSRCKRW+AQGGKSNVYFAK+LDERFII
Sbjct  1273  DKAKFSITCYFAKHFAALRKKCCPKDIDFIRSLSRCKRWNAQGGKSNVYFAKTLDERFII  1332

Query  1733  KQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIV  1912
             KQ+ +TEL+SF EFAP+YF YL +S +SGSPTCLAK+VG+YQV +K LKGG+E KMDL+V
Sbjct  1333  KQVTRTELESFVEFAPQYFRYLMESLTSGSPTCLAKIVGVYQVNIKGLKGGREVKMDLMV  1392

Query  1913  MENLFYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRSLER  2092
             MENLF+ R ISRVYDLKGS+RSRY S    +KVLLD N LE+L TKPIFLGSKAKR LER
Sbjct  1393  MENLFFERKISRVYDLKGSLRSRYTS--SESKVLLDSNLLEALHTKPIFLGSKAKRRLER  1450

Query  2093  AVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AVWNDTSFLA   VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1451  AVWNDTSFLATADVMDYSLLVGIDEEKKELVIGIIDYLRQYTWDKQLETW  1500



>ref|XP_010909652.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X2 [Elaeis guineensis]
Length=1778

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/793 (48%), Positives = 510/793 (64%), Gaps = 72/793 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LPPS L+F SQ++Q  + KE A++  K + L+A
Sbjct  968   RDCLRFYGFGSMVAFFRYSPVDILSVNLPPSTLDFTSQTQQELVRKEAAKISNKVEFLHA  1027

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  +Q +E+K  ++         +   I +L+++L  EKN +  L Q    E  +   
Sbjct  1028  EVSKGLQGIEKK-ITISEHEPLKASIPKHITQLRELLKWEKNEYEVLLQTVKIENIQLFN  1086

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI-----FDNNFSSQHPENAVSCINPGEWG  526
              TID+L+LNRLR +LL D + WDH LY ++S+     +      + PE   S     +W 
Sbjct  1087  ATIDILDLNRLRRNLLLDAYLWDHLLYLLDSLSKAESYTAKVDPKLPE-IFSPTKLRDWR  1145

Query  527   GETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSS-------  685
              E   KDG L  + E+N+ +       P + + S+  E       LS Q   S       
Sbjct  1146  AELFSKDGQLWTSSEKNISKTSTLLGTPRKSMLSKQQE------ELSLQVLESNSINMVE  1199

Query  686   --------------------STSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKID  805
                                 S  CNG    E ++  E +++ S L+  PS  S LSD+ID
Sbjct  1200  MDLSIESIEGYVGPAGLNLASGHCNGYD--ERKVVAEASIDTSSLD-LPSPASSLSDQID  1256

Query  806   CAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQE  985
              AWTG       M    S+ EG+    S G    +D+P  K++ SP RVYSFDSAL+ ++
Sbjct  1257  LAWTG--SGQLVMDPPKSVSEGD----SVGSSGLMDNPCYKKVMSPVRVYSFDSALKFRD  1310

Query  986   RISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTT  1165
             R+   L PS  +L++  SF A GD  +M +D   N++   S   PR+ Q+L++L S +  
Sbjct  1311  RVHGGLSPS-LHLTSFTSFDASGDSVSMCKDATPNMRRAYSGRSPRDIQRLDILLSHTPI  1369

Query  1166  FTSHASIL-PEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEG  1342
                  S++  +GARL++P+ G  D VIAVYD+EPTSIISYA+ S+EY +++T K  +++ 
Sbjct  1370  HILSVSLMVSDGARLLLPQTGLIDGVIAVYDDEPTSIISYAMISREYAEFITSK--LNQH  1427

Query  1343  GWGVSDTNKESPIASKLS------------TWQRFGSLDLDYMHFGSYGSEDASGRIGFL  1486
             G  +++ +K S I +++             +  ++ S D     +GS G++         
Sbjct  1428  G-DLNEKDKTSSIRNQMGYHAEAMNFAAQESVAQYQSNDTQSWSYGSDGTQLLQDNP---  1483

Query  1487  FSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKR  1666
              SDPK  PH RISF D+S     KVK+SVTCYFA+QFDALRKKCCP+ELD++RSLSRCK+
Sbjct  1484  -SDPK-EPHFRISFGDDSSFPSDKVKYSVTCYFARQFDALRKKCCPNELDYMRSLSRCKK  1541

Query  1667  WSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVV  1846
             WSAQGGKSNVYFAKS D+RFIIKQ+ KTELDSFE+FAP+YF YLT+S +SGSPTCLAK++
Sbjct  1542  WSAQGGKSNVYFAKSWDDRFIIKQVTKTELDSFEDFAPEYFRYLTESITSGSPTCLAKIL  1601

Query  1847  GIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDL  2023
             GIYQV VKHLKGG+E +MDL+VMENLF+ R+ISRVYDLKGS+RSRYN DT   N+VLLDL
Sbjct  1602  GIYQVTVKHLKGGREVRMDLMVMENLFFRRNISRVYDLKGSLRSRYNPDTSGDNRVLLDL  1661

Query  2024  NFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDY  2203
             N LE+L+TKPIFLGSKAKRSLERAVWNDTSFLA V VMDYSLLVG+DE++KELV+GIID+
Sbjct  1662  NLLETLRTKPIFLGSKAKRSLERAVWNDTSFLASVDVMDYSLLVGIDEDQKELVIGIIDF  1721

Query  2204  MRQYTWDKHLETW  2242
             MRQYTWDKHLETW
Sbjct  1722  MRQYTWDKHLETW  1734



>gb|EEC83612.1| hypothetical protein OsI_29312 [Oryza sativa Indica Group]
Length=1553

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/770 (46%), Positives = 479/770 (62%), Gaps = 73/770 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSP+DILSV LPPSVL+FN +S Q W+ +   E+  K ++L++
Sbjct  790   RDCLRFYGYGNMVAFFRYSPVDILSVNLPPSVLDFNCRSRQDWMRRMAVEIYSKMETLHS  849

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   +   E+   S   D     G+   I+E+KD+L  E+N +  L  P   +++   Q
Sbjct  850   EVYDFLHHNEKSVTSE--DEPVKAGVQRQIIEMKDLLKMERNGYEILLLPVITDSNHSVQ  907

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              +IDVLELNRLR  LL D + WD RL Y++S+   +    +P+  +  +   EW  + + 
Sbjct  908   VSIDVLELNRLRRGLLLDAYIWDRRLCYIDSLLKKDSHVSNPDIFLD-VRLKEWKADLLV  966

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNG------  703
              D  +  +          S   P + L S         +   Y+ G +++  +       
Sbjct  967   GDTKIGKSTN-----LSQSSGSPRKSLLSREG----CLNDTEYRMGETNSQIDLVTHPVD  1017

Query  704   -----DKTL-----ETRLGLENA-VNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV  850
                  DK       ET      A + K P+ER PS  SI SDKID AWTG        ++
Sbjct  1018  DAEDLDKVFRRFNGETEQPFTTATMGKEPVERLPSLASIFSDKIDLAWTG------SSEI  1071

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
                L +G  ++  +G  +  D+P+     +P R++SFDS   I +R    L P+  +LS+
Sbjct  1072  QDDLLQGFTKIDEYGSFNFPDNPSYGNSVTPVRIHSFDSKFAIHQRERNGLAPTSLHLSS  1131

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS-ILPEGARL  1207
              +S   +GD+ ++++DP+ NI+  CSQ  P   +KLN++ + + T+ S AS ++ +GARL
Sbjct  1132  FRSAEYFGDFTSILKDPMPNIRRACSQRSPGAVEKLNVVLTRTLTYISSASHMIDDGARL  1191

Query  1208  MVPENG-QKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA  1384
             ++P+ G + D VIAVYD+EPTSI+SYA++S+EY   VT K                  + 
Sbjct  1192  LLPQIGYEDDAVIAVYDDEPTSIVSYAMTSQEYVQQVTRK------------------LN  1233

Query  1385  SKLSTWQRFGSLDLDYMHFGSYGSE----DASGRIGFLFSDPKLSPHPRISFEDESCNTG  1552
             S LS      ++D  +   G+  S+    D+ G             H + SF+DES  + 
Sbjct  1234  SSLSFLHLPNAIDSSHGLDGTLLSQEDHLDSKG------------THFKFSFDDESPLSE  1281

Query  1553  GKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFII  1732
              K KFSVTCYFAK F ALRKKCCP ++DFIRSLSRCKRW+AQGGKSNVYFAK+LDERFII
Sbjct  1282  DKAKFSVTCYFAKHFAALRKKCCPKDIDFIRSLSRCKRWNAQGGKSNVYFAKTLDERFII  1341

Query  1733  KQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIV  1912
             KQ+ +TEL+SF EFAP+YF YL +S +SGSPTCLAK+VG+YQV +K LKGG+E KMDL+V
Sbjct  1342  KQVTRTELESFVEFAPQYFRYLMESLTSGSPTCLAKIVGVYQVNIKGLKGGREVKMDLMV  1401

Query  1913  MENLFYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRSLER  2092
             MENLF+ R ISRVYDLKGS+RSRY S    +KVLLD N LE+L TKPIFLGSKAKR LER
Sbjct  1402  MENLFFERKISRVYDLKGSLRSRYTS--SESKVLLDSNLLEALHTKPIFLGSKAKRRLER  1459

Query  2093  AVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AVWNDTSFLA   VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1460  AVWNDTSFLATADVMDYSLLVGIDEEKKELVIGIIDYLRQYTWDKQLETW  1509



>ref|NP_001061851.1| Os08g0428900 [Oryza sativa Japonica Group]
 dbj|BAC24937.1| FYVE finger-containing phosphoinositide kinase-like [Oryza sativa 
Japonica Group]
 dbj|BAF23765.1| Os08g0428900 [Oryza sativa Japonica Group]
Length=1630

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/770 (46%), Positives = 479/770 (62%), Gaps = 73/770 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSP+DILSV LPPSVL+FN +S Q W+ +   E+  K ++L++
Sbjct  867   RDCLRFYGYGNMVAFFRYSPVDILSVNLPPSVLDFNCRSRQDWMRRMAVEIYSKMETLHS  926

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   +   E    S   D     G+   I+E+KD+L  E+N +  L  P   +++   Q
Sbjct  927   EVYDFLHHNENSVTSE--DEPVKAGVQRQIIEMKDLLKMERNGYEILLLPVITDSNHSVQ  984

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              +IDVLELNRLR  LL D + WD RL Y++S+   +    +P+  +  +   EW  + + 
Sbjct  985   VSIDVLELNRLRRGLLLDAYIWDRRLCYIDSLLKKDSHVSNPDIFLD-VRLKEWKADLLV  1043

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNG------  703
              D  +  +          S   P + L S         +   Y+ G +++  +       
Sbjct  1044  GDTKIGKSTN-----LSQSSGSPRKSLLSREG----CLNDTEYRMGETNSQIDLVTHPVD  1094

Query  704   -----DKTL-----ETRLGLENA-VNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV  850
                  DK       ET   +  A + K P+ER PS  SI SDKID AWTG        ++
Sbjct  1095  DAEDLDKVFRRFNGETEQPVTTATMGKEPVERLPSLASIFSDKIDLAWTG------SSEI  1148

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
                L +G  ++  +G  +  D+P+     +P R++SFDS   I +R    L P+  +LS+
Sbjct  1149  QDDLLQGFTKIDEYGSFNFPDNPSYGNSVTPVRIHSFDSKFAIHQRERNGLAPTSLHLSS  1208

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS-ILPEGARL  1207
              +S   +GD+ ++++DP+ NI+  CSQ  P   +KLN++ + + T+ S AS ++ +GARL
Sbjct  1209  FRSAEYFGDFTSILKDPMPNIRRACSQRSPGAVEKLNVVLTRTLTYISSASHMIDDGARL  1268

Query  1208  MVPENG-QKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA  1384
             ++P+ G + D VIAVYD+EPTSI+SYA++S+EY   VT K                  + 
Sbjct  1269  LLPQIGYEDDAVIAVYDDEPTSIVSYAMTSQEYVQQVTRK------------------LN  1310

Query  1385  SKLSTWQRFGSLDLDYMHFGSYGSE----DASGRIGFLFSDPKLSPHPRISFEDESCNTG  1552
             S LS      ++D  +   G+  S+    D+ G             H + SF+DES  + 
Sbjct  1311  SSLSFLHLPNAIDSSHGLDGTLLSQEDHLDSKG------------THFKFSFDDESPLSE  1358

Query  1553  GKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFII  1732
              K KFS+TCYFAK F ALRKKCCP ++DFIRSLSRCKRW+AQGGKSNVYFAK+LDERFII
Sbjct  1359  DKAKFSITCYFAKHFAALRKKCCPKDIDFIRSLSRCKRWNAQGGKSNVYFAKTLDERFII  1418

Query  1733  KQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIV  1912
             KQ+ +TEL+SF EFAP+YF YL +S +SGSPTCLAK+VG+YQV +K LKGG+E KMDL+V
Sbjct  1419  KQVTRTELESFVEFAPQYFRYLMESLTSGSPTCLAKIVGVYQVNIKGLKGGREVKMDLMV  1478

Query  1913  MENLFYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRSLER  2092
             MENLF+ R ISRVYDLKGS+RSRY S    +KVLLD N LE+L TKPIFLGSKAKR LER
Sbjct  1479  MENLFFERKISRVYDLKGSLRSRYTS--SESKVLLDSNLLEALHTKPIFLGSKAKRRLER  1536

Query  2093  AVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AVWNDTSFLA   VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1537  AVWNDTSFLATADVMDYSLLVGIDEEKKELVIGIIDYLRQYTWDKQLETW  1586



>ref|XP_010909650.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Elaeis guineensis]
 ref|XP_010909651.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Elaeis guineensis]
Length=1779

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/794 (48%), Positives = 510/794 (64%), Gaps = 73/794 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LPPS L+F SQ++Q  + KE A++  K + L+A
Sbjct  968   RDCLRFYGFGSMVAFFRYSPVDILSVNLPPSTLDFTSQTQQELVRKEAAKISNKVEFLHA  1027

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKN-YWNDLHQPTHEETSEEG  358
             E+S  +Q +E+K  ++         +   I +L+++L  EKN Y   L Q    E  +  
Sbjct  1028  EVSKGLQGIEKK-ITISEHEPLKASIPKHITQLRELLKWEKNEYEQVLLQTVKIENIQLF  1086

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI-----FDNNFSSQHPENAVSCINPGEW  523
               TID+L+LNRLR +LL D + WDH LY ++S+     +      + PE   S     +W
Sbjct  1087  NATIDILDLNRLRRNLLLDAYLWDHLLYLLDSLSKAESYTAKVDPKLPE-IFSPTKLRDW  1145

Query  524   GGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSS------  685
               E   KDG L  + E+N+ +       P + + S+  E       LS Q   S      
Sbjct  1146  RAELFSKDGQLWTSSEKNISKTSTLLGTPRKSMLSKQQE------ELSLQVLESNSINMV  1199

Query  686   ---------------------STSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKI  802
                                  S  CNG    E ++  E +++ S L+  PS  S LSD+I
Sbjct  1200  EMDLSIESIEGYVGPAGLNLASGHCNGYD--ERKVVAEASIDTSSLD-LPSPASSLSDQI  1256

Query  803   DCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
             D AWTG       M    S+ EG+    S G    +D+P  K++ SP RVYSFDSAL+ +
Sbjct  1257  DLAWTG--SGQLVMDPPKSVSEGD----SVGSSGLMDNPCYKKVMSPVRVYSFDSALKFR  1310

Query  983   ERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSST  1162
             +R+   L PS  +L++  SF A GD  +M +D   N++   S   PR+ Q+L++L S + 
Sbjct  1311  DRVHGGLSPS-LHLTSFTSFDASGDSVSMCKDATPNMRRAYSGRSPRDIQRLDILLSHTP  1369

Query  1163  TFTSHASIL-PEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSE  1339
                   S++  +GARL++P+ G  D VIAVYD+EPTSIISYA+ S+EY +++T K  +++
Sbjct  1370  IHILSVSLMVSDGARLLLPQTGLIDGVIAVYDDEPTSIISYAMISREYAEFITSK--LNQ  1427

Query  1340  GGWGVSDTNKESPIASKLS------------TWQRFGSLDLDYMHFGSYGSEDASGRIGF  1483
              G  +++ +K S I +++             +  ++ S D     +GS G++        
Sbjct  1428  HG-DLNEKDKTSSIRNQMGYHAEAMNFAAQESVAQYQSNDTQSWSYGSDGTQLLQDNP--  1484

Query  1484  LFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCK  1663
               SDPK  PH RISF D+S     KVK+SVTCYFA+QFDALRKKCCP+ELD++RSLSRCK
Sbjct  1485  --SDPK-EPHFRISFGDDSSFPSDKVKYSVTCYFARQFDALRKKCCPNELDYMRSLSRCK  1541

Query  1664  RWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKV  1843
             +WSAQGGKSNVYFAKS D+RFIIKQ+ KTELDSFE+FAP+YF YLT+S +SGSPTCLAK+
Sbjct  1542  KWSAQGGKSNVYFAKSWDDRFIIKQVTKTELDSFEDFAPEYFRYLTESITSGSPTCLAKI  1601

Query  1844  VGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLD  2020
             +GIYQV VKHLKGG+E +MDL+VMENLF+ R+ISRVYDLKGS+RSRYN DT   N+VLLD
Sbjct  1602  LGIYQVTVKHLKGGREVRMDLMVMENLFFRRNISRVYDLKGSLRSRYNPDTSGDNRVLLD  1661

Query  2021  LNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIID  2200
             LN LE+L+TKPIFLGSKAKRSLERAVWNDTSFLA V VMDYSLLVG+DE++KELV+GIID
Sbjct  1662  LNLLETLRTKPIFLGSKAKRSLERAVWNDTSFLASVDVMDYSLLVGIDEDQKELVIGIID  1721

Query  2201  YMRQYTWDKHLETW  2242
             +MRQYTWDKHLETW
Sbjct  1722  FMRQYTWDKHLETW  1735



>ref|XP_008800771.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X3 [Phoenix dactylifera]
Length=1729

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/781 (48%), Positives = 499/781 (64%), Gaps = 46/781 (6%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LPPS L+F  Q +Q    KE A++    + L+ 
Sbjct  918   RDCLRFYGFGSMVAFFRYSPVDILSVNLPPSTLDFACQIQQELARKEGAKICNMVELLHG  977

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   +Q +E    ++     +   +H  I ELK++L  E+N +  L Q    E  +   
Sbjct  978   EVYDMLQGIERN-ITISEHEPSKESIHKHITELKNLLKVERNEYEVLLQAVKTENIQLFN  1036

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI-----FDNNFSSQHPENAVSCINPGEWG  526
              ++D+LELNRLR SLL + + WD +LY ++S+     +      + P+   S     EW 
Sbjct  1037  ASVDILELNRLRRSLLLNAYMWDRQLYLLDSLSKAESYPAKVDPKLPD-MFSLTKLKEWR  1095

Query  527   GETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEP----------------PVPKD  658
              E   KDG L ++ E+   +   S   P + + S+  E                  +  +
Sbjct  1096  AELFSKDGQLGNSSEKITTKPLASLGTPRKSMLSKQHEELSLQVLECNSSNMVEIDLSVE  1155

Query  659   ALSYQQGSSSTS-----CNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGI  823
             ++   +G +S +     CNG    E ++  E ++  S +E   S  S LSD+ID AWTG 
Sbjct  1156  SIEGYEGPASLNFFSGQCNGYD--ERKVVAEASIAASSVENLHSPSSNLSDQIDLAWTG-  1212

Query  824   DPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRL  1003
                    Q+     +G+ +  S G  S +D+   K++ SP RVYSFDSAL+ ++R+   L
Sbjct  1213  -----SGQLVKDPPKGDAKADSVGSPSLLDNSCYKKVMSPVRVYSFDSALKFRDRVYGGL  1267

Query  1004  PPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS  1183
              PS   L++ +S    GD+ +  +DP+ N++   SQ   R+ Q+LN L S +  + S AS
Sbjct  1268  SPSSLQLTSFRSADVAGDFVSTFKDPILNMRRAYSQRSRRDIQRLNTLLSQTPIYISSAS  1327

Query  1184  -ILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT---DKPYMSEGGWG  1351
              ++ +GA L++ + G  D+V+AVYD+EPTSIISYAL+S+EY D++T   D+    +G   
Sbjct  1328  HMVSDGAHLLLSQTGLSDIVVAVYDDEPTSIISYALTSQEYADFITSRLDQRKELKGKDK  1387

Query  1352  VSDTNKE---SPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRI  1522
             +S    +      A   +  +      L+ +    YGS++A      L SDPK S H RI
Sbjct  1388  ISSLRNQMSNHAAAMNFAGQESVAQYQLNDIQSWCYGSDEAQLSREKL-SDPKES-HFRI  1445

Query  1523  SFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYF  1702
              F DES     K K+SVTCYFA+QFDALRKKCCP+ELD+IRSLSRCKRW AQGGKSNVYF
Sbjct  1446  YFGDESSFPADKAKYSVTCYFARQFDALRKKCCPNELDYIRSLSRCKRWRAQGGKSNVYF  1505

Query  1703  AKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKG  1882
             AKSLD+RFIIKQ+ KTELDSFE+FAP+YF+YLT+S +SGSPTCLAK++GIYQV VKHLKG
Sbjct  1506  AKSLDDRFIIKQVTKTELDSFEDFAPEYFKYLTESITSGSPTCLAKILGIYQVTVKHLKG  1565

Query  1883  GKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIF  2059
             G+E +MD++VMENLF+ R+ISRVYDLKGS+RSRYN DT   N+VLLDLN LE+L+TKPIF
Sbjct  1566  GREVRMDIMVMENLFFRRNISRVYDLKGSLRSRYNPDTSGNNRVLLDLNLLETLRTKPIF  1625

Query  2060  LGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLET  2239
             LGSKAKR LERAVWNDT FLA V VMDYSLLVG+DE+RKELV+GIID+MRQYTWDKHLET
Sbjct  1626  LGSKAKRRLERAVWNDTFFLASVDVMDYSLLVGIDEDRKELVIGIIDFMRQYTWDKHLET  1685

Query  2240  W  2242
             W
Sbjct  1686  W  1686



>ref|XP_008800770.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X2 [Phoenix dactylifera]
Length=1769

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/781 (48%), Positives = 499/781 (64%), Gaps = 46/781 (6%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LPPS L+F  Q +Q    KE A++    + L+ 
Sbjct  958   RDCLRFYGFGSMVAFFRYSPVDILSVNLPPSTLDFACQIQQELARKEGAKICNMVELLHG  1017

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   +Q +E    ++     +   +H  I ELK++L  E+N +  L Q    E  +   
Sbjct  1018  EVYDMLQGIERN-ITISEHEPSKESIHKHITELKNLLKVERNEYEVLLQAVKTENIQLFN  1076

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI-----FDNNFSSQHPENAVSCINPGEWG  526
              ++D+LELNRLR SLL + + WD +LY ++S+     +      + P+   S     EW 
Sbjct  1077  ASVDILELNRLRRSLLLNAYMWDRQLYLLDSLSKAESYPAKVDPKLPD-MFSLTKLKEWR  1135

Query  527   GETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEP----------------PVPKD  658
              E   KDG L ++ E+   +   S   P + + S+  E                  +  +
Sbjct  1136  AELFSKDGQLGNSSEKITTKPLASLGTPRKSMLSKQHEELSLQVLECNSSNMVEIDLSVE  1195

Query  659   ALSYQQGSSSTS-----CNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGI  823
             ++   +G +S +     CNG    E ++  E ++  S +E   S  S LSD+ID AWTG 
Sbjct  1196  SIEGYEGPASLNFFSGQCNGYD--ERKVVAEASIAASSVENLHSPSSNLSDQIDLAWTG-  1252

Query  824   DPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRL  1003
                    Q+     +G+ +  S G  S +D+   K++ SP RVYSFDSAL+ ++R+   L
Sbjct  1253  -----SGQLVKDPPKGDAKADSVGSPSLLDNSCYKKVMSPVRVYSFDSALKFRDRVYGGL  1307

Query  1004  PPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS  1183
              PS   L++ +S    GD+ +  +DP+ N++   SQ   R+ Q+LN L S +  + S AS
Sbjct  1308  SPSSLQLTSFRSADVAGDFVSTFKDPILNMRRAYSQRSRRDIQRLNTLLSQTPIYISSAS  1367

Query  1184  -ILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT---DKPYMSEGGWG  1351
              ++ +GA L++ + G  D+V+AVYD+EPTSIISYAL+S+EY D++T   D+    +G   
Sbjct  1368  HMVSDGAHLLLSQTGLSDIVVAVYDDEPTSIISYALTSQEYADFITSRLDQRKELKGKDK  1427

Query  1352  VSDTNKE---SPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRI  1522
             +S    +      A   +  +      L+ +    YGS++A      L SDPK S H RI
Sbjct  1428  ISSLRNQMSNHAAAMNFAGQESVAQYQLNDIQSWCYGSDEAQLSREKL-SDPKES-HFRI  1485

Query  1523  SFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYF  1702
              F DES     K K+SVTCYFA+QFDALRKKCCP+ELD+IRSLSRCKRW AQGGKSNVYF
Sbjct  1486  YFGDESSFPADKAKYSVTCYFARQFDALRKKCCPNELDYIRSLSRCKRWRAQGGKSNVYF  1545

Query  1703  AKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKG  1882
             AKSLD+RFIIKQ+ KTELDSFE+FAP+YF+YLT+S +SGSPTCLAK++GIYQV VKHLKG
Sbjct  1546  AKSLDDRFIIKQVTKTELDSFEDFAPEYFKYLTESITSGSPTCLAKILGIYQVTVKHLKG  1605

Query  1883  GKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIF  2059
             G+E +MD++VMENLF+ R+ISRVYDLKGS+RSRYN DT   N+VLLDLN LE+L+TKPIF
Sbjct  1606  GREVRMDIMVMENLFFRRNISRVYDLKGSLRSRYNPDTSGNNRVLLDLNLLETLRTKPIF  1665

Query  2060  LGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLET  2239
             LGSKAKR LERAVWNDT FLA V VMDYSLLVG+DE+RKELV+GIID+MRQYTWDKHLET
Sbjct  1666  LGSKAKRRLERAVWNDTFFLASVDVMDYSLLVGIDEDRKELVIGIIDFMRQYTWDKHLET  1725

Query  2240  W  2242
             W
Sbjct  1726  W  1726



>ref|XP_008800769.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Phoenix dactylifera]
Length=1770

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/781 (48%), Positives = 499/781 (64%), Gaps = 46/781 (6%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LPPS L+F  Q +Q    KE A++    + L+ 
Sbjct  959   RDCLRFYGFGSMVAFFRYSPVDILSVNLPPSTLDFACQIQQELARKEGAKICNMVELLHG  1018

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   +Q +E    ++     +   +H  I ELK++L  E+N +  L Q    E  +   
Sbjct  1019  EVYDMLQGIERN-ITISEHEPSKESIHKHITELKNLLKVERNEYEVLLQAVKTENIQLFN  1077

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI-----FDNNFSSQHPENAVSCINPGEWG  526
              ++D+LELNRLR SLL + + WD +LY ++S+     +      + P+   S     EW 
Sbjct  1078  ASVDILELNRLRRSLLLNAYMWDRQLYLLDSLSKAESYPAKVDPKLPD-MFSLTKLKEWR  1136

Query  527   GETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEP----------------PVPKD  658
              E   KDG L ++ E+   +   S   P + + S+  E                  +  +
Sbjct  1137  AELFSKDGQLGNSSEKITTKPLASLGTPRKSMLSKQHEELSLQVLECNSSNMVEIDLSVE  1196

Query  659   ALSYQQGSSSTS-----CNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGI  823
             ++   +G +S +     CNG    E ++  E ++  S +E   S  S LSD+ID AWTG 
Sbjct  1197  SIEGYEGPASLNFFSGQCNGYD--ERKVVAEASIAASSVENLHSPSSNLSDQIDLAWTG-  1253

Query  824   DPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRL  1003
                    Q+     +G+ +  S G  S +D+   K++ SP RVYSFDSAL+ ++R+   L
Sbjct  1254  -----SGQLVKDPPKGDAKADSVGSPSLLDNSCYKKVMSPVRVYSFDSALKFRDRVYGGL  1308

Query  1004  PPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS  1183
              PS   L++ +S    GD+ +  +DP+ N++   SQ   R+ Q+LN L S +  + S AS
Sbjct  1309  SPSSLQLTSFRSADVAGDFVSTFKDPILNMRRAYSQRSRRDIQRLNTLLSQTPIYISSAS  1368

Query  1184  -ILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT---DKPYMSEGGWG  1351
              ++ +GA L++ + G  D+V+AVYD+EPTSIISYAL+S+EY D++T   D+    +G   
Sbjct  1369  HMVSDGAHLLLSQTGLSDIVVAVYDDEPTSIISYALTSQEYADFITSRLDQRKELKGKDK  1428

Query  1352  VSDTNKE---SPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRI  1522
             +S    +      A   +  +      L+ +    YGS++A      L SDPK S H RI
Sbjct  1429  ISSLRNQMSNHAAAMNFAGQESVAQYQLNDIQSWCYGSDEAQLSREKL-SDPKES-HFRI  1486

Query  1523  SFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYF  1702
              F DES     K K+SVTCYFA+QFDALRKKCCP+ELD+IRSLSRCKRW AQGGKSNVYF
Sbjct  1487  YFGDESSFPADKAKYSVTCYFARQFDALRKKCCPNELDYIRSLSRCKRWRAQGGKSNVYF  1546

Query  1703  AKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKG  1882
             AKSLD+RFIIKQ+ KTELDSFE+FAP+YF+YLT+S +SGSPTCLAK++GIYQV VKHLKG
Sbjct  1547  AKSLDDRFIIKQVTKTELDSFEDFAPEYFKYLTESITSGSPTCLAKILGIYQVTVKHLKG  1606

Query  1883  GKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIF  2059
             G+E +MD++VMENLF+ R+ISRVYDLKGS+RSRYN DT   N+VLLDLN LE+L+TKPIF
Sbjct  1607  GREVRMDIMVMENLFFRRNISRVYDLKGSLRSRYNPDTSGNNRVLLDLNLLETLRTKPIF  1666

Query  2060  LGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLET  2239
             LGSKAKR LERAVWNDT FLA V VMDYSLLVG+DE+RKELV+GIID+MRQYTWDKHLET
Sbjct  1667  LGSKAKRRLERAVWNDTFFLASVDVMDYSLLVGIDEDRKELVIGIIDFMRQYTWDKHLET  1726

Query  2240  W  2242
             W
Sbjct  1727  W  1727



>ref|XP_006659418.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C-like [Oryza brachyantha]
Length=1490

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/763 (46%), Positives = 473/763 (62%), Gaps = 57/763 (7%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSP+DILSV LPPSVL FN  S+Q W+ +   E+  K +SL++
Sbjct  725   RDCLRFYGYGNMVAFFRYSPVDILSVNLPPSVLGFNCHSQQDWMRRMAHEIYEKMESLHS  784

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   + + E    S   D     G+   I+E+KD+L  E+N +  L  P   + S   Q
Sbjct  785   EVYGFLHRNESTITSE--DEPVKTGVQRQIIEMKDLLKMERNGYEILLLPVITDNSHSVQ  842

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINP--GEW----  523
              +ID+LELNRLR  LL D + WD RL Y++S+   +    +P N  + ++    EW    
Sbjct  843   ISIDILELNRLRRCLLLDAYIWDQRLCYIDSLLKKDGHDSNPSNPDNFLDVRLKEWKTDL  902

Query  524   --GGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSC  697
               G   I K  +L  +         + E C    L+            + +   S   S 
Sbjct  903   LEGDTKIGKSTNLSQSSGSPRKSLLSREGC----LNDTEYRMGETNSQIDFVYHSIDDSE  958

Query  698   NGDKTLETRLG-LENAVNKS-----PLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHAS  859
             + DK      G  E ++ K+     P ER PS  SI+SDKID AWTG    S ++     
Sbjct  959   DLDKVFSRFNGEKEQSITKATTGMEPAERLPSLASIISDKIDLAWTG----SSELY---D  1011

Query  860   LQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKS  1039
               +   ++   G  S  D+ +C    +P R++SFDS L +++R    L P+  +LS+ +S
Sbjct  1012  FPQDCTKIDEHGSFSFPDNLSCGNAATPVRIHSFDSKLVLRQRERNGLAPTSLHLSSFRS  1071

Query  1040  FHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS-ILPEGARLMVP  1216
                +GD  ++++DP+ NI+  CSQ  P   +KLN++ + + T+ S  S ++ +GARL++P
Sbjct  1072  AEYFGDLSSIMKDPLPNIRRACSQRSPGAVEKLNVVLTRTLTYVSPTSHMIDDGARLLLP  1131

Query  1217  ENG-QKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKL  1393
             + G + D VIAVYD+EPTSI+SYA++S+EY   VT KP  S     + +T          
Sbjct  1132  QIGYEDDAVIAVYDDEPTSIVSYAMTSQEYVQQVTRKPNSSLSFLHLPNTID--------  1183

Query  1394  STWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSV  1573
             S+    G++     H  S G+                  H + SF+DES  +  K KFSV
Sbjct  1184  SSHGLDGAMLSQEDHLDSKGT------------------HFKFSFDDESPLSEDKAKFSV  1225

Query  1574  TCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTE  1753
              CYFAK F ALRKKCCP ++DFIRSLSRCKRW+AQGGKSNVYFAK+LDERFIIKQ+ +TE
Sbjct  1226  ICYFAKHFAALRKKCCPKDIDFIRSLSRCKRWNAQGGKSNVYFAKTLDERFIIKQVTRTE  1285

Query  1754  LDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYG  1933
             L+SF EFAP+YF YL +S +SGSPTCLAK+VG+YQV +K LKGG+E KMDL+VMENLF+ 
Sbjct  1286  LESFVEFAPQYFRYLMESLTSGSPTCLAKIVGLYQVNIKGLKGGREVKMDLMVMENLFFE  1345

Query  1934  RSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTS  2113
             R ISRVYDLKGS+RSRY S    +KVLLD N +E+L TKP+FLGSKAKR LERA+WNDTS
Sbjct  1346  RKISRVYDLKGSLRSRYTS--SESKVLLDSNLVETLHTKPLFLGSKAKRRLERAIWNDTS  1403

Query  2114  FLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             FLA   VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1404  FLATADVMDYSLLVGIDEEKKELVIGIIDYLRQYTWDKQLETW  1446



>ref|XP_008801166.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X2 [Phoenix dactylifera]
Length=1498

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/786 (48%), Positives = 506/786 (64%), Gaps = 58/786 (7%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             +DCLR+YG GSM+A FRYSP+DILSV LPPS L+F S+ +Q  + KE A++  K + L+A
Sbjct  688   KDCLRFYGFGSMVAFFRYSPVDILSVNLPPSTLDFTSRIQQELVRKEAAKISNKVEFLHA  747

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  +Q +E+K  +   +    + +   I  L+++L + KN +  L Q    E  +   
Sbjct  748   EVSKVLQGIEKKITNSEHEPLKAS-IPKHITVLRELLKRGKNEYEVLLQTVKIENIQLFN  806

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI-----FDNNFSSQHPENAVSCINPGEWG  526
              TID+LELNRLR +LL D + WD+ LY ++S+     +   F  + PE   S     +W 
Sbjct  807   ATIDILELNRLRRNLLLDAYLWDYLLYLLDSLSKAESYTAKFDPKLPE-IFSPTKLKDWR  865

Query  527   GETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGD  706
              E   KD  L  + E+N+ +       P + + S+  E    + +L   +G+SS     +
Sbjct  866   DELFSKDWQLRTSSEKNIAKTSTLLGTPRKSMLSKQQE----EISLQVLEGNSSNMVELN  921

Query  707   KTLETRLG-----------------------LENAVNKSPLERAPSAGSILSDKIDCAWT  817
              ++E+  G                        E +++   LE  PS  S LSD+ID AWT
Sbjct  922   LSIESTEGYVGPAGLNLASGHCRGYDERNVVAEASIDTLSLEDLPSPVSSLSDQIDLAWT  981

Query  818   GIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISK  997
             G      D        +      S G  S +DSP  K++ SP RVYSFDSAL+ ++R+  
Sbjct  982   GSGQLVMDPPKDGPEDD------SVGSSSLMDSPCYKKVMSPVRVYSFDSALKFRDRVHG  1035

Query  998   RLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSH  1177
              L PS  +L++ KSF A GD  +M R+P+ NI+   SQ  PR+ Q+ ++L   +  + S 
Sbjct  1036  GLSPS-LHLTSFKSFDASGDSVSMFRNPL-NIRRAYSQRSPRDIQRWDILLGRTPIYISS  1093

Query  1178  AS-ILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK---------P  1327
              S ++ +GARL++P+ G  D VIAVYD+EPTSIISYA++S+EY +++  K          
Sbjct  1094  VSHMVSDGARLLLPQTGLIDGVIAVYDDEPTSIISYAMTSREYAEFIASKLNQHVDLNGK  1153

Query  1328  YMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLS  1507
               + G W  +  + E+   +   +  ++ S D     +GS G++ +        SDPK S
Sbjct  1154  EQTSGMWNQTGCHAEAKNFAAQESVAQYQSNDTQSRCYGSDGTQLSQENP----SDPKES  1209

Query  1508  PHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGK  1687
              H RISF+DES     KVK+SVTCYF +QFDALRKKCCP+ELD+IRSLSRCK+WSAQGGK
Sbjct  1210  -HFRISFDDESSFPSDKVKYSVTCYFGRQFDALRKKCCPNELDYIRSLSRCKKWSAQGGK  1268

Query  1688  SNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAV  1867
             SNVYFAKSLDERFIIKQ+ KTELDSFE+FAP+YF+YLT+S +SGSPTCLAK++GIYQV V
Sbjct  1269  SNVYFAKSLDERFIIKQVTKTELDSFEDFAPEYFKYLTESITSGSPTCLAKILGIYQVTV  1328

Query  1868  KHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQ  2044
             KHLKGG+E KMDL+VMENLF+ R+ISRVYDLKGS+RSRYN D    N+VLLDLN LE+L+
Sbjct  1329  KHLKGGREIKMDLMVMENLFFRRNISRVYDLKGSLRSRYNPDASGDNRVLLDLNLLETLR  1388

Query  2045  TKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWD  2224
             TKPIFLGSKAKRSLERAVWNDTSFLA   VMDYSLLVG+DE+RKELV+GIID+MRQYTWD
Sbjct  1389  TKPIFLGSKAKRSLERAVWNDTSFLASGDVMDYSLLVGIDEDRKELVIGIIDFMRQYTWD  1448

Query  2225  KHLETW  2242
             K LETW
Sbjct  1449  KQLETW  1454



>gb|EMS47098.1| 1-phosphatidylinositol-3-phosphate 5-kinase fab1 [Triticum urartu]
Length=1574

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/773 (46%), Positives = 468/773 (61%), Gaps = 78/773 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSP+DILSV LPPSVL FN  S Q W      E+  K KSL+ 
Sbjct  810   RDCLRFYGYGNMVAFFRYSPVDILSVTLPPSVLCFNCHSSQDWTKTVAVEIYGKMKSLHW  869

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + + E+   S   D     G+H  I+E+KD+L  E+N    L  P   +++   Q
Sbjct  870   EISDFLHRTEKNIPSE--DDPVKTGIHRQIIEMKDLLKMERNECEILLLPVIRDSNHHVQ  927

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSC---INPGEWGGE  532
              +ID+LELNRLR  L+ D + WD RL +++S+ + N S      A      I   EW  +
Sbjct  928   ASIDILELNRLRRGLILDAYLWDRRLCHIDSLIETNGSVSKNNPATEFLLDIRLKEWKTD  987

Query  533   TIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEH-----DEPPVPKDALSY----QQGSS  685
              +  D ++       + + P S   P + L S       DE  +    L        G  
Sbjct  988   LLEADTNI--GKPTCLLQSPGS---PRKSLLSREVCFSDDEYSISGKKLQIDLVDHPGDD  1042

Query  686   S-------TSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDM  844
             +       +  NG+K   +      A+   P+ER PS  SI SD ID AWTG    S ++
Sbjct  1043  TEDLDKVFSKFNGEKEWPS---TRAAIGMEPVERLPSLASIFSDNIDLAWTG----SSEL  1095

Query  845   QVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYL  1024
             Q    L +   ++   G L  +D+P  K   +P R++SFDS +  ++R    L P+  +L
Sbjct  1096  QY--DLPQDFTKIDENGSLKLLDNPVYK--NAPIRIHSFDSTVASRQRERTGLAPTSLHL  1151

Query  1025  STLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS-ILPEGA  1201
             S+ +S   +G   ++ +DP+ NI+  CSQ  P   +KLN++ + S T  S AS ++ +GA
Sbjct  1152  SSFRSAEYFGGLTSITKDPMPNIRRACSQRSPGAIEKLNVILTRSPTHISSASHMVDDGA  1211

Query  1202  RLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPI  1381
             RL++P+ G +DVV+AVYD+EPTSI++YA++S EY   VT K          + +    P 
Sbjct  1212  RLLLPQIGNEDVVVAVYDDEPTSIVAYAMTSNEYVQKVTRK-------LNSTSSFSHLPN  1264

Query  1382  ASKL------STWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESC  1543
             A++L      S   +  +LD +  HF                         + SF+DE+ 
Sbjct  1265  ATELNHGLEQSLPSQENNLDSEGTHF-------------------------KFSFDDETP  1299

Query  1544  NTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDER  1723
                   KFSV CYFAK F ALR KCCP ++D+IRSLSRCKRWSAQGGKSNVYFA++LDER
Sbjct  1300  LPADNAKFSVICYFAKHFAALRDKCCPKDIDYIRSLSRCKRWSAQGGKSNVYFARTLDER  1359

Query  1724  FIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMD  1903
             FIIKQ+ KTELDSF EFAP+YF+YL +S +SGSPTCLAK+VG+YQV VK LK G+E KMD
Sbjct  1360  FIIKQVTKTELDSFVEFAPQYFKYLMESLASGSPTCLAKIVGLYQVNVKGLKTGREVKMD  1419

Query  1904  LIVMENLFYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRS  2083
             L+VMENLF+ + I RVYDLKGS+RSRY S    +KVLLD N +E+L TKPIFLGS+AKR 
Sbjct  1420  LMVMENLFFEKKIPRVYDLKGSLRSRYTSGD--SKVLLDSNLIEALHTKPIFLGSRAKRR  1477

Query  2084  LERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LERAVWNDTSFLA   VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1478  LERAVWNDTSFLASADVMDYSLLVGIDEEKKELVIGIIDYLRQYTWDKQLETW  1530



>ref|XP_004956770.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C-like [Setaria italica]
Length=1634

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/764 (44%), Positives = 467/764 (61%), Gaps = 57/764 (7%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A F+YSP+  LSV LPP VL+F+  + Q W+ +E  E+  K +SL+ 
Sbjct  867   RDCLRFYGYGNMVAAFQYSPMVTLSVNLPPPVLDFSFHATQEWVKREAVEVFGKMESLHK  926

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   +  +E+    +  D +    +   I+E+KD+L  E+N +  L  P    ++   +
Sbjct  927   EVYDLLHNIEKSI--ITEDDSVKTSMQRQIMEMKDLLNIERNEYEALLLPVIRGSAHSVK  984

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFD-------NNFSSQHPENAVSCINPGE  520
             + ID+LELNR+R  L  D H WD RL  ++S+ +       ++F+ + P+       P E
Sbjct  985   SKIDILELNRIRRGLFLDAHTWDCRLCGIDSLREGGDVSRTDSFNQEKPQGTNEA-RP-E  1042

Query  521   WGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCN  700
                      G+ +          P       EG   +H    V KD         +    
Sbjct  1043  LHQAITRLGGTWQEPCPRRSTGSPRKSLLSTEGHSKDHQSAMVEKDLQIGLMDGVAGDAG  1102

Query  701   GDKTLETRLGL-------ENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHAS  859
             G   + ++  +       E+ +   P+ER PS  SIL+DKID AW+G        ++H +
Sbjct  1103  GLDLVFSKFNIYEGHHVSEDPIKTDPVERLPSLASILADKIDMAWSG------SGELHYN  1156

Query  860   LQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKS  1039
             L     +       S +++P+CK+  +P R++SFD+ LR+ +R    L P+ S  S LK 
Sbjct  1157  LPHDLTKADENRSFSLLNNPSCKKATAPVRIHSFDAVLRLHQREQTGLVPA-SLHSALKP  1215

Query  1040  FHAYGDYRNMIRDPVSNIQMICSQALPREAQKLN-LLPSSSTTFTSHASILPEGARLMVP  1216
               ++ D  ++++DP++N++   SQ  PR    LN +L  +    TS + ++  GARL++P
Sbjct  1216  ADSFRDLTSLVKDPMTNMRRAFSQISPRTRGNLNSVLTRAPKYITSASDMVKNGARLLLP  1275

Query  1217  E-NGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKL  1393
               + +  VVI VYD++PTS++SYA++S+EY + VT K   S                   
Sbjct  1276  NISCEGSVVITVYDDDPTSVVSYAMTSQEYVEHVTHKMNAS-------------------  1316

Query  1394  STWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSV  1573
             S++  F     + +   S   ED S   G          H R +F+D+  ++    KFSV
Sbjct  1317  SSFSDFTKASSNRLDGSSSLHEDLSDLKG---------THFRFNFDDD-VSSADSTKFSV  1366

Query  1574  TCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTE  1753
             TCYFA+QFDALRKKCCPS++D+IRSLSRCKRWSAQGGKSNVYFAK++DERFIIKQ+ KTE
Sbjct  1367  TCYFARQFDALRKKCCPSDIDYIRSLSRCKRWSAQGGKSNVYFAKTMDERFIIKQVTKTE  1426

Query  1754  LDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYG  1933
             LDSF EFAP YF +LT+S SS SPTCLAK++G+YQV +K LKGG+E KMDL+VMEN+F+ 
Sbjct  1427  LDSFVEFAPHYFRHLTESLSSRSPTCLAKIMGLYQVGIKSLKGGREVKMDLMVMENIFFQ  1486

Query  1934  RSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDT  2110
             R+ISRVYDLKGSVRSRYNSDT   NKVLLD N +E+L TKP+FLGSKAKR LERAVWNDT
Sbjct  1487  RTISRVYDLKGSVRSRYNSDTSGHNKVLLDSNLIEALHTKPMFLGSKAKRRLERAVWNDT  1546

Query  2111  SFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             SFLA + VMDYSLLVG+DEE+ ELV+GIID++RQYTWDK LETW
Sbjct  1547  SFLASLDVMDYSLLVGIDEEKSELVVGIIDFLRQYTWDKQLETW  1590



>gb|EMT17188.1| 1-phosphatidylinositol-3-phosphate 5-kinase fab1 [Aegilops tauschii]
Length=1629

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/773 (46%), Positives = 471/773 (61%), Gaps = 78/773 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSP+DILSV LPPSVL FN +S Q W      E+  K KSL+ 
Sbjct  865   RDCLRFYGYGNMVAFFRYSPVDILSVTLPPSVLCFNCRSPQDWTKTVAVEIYGKMKSLHW  924

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EIS  + + E+   S   D     G+H  I+E+KD+L  E+N    L  P   +++   Q
Sbjct  925   EISDFLHRTEKNIPSE--DDPVKTGIHRQIIEMKDLLKMERNECEILLLPVIRDSNHHVQ  982

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNN--FSSQHPENAVSC-INPGEWGGE  532
              +ID+LELNRLR  L+ D + WD RL +++S+ + N   S  +P       I   EW  +
Sbjct  983   ASIDILELNRLRRGLILDAYLWDRRLCHIDSLIETNGCVSKNNPATEFLLDIRLKEWKTD  1042

Query  533   TIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEH-----DEPPVPKDALSY----QQGSS  685
              +  D ++       + + P S   P + L S       DE  +    L        G  
Sbjct  1043  LLEADTNI--GKPTCLLQSPGS---PRKSLLSREVCFSDDEYSMSGKKLQIDLVDHPGDD  1097

Query  686   S-------TSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDM  844
             +       +  NG+K   +      A+   P+ER PS  SI SD ID AWTG    S ++
Sbjct  1098  TEDLDKVFSKFNGEKEWPS---TRAAIGMEPVERLPSLASIFSDNIDLAWTG----SSEL  1150

Query  845   QVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYL  1024
             Q    L +   ++   G L+ +D+P  K   +P R++SFDS +  ++R    L P+  +L
Sbjct  1151  QY--DLPQDFTKIDENGSLNLLDNPGYK--NAPVRIHSFDSTVASRQRERTGLAPTSLHL  1206

Query  1025  STLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS-ILPEGA  1201
             S+ +S   +G   ++ +DP+ NI+  CSQ  P   +KLN++ + S T  S AS ++ +GA
Sbjct  1207  SSFRSAEYFGGLTSITKDPMPNIRRACSQRSPGAIEKLNVILTRSPTHISSASHMVDDGA  1266

Query  1202  RLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPI  1381
             RL++P+ G +DVV+AVYD+EPTSI++YA++S EY   VT K          + +    P 
Sbjct  1267  RLLLPQIGNEDVVVAVYDDEPTSIVAYAMTSNEYVQKVTRK-------LNSTSSFSHLPN  1319

Query  1382  ASKL------STWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESC  1543
             A++L      S   +  +LD +  HF                         + SF+DE+ 
Sbjct  1320  ATELNHGLEQSLPSQENNLDSEGTHF-------------------------KFSFDDETP  1354

Query  1544  NTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDER  1723
                   KFSV CYFAK F ALR KCCP ++D+IRSLSRCKRWSAQGGKSNVYFA++LDER
Sbjct  1355  LPADNAKFSVICYFAKHFAALRDKCCPKDIDYIRSLSRCKRWSAQGGKSNVYFARTLDER  1414

Query  1724  FIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMD  1903
             FIIKQ+ KTELDSF EFAP+YF+YL +S +SGSPTCLAK+VG+YQV VK LK G+E KMD
Sbjct  1415  FIIKQVTKTELDSFVEFAPQYFKYLMESLASGSPTCLAKIVGLYQVNVKGLKTGREVKMD  1474

Query  1904  LIVMENLFYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRS  2083
             L+VMENLF+ + I RVYDLKGS+RSRY S    +KVLLD N +E+L TKPIFLGS+AKR 
Sbjct  1475  LMVMENLFFEKKIPRVYDLKGSLRSRYTSGD--SKVLLDSNLIEALHTKPIFLGSRAKRR  1532

Query  2084  LERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LERAVWNDTSFLA   VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1533  LERAVWNDTSFLASADVMDYSLLVGIDEEKKELVIGIIDYLRQYTWDKQLETW  1585



>tpg|DAA49040.1| TPA: putative 1-phosphatidylinositol-4-phosphate 5-kinase/ zinc 
ion binding family [Zea mays]
Length=1144

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/764 (47%), Positives = 472/764 (62%), Gaps = 62/764 (8%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSP+DILSV LPP VL+FN  S Q W+ +   E+  K +SL+ 
Sbjct  382   RDCLRFYGYGNMVAFFRYSPVDILSVNLPPPVLDFNCCSTQEWLKRVAVEIFGKMESLHV  441

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  +   E+    V  D      +   I+E+KD L  ++N +  L  P   E++   Q
Sbjct  442   EVSEFLHCTEKNI--VTEDEPVRECVQRQIIEMKDWLKMQRNEYEMLLLPVMRESNHPMQ  499

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDN--NFSSQHPEN--AVSCINPGEWGG  529
             T+ID+LELNRLR  LL D + WD RL +++S+ +   + S  +P+N   + C    EW  
Sbjct  500   TSIDILELNRLRRGLLLDAYIWDRRLCHIDSVLNTHGHISKTNPDNLDILLCTRLKEWKA  559

Query  530   ETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHD---------EPPVPKDALSYQQGS  682
             + +  D  +E +         + E    +  +S  D          P    D L      
Sbjct  560   DLLCGDTEIEKSLGSPKKSLLSREGHLNDNEYSVADTNLEICLEGHPVDDADDLDKVYNK  619

Query  683   SSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDM-QVHAS  859
              S       T E   GLE      P+ER PS  SI SD ID AWTG      D+ Q    
Sbjct  620   FS-GVKKRPTAEPTDGLE------PVERLPSLASIFSDTIDLAWTGSCDLQHDLPQAFTK  672

Query  860   LQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKS  1039
             + E      SF    ++DSP    L +P R++SF S L +++R    L P+  +LS+ KS
Sbjct  673   IDEN----VSF----NLDSPKYSNLVTPVRIHSFSSTLGLRQRERTGLVPASLHLSSFKS  724

Query  1040  FHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS-ILPEGARLMVP  1216
                +G  R++++DP+ N++  CSQ  P   +KLN++ +   T+ S  S I+ +GARL++P
Sbjct  725   AEYFGAMRSILKDPMPNMRRSCSQRSPGTIEKLNVVLARKPTYISSTSNIINDGARLLLP  784

Query  1217  ENG-QKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKL  1393
             + G + DVV+AVY++EPTSIISYA++S+EY + VT +   S       +TN  S      
Sbjct  785   QTGYEHDVVVAVYEDEPTSIISYAMTSEEYVEQVTHRLNSSLSFSHQPNTNGIS------  838

Query  1394  STWQRFGSLDLDYMHFGSYGSEDASGRIG-FLFSDPKLSPHPRISFEDESCNTGGKVKFS  1570
                              S+G E +S   G  L S      H ++SF+D+S  +  K KFS
Sbjct  839   -----------------SHGLEASSPSQGDHLHSK---GTHFKLSFDDDSPISPDKTKFS  878

Query  1571  VTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKT  1750
             V CYFAK F ALRKKCCP ++D+IRSLSRCKRW+AQGGKSNVYFAK+LDERFIIKQ+ +T
Sbjct  879   VICYFAKHFAALRKKCCPKDIDYIRSLSRCKRWNAQGGKSNVYFAKTLDERFIIKQVTRT  938

Query  1751  ELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFY  1930
             EL+SF EFAP+YF+YL +S +SGSPTCLAK+VG+YQV VK LK GKE +MDL+VMEN+F+
Sbjct  939   ELESFVEFAPQYFKYLMESLASGSPTCLAKIVGLYQVGVKSLKTGKEVRMDLMVMENVFF  998

Query  1931  GRSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDT  2110
              R ISRVYDLKGS+RSRY +    +KVLLD N +E+L TKPIFLGSKAKR LERAVWNDT
Sbjct  999   ERKISRVYDLKGSLRSRYTAGD--SKVLLDANLIEALHTKPIFLGSKAKRRLERAVWNDT  1056

Query  2111  SFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             SFLA   VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1057  SFLALADVMDYSLLVGIDEEKKELVIGIIDYLRQYTWDKQLETW  1100



>ref|XP_010235142.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Brachypodium distachyon]
Length=1595

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/775 (45%), Positives = 478/775 (62%), Gaps = 83/775 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG  +M+A FRYSP+DILSV LPPS+L FN +++Q W      E+  K KSL+ 
Sbjct  832   RDCLRFYGYANMVAFFRYSPVDILSVNLPPSLLCFNYRNQQDWTKTVAVEIFGKMKSLHW  891

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  + + E+    +  D     G+   I+ELKD+L  E+N +  L  P   +++   Q
Sbjct  892   EVSDFLHRTEKSI--LIEDEPIKTGIQRQIIELKDLLNMERNEYEILLLPVISDSNHYMQ  949

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              +ID+LELNRLR  L+ D + WD RL Y++S+ + N         VS  NP E     I 
Sbjct  950   ASIDILELNRLRRGLILDAYLWDRRLCYIDSLLETN-------GHVSKTNPSE-----IL  997

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDAL----------SYQQGSSST  691
              D  L+    +++    N+ + P   LHS    P  P+ +L           Y       
Sbjct  998   LDIRLKERKADSLQVDTNTGK-PTGLLHS----PGSPRKSLLSREVCLNDNEYNMAEEKL  1052

Query  692   --------SC---NGDKTL------ETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTG  820
                     +C   + DK        + +L  + A+   P+ER PS  SI SDKID AWTG
Sbjct  1053  QIDLVDHPACEIEDIDKVFSRFNEEKEQLTTKAAIGMEPIERLPSLASIFSDKIDFAWTG  1112

Query  821   IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKR  1000
                 S ++Q    L EG  ++      S +D+ + +   +P R++SFDS LR ++R    
Sbjct  1113  ----SSELQY--DLPEGFTKLDENRSFSLLDNSSYR--NAPVRIHSFDSTLRSRQRERTG  1164

Query  1001  LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHA  1180
             L P+  +L + +S   +G   ++ +DP+ NI+  CSQ  P   +KLN++ + + T  S A
Sbjct  1165  LAPTSLHLPSSRSAEYFGGSTSISKDPMQNIRRACSQRSPGAIEKLNVIFTRAPTHISSA  1224

Query  1181  S-ILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVS  1357
             S ++ +GARL++P  G +D V+AVYD+EPTSI++YA++S+EY   V+ K          +
Sbjct  1225  SHMVDDGARLLLPPIGSEDAVVAVYDDEPTSIVAYAMTSQEYVQQVSRK-------LNST  1277

Query  1358  DTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDE  1537
              +    P A++ S               G++ S++ +        D K   H + SF+D+
Sbjct  1278  SSFSHVPNATEASHGLE-----------GAFPSQEDN-------LDSK-GTHFKFSFDDD  1318

Query  1538  SCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLD  1717
             +  +  K KFSV CYFAK F  LRKKCCP ++D+IRSLSRCKRWSAQGGKSNVYFA++LD
Sbjct  1319  TPLSPDKAKFSVICYFAKHFAMLRKKCCPKDIDYIRSLSRCKRWSAQGGKSNVYFARTLD  1378

Query  1718  ERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETK  1897
             ERFIIKQ+ KTELDSF EFAP+YF+YL +S +SGSPTCLAK++G+YQV+VK LKGG+E K
Sbjct  1379  ERFIIKQVTKTELDSFVEFAPQYFKYLMESLTSGSPTCLAKIIGLYQVSVKGLKGGREVK  1438

Query  1898  MDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAK  2077
             MDL+VMENLF+ R I RVYDLKGS+RSRY S    +KVLLD N +E+L TKPIFLGS AK
Sbjct  1439  MDLMVMENLFFERKIPRVYDLKGSLRSRYTSGD--SKVLLDSNLIEALHTKPIFLGSHAK  1496

Query  2078  RSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             R LERAVWNDTSFLA   VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1497  RRLERAVWNDTSFLASADVMDYSLLVGIDEEKKELVIGIIDYLRQYTWDKQLETW  1551



>dbj|BAJ90327.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=855

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/780 (43%), Positives = 463/780 (59%), Gaps = 87/780 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A F YSP+   SV LPP  L FN    Q W+  E   +  + +SL+ 
Sbjct  86    RDCLRFYGYGNMVAAFHYSPMVTRSVNLPPLELNFNCHGMQDWVKGETLMVFDEMESLHM  145

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   +  +E    ++  D     G+   I+E+KD+L +E+N +  L  P  + +    +
Sbjct  146   EVYGFLNSIERSIITL--DEPVKTGIRKQIVEMKDLLNRERNEYEGLLLPVIKGSVHSMK  203

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             +TID LELNR+R  LL D + WD RL  ++S+  N     H   A S  NP      +I 
Sbjct  204   STIDTLELNRVRRGLLLDAYVWDCRLCNIDSLKANG----HIARADSS-NPENLQATSIK  258

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             +D S      E +       E               P+ +L  ++ S     NG+  +ET
Sbjct  259   EDKS------ELLTTVTQHGETHVGSTTYRRCSSGSPRRSLLSREASMD---NGNILVET  309

Query  722   RLGLE-----------------------------NAVNKSPLERAPSAGSILSDKIDCAW  814
              L +E                             N++   P+ER PS  SILSDKID  W
Sbjct  310   NLPIELVDGVSGAGDLDVVFSKFSVCENGQRLPMNSIETVPVERLPSLASILSDKIDMLW  369

Query  815   TGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERIS  994
             +G        + H SL +   +    G  S + +P+ K+  SP RV+SFDS  R+ ER  
Sbjct  370   SG------STEAHCSLPQDLIKADGKGSFSLLGNPSYKKAISPVRVHSFDSIFRLHEREQ  423

Query  995   KRLPPSPSYLS-TLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTF-  1168
               L P+  +LS  ++S  ++ D  ++++DP++N++   SQ  PR    LN++ + + T+ 
Sbjct  424   SGLLPASLHLSLKMRSVDSFRDLTSLVKDPMTNMRRAFSQISPRSRGNLNVILTRAPTYL  483

Query  1169  TSHASILPEGARLMVPENGQKD-VVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGG  1345
              S + ++ +GARL++P  G +  +V+AVYD+EPTSI+SYA++S+EY + VT K       
Sbjct  484   KSPSHMVSDGARLLLPHIGSEGAIVVAVYDDEPTSIVSYAMTSQEYVEHVTHK-------  536

Query  1346  WGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRIS  1525
                        + SK S           + H  +  +   +G    L S      H + S
Sbjct  537   -----------LDSKSS-----------FQHMSNCSAVSNNGPEKALPSQE--GAHFKYS  572

Query  1526  FEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFA  1705
             F+DE+       KFSVTCYFA+QF +LRKKCCPS++D+IRSLSRCKRWSA GGKSNVYFA
Sbjct  573   FDDEAF-CADNTKFSVTCYFARQFASLRKKCCPSDVDYIRSLSRCKRWSADGGKSNVYFA  631

Query  1706  KSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGG  1885
             K++DERFIIKQ+ KTELDSF  FAP YF +LT S +SGSPTCLAK++GIYQV +K LKGG
Sbjct  632   KTMDERFIIKQVTKTELDSFVGFAPHYFRHLTQSLTSGSPTCLAKILGIYQVNIKGLKGG  691

Query  1886  KETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKAN-KVLLDLNFLESLQTKPIFL  2062
             +E KMDL+VMEN+F+ ++ISRVYDLKGSVRSRYNSDT ++ KVLLD N +E L TKPIFL
Sbjct  692   REVKMDLMVMENIFFQKTISRVYDLKGSVRSRYNSDTTSHKKVLLDSNLIEELHTKPIFL  751

Query  2063  GSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             G KAKR+LERAVWNDTS LA + VMDYSLLVG+D+E+ ELV+GIID++RQYTWDK LETW
Sbjct  752   GHKAKRTLERAVWNDTSVLASLDVMDYSLLVGIDDEKNELVIGIIDFLRQYTWDKQLETW  811



>ref|XP_008801162.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Phoenix dactylifera]
 ref|XP_008801163.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Phoenix dactylifera]
 ref|XP_008801165.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C isoform X1 [Phoenix dactylifera]
Length=1778

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/786 (48%), Positives = 506/786 (64%), Gaps = 58/786 (7%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             +DCLR+YG GSM+A FRYSP+DILSV LPPS L+F S+ +Q  + KE A++  K + L+A
Sbjct  968   KDCLRFYGFGSMVAFFRYSPVDILSVNLPPSTLDFTSRIQQELVRKEAAKISNKVEFLHA  1027

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  +Q +E+K  +   +    + +   I  L+++L + KN +  L Q    E  +   
Sbjct  1028  EVSKVLQGIEKKITNSEHEPLKAS-IPKHITVLRELLKRGKNEYEVLLQTVKIENIQLFN  1086

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI-----FDNNFSSQHPENAVSCINPGEWG  526
              TID+LELNRLR +LL D + WD+ LY ++S+     +   F  + PE   S     +W 
Sbjct  1087  ATIDILELNRLRRNLLLDAYLWDYLLYLLDSLSKAESYTAKFDPKLPE-IFSPTKLKDWR  1145

Query  527   GETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGD  706
              E   KD  L  + E+N+ +       P + + S+  E    + +L   +G+SS     +
Sbjct  1146  DELFSKDWQLRTSSEKNIAKTSTLLGTPRKSMLSKQQE----EISLQVLEGNSSNMVELN  1201

Query  707   KTLETRLGL-----------------------ENAVNKSPLERAPSAGSILSDKIDCAWT  817
              ++E+  G                        E +++   LE  PS  S LSD+ID AWT
Sbjct  1202  LSIESTEGYVGPAGLNLASGHCRGYDERNVVAEASIDTLSLEDLPSPVSSLSDQIDLAWT  1261

Query  818   GIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISK  997
             G      D        +      S G  S +DSP  K++ SP RVYSFDSAL+ ++R+  
Sbjct  1262  GSGQLVMDPPKDGPEDD------SVGSSSLMDSPCYKKVMSPVRVYSFDSALKFRDRVHG  1315

Query  998   RLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSH  1177
              L PS  +L++ KSF A GD  +M R+P+ NI+   SQ  PR+ Q+ ++L   +  + S 
Sbjct  1316  GLSPS-LHLTSFKSFDASGDSVSMFRNPL-NIRRAYSQRSPRDIQRWDILLGRTPIYISS  1373

Query  1178  AS-ILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK---------P  1327
              S ++ +GARL++P+ G  D VIAVYD+EPTSIISYA++S+EY +++  K          
Sbjct  1374  VSHMVSDGARLLLPQTGLIDGVIAVYDDEPTSIISYAMTSREYAEFIASKLNQHVDLNGK  1433

Query  1328  YMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLS  1507
               + G W  +  + E+   +   +  ++ S D     +GS G++ +        SDPK S
Sbjct  1434  EQTSGMWNQTGCHAEAKNFAAQESVAQYQSNDTQSRCYGSDGTQLSQENP----SDPKES  1489

Query  1508  PHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGK  1687
              H RISF+DES     KVK+SVTCYF +QFDALRKKCCP+ELD+IRSLSRCK+WSAQGGK
Sbjct  1490  -HFRISFDDESSFPSDKVKYSVTCYFGRQFDALRKKCCPNELDYIRSLSRCKKWSAQGGK  1548

Query  1688  SNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAV  1867
             SNVYFAKSLDERFIIKQ+ KTELDSFE+FAP+YF+YLT+S +SGSPTCLAK++GIYQV V
Sbjct  1549  SNVYFAKSLDERFIIKQVTKTELDSFEDFAPEYFKYLTESITSGSPTCLAKILGIYQVTV  1608

Query  1868  KHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQ  2044
             KHLKGG+E KMDL+VMENLF+ R+ISRVYDLKGS+RSRYN D    N+VLLDLN LE+L+
Sbjct  1609  KHLKGGREIKMDLMVMENLFFRRNISRVYDLKGSLRSRYNPDASGDNRVLLDLNLLETLR  1668

Query  2045  TKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWD  2224
             TKPIFLGSKAKRSLERAVWNDTSFLA   VMDYSLLVG+DE+RKELV+GIID+MRQYTWD
Sbjct  1669  TKPIFLGSKAKRSLERAVWNDTSFLASGDVMDYSLLVGIDEDRKELVIGIIDFMRQYTWD  1728

Query  2225  KHLETW  2242
             K LETW
Sbjct  1729  KQLETW  1734



>ref|XP_002462355.1| hypothetical protein SORBIDRAFT_02g024300 [Sorghum bicolor]
 gb|EER98876.1| hypothetical protein SORBIDRAFT_02g024300 [Sorghum bicolor]
Length=1625

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/762 (45%), Positives = 464/762 (61%), Gaps = 55/762 (7%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A F Y P+  LSV LPP VL+ NS + Q W+ +E  E+    + L+ 
Sbjct  860   RDCLRFYGYGNMVAAFHYGPMITLSVDLPPPVLDLNSHATQDWVKREAVEVFHTMELLHT  919

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   +  LE+    +  D +    +   I+E+KD+L  E+N +  L  P    ++   +
Sbjct  920   EVYDVLHNLEKSI--ITDDDSTKTSIQRQIVEMKDLLNVERNEYEALLLPVIMGSAHSFK  977

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDN-NFSSQHPEN--AVSCINPGEWGGE  532
             + ID+LELNR+R SLL D H WD RL  ++S+  N + S   P N      IN G     
Sbjct  978   SNIDILELNRIRRSLLLDAHTWDCRLCDIDSLEANGHISRTDPFNQEKTQGINEGRSDSL  1037

Query  533   TIFKD--GSLEHAYEENVHEFPNSEECPGEG-------LHSEHDEPPVPKDALSYQQGSS  685
              I +   G+ E    ++  E P       EG       +  E D P    D +S   G  
Sbjct  1038  QIVRKHGGTYEEPCPQHSSESPRKSLLSTEGHVNDKQSVMVETDLPVGLVDGVSGGAGGL  1097

Query  686   STSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQ  865
                 N   T E R   +      P+ER PS  SIL+DKID AW+G      ++  H   +
Sbjct  1098  DLIFNKFDTCEGRCLSKYPSKTEPVERLPSLASILADKIDMAWSGFGELDCNLP-HDLTK  1156

Query  866   EGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFH  1045
               E R      L+ + +P+ ++  +P R++SFD+ +R+ +R    + P+ S  S LKS  
Sbjct  1157  ANENR-----SLNLLANPSYEKATAPVRIHSFDTVMRLHQREQTGVIPA-SLHSALKSVD  1210

Query  1046  AYGDYRNMIRDPVSNIQMICSQALPREAQKLN-LLPSSSTTFTSHASILPEGARLMVPE-  1219
             ++ D  ++++DP++N++   SQ  PR    LN +L  +    TS + ++ +GARL++P  
Sbjct  1211  SFRDLTSLVKDPMTNMRRAFSQISPRTRGNLNTVLIRAPKYITSASHMVNDGARLLLPNI  1270

Query  1220  NGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLST  1399
             +    V + VYD+EPTS +SYA++S+EY D VT K  ++      + +N           
Sbjct  1271  SCGGSVFVTVYDDEPTSAVSYAMTSQEYADHVTHKMNINTSFSDFTSSNG----------  1320

Query  1400  WQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTC  1579
                        +H      ED S   G          H R+SF+D++  T    KFSVTC
Sbjct  1321  -----------LHRSLSSHEDLSNSKG---------THFRLSFDDDASPTDS-TKFSVTC  1359

Query  1580  YFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELD  1759
             YFAKQF ALRKKCCPS++D+IRS+SRCKRWSAQGGKSNVYFAK++DERFIIKQ+ KTELD
Sbjct  1360  YFAKQFAALRKKCCPSDIDYIRSISRCKRWSAQGGKSNVYFAKTMDERFIIKQVTKTELD  1419

Query  1760  SFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRS  1939
             SF +FAP YF +LT+S +S SPTCLAK+VG+YQV++K+ KGG+E KMDL+VMEN+F+ RS
Sbjct  1420  SFVDFAPHYFRHLTESLTSRSPTCLAKIVGLYQVSIKNSKGGREVKMDLMVMENIFFQRS  1479

Query  1940  ISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSF  2116
             ISRVYDLKGS RSRYNSD    NKVLLD N +E+L TKP+FLGSKAK+ LERAVWNDTSF
Sbjct  1480  ISRVYDLKGSGRSRYNSDASGHNKVLLDSNLIEALHTKPMFLGSKAKQRLERAVWNDTSF  1539

Query  2117  LAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LA + VMDYSLLVGVDEE+KELV+GIID++RQYTWDK LETW
Sbjct  1540  LASLDVMDYSLLVGVDEEKKELVVGIIDFLRQYTWDKQLETW  1581



>ref|XP_004973485.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C-like [Setaria italica]
Length=1630

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/766 (46%), Positives = 473/766 (62%), Gaps = 66/766 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSP+DILSV LPPSVL+FN  S Q W+ +   E+  K +SL+ 
Sbjct  868   RDCLRFYGYGNMVAFFRYSPVDILSVNLPPSVLDFNCHSPQEWLKRVAIEIFGKMESLHV  927

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  + + E+   +   D     G+   I+E+KD L  E+N +  L  P   E+S   Q
Sbjct  928   EVSEFLHRTEKNIETE--DEPVKEGVQRQIIEMKDFLKMERNEYEILLLPVIRESSHPMQ  985

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNF----SSQHPENAVSCINPGEWGG  529
             T+ID+LELNRLR  LL D + WD RL +++S+   +     +S    + +      EW  
Sbjct  986   TSIDILELNRLRRGLLLDAYIWDRRLCHLDSLLKTHGHVSKTSSDNLDILLYTRLKEWKA  1045

Query  530   ETIFKDGSL--------EHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSS  685
               +  D  +        +      VH   N  EC     + +      P D  +      
Sbjct  1046  NFLRGDIEIGKSLGSPRKSLLSREVHL--NDNECSVADTNLQTCLVGHPVDG-AEDLDKV  1102

Query  686   STSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQ  865
              +  NG    E R   E      P+ER PS  S+ SD ID AWTG    S D+Q    L 
Sbjct  1103  YSKFNGR---EKRSVTEPTNGMEPVERLPSLASMFSDNIDLAWTG----SSDLQY--DLP  1153

Query  866   EGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFH  1045
             +   ++   G   ++DSP  K + +P R++SF S L +++R    L P+  +LS+ KS  
Sbjct  1154  QAFTKIDENGSF-NLDSPNYKNVVTPVRIHSFSSTLGLRQRERTGLAPTSLHLSSFKSAE  1212

Query  1046  AYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS-ILPEGARLMVPEN  1222
              +GD  ++++DP+ N++  CSQ  P   +KLN++ + + T+ S AS I+ +GARL++P+ 
Sbjct  1213  FFGDMTSILKDPMPNMRRACSQRSPGVIEKLNVVLARTPTYISSASNIIDDGARLLLPQI  1272

Query  1223  GQKD-VVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLST  1399
             G +D VVIAVYD+EPTSI+SYA++S+EY   VT                           
Sbjct  1273  GYEDNVVIAVYDDEPTSIVSYAMTSEEYVRQVT---------------------------  1305

Query  1400  WQRFGSLDLDYMHFGSYGSEDASGRIGFLFS-----DPKLSPHPRISFEDESCNTGGKVK  1564
              +R  S +L + H  S     + G  GF  S     D K   H + SF+DES  +  K K
Sbjct  1306  -RRLNS-NLSFSHLQSTTEFSSHGLEGFSPSQEDHLDSK-GTHFKFSFDDESPISPDKTK  1362

Query  1565  FSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQ  1744
             FSV CYF + F ALRKKCCP++ D+IRSLSRCKRW+AQGGKSNVYFAK++DERFIIKQ+ 
Sbjct  1363  FSVVCYFERHFAALRKKCCPNDTDYIRSLSRCKRWNAQGGKSNVYFAKTMDERFIIKQVT  1422

Query  1745  KTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENL  1924
             +TEL+SF EFAP+YF+YL +S +SGSPTCLAK+VG+YQV+VK LK GKE KMDL+VMEN+
Sbjct  1423  RTELESFVEFAPQYFKYLMESLTSGSPTCLAKIVGLYQVSVKSLKAGKEVKMDLMVMENI  1482

Query  1925  FYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWN  2104
             F+ R ISRVYDLKGS+RSRY S    +KVLLD N +E+L TKPIFLGSKAKR LERAVWN
Sbjct  1483  FFERKISRVYDLKGSLRSRYTSGD--SKVLLDSNLIEALHTKPIFLGSKAKRRLERAVWN  1540

Query  2105  DTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             DTSFLA   VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1541  DTSFLALADVMDYSLLVGIDEEKKELVIGIIDYLRQYTWDKQLETW  1586



>ref|XP_008652690.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Zea mays]
 tpg|DAA61367.1| TPA: putative 1-phosphatidylinositol-4-phosphate 5-kinase/ zinc 
ion binding family [Zea mays]
Length=1615

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/764 (45%), Positives = 462/764 (60%), Gaps = 62/764 (8%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M A F YSP+  LSV LPP VL+FN+ + Q W+ +E  E+      L+ 
Sbjct  850   RDCLRFYGYGNMAAAFHYSPMITLSVNLPPPVLDFNTHATQDWVKREAVEVFHTMDLLHT  909

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+  A+  LE+    +  D +    +   I+E+KD+L  E+N +  L  P    +S   +
Sbjct  910   EVYDALNNLEKSI--ITDDDSTKTSIQRQIVEMKDLLNVERNEYEVLLLPVIMGSSHSFK  967

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI-FDNNFSSQHPEN--AVSCINPGEWG-G  529
               ID+LELNR+R SLL D H WD RL  ++S+  D++ S   P N      IN G     
Sbjct  968   PNIDILELNRVRRSLLLDAHTWDRRLCGIDSLEADSHISRTDPFNLEKTQGINEGRSDLL  1027

Query  530   ETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHD----------EPPVPKDALSYQQG  679
             +T+ K G     YEE   +  +S E P + L S             E  +P   +    G
Sbjct  1028  QTVRKHGG---TYEEPCPQ--HSSESPRKSLLSTEGHLNDKKYVMVETDLPVGLVDGDAG  1082

Query  680   SSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHAS  859
                     +   E R   +      P+ER PS  SIL+DKID AW+G        ++  +
Sbjct  1083  LDLIFNKLNTCEEGRCLSKYPSKTGPVERLPSLASILADKIDMAWSGFG------ELDYN  1136

Query  860   LQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKS  1039
             L  G  +      L+   +P+ K+   P R++SFD+ LR+ +R    + P+ S  S LKS
Sbjct  1137  LPHGLSKANENTSLNLFGNPSYKKATGPVRIHSFDTVLRLHQREQTGVIPA-SLHSALKS  1195

Query  1040  FHAYGDYRNMIRDPVSNIQMICSQALPREAQKLN-LLPSSSTTFTSHASILPEGARLMVP  1216
               ++ D  ++++DP++N++   SQ  PR    LN +L  +    TS + ++ +GARL++P
Sbjct  1196  IDSFRDLTSLVKDPMTNMRRAFSQISPRTRGNLNTVLTRAPKYITSASRMVNDGARLLLP  1255

Query  1217  E-NGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKL  1393
               + +  V + VYD+EPTS++SYA++S+EY + VT K          SD    + +   L
Sbjct  1256  NISCEGSVFVTVYDDEPTSVVSYAMTSQEYAEHVTHK---MNANTSFSDFTSSNGLDGSL  1312

Query  1394  STWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSV  1573
             S+ +   +                               H R+SF+D++  T    KFSV
Sbjct  1313  SSHEELSNFR---------------------------GAHFRLSFDDDASPT-DSTKFSV  1344

Query  1574  TCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTE  1753
             TCYFA+QF ALRKKCCPS  D+IRS+SRCKRWSAQGGKSNVYFAK++DERFIIKQ+ KTE
Sbjct  1345  TCYFARQFAALRKKCCPSNSDYIRSISRCKRWSAQGGKSNVYFAKTMDERFIIKQVTKTE  1404

Query  1754  LDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYG  1933
             LDSF EFAP YF +LT+S +S SPTCLAK++G+YQV++K+ KGG+E KMDL+VMEN+ + 
Sbjct  1405  LDSFVEFAPHYFRHLTESLTSRSPTCLAKILGLYQVSIKNSKGGREVKMDLMVMENILFQ  1464

Query  1934  RSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDT  2110
             RSISRVYDLKGSVRSRYNSD    NKVLLD N +E+L TKPIFLGSKAK+ LERAVWNDT
Sbjct  1465  RSISRVYDLKGSVRSRYNSDASGHNKVLLDSNLIEALHTKPIFLGSKAKQRLERAVWNDT  1524

Query  2111  SFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             SFLA + VMDYSLLVGVDEE+KELV+GIID++RQYTWDK LETW
Sbjct  1525  SFLASLDVMDYSLLVGVDEEKKELVVGIIDFLRQYTWDKQLETW  1568



>ref|XP_006841270.1| hypothetical protein AMTR_s00135p00112810 [Amborella trichopoda]
 gb|ERN02945.1| hypothetical protein AMTR_s00135p00112810 [Amborella trichopoda]
Length=1093

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/757 (47%), Positives = 468/757 (62%), Gaps = 79/757 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSPIDILSV LPPSVLEFNS   Q W  KE AE++ K + LY 
Sbjct  337   RDCLRFYGFGSMVAFFRYSPIDILSVHLPPSVLEFNSVVRQDWAKKEAAEVIDKIEFLYE  396

Query  182   EISSAVQKLEEKCASV--GCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+S A+  +E++ A+   G +   +   +N I ELKD+L+KE+  +         E  + 
Sbjct  397   EVSDALDGMEKEFAAFESGYESTKVMEFYNYIDELKDLLIKERGEYMAFLYKGAVEICKT  456

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
              Q   +VLELN LR  LL D + WD R+  + S+     S +    + S +N      ET
Sbjct  457   MQPVPEVLELNHLRRCLLIDSYMWDRRICLLHSL-----SVKSKSGSASSLNGNT--SET  509

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPV------PKDALSYQQ-------  676
               KD ++E        E P  +  P  G+ SE   P +      PKD L   +       
Sbjct  510   RLKD-TVE-------TEVPCRDNKP--GISSEVSSPKISNALEKPKDNLLLPKPSEEMKD  559

Query  677   -----GSSSTSCNGDKTLE--------TRLGLENAVNKSP--------------LERAPS  775
                  GS  TS +   T++        T++ + ++ N SP              LE   S
Sbjct  560   LINTVGSLPTSRDTMGTVDLKGPSYCSTQIAILDS-NSSPTGTLEGKGIVVNTTLEPLSS  618

Query  776   AGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVY  955
               S LSDKID AWTG     Q +   AS   G    A+ G     D  + +++ SP RVY
Sbjct  619   FASNLSDKIDLAWTG---EGQIVTQGASNGHGTGP-ATLGPTVGKDQISQRKILSPVRVY  674

Query  956   SFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQK  1135
             SFDSAL+   R  K    S  +LS+ +SFH+ GD+R+++ +P+  I    S+A P   + 
Sbjct  675   SFDSALKFHPRSKKGPLHSALHLSSTRSFHSSGDFRSLVWEPIPKILKSFSRASPGSLEA  734

Query  1136  LN----LLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEY  1303
              +    L   S +  +S + I+ +GARL++P   +KDVVIAVYD EPTS+I+YAL +KEY
Sbjct  735   FHKFDFLFSYSPSVISSISRIVTDGARLLLPATSRKDVVIAVYDGEPTSVIAYALCTKEY  794

Query  1304  KDWVTDKPYMSEGGWGVSDTNKESPIASKL---STWQRFGSLDLDYMHFGSYGSEDASGR  1474
             ++ ++DK  + E      +++KES I +     S W    SLD D++H  SYGSE+ S  
Sbjct  795   ENQLSDK--LDE-----IESSKESHIGTHSSFGSVWHSDTSLDTDFVHPRSYGSEEISSL  847

Query  1475  IGFLFSDPKLSP-HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSL  1651
              G   SD   SP H +++F D+S    GK +F VTCYFA+QFDALR+KCC +E+DF+RSL
Sbjct  848   KGSPVSDMGKSPLHVKVTFGDDSSLPSGKARFLVTCYFARQFDALRRKCCDNEMDFLRSL  907

Query  1652  SRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTC  1831
             SR KRWSAQGGKSNVYFAK+LDERF+IKQ+ KTEL+SFEEFAP+YF+YL+D+ S+GSPTC
Sbjct  908   SRNKRWSAQGGKSNVYFAKTLDERFVIKQVTKTELESFEEFAPEYFKYLSDAISTGSPTC  967

Query  1832  LAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKANKV  2011
             LAK++GIYQV VK+LKGGKE++MDL+VMENLFYGR++SRVYDLKGS RSRYN +T +  V
Sbjct  968   LAKILGIYQVTVKNLKGGKESRMDLMVMENLFYGRNVSRVYDLKGSARSRYNPETGSGNV  1027

Query  2012  LLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLA  2122
             LLD N LE L+TKPIFLGSKAKR+LERAVWNDTSFL 
Sbjct  1028  LLDQNLLEVLRTKPIFLGSKAKRNLERAVWNDTSFLT  1064



>ref|XP_008664671.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Zea mays]
Length=1625

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/763 (46%), Positives = 474/763 (62%), Gaps = 60/763 (8%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSP+DILSV LPP VL+FN  S Q W+ +   E+  K +SL+ 
Sbjct  863   RDCLRFYGYGNMVAFFRYSPVDILSVNLPPPVLDFNCCSTQEWLKRVAVEIFGKMESLHV  922

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  +   E+    V  D      +   I+E+KD L  ++N +  L  P   E++   Q
Sbjct  923   EVSEFLHCTEKNI--VTEDEPVRECVQRQIIEMKDWLKMQRNEYEMLLLPVMRESNHPMQ  980

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDN--NFSSQHPEN--AVSCINPGEWGG  529
             T+ID+LELNRLR  LL D + WD RL +++S+ +   + S  +P+N   + C    EW  
Sbjct  981   TSIDILELNRLRRGLLLDAYIWDRRLCHIDSVLNTHGHISKTNPDNLDILLCTRLKEWKA  1040

Query  530   ETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHD---------EPPVPKDALSYQQGS  682
             + +  D  +E +         + E    +  +S  D          P    D L      
Sbjct  1041  DLLCGDTEIEKSLGSPKKSLLSREGHLNDNEYSVADTNLEICLEGHPVDDADDLDKVYNK  1100

Query  683   SSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDM-QVHAS  859
              S       T E   GLE      P+ER PS  SI SD ID AWTG      D+ Q    
Sbjct  1101  FS-GVKKRPTAEPTDGLE------PVERLPSLASIFSDTIDLAWTGSCDLQHDLPQAFTK  1153

Query  860   LQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKS  1039
             + E      SF    ++DSP    L +P R++SF S L +++R    L P+  +LS+ KS
Sbjct  1154  IDEN----VSF----NLDSPKYSNLVTPVRIHSFSSTLGLRQRERTGLVPASLHLSSFKS  1205

Query  1040  FHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS-ILPEGARLMVP  1216
                +G  R++++DP+ N++  CSQ  P   +KLN++ +   T+ S  S I+ +GARL++P
Sbjct  1206  AEYFGAMRSILKDPMPNMRRSCSQRSPGTIEKLNVVLARKPTYISSTSNIINDGARLLLP  1265

Query  1217  ENG-QKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKL  1393
             + G + DVV+AVY++EPTSIISYA++S+EY + VT +   S       +TN  S    + 
Sbjct  1266  QTGYEHDVVVAVYEDEPTSIISYAMTSEEYVEQVTHRLNSSLSFSHQPNTNGISSHGLEA  1325

Query  1394  STWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSV  1573
             S+  +      D++H  S G+                  H ++SF+D+S  +  K KFSV
Sbjct  1326  SSPSQG-----DHLH--SKGT------------------HFKLSFDDDSPISPDKTKFSV  1360

Query  1574  TCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTE  1753
              CYFAK F ALRKKCCP ++D+IRSLSRCKRW+AQGGKSNVYFAK+LDERFIIKQ+ +TE
Sbjct  1361  ICYFAKHFAALRKKCCPKDIDYIRSLSRCKRWNAQGGKSNVYFAKTLDERFIIKQVTRTE  1420

Query  1754  LDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYG  1933
             L+SF EFAP+YF+YL +S +SGSPTCLAK+VG+YQV VK LK GKE +MDL+VMEN+F+ 
Sbjct  1421  LESFVEFAPQYFKYLMESLASGSPTCLAKIVGLYQVGVKSLKTGKEVRMDLMVMENVFFE  1480

Query  1934  RSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTS  2113
             R ISRVYDLKGS+RSRY +    +KVLLD N +E+L TKPIFLGSKAKR LERAVWNDTS
Sbjct  1481  RKISRVYDLKGSLRSRYTAGD--SKVLLDANLIEALHTKPIFLGSKAKRRLERAVWNDTS  1538

Query  2114  FLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             FLA   VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1539  FLALADVMDYSLLVGIDEEKKELVIGIIDYLRQYTWDKQLETW  1581



>gb|EMS52787.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1 [Triticum urartu]
Length=1462

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/789 (43%), Positives = 459/789 (58%), Gaps = 105/789 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A F YSP+   SV LPPSVL FN    Q W+  E   +  + +SL+ 
Sbjct  693   RDCLRFYGYGNMVAAFHYSPMVTRSVNLPPSVLNFNCHGMQDWVKGETVMVFDEMESLHM  752

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   +  +E    ++  D     G+   I+E+KD+L +E+N +  L  P  + +    +
Sbjct  753   EVYGFLNSIERSITTL--DEPVKTGIRRQIIEMKDLLNRERNEYEGLLLPVIKGSVHSMK  810

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
             +TID LELNR+R  LL D + WD RL  ++S+  N                    G    
Sbjct  811   STIDTLELNRVRRGLLLDAYVWDCRLCNIDSLKAN--------------------GHIAR  850

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPV---------PKDALSYQQGSSSTS  694
              D S     +    +   SE       H E  E P          P+ +L  ++ S    
Sbjct  851   TDSSNSENLQATSIKEDKSELLTTVTQHGETHEGPATYRRCSSGSPRRSLLSREASMD--  908

Query  695   CNGDKTLETRLGL-----------------------------ENAVNKSPLERAPSAGSI  787
              NG+  +ET L +                              N++   P+ER PS  SI
Sbjct  909   -NGNILVETNLPIGQVDGVSGAGDLDVVFSQFSVSENGRRLSMNSIETVPVERLPSLASI  967

Query  788   LSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDS  967
             LSDKID  W+G        + H SL +   +    G  S + +P  K+  SP RV+SFDS
Sbjct  968   LSDKIDMLWSG------STEAHCSLPQDLIKADGKGSFSLLGNPNYKKAISPVRVHSFDS  1021

Query  968   ALRIQERISKRLPPSPSYLS-TLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNL  1144
               R+ ER    L P+  +LS  ++S  ++ D  ++++DP++N++   SQ  PR    LN+
Sbjct  1022  IFRLHEREQTGLLPASLHLSLKMRSVDSFRDLTSLVKDPMTNMRRAFSQISPRSRGNLNV  1081

Query  1145  LPSSSTTFTSHAS-ILPEGARLMVPENGQKD-VVIAVYDNEPTSIISYALSSKEYKDWVT  1318
             + + + T+   AS ++ +GARL++P  G +  +V+AVYD+EPTSI+SYA++S+EY + VT
Sbjct  1082  ILTRAPTYLKSASHMVSDGARLLLPHIGSEGALVVAVYDDEPTSIVSYAMTSQEYVEHVT  1141

Query  1319  DKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDP  1498
              K                  + SK S           + H  +  +   SG    L S  
Sbjct  1142  HK------------------LDSKSS-----------FQHMSNCSAVSNSGLEKALPSQE  1172

Query  1499  KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQ  1678
                 H + SF+DE+       KFSVTCYFA+QF +LRKKCCPS++D+IRSLSRCKRWSA 
Sbjct  1173  --GAHFKYSFDDEAF-CADNTKFSVTCYFARQFASLRKKCCPSDVDYIRSLSRCKRWSAD  1229

Query  1679  GGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQ  1858
             GGKSNVYFAK++DERFIIKQ+ KTELDSF  FAP YF +LT S +SGSPTCLAK++GIYQ
Sbjct  1230  GGKSNVYFAKTMDERFIIKQVTKTELDSFVGFAPHYFRHLTQSLTSGSPTCLAKILGIYQ  1289

Query  1859  VAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLE  2035
             V +K LKGG+E KMDL+VMEN+F+ ++ISRVYDLKGSVRSRYNSDT + NKVLLD N +E
Sbjct  1290  VNIKGLKGGREVKMDLMVMENIFFQKTISRVYDLKGSVRSRYNSDTSSHNKVLLDSNLIE  1349

Query  2036  SLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQY  2215
              L TKPIFLG  AKR+LERAVWNDTS LA + VMDYSLLVG+DEE  ELV+GIID++RQY
Sbjct  1350  ELHTKPIFLGRNAKRTLERAVWNDTSILASLDVMDYSLLVGIDEENNELVIGIIDFLRQY  1409

Query  2216  TWDKHLETW  2242
             TWDK LETW
Sbjct  1410  TWDKQLETW  1418



>ref|XP_002445523.1| hypothetical protein SORBIDRAFT_07g020930 [Sorghum bicolor]
 gb|EES15018.1| hypothetical protein SORBIDRAFT_07g020930 [Sorghum bicolor]
Length=1626

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/765 (47%), Positives = 486/765 (64%), Gaps = 64/765 (8%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A FRYSP+DILSV LPPSVL+FN +S Q  + +   E+  K +SL+ 
Sbjct  864   RDCLRFYGYGNMVAFFRYSPVDILSVNLPPSVLDFNCRSPQELLKRVAVEIFGKMESLHV  923

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S  + + E     V  D      +   I+E+KD+L  E+N +  L  P   E++   Q
Sbjct  924   EVSEFLHRTELNI--VNEDEPVKECVQRQIIEMKDLLKMERNEYEILLLPVMRESNHPMQ  981

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFD--NNFSSQHPENAVSCI--NPGEWGG  529
             T+ID+LELNRLR  LL D + WD RL +++S+     + S  +P++  + +     EW  
Sbjct  982   TSIDILELNRLRRGLLLDAYIWDRRLCHVDSVLKAHGHISKTNPDSLDNLLYTRLKEWKA  1041

Query  530   ETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEP--------PVPKDALSYQQGSS  685
             + +  D  +  +         + E    +  HS  D          PV  DA    +  +
Sbjct  1042  DLLCGDTEIGKSLGSPKKSLLSREGHLNDNEHSVGDTNLEICLEGHPV-DDAEDLDKVYN  1100

Query  686   STSCNGDKT--LETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQ--VH  853
               S  G K+   E   GLE      P+ER PS  SI SD ID AWTG    S D+Q  + 
Sbjct  1101  KLS-GGKKSPIAEPADGLE------PVERLPSLASIFSDNIDLAWTG----SCDLQYDLP  1149

Query  854   ASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTL  1033
              +  + + +V SF    ++DSP    + +P R++SF+S L +++R    L P+  +LST 
Sbjct  1150  QAFTKIDEKV-SF----NLDSPNYSNVVTPVRIHSFNSTLGLRQRERTGLAPASLHLSTF  1204

Query  1034  KSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS-ILPEGARLM  1210
             KS   +G   ++++DP+ NI+ +CSQ  P   +KLN++ + + T+ S AS I+ +GARL+
Sbjct  1205  KSAEYFGGMTSILKDPMPNIRRVCSQRSPGVIEKLNVVLARTPTYISTASNIVDDGARLL  1264

Query  1211  VPENG-QKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIAS  1387
             +P+ G + DV++AVYD+EPTSIISYA++S+EY   VT +   S       +T   S    
Sbjct  1265  LPQTGYEDDVIVAVYDDEPTSIISYAMTSQEYVQQVTHRLNSSLSFSHPPNTKGISTHGL  1324

Query  1388  KLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKF  1567
             ++S+  +      D+MH  S G+                  H + SF+D+S  +  K KF
Sbjct  1325  EVSSPSQ-----EDHMH--SKGT------------------HFKFSFDDDSPISPDKTKF  1359

Query  1568  SVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQK  1747
             SV CYFAK F ALRKKCCP ++D+IRSLSRCKRW+AQGGKSNVYFAK++DERFIIKQ+ +
Sbjct  1360  SVICYFAKHFAALRKKCCPKDIDYIRSLSRCKRWNAQGGKSNVYFAKTMDERFIIKQVTR  1419

Query  1748  TELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLF  1927
             TEL+SF EFAP+YF+YL +S +SGSPTCLAK+VG+YQV+VK LK GKE +MDL+VMEN+F
Sbjct  1420  TELESFVEFAPQYFKYLMESLTSGSPTCLAKIVGLYQVSVKSLKAGKEVRMDLMVMENIF  1479

Query  1928  YGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWND  2107
             + R ISRVYDLKGS+RSRY +    +KVLLD N +E+L TKPIFLGSKAKR LERAVWND
Sbjct  1480  FERKISRVYDLKGSLRSRYTAGD--SKVLLDSNLIEALHTKPIFLGSKAKRRLERAVWND  1537

Query  2108  TSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             TSFLA   VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1538  TSFLALADVMDYSLLVGIDEEKKELVIGIIDYLRQYTWDKQLETW  1582



>gb|EMT15939.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1 [Aegilops tauschii]
Length=1591

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/780 (44%), Positives = 467/780 (60%), Gaps = 87/780 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A F YSP+   SV LPPSVL F+    Q W+  E   +  + +SL+ 
Sbjct  822   RDCLRFYGYGNMVAAFHYSPMVTRSVNLPPSVLNFSCHGMQDWVKGETVMVFDEMESLHM  881

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+   +  +E    ++  D     G+   I+E+KD+L +E+N +  L  P  + +    +
Sbjct  882   EVYGFLNSIERSITTL--DEPVKTGIRRQIIEMKDLLNRERNEYEGLLLPVIKGSVHSMK  939

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNF----SSQHPEN--AVSCINPGEW  523
             +TID LELNR+R  LL D + WD RL  ++S+  N       S +PEN  A S       
Sbjct  940   STIDTLELNRVRRGLLLDAYVWDCRLCNIDSLKANGHIARTDSSNPENLQATSMKEDKSE  999

Query  524   GGETIFKDGSLEHAYEENVHEFPN-----SEECPGEGLHSEHD---------EPPVPKDA  661
                T+ + G          HE P      S   P   L S            E  +P   
Sbjct  1000  LLTTVTQHG--------ETHEGPATYRRCSSGSPRRSLLSREASMDNGNILVETNLPIGQ  1051

Query  662   LSYQQGSS---------STSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAW  814
             +    G+          S S NG      RL + N++   P+ER PS  SILSDKID  W
Sbjct  1052  VDGVSGAGDLDVVFSQFSVSENG-----RRLSM-NSIETVPVERLPSLASILSDKIDMLW  1105

Query  815   TGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERIS  994
             +G        + H SL +   +    G  S + +P  K+  SP RV+SFDS  R+ ER  
Sbjct  1106  SG------STEAHCSLPQDLIKADGKGSFSLLGNPNYKKAISPVRVHSFDSIFRLHEREQ  1159

Query  995   KRLPPSPSYLS-TLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFT  1171
               L P+  +LS  ++S  ++ D  ++++DP++N++   SQ  PR    LN++ + + T+ 
Sbjct  1160  TGLLPASLHLSLKMRSVDSFRDLTSLVKDPMTNMRRAFSQISPRSRGNLNVILTRAPTYL  1219

Query  1172  SHAS-ILPEGARLMVPENGQKD-VVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGG  1345
               AS ++ +GARL++P  G +  +V+AVYD+EPTSI+SYA++S+EY + VT K       
Sbjct  1220  KSASHMVSDGARLLLPHIGSEGALVVAVYDDEPTSIVSYAMTSQEYVEHVTHK-------  1272

Query  1346  WGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRIS  1525
                        + SK S           + H  +  +   SG    L S  +   H + S
Sbjct  1273  -----------LDSKSS-----------FQHMSNCSAVSNSGLEKALPS--QEGAHFKYS  1308

Query  1526  FEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFA  1705
             F++E+       KFSVTCYFA+QF +LRKKCCPS++D+IRSLSRCKRWSA GGKSNVYFA
Sbjct  1309  FDNEAF-CADNTKFSVTCYFARQFASLRKKCCPSDVDYIRSLSRCKRWSADGGKSNVYFA  1367

Query  1706  KSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGG  1885
             K++DERFIIKQ+ KTELDSF  FAP+YF +LT S +SGSPTCLAK++GIYQV +K LKGG
Sbjct  1368  KTMDERFIIKQVTKTELDSFVGFAPQYFRHLTQSLTSGSPTCLAKILGIYQVNIKGLKGG  1427

Query  1886  KETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFL  2062
             +E KMDL+VMEN+F+ ++ISRVYDLKGSVRSRYNSDT + NKVLLD N +E L TKPIFL
Sbjct  1428  REVKMDLMVMENIFFQKTISRVYDLKGSVRSRYNSDTSSHNKVLLDSNLIEELHTKPIFL  1487

Query  2063  GSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             G KAKR+LERAVWNDTS LA + VMDYSLLVG+DEE  ELV+GIID++RQYTWDK LETW
Sbjct  1488  GRKAKRTLERAVWNDTSILASLDVMDYSLLVGIDEENNELVIGIIDFLRQYTWDKQLETW  1547



>ref|XP_009410073.1| PREDICTED: LOW QUALITY PROTEIN: putative 1-phosphatidylinositol-3-phosphate 
5-kinase FAB1C [Musa acuminata subsp. malaccensis]
Length=1767

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/773 (46%), Positives = 472/773 (61%), Gaps = 63/773 (8%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LPPS+L+F  Q +Q W+ +E   +  K   L++
Sbjct  935   RDCLRFYGFGSMVAFFRYSPVDILSVCLPPSLLDFTCQIQQEWLRQEAILVSNKINILHS  994

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             +IS  +  +E K  ++  D      ++  I++LK +L  E++ ++ L QP      +  Q
Sbjct  995   KISDVLHVIERKITTLK-DKPLEASIYRHIIKLKGLLKMERHEYDLLLQPVMVGNIQPFQ  1053

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYME--------SIFDNNFSSQHPENAVSCINPG  517
              T D+L+LNRLR +LL D + WD RLY ++        +I D+  ++  P       N  
Sbjct  1054  ETFDILDLNRLRRALLLDSYIWDRRLYSLDLLSKEKSCTIIDSRLTNFSPRT-----NLR  1108

Query  518   EWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSC  697
             E   E   K  + E    +   +              +H+E       LS+Q       C
Sbjct  1109  EQREEIPRKGRTFEDLAGDVTAKSSPLLGTDKSSFSKQHEE-------LSFQ----VLEC  1157

Query  698   NGDKTLETRLGLENAVNKSPL-----------ERAPSAGSILSDKIDCAWTGIDPSSQDM  844
             N +  +ET L +E+  + +             + +    S LSDKID AW+G        
Sbjct  1158  NTN-MVETDLSIEDCSSSAGFNSVFVQYDDWDDTSIFGESNLSDKIDLAWSG------SG  1210

Query  845   QVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYL  1024
             Q+     +G     +   L  +DSP  +++KSP RVYSFDSALR ++RI     P+  ++
Sbjct  1211  QLVMDQPKGSSEADALVIL--MDSPCYRKVKSPLRVYSFDSALRFRKRIHGGFLPASLHI  1268

Query  1025  STLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLN-LLPSSSTTFTSHASILPEGA  1201
              ++KSF + GD  +M+RDP+++++   SQ  PR  Q+L+ LL       +     + + A
Sbjct  1269  PSVKSFDSSGDLASMVRDPITSMRRAYSQNSPRLVQRLDDLLNHKPVHISPVLEKMTDRA  1328

Query  1202  RLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTD-----KPYMSEGGWGVSDTN  1366
             RL++P+N   D+VIAVYD+EPTSIISYA++S+EY D +T      + +   G   V +  
Sbjct  1329  RLLLPQNALDDIVIAVYDDEPTSIISYAMASQEYSDCITSSLDEIEDFSMVGKKSVGNYG  1388

Query  1367  KESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCN  1546
               + + ++L+  Q           + S+   D          D K   H +ISFEDE   
Sbjct  1389  SNNNVGTRLAAQQ-------PKFQYHSHVGHDEPQLSQMNLLDTK-ETHFKISFEDEYSI  1440

Query  1547  TGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERF  1726
                K KFSVTCYFAKQF A RK CCPSE D+IRSLSRCKRWSAQGGKSNVYFAKSLDERF
Sbjct  1441  PSDKAKFSVTCYFAKQFHAFRKICCPSEFDYIRSLSRCKRWSAQGGKSNVYFAKSLDERF  1500

Query  1727  IIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDL  1906
             IIKQ+ KTELDSFEEFAP+YF+YLT S +SG PTCLAKV+GIYQV VKH KGG+E KMD+
Sbjct  1501  IIKQVTKTELDSFEEFAPQYFKYLTQSITSGCPTCLAKVLGIYQVTVKHTKGGREMKMDV  1560

Query  1907  IVMENLFYGRSISRVYDLKGSVRSRYNSDTKANK-VLLDLNFLESLQTKPIFLGSKAKRS  2083
             +VMENLF+ R+ISRVYDLKGS+RSRYN DT  N  VLLDLN LE   TKPIFLGSKAKRS
Sbjct  1561  MVMENLFFKRNISRVYDLKGSLRSRYNPDTSGNNTVLLDLNLLE---TKPIFLGSKAKRS  1617

Query  2084  LERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LERAVWNDT FL  V VMDYSLLVG+DE +KELV+GIID+MRQYTWDK LETW
Sbjct  1618  LERAVWNDTYFLTCVDVMDYSLLVGIDETQKELVIGIIDFMRQYTWDKQLETW  1670



>gb|EEE69670.1| hypothetical protein OsJ_29297 [Oryza sativa Japonica Group]
Length=1604

 Score =   549 bits (1415),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 334/761 (44%), Positives = 459/761 (60%), Gaps = 64/761 (8%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A F+YSP+  LSV LPPS+L+FN  S Q W+  E   +  + +SL+A
Sbjct  849   RDCLRFYGYGNMVAVFQYSPMVTLSVNLPPSMLDFNCHSTQEWVKGEAVAVFGEMESLHA  908

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKN-YWNDLHQPTHEETSEEG  358
             E+   +   E+   ++  D +   G+   I+E+KD+L  E+N Y   L  P    ++   
Sbjct  909   EVYGFLSNTEKSIITM--DESLKTGIERQIIEMKDLLNMERNEYEVTLLLPVIRGSTHSM  966

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQ----HPENAVSCINPGEWG  526
             +++ID+LELNRLR  LL D + WD RL  + SI  +  +S+      E   +  N GE  
Sbjct  967   KSSIDILELNRLRRGLLLDAYIWDCRLCNISSITKDGRASRIKGSEAELHQAITNHGEMH  1026

Query  527   GETIF----KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTS  694
              E         GSL  +                E +  E D P    D+  +  G     
Sbjct  1027  QEPSTCPQCSSGSLRKSLLSR-----EGHSMDTEIILPEIDLPVGMVDSFVHDIGGLDLV  1081

Query  695   CNGDKTLETRLGL-ENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEG  871
              +          L ++++   P+ER PS  SILSDKID AW+G        ++H +L E 
Sbjct  1082  FSKFDVSGIAQSLSKDSIKTEPVERLPSLASILSDKIDMAWSG------SCELHNNLPES  1135

Query  872   ERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAY  1051
               +          ++P+  +   P R++SFDS  R+ +R S  L P+  +LS+ KS  ++
Sbjct  1136  TTKGN--------ENPSYSKAIPPVRIHSFDSIFRLHQRESTGLLPASLHLSS-KSVDSF  1186

Query  1052  GDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPE-NGQ  1228
              D  ++++DP++N++   S   PRE   LN+L    T   S A ++ +GARL++P  + +
Sbjct  1187  RDLTSLVKDPLTNMRRAFSHISPRERGNLNVLTHLPTYIRSAAHMVSDGARLLLPHIDFE  1246

Query  1229  KDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNK--ESPIASKLSTW  1402
               VV+AVYD+EPTSI+SY ++S+EY + +T K           DT      P+   +++ 
Sbjct  1247  GGVVVAVYDDEPTSIVSYVMTSQEYIEHITHK----------MDTKSSFHHPVNCAVASN  1296

Query  1403  QRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCY  1582
              +F     +       G  +  G             H   SF+DE+  +    KFSVTCY
Sbjct  1297  NQF-----EESFLPQEGHSEFKGT------------HFSFSFDDEAF-SADNTKFSVTCY  1338

Query  1583  FAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDS  1762
             FA+QF ALRKKCCP ++D+IRSLSRCKRWSAQGGKSNVYFAK++DERFIIKQ+ KTELDS
Sbjct  1339  FARQFAALRKKCCPGDIDYIRSLSRCKRWSAQGGKSNVYFAKTMDERFIIKQVTKTELDS  1398

Query  1763  FEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSI  1942
             F  FAP YF +L +S +S SPTCLAK++G+YQV +K LKGG+E KMDL+VMEN+F+ R+I
Sbjct  1399  FIGFAPHYFRHLAESLTSRSPTCLAKIMGLYQVNIKGLKGGREVKMDLMVMENIFFQRTI  1458

Query  1943  SRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFL  2119
             SRVYDLKGSVRSRYNSDT   NKVLLD N +E+  T PIFLGSKAK+ +ERAVWNDTSFL
Sbjct  1459  SRVYDLKGSVRSRYNSDTSGHNKVLLDSNLIEAQHTNPIFLGSKAKQRMERAVWNDTSFL  1518

Query  2120  AGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             A + VMDYSLLVGVDE + ELV+GIID++RQYTWDK LETW
Sbjct  1519  ASLDVMDYSLLVGVDERKNELVIGIIDFLRQYTWDKQLETW  1559



>gb|EEC84553.1| hypothetical protein OsI_31305 [Oryza sativa Indica Group]
Length=1553

 Score =   547 bits (1410),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 335/771 (43%), Positives = 461/771 (60%), Gaps = 84/771 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+A F+YSP+  LSV LPPS+L+FN  S Q W+  E   +  + +SL+A
Sbjct  798   RDCLRFYGYGNMVAVFQYSPMVTLSVNLPPSMLDFNCHSTQEWVKGEAVAVFGEMESLHA  857

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKN-YWNDLHQPTHEETSEEG  358
             E+   +   E+   ++  D +   G+   I+E+KD+L  E+N Y   L  P    ++   
Sbjct  858   EVYGFLSNTEKSIITM--DESLKTGIERQIIEMKDLLNMERNEYEVTLLLPVIRGSTHSM  915

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             +++ID+LELNRLR  LL D + WD RL         N SS       S I     G E  
Sbjct  916   KSSIDILELNRLRRGLLLDAYIWDCRLC--------NISSMKKGGRASRIK----GSEAE  963

Query  539   FKDGSLEHAYEENVHEFPNS-EECPGEGL---------HSEHDEPPVPKDALSYQQGSSS  688
                    H     +H+ P++  +C    L         HS   E  +P+  L      S 
Sbjct  964   LHQAITNHG---EMHQEPSTCPQCSSGSLRKSLLSREGHSMDTEIILPEIDLPVGMVDSF  1020

Query  689   T-SCNGDKTLETRLGL--------ENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQD  841
                  G   + ++  +        ++++   P+ER PS  SILSDKID AW+G       
Sbjct  1021  VHDIGGLDLVFSKFDVSGIAQSLSKDSIKTEPVERLPSLASILSDKIDMAWSG------S  1074

Query  842   MQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSY  1021
              ++H +L E   +          ++P+  +   P R++SFDS LR+ +R S  L P+  +
Sbjct  1075  CELHNNLPESTTKGN--------ENPSYSKAIPPVRIHSFDSILRLHQRESTGLLPASLH  1126

Query  1022  LSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGA  1201
             LS+ KS  ++ D  ++++DP++N++   S   PRE   LN+     T   S A ++ +GA
Sbjct  1127  LSS-KSVDSFRDLTSLVKDPLTNMRRAFSHISPRERGNLNVRTHLPTYIRSAAHMVSDGA  1185

Query  1202  RLMVPE-NGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNK--E  1372
             RL++P  + +  VV+AVYD+EPTSI+SY ++S+EY + +T K           DT     
Sbjct  1186  RLLLPHIDFEGGVVVAVYDDEPTSIVSYVMTSQEYIEHITHK----------MDTKSSFH  1235

Query  1373  SPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTG  1552
              P+   +++  +F     +       G  +  G             H   SF+DE+  + 
Sbjct  1236  HPVNCAVASNNQF-----EESFLPQEGHSEFKG------------THFSFSFDDEAF-SA  1277

Query  1553  GKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFII  1732
                KFSVTCYFA+QF ALRKKCCP ++D+IRSLSRCKRWSAQGGKSNVYFAK++DERFII
Sbjct  1278  DNTKFSVTCYFARQFAALRKKCCPGDIDYIRSLSRCKRWSAQGGKSNVYFAKTMDERFII  1337

Query  1733  KQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIV  1912
             KQ+ KTELDSF  FAP YF +L +S +S SPTCLAK++G+YQV +K LKGG+E KMDL+V
Sbjct  1338  KQVTKTELDSFIGFAPHYFRHLAESLTSRSPTCLAKIMGLYQVNIKGLKGGREVKMDLMV  1397

Query  1913  MENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLE  2089
             MEN+F+ R+ISRVYDLKGSVRSRYNSDT   NKVLLD N +E+  T PIFLGSKAK+ +E
Sbjct  1398  MENIFFQRTISRVYDLKGSVRSRYNSDTSGHNKVLLDSNLIEAQHTNPIFLGSKAKQRME  1457

Query  2090  RAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             RAVWNDTSFLA + VMDYSLLVGVDE + ELV+GIID++RQYTWDK LETW
Sbjct  1458  RAVWNDTSFLASLDVMDYSLLVGVDERKNELVIGIIDFLRQYTWDKQLETW  1508



>ref|XP_004965176.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C-like [Setaria italica]
Length=1610

 Score =   545 bits (1405),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 336/785 (43%), Positives = 468/785 (60%), Gaps = 109/785 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A F YSP+DILSV LPPSVL+F+  + Q WI+KE A++  + + LY 
Sbjct  853   RDCLRFYGLGSMVAVFHYSPVDILSVNLPPSVLDFSYPTAQDWIIKEAADVASRKEHLYK  912

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EI + +  +E+   +      +  GL+  + +LK+++  E   ++ L   ++ +  +   
Sbjct  913   EIVAKLDCIEQIIKAQNVTMKS--GLYKHVADLKELVKVEWKKYDVLSGFSNIDNLQTFG  970

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              T+DVL+LN LR  L  D+H WD RLY M S+   N  +   E   S     E   E++ 
Sbjct  971   PTLDVLDLNHLRRELALDIHIWDRRLYMMHSLTKENCHTVPTETQCS-----EKLTESVL  1025

Query  542   ---------KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSS---  685
                      K G++ ++ E+     PN+ E P +         P P    +   GS    
Sbjct  1026  EEPKDVISSKHGTINNSLEQT---HPNALELPTDSAK------PFPMREQNNTSGSHLGL  1076

Query  686   STSCNGDKTLET-RLGLENAVN----------------KSPLERAPSAGSILSDKIDCAW  814
              T+   D +L +   G+ +A+                 ++ L+++ S+ S +SD+ID AW
Sbjct  1077  KTNTAADVSLHSGSAGISSALGPCKIQSEVVLADELKAETMLQKSQSSASNISDRIDLAW  1136

Query  815   TG-----IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRI  979
             TG     IDPS   M+    +    +           D P  +++ +P R+ SFDSA+  
Sbjct  1137  TGSGQFVIDPSQCSMETVPVIPAALK-----------DDPAYQKVIAPIRIKSFDSAVSS  1185

Query  980   QERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSS  1159
             + R+S                         + D  ++I+   SQ  P+  +K     + S
Sbjct  1186  RNRLSP------------------------VDDSNASIRRSYSQRPPKAIEKTGR--ARS  1219

Query  1160  TTFTSHAS---ILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPY  1330
              TF S+ S   ++    RL++ +N   DVV+ +YD+EP+S+I++A++  EY  ++   P 
Sbjct  1220  PTFMSNLSLSGVVDGEGRLLLSQN-DSDVVVPIYDDEPSSMIAHAMTVPEYHSFLL--PL  1276

Query  1331  MSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSP  1510
             M        D N ES + + ++      + D     +GS  S+  +G      SD K   
Sbjct  1277  M--------DENNESSVLNYVAHKSSRSTFDGSMRSYGSDQSQAITG------SDSK-DN  1321

Query  1511  HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKS  1690
             H  +SFEDE  N+  K KFSVTCYFAKQFDA+R+KCCP ELD+IRSLSRCKRWSAQGGKS
Sbjct  1322  HLTVSFEDEDSNSVDKAKFSVTCYFAKQFDAIRRKCCPDELDYIRSLSRCKRWSAQGGKS  1381

Query  1691  NVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVK  1870
             NVYFAK+LD+RF+IKQ+ +TELDSFE++A +YF+YLT+S SSGSPTCL K++G+YQ+  K
Sbjct  1382  NVYFAKTLDDRFVIKQVTRTELDSFEDYAVEYFKYLTESVSSGSPTCLTKILGLYQITAK  1441

Query  1871  HLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQT  2047
             +L+ GKE KMD++VMENLF+ R +SR+YDLKGS+RSRYN DT   NKVLLDLN LE+L T
Sbjct  1442  NLRDGKELKMDVMVMENLFFKRKVSRIYDLKGSLRSRYNPDTSGKNKVLLDLNLLETLHT  1501

Query  2048  KPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDK  2227
             KPIFLGSKAKR LERAVWNDTSFLA V VMDYSLLVG+DEERKELV+GIIDY+RQYTWDK
Sbjct  1502  KPIFLGSKAKRRLERAVWNDTSFLASVDVMDYSLLVGIDEERKELVMGIIDYLRQYTWDK  1561

Query  2228  HLETW  2242
              LETW
Sbjct  1562  QLETW  1566



>ref|XP_002532951.1| fyve finger-containing phosphoinositide kinase, fyv1, putative 
[Ricinus communis]
 gb|EEF29435.1| fyve finger-containing phosphoinositide kinase, fyv1, putative 
[Ricinus communis]
Length=1838

 Score =   545 bits (1405),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 348/795 (44%), Positives = 478/795 (60%), Gaps = 89/795 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+ I++LSV LPP  L+FNS++ Q WI KE  E++ +A+ L++
Sbjct  1017  RDCLRFYGFGNMVACFRYASINVLSVYLPPLKLDFNSEN-QEWIQKETDEVVNRAELLFS  1075

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             ++ +A+ ++ +K +S+G   + M        I EL+ ML  EK  + D  Q    + +++
Sbjct  1076  DVLNALSQIAQKKSSLGPGNSGMKLPESRRQIGELEAMLQNEKTEFEDSLQRALNKEAKK  1135

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+LE+NRLR  L+   + WDHRL Y  S+ +N+      ++ ++C N G    E 
Sbjct  1136  GQPVIDILEINRLRRQLVFQSYMWDHRLIYAASLDNNSL-----QDDLNCSNTGH--EEK  1188

Query  536   IFKDGSLEHAYEENVHE-----FPNSEECP------------GEGLHSE-----HDEPPV  649
              F   S E   E NV++     F + +  P            G G++S+     H E  +
Sbjct  1189  AF--ASTEQLNEMNVNDKAGKGFGSFDSLPVGAKLLKIDRQGGLGINSDQSETVHREIDM  1246

Query  650   PKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAW  814
              +D  ++++   +       T +   GLE++ N   + R  S G +     LSD +D AW
Sbjct  1247  SQDP-NHEKNDRAELSGAMPTCDQPHGLEHSGN---VRRTLSEGQVPIVSNLSDTLDAAW  1302

Query  815   TGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQE---  985
             TG      +      L + +  V S       DS       +   +   D   ++Q+   
Sbjct  1303  TG------ENHPGIGLVKDDSSVLS-------DSAVADLSTTSTAMEGLDLYSQLQDPNG  1349

Query  986   -RISKRLPPSPSYLSTLKS--FHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSS  1156
              ++S  L P+   LST  S      G Y   +R P  N     ++      +KL  +   
Sbjct  1350  SKVSNALSPA---LSTKGSDNMEEVGGY---LRTPFLNFYRSLNKTFYASPEKLETMGEY  1403

Query  1157  STTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK-P  1327
             S  + S      L  GARL++P  G +DVVI V+D+EPTSII+YAL S EY+D + D   
Sbjct  1404  SPVYVSSFRELELQGGARLLLPM-GVRDVVIPVFDDEPTSIIAYALLSPEYEDQLADDGE  1462

Query  1328  YMSEGGWGVSDTNKESPIASKLSTWQRFGSLD---LDYMHFGSYGSED---ASGRIGFLF  1489
              + EGG    D N  S ++  L++ Q F S D   +D      Y  E     SG    L 
Sbjct  1463  RIKEGG----DANYSSNLSDHLTS-QSFHSADEVTIDSHRSLGYTDESILSMSGSHSPLV  1517

Query  1490  SDP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRC  1660
              DP     + H R+SF DE     GKVK+SVTCY+AK+F+ALR +CCPSELDFIRSLSRC
Sbjct  1518  LDPLSYTKTMHARVSFGDE--GPLGKVKYSVTCYYAKRFEALRNRCCPSELDFIRSLSRC  1575

Query  1661  KRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAK  1840
             K+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF YL++S SS SPTCLAK
Sbjct  1576  KKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPEYFRYLSESISSRSPTCLAK  1635

Query  1841  VVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLL  2017
             ++GIYQV  KHLKGGKE+KMD++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLL
Sbjct  1636  ILGIYQVTSKHLKGGKESKMDVLVMENLLFGRNVTRLYDLKGSSRSRYNPDSSGSNKVLL  1695

Query  2018  DLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGII  2197
             D N +E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDE+  ELVLGII
Sbjct  1696  DQNLIEAMPTSPIFVGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGVDEQTHELVLGII  1755

Query  2198  DYMRQYTWDKHLETW  2242
             D+MRQYTWDKHLETW
Sbjct  1756  DFMRQYTWDKHLETW  1770



>ref|XP_009338310.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Pyrus x bretschneideri]
Length=1833

 Score =   531 bits (1369),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 330/783 (42%), Positives = 464/783 (59%), Gaps = 74/783 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ ++FN + +Q WI KE  E++ +A+ L++
Sbjct  1023  RDCLRFYGFGKMVACFRYASIDVHSVYLPPAKVDFNYE-KQEWIQKETDEVIDRAELLFS  1081

Query  182   EISSAVQKLEEKCASVGCDWNNM---NGLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
             E+ + ++++ EK +  G   + M      H  I+EL+ ML KEK  + +L Q T    ++
Sbjct  1082  EVLNVLRQIAEKRSGSGSHSSGMVTPESRHQ-IVELEGMLQKEKVEFEELLQKTLNREAK  1140

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFS-------------SQHPEN  493
             +GQ  ID+LE+NRLR  LL   + WDHRL Y  S+ +N                + H E+
Sbjct  1141  KGQPVIDILEINRLRRQLLFQSYMWDHRLVYAASLENNRHGDGLNSSIPDEGKPATHSED  1200

Query  494   AVS--CINPGEW--GGETIFKDGSLEHAYEE------NVH-EFPNSEECPGEGLHSEHDE  640
                   INPG+     ++   D  L   ++        VH E  N E   G     E+++
Sbjct  1201  IAGNVAINPGKSYNSCDSFLVDAMLNKGFDHGEDIANTVHSEMVNKERDGGRNSKYENED  1260

Query  641   PPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTG  820
                  D +S        +C+    L+ R G+  +++             LSD +D AWTG
Sbjct  1261  QCNLSDGVS--------TCDQSDPLKPRAGIRKSLSDGQFPVIMD----LSDTLDTAWTG  1308

Query  821   IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKR  1000
                  ++     + ++  R V   G+     SP    L       + D A   +++   +
Sbjct  1309  -----ENQCGFVTAKDSTRTVPVLGRADSSASPVKDGL-------NLDHA---EDQNGPK  1353

Query  1001  LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--  1174
             L  S S LST K      D  + ++ P  N     ++     +QKL+ L   +  + S  
Sbjct  1354  LAHSASGLST-KGSENMEDSVSWLKMPFLNFYRGFNKNFLSASQKLDTLGEYNPVYVSSF  1412

Query  1175  HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGV  1354
                 L  GARL++P  G  D V+ VYD+EPTS+ISYAL+S +Y+  ++ +   +     V
Sbjct  1413  RELELKGGARLLLPV-GVNDTVVPVYDDEPTSLISYALASPDYQLQISGEGERTRDNGDV  1471

Query  1355  S-----DTNKESPIASKLSTWQR-FGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHP  1516
             S      T    P     S   R FGS +   +   +YGS  + G     ++    + H 
Sbjct  1472  SLSDSLTTQLHHPDDDTTSESHRSFGSTEESLL--STYGSRSSLGLDPLSYTK---ALHA  1526

Query  1517  RISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNV  1696
             R+SF D+S    G+VK+SVTCY+AK+F+ALR+ CCPSELD++RSLSRCK+W AQGGKSNV
Sbjct  1527  RVSFGDDS--PLGQVKYSVTCYYAKRFEALRRICCPSELDYVRSLSRCKKWGAQGGKSNV  1584

Query  1697  YFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHL  1876
             +FAKSLD+RFIIKQ+ KTEL+SF +FAP YF YL+++  + SPTCLAK++GIYQV  KHL
Sbjct  1585  FFAKSLDDRFIIKQVTKTELESFIKFAPGYFRYLSEAIGTKSPTCLAKILGIYQVTSKHL  1644

Query  1877  KGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKP  2053
             KGGKE+K+D++VMENL +GR+I+R+YDLKGS RSRYN D+  +NKVLLD N +E++ T P
Sbjct  1645  KGGKESKIDVLVMENLLFGRNITRLYDLKGSSRSRYNPDSSGSNKVLLDQNLIEAMPTSP  1704

Query  2054  IFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHL  2233
             IF+G+KAKR LERAVWNDT+FLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHL
Sbjct  1705  IFVGNKAKRVLERAVWNDTAFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHL  1764

Query  2234  ETW  2242
             ETW
Sbjct  1765  ETW  1767



>ref|XP_006655983.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C-like [Oryza brachyantha]
Length=1614

 Score =   528 bits (1359),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 337/791 (43%), Positives = 459/791 (58%), Gaps = 120/791 (15%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LPP+VL+F     Q WI+K+VA++  + + LY 
Sbjct  856   RDCLRFYGYGSMVAVFRYSPVDILSVNLPPAVLDFTYPVAQDWIVKDVADVTSRKEHLYK  915

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EI   +  +E     +  +     GLH  +++LKD++  E   ++ L + +  E     +
Sbjct  916   EIFDKLDSIEN--IVLAQNMTMKTGLHKHVVDLKDLIKVEWKKYDVLSRFSSIENLHTLE  973

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               ID+LELN LR  L+ D H WD RLY M+++   N  ++  +  + C+           
Sbjct  974   PAIDILELNCLRRELVIDAHIWDRRLYMMQALTKENCHTEPTD--MQCL-----------  1020

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDAL-----------SYQQGSSS  688
              D   E + E++  E P+++E     L        V  +++           +       
Sbjct  1021  -DKLPECSVEKSKVEIPDTQENLENSLKLTQSSSTVATNSVKPLLRGERIDTTVTHFGLK  1079

Query  689   TSCNGDKTLETRLGLENAVNKSP----------------LERAPSAGSILSDKIDCAWTG  820
             T   G+  L++  G  ++V   P                LER  S+ S LSD+ID AWTG
Sbjct  1080  TDITGEVPLQSAEGCSSSVVPGPSERPNDGILTNELEKTLERTRSSASNLSDRIDLAWTG  1139

Query  821   I-----DPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQE  985
                   DPS   M+    +             + VD P+ +++ +P R+ SFDSA+  + 
Sbjct  1140  SSQFANDPSKCSMEALPVIPA-----------ALVDHPSYQKVMAPIRINSFDSAINFKN  1188

Query  986   RISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTT  1165
             R+S    PS              D   +IR   S       +AL R  Q L        T
Sbjct  1189  RLS----PS-------------DDSDGIIRRAYSQKP---PKALERTGQVL------CPT  1222

Query  1166  FTSHASILPE----GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT-----  1318
             F +  S+ PE      R ++P+N   DVV+ +YD+EP+S+I++A++  +Y  +++     
Sbjct  1223  FKNELSV-PEIMHGEGRFLLPQNA-TDVVVPIYDDEPSSMIAHAMTVPDYHKFLSPLLDQ  1280

Query  1319  --DKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFS  1492
               D    S G     D++  S  +  +STW    +   D    G+  S+D          
Sbjct  1281  HNDLAKFSAGNSLDQDSSSRS--SLDVSTW----NYSSDQPRTGNNDSKDI---------  1325

Query  1493  DPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWS  1672
                   H  +SFED+   +  K KFSVTCYFAKQFDA+R+KCCP ELD+IRSLSRCKRWS
Sbjct  1326  ------HLTLSFEDDDSISVDKAKFSVTCYFAKQFDAIRRKCCPDELDYIRSLSRCKRWS  1379

Query  1673  AQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGI  1852
             AQGGKSNVYFAK+LD+RF+IKQ+ +TELDSFE++A +YF+YLT+S SSGSPTCLAKV+G+
Sbjct  1380  AQGGKSNVYFAKTLDDRFVIKQVTRTELDSFEDYAAEYFKYLTESVSSGSPTCLAKVLGL  1439

Query  1853  YQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNF  2029
             YQV  ++L+ GKE K+D++VMENLFY + ISR+YDLKGS+RSRYN DT   NKVLLDLN 
Sbjct  1440  YQVVARNLRDGKELKLDVMVMENLFYKKKISRIYDLKGSLRSRYNPDTSGNNKVLLDLNL  1499

Query  2030  LESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMR  2209
             LE+L TKPIFLGSKAKR LERAVWNDTSFLA V VMDYSLLVG+DEE KELV+GIIDY+R
Sbjct  1500  LETLHTKPIFLGSKAKRRLERAVWNDTSFLASVDVMDYSLLVGIDEESKELVMGIIDYLR  1559

Query  2210  QYTWDKHLETW  2242
             QYTWDK LETW
Sbjct  1560  QYTWDKQLETW  1570



>ref|XP_008380740.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X2 [Malus domestica]
Length=1642

 Score =   528 bits (1360),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 331/783 (42%), Positives = 464/783 (59%), Gaps = 76/783 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ ++FN + +Q WI KE  E++ +A+ L++
Sbjct  834   RDCLRFYGFGKMVACFRYASIDVYSVYLPPAKVDFNYE-KQEWIQKETDEVIDRAELLFS  892

Query  182   EISSAVQKLEEKCASVGCDWNNM---NGLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
             E+ + ++++ EK +  G   + M      H  I+EL+ ML +EK  + +L Q T    ++
Sbjct  893   EVXNVLRQIAEKRSGSGSHSSGMVTPESRHQ-IVELEGMLQREKVEFEELLQKTLNREAK  951

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFS----SQHPENAVSC-----  505
             +GQ  ID+LE+NRLR  LL   + WDHRL Y  S+ +N  S    S  P+          
Sbjct  952   KGQPVIDILEINRLRRQLLFQSYMWDHRLVYAASLENNRHSDGLNSSIPDEGKPATNSED  1011

Query  506   ------INPGEW--GGETIFKDGSLEHAYEE------NVH-EFPNSEECPGEGLHSEHDE  640
                   INPG+     ++   D  L   ++        VH E  N E   G     E+++
Sbjct  1012  IADNVAINPGKSYNSCDSFLVDTMLNKGFDHGEDIANTVHSEMVNKERDSGRNSKYENED  1071

Query  641   PPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTG  820
                  D +S        +C+    L+ R G+  +++             LSD +D AWTG
Sbjct  1072  QCNLSDGVS--------TCDQSDPLKPRAGIRKSLSDGQFPVIMD----LSDTLDTAWTG  1119

Query  821   IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKR  1000
                  ++     + ++  R V   G      SP    L       + D A   +++   +
Sbjct  1120  -----ENQCGFGTAKDSTRTVPVLGLADSSASPVKDGL-------NLDHA---EDQNGPK  1164

Query  1001  LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--  1174
             L  S S LST K      D  + ++ P  N     ++     +QKL+ L   +  + S  
Sbjct  1165  LAHSASGLST-KGSENMEDSVSWLKMPFLNFYF--NKNFLSASQKLDTLGEYNPVYVSSF  1221

Query  1175  HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSE--GGW  1348
                 L  GARL++P  G  D V+ VYD+EPTS+ISYAL+S +Y+  ++D    +   G  
Sbjct  1222  RELELKGGARLLLPV-GVNDTVVPVYDDEPTSLISYALASPDYQLQISDDGERTRDNGDV  1280

Query  1349  GVSDT---NKESPIASKLSTWQR-FGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHP  1516
              +SD+       P     S   R FGS +   +   +YGS  + G     ++    + H 
Sbjct  1281  SLSDSLAMQSHHPDDDTTSESHRSFGSTEESLLP--TYGSRSSLGLDPLSYTK---ALHA  1335

Query  1517  RISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNV  1696
             R+SF D+S    G+VK+SVTCY+AK+F+ALR+ CCPSELD++RSLSRCK+W AQGGKSNV
Sbjct  1336  RVSFGDDS--PLGQVKYSVTCYYAKRFEALRRICCPSELDYVRSLSRCKKWGAQGGKSNV  1393

Query  1697  YFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHL  1876
             +FAKSLD+RFIIKQ+ KTEL+SF +FAP YF+YL++S  + SPTCLAK++GIYQV  KHL
Sbjct  1394  FFAKSLDDRFIIKQVTKTELESFIKFAPSYFKYLSESIGTKSPTCLAKILGIYQVTSKHL  1453

Query  1877  KGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKP  2053
             KGGKE+K+D++VMENL +GR+I+R+YDLKGS RSRYN D+  +NKVLLD N +E++ T P
Sbjct  1454  KGGKESKIDVLVMENLLFGRNITRLYDLKGSSRSRYNPDSSGSNKVLLDQNLIEAMPTSP  1513

Query  2054  IFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHL  2233
             IF+G+K KR LERAVWNDT+FLA + VMDYSLLVGVDEE  ELVLGIID+MRQYTWDKHL
Sbjct  1514  IFVGNKPKRVLERAVWNDTAFLASIDVMDYSLLVGVDEENHELVLGIIDFMRQYTWDKHL  1573

Query  2234  ETW  2242
             ETW
Sbjct  1574  ETW  1576



>ref|XP_004303752.1| PREDICTED: 1-phosphatidylinositol 3-phosphate 5-kinase fab1-like 
[Fragaria vesca subsp. vesca]
Length=1818

 Score =   530 bits (1364),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 331/793 (42%), Positives = 461/793 (58%), Gaps = 90/793 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPPS L+F S+ +Q WI KE  E++ +A+ L++
Sbjct  1002  RDCLRFYGFGKMVACFRYASIDVHSVYLPPSKLDFISK-KQEWIQKETNEVVDRAELLFS  1060

Query  182   EISSAVQKLEEKCASVGCDWNNM---NGLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
             E+ +A++++ EK +  G   + +      H  I+EL+ ML KEK  + +L Q T     +
Sbjct  1061  EVLNALRQIVEKRSGSGSITSGILTAESRHQ-IVELEGMLQKEKVEFEELLQKTLTREPK  1119

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGE  532
             +GQ  ID+LE+NRLR  L    + WDHRL Y  S+ +N+F     ++++S   P E    
Sbjct  1120  KGQPVIDILEINRLRRQLFFQSYMWDHRLVYAASLDNNSF-----QDSLSSSIPAE----  1170

Query  533   TIFKDGSLEHAYEENVHEFPNSEECPGEGLHS--EHDEPPVPKDALSYQQGSSSTSCNGD  706
                       A  E +    + E  PG+G +S   +    + +D   +  G +S + N D
Sbjct  1171  ------EKPMATNEKLAGM-DVERKPGKGYNSCDSYLVDTLLRDGFDHDGGFTSPAINAD  1223

Query  707   KTLETRLGLENAVNK-----------------SPL------ERAPSAGSI-----LSDKI  802
                   + + N +NK                 +PL       R  S G +     LSD +
Sbjct  1224  MVHAAHVDMNNDLNKDKGQANLPTSTSVGAQFAPLTPRTGHRRVLSDGELPRMLNLSDTL  1283

Query  803   DCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
             + AWTG            +L +G +   +   +  V         S   +    +  R  
Sbjct  1284  ETAWTG-----------ENLMKGVKARENTCPVPVVPVENSSNASSVEGLNLNHAEARNG  1332

Query  983   ERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSST  1162
              +++  + P+   LST K      D    ++ P  N     ++     AQK + L   + 
Sbjct  1333  TKVAHHVSPA---LST-KGSENMEDRARWLKMPFLNFYWSLNKNFLSAAQKFDTLGEYNP  1388

Query  1163  TFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMS  1336
              + S      L  GARL++P  G  D V+ VYD+EP S+I+YAL S +YK   +D+   +
Sbjct  1389  VYISSFRELELEGGARLLLPV-GDNDTVVPVYDDEPASLIAYALVSSDYKLQTSDEGERA  1447

Query  1337  EGGWGV------SDTNKESPIASKLSTWQR-FGSLDLDYMHFGSYGSEDASGRIGFLFSD  1495
             +    V      +D+    P    +S   R  GS +   +          SG  G L  D
Sbjct  1448  KDNGDVVATVSFTDSVIMHPDDDTVSETHRSLGSTEESILSM--------SGSRGSLGLD  1499

Query  1496  P---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKR  1666
             P     + H R+SF D+     G+VK+SVTCY+AK+F+ALRK CCPSELDF+RSL RCK+
Sbjct  1500  PLSYTKALHARVSFGDD--GPLGQVKYSVTCYYAKRFEALRKMCCPSELDFVRSLGRCKK  1557

Query  1667  WSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVV  1846
             W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL+DS S+GSPTCLAK++
Sbjct  1558  WGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSDSISTGSPTCLAKIL  1617

Query  1847  GIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDL  2023
             GIYQV  KH+KGGKETKMD+++MENL +GR+++RVYDLKGS RSRYN D+  +NKVLLD 
Sbjct  1618  GIYQVTSKHVKGGKETKMDVLIMENLLFGRTVTRVYDLKGSSRSRYNPDSSGSNKVLLDQ  1677

Query  2024  NFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDY  2203
             N +E++ T PIF+G+KAKR LERAVWNDT+FLA + VMDYSLLVGVDEE+ ELVLGIID+
Sbjct  1678  NLIEAMPTSPIFVGNKAKRLLERAVWNDTAFLASIDVMDYSLLVGVDEEKHELVLGIIDF  1737

Query  2204  MRQYTWDKHLETW  2242
             MRQYTWDKHLETW
Sbjct  1738  MRQYTWDKHLETW  1750



>ref|XP_006369088.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
 gb|ERP65657.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
Length=1763

 Score =   527 bits (1357),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 337/780 (43%), Positives = 461/780 (59%), Gaps = 90/780 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++LSV LPPS ++F+ ++ Q W+ KE  E++ +A+ L +
Sbjct  973   RDCLRFYGFGQMVACFRYASINVLSVYLPPSRVDFSFEN-QEWMQKETDEVVNRAELLLS  1031

Query  182   EISSAVQKLEEKCASVGCDWNNMNG------LHNCILELKDMLMKE-KNYWNDLHQPTHE  340
             E+ +A+ ++ EK     C    +N       L   I EL+ ML KE   +   LH+    
Sbjct  1032  EVLNALSQISEK----RCKIEQLNSGMKLPELRRQIAELELMLQKEMAEFEESLHKVLSR  1087

Query  341   ETSEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGE  520
             E  + GQ  ID+LE+NRLR  LL   + WD+RL Y  S+ DN+F   H ++  S      
Sbjct  1088  EV-KNGQPVIDILEINRLRRQLLFQSYMWDNRLIYAASL-DNSF---HDDSNSST-----  1137

Query  521   WGGETIFKDGSLEHAYEENVHEFPNSEEC--------PGEGLHSEHDEPPVPKDAL--SY  670
                            YEE + E  NS+          PG G  S  D P V    L  S 
Sbjct  1138  -------------SGYEEKLLEPDNSDRLVEENMGHRPGNGF-SSCDFPSVEAKLLKGSD  1183

Query  671   QQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAWTGIDPSS  835
             QQG   ++ N    L  ++  E   +     R  S G +     LSD +D AWTG     
Sbjct  1184  QQGGFGSNTN----LSDKVDQEMDESGGNFFRTLSDGQVPIMANLSDTLDAAWTG-----  1234

Query  836   QDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSP  1015
             ++     +L++   R++        DS   +   +   +   D   R +++   ++  SP
Sbjct  1235  ENHPGVGTLKDDNNRLS--------DSAMEESSTTAVGLEGVDLEGRAKDQDGSKVCYSP  1286

Query  1016  SYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASIL  1189
             S   + K      DY + +R P  N     ++     ++KL  L   +  + S   +  L
Sbjct  1287  SPALSAKDPDNMEDYMSWLRMPFLNFYRSLNKNFLTSSEKLGTLGEYNPVYVSSFRSLEL  1346

Query  1190  PEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNK  1369
               GARL++P  G  D VI VYD+EPTS+ISYAL+S EY   +TD+      G  + DT +
Sbjct  1347  QGGARLLLPV-GVNDTVIPVYDDEPTSLISYALASPEYHAQLTDE------GERIKDTGE  1399

Query  1370  ESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDP---KLSPHPRIS  1525
              S  +S   ++     + LD   + S+GS D      SG    L  DP     + H ++S
Sbjct  1400  SSSFSSLSESFHSLEEVSLDL--YKSFGSTDESILSMSGSRSSLILDPLSYTKAMHVKVS  1457

Query  1526  FEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFA  1705
             F D+S +  GK ++SVTCY+AK+F+ LR+ CCPSELDF+RSLSRCK+W AQGGKSNV+FA
Sbjct  1458  FGDDSPD--GKARYSVTCYYAKRFETLRRICCPSELDFVRSLSRCKKWGAQGGKSNVFFA  1515

Query  1706  KSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGG  1885
             K+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S SS SPTCLAK++GIYQV  K+LKGG
Sbjct  1516  KTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESISSRSPTCLAKILGIYQVTSKNLKGG  1575

Query  1886  KETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFL  2062
             KETKMD++VMENL Y R ++R+YDLKGS RSRYN D+  +NKVLLD N +E++ T PIF+
Sbjct  1576  KETKMDVLVMENLLYRRKVTRLYDLKGSSRSRYNPDSSGSNKVLLDQNLIEAMPTSPIFV  1635

Query  2063  GSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             G+K+KR LERAVWNDTSFLA + VMDYSLLVGVDEE+ EL LGIID+MRQYTWDKHLETW
Sbjct  1636  GNKSKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELALGIIDFMRQYTWDKHLETW  1695



>ref|XP_006342901.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Solanum tuberosum]
Length=1783

 Score =   526 bits (1356),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 348/792 (44%), Positives = 471/792 (59%), Gaps = 93/792 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPPS L+FN ++ Q WI  EV E++ +A+ L+A
Sbjct  976   RDCLRFYGFGKMVACFRYASIDVHSVYLPPSKLDFNYEN-QEWIQHEVNEVIFRAELLFA  1034

Query  182   EISSAVQKLEEKCASVGCDWN-NMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEG  358
             E+ +A++ L EK +    + + N+      I +L+ ML KEK  + +  Q    E  ++G
Sbjct  1035  EVLNAIRLLVEKRSGRQLNSSINVPEARRQISDLEGMLQKEKQEFEESLQRILMEEVKKG  1094

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFD------NNFSSQHPENAVSCINPGE  520
             Q+ +D+LE+NRLR  LL   + WDHRL Y  S+ D       + +S  PE  + C     
Sbjct  1095  QS-VDILEINRLRRQLLFQSYVWDHRLVYAASMDDKSHWINGDVTSLEPEKPLVC-----  1148

Query  521   WGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHS--EHDEPPVPKDA-LSYQQGSSST  691
                +  F D  L++  + +  + PNS E     L +    DE  V +++ +      S+ 
Sbjct  1149  ---DDKFTD--LDNCADPS--KCPNSSESVPAILKAGENGDEGSVGQNSHVDAVHQESAV  1201

Query  692   SCNGDKTLETRLGLENAVNK---SPLE-------RAPSAGSI-----LSDKIDCAWTGID  826
               + D  +E   GL  A      S LE       RA SAG       LSD ++ AWTG  
Sbjct  1202  DFDADCAIEKPPGLPVATKSFCGSHLEESILQRQRALSAGQFPNMESLSDTLEAAWTGET  1261

Query  827   PSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALR---IQERISK  997
              S                      +  +   TCK    P  V +  + +      E    
Sbjct  1262  TSG---------------------VVVIKGDTCKS-SEPLLVNTLTTGMAEKVYTEDHGT  1299

Query  998   RLPPSPSYLSTLKSFHAYGDYRNMIRDP-VSNIQMICSQALPREAQKLNLLPSSSTTFTS  1174
              L  SPS L++ K      D  + +  P +S  +M+    LP  AQKL+ L   +  + S
Sbjct  1300  ILSQSPSLLAS-KGSENMEDAGSWLGMPFISFYRMLNKNFLP-SAQKLDPLGGYNPVYIS  1357

Query  1175  --HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGW  1348
                 S    GARL++P  G  D VI VYD+EPTSIISYAL+S +Y   ++D+    +   
Sbjct  1358  SFRESDAQSGARLLLPV-GVNDTVIPVYDDEPTSIISYALASHDYHAQLSDELEKFKDAS  1416

Query  1349  GVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDP------KLSP  1510
               S+ +  S  +S L + Q F  + L+   + S GS D S     L S P       L P
Sbjct  1417  LDSNFSFHSLDSSNLHSPQSFDEMVLE--SYRSLGSMDES-----LLSLPISRSSFDLDP  1469

Query  1511  -------HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRW  1669
                    H R+SF D+   + GKVK+SVTCY+AK+F+ALR+ CCPSE+DFIRSLSRCK+W
Sbjct  1470  LSYTKTLHARVSFGDD--GSLGKVKYSVTCYYAKRFEALRRICCPSEMDFIRSLSRCKKW  1527

Query  1670  SAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVG  1849
              AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF+YL++S  +GSPTCLAK++G
Sbjct  1528  GAQGGKSNVFFAKTLDDRFIIKQVTKTELESFMKFAPEYFKYLSESIITGSPTCLAKILG  1587

Query  1850  IYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLN  2026
             IYQV+ K LKGGKE+KMD++VMENL +GR ++R+YDLKGS RSRYN D + +NKVLLD N
Sbjct  1588  IYQVSSKQLKGGKESKMDVLVMENLLFGRKLARLYDLKGSARSRYNPDASGSNKVLLDQN  1647

Query  2027  FLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYM  2206
              +ES+ T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELV+GIID+M
Sbjct  1648  LIESMPTSPIFVGNKAKRLLERAVWNDTAFLAAVDVMDYSLLVGVDEEKNELVVGIIDFM  1707

Query  2207  RQYTWDKHLETW  2242
             RQYTWDKHLETW
Sbjct  1708  RQYTWDKHLETW  1719



>ref|XP_008380739.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Malus domestica]
Length=1831

 Score =   527 bits (1358),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 331/783 (42%), Positives = 464/783 (59%), Gaps = 76/783 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ ++FN + +Q WI KE  E++ +A+ L++
Sbjct  1023  RDCLRFYGFGKMVACFRYASIDVYSVYLPPAKVDFNYE-KQEWIQKETDEVIDRAELLFS  1081

Query  182   EISSAVQKLEEKCASVGCDWNNM---NGLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
             E+ + ++++ EK +  G   + M      H  I+EL+ ML +EK  + +L Q T    ++
Sbjct  1082  EVXNVLRQIAEKRSGSGSHSSGMVTPESRHQ-IVELEGMLQREKVEFEELLQKTLNREAK  1140

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFS----SQHPENAVSC-----  505
             +GQ  ID+LE+NRLR  LL   + WDHRL Y  S+ +N  S    S  P+          
Sbjct  1141  KGQPVIDILEINRLRRQLLFQSYMWDHRLVYAASLENNRHSDGLNSSIPDEGKPATNSED  1200

Query  506   ------INPGEW--GGETIFKDGSLEHAYEE------NVH-EFPNSEECPGEGLHSEHDE  640
                   INPG+     ++   D  L   ++        VH E  N E   G     E+++
Sbjct  1201  IADNVAINPGKSYNSCDSFLVDTMLNKGFDHGEDIANTVHSEMVNKERDSGRNSKYENED  1260

Query  641   PPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTG  820
                  D +S        +C+    L+ R G+  +++             LSD +D AWTG
Sbjct  1261  QCNLSDGVS--------TCDQSDPLKPRAGIRKSLSDGQFPVIMD----LSDTLDTAWTG  1308

Query  821   IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKR  1000
                  ++     + ++  R V   G      SP    L       + D A   +++   +
Sbjct  1309  -----ENQCGFGTAKDSTRTVPVLGLADSSASPVKDGL-------NLDHA---EDQNGPK  1353

Query  1001  LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--  1174
             L  S S LST K      D  + ++ P  N     ++     +QKL+ L   +  + S  
Sbjct  1354  LAHSASGLST-KGSENMEDSVSWLKMPFLNFYF--NKNFLSASQKLDTLGEYNPVYVSSF  1410

Query  1175  HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSE--GGW  1348
                 L  GARL++P  G  D V+ VYD+EPTS+ISYAL+S +Y+  ++D    +   G  
Sbjct  1411  RELELKGGARLLLPV-GVNDTVVPVYDDEPTSLISYALASPDYQLQISDDGERTRDNGDV  1469

Query  1349  GVSDT---NKESPIASKLSTWQR-FGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHP  1516
              +SD+       P     S   R FGS +   +   +YGS  + G     ++    + H 
Sbjct  1470  SLSDSLAMQSHHPDDDTTSESHRSFGSTEESLLP--TYGSRSSLGLDPLSYTK---ALHA  1524

Query  1517  RISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNV  1696
             R+SF D+S    G+VK+SVTCY+AK+F+ALR+ CCPSELD++RSLSRCK+W AQGGKSNV
Sbjct  1525  RVSFGDDS--PLGQVKYSVTCYYAKRFEALRRICCPSELDYVRSLSRCKKWGAQGGKSNV  1582

Query  1697  YFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHL  1876
             +FAKSLD+RFIIKQ+ KTEL+SF +FAP YF+YL++S  + SPTCLAK++GIYQV  KHL
Sbjct  1583  FFAKSLDDRFIIKQVTKTELESFIKFAPSYFKYLSESIGTKSPTCLAKILGIYQVTSKHL  1642

Query  1877  KGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKP  2053
             KGGKE+K+D++VMENL +GR+I+R+YDLKGS RSRYN D+  +NKVLLD N +E++ T P
Sbjct  1643  KGGKESKIDVLVMENLLFGRNITRLYDLKGSSRSRYNPDSSGSNKVLLDQNLIEAMPTSP  1702

Query  2054  IFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHL  2233
             IF+G+K KR LERAVWNDT+FLA + VMDYSLLVGVDEE  ELVLGIID+MRQYTWDKHL
Sbjct  1703  IFVGNKPKRVLERAVWNDTAFLASIDVMDYSLLVGVDEENHELVLGIIDFMRQYTWDKHL  1762

Query  2234  ETW  2242
             ETW
Sbjct  1763  ETW  1765



>gb|KDP40633.1| hypothetical protein JCGZ_24632 [Jatropha curcas]
Length=1840

 Score =   525 bits (1351),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 334/796 (42%), Positives = 460/796 (58%), Gaps = 92/796 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+ACFRY+ I++LSV LPP  L+FN +S Q W+ KE  E++ +A+ L++
Sbjct  1020  RDCLRFYGFGSMVACFRYASINVLSVYLPPPKLDFNFES-QEWVQKETDEVVDRAQLLFS  1078

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHN--CILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+  A+  + EK        N M  L +   I EL+  L K K  + +  Q       ++
Sbjct  1079  EVLKALNGIAEKRTCSASPNNGMKLLESRRQIGELEAQLEKMKLEFEESLQKALNREVKK  1138

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+LE+N+LR  LL     W+H L+   S  DN+      ++  +C + G      
Sbjct  1139  GQPVIDILEINKLRRQLLLIALVWNHNLHAANSD-DNSL-----QDDANCSDSGREEKPP  1192

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEP------------------PVPKDA  661
                      A  E ++E  N ++ PG+G  S +  P                  P  +  
Sbjct  1193  ---------ANTEQLNEM-NVDDKPGKGFSSSNSLPEDTKLLKIPDQQGGFDSNPTNQSG  1242

Query  662   LSYQQGSSSTSCNGDKTLETRLGLENAVNKSP--LE------RAPSAG-----SILSDKI  802
             ++  +   S   N  K     L    A++  P  LE      R  S G     S LSD +
Sbjct  1243  ITQLEIDVSQDFNHTKENHADLSTAIAISDQPESLECSGNVCRTMSEGQAPTMSNLSDTL  1302

Query  803   DCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
             D AWTG +     +     L++G   ++        DS       +   +   D   R++
Sbjct  1303  DAAWTGENHPGTGL-----LKDGTSVLS--------DSAAGDSSTTSTALEGLDFCNRVE  1349

Query  983   ERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSST  1162
             +    ++  SP    ++K      +  + +R P  N+    ++     ++KL+ +   + 
Sbjct  1350  DPNGTKVSYSPLPALSIKGSENMEESGSYLRIPFLNLYRSLNKNFLPTSEKLDTMGEYTP  1409

Query  1163  TFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK-PYM  1333
              + S      L  GARL+ P + + D VI VYD+EPTSIISYAL+S EY+  +TD+   M
Sbjct  1410  VYVSLFRELELQGGARLLDPLS-KNDCVIPVYDDEPTSIISYALASPEYQGKLTDEGERM  1468

Query  1334  SEGGWGVSDTNKESPIASK---------LSTWQRFGSLDLDYMHFGSYGSEDASGRIGFL  1486
              +GG   S  N    IAS+         + + +  GSL+   +          SG    L
Sbjct  1469  KDGGDFNSSLNLSDSIASQSFLSVDDVTIDSHRSLGSLEESILSI--------SGSRSSL  1520

Query  1487  FSDP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSR  1657
               DP     + H R+SF DE     GKVK+SVTCYFAK+F+ALR+ CCPSELDFIRSLSR
Sbjct  1521  ILDPLSYAKTLHARVSFADEH----GKVKYSVTCYFAKRFEALRRICCPSELDFIRSLSR  1576

Query  1658  CKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLA  1837
             C++W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF+YL++S SS SPTCLA
Sbjct  1577  CRKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPEYFKYLSESISSRSPTCLA  1636

Query  1838  KVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVL  2014
             K++GIYQV  KHLKGGKE+KMD++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVL
Sbjct  1637  KILGIYQVTSKHLKGGKESKMDVLVMENLLFGRNVTRLYDLKGSSRSRYNPDSSGSNKVL  1696

Query  2015  LDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGI  2194
             LD N +E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGI
Sbjct  1697  LDQNLIEAMPTSPIFVGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELVLGI  1756

Query  2195  IDYMRQYTWDKHLETW  2242
             ID+MRQYTWDKHLETW
Sbjct  1757  IDFMRQYTWDKHLETW  1772



>ref|XP_011072684.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
[Sesamum indicum]
Length=1818

 Score =   524 bits (1349),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 342/784 (44%), Positives = 456/784 (58%), Gaps = 73/784 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L+FN ++ Q WI +E+ E++R+A+ L++
Sbjct  1000  RDCLRFYGFGKMVACFRYASIDVHSVYLPPPKLDFNYET-QEWIERELNEVVRRAELLFS  1058

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHN--CILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+  A+  L EK +        MN   +   I +L+ ML KEK+ + +  Q    + +++
Sbjct  1059  EVLKALYLLVEKKSGRSLLNGGMNITESRGQIADLEGMLQKEKSEFEESIQKILNKEAKK  1118

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNN------FSSQHP----------  487
             GQ  ID+LELNRLR  L+   + WDHRL Y +S+   N       +S  P          
Sbjct  1119  GQPIIDILELNRLRRQLIFQSYMWDHRLIYADSVDVENEPDVVEVTSSEPIQKPPSDTEK  1178

Query  488   ---ENAVSCINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSE--HDEPPVP  652
                 NA+  I+      E+I      E   +  V + PN+        HSE  H    V 
Sbjct  1179  NLDRNALVKISKFLGNSESIAAVTKPEQNPDHGVSDMPNN--------HSEISHQRSDVF  1230

Query  653   KDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPS  832
              ++    Q   + S     T E+   L  A  +  L    +  S LSD +D AWTG    
Sbjct  1231  LNSDHGNQNPLALSHGTQATDESDPLLSGATVRRALSDGQAPVS-LSDTLDAAWTG----  1285

Query  833   SQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPS  1012
                 + H     G  +  SF  L    + +   +     V      L +      ++  S
Sbjct  1286  ----ESHPC--TGIPKNNSFSGLVEAHTSSAVGVSDKLDVEDHKDDLTMS-----KVSQS  1334

Query  1013  PSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASI  1186
             PS  ST  S +A  D  + +  P  +     +      AQKL+ L   +  + S    S 
Sbjct  1335  PSVSSTKGSDNAE-DTVSWLGMPFVSFYRSLNINFLGTAQKLDTLSEYNPVYISSFRESE  1393

Query  1187  LPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTN  1366
             L  GARL++P  G  D VI VYD+EPTSIISYAL S +Y   ++D+P   +      DT 
Sbjct  1394  LQGGARLLLPV-GANDTVIPVYDDEPTSIISYALVSPDYFVQLSDEPDRPK------DT-  1445

Query  1367  KESPIASKL---STWQRFGSLDLDYMHFGSYGSEDAS-----GRIGFLFSDP---KLSPH  1513
              ES I+ +      +  F SLD     + S GS D S             DP     + H
Sbjct  1446  AESLISMQSLDSGNFPSFHSLDEMLESYRSLGSVDESFLSLTSSRNSSSLDPLSHTKALH  1505

Query  1514  PRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSN  1693
              R+SF D+     GKVK++VTCY+AK+F+ALR+ CCPSE+DFIRSLSRCK+W AQGGKSN
Sbjct  1506  ARVSFGDD--GPLGKVKYTVTCYYAKRFEALRRICCPSEVDFIRSLSRCKKWGAQGGKSN  1563

Query  1694  VYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKH  1873
             V+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S  S SPTCLAK++GIYQV  KH
Sbjct  1564  VFFAKTLDDRFIIKQVTKTELESFIKFAPGYFKYLSESVGSRSPTCLAKILGIYQVTSKH  1623

Query  1874  LKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTK  2050
             LKGGKETKMD++VMENL +GR+I+R+YDLKGS RSRYN D+  +NKVLLD N +E++ T 
Sbjct  1624  LKGGKETKMDVLVMENLLFGRNITRLYDLKGSSRSRYNPDSSGSNKVLLDQNLIEAMPTS  1683

Query  2051  PIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKH  2230
             PIF+G+KAKR LERAVWNDT+FLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKH
Sbjct  1684  PIFVGNKAKRLLERAVWNDTAFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKH  1743

Query  2231  LETW  2242
             LETW
Sbjct  1744  LETW  1747



>ref|XP_006342900.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Solanum tuberosum]
Length=1784

 Score =   523 bits (1346),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 348/793 (44%), Positives = 471/793 (59%), Gaps = 94/793 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPPS L+FN ++ Q WI  EV E++ +A+ L+A
Sbjct  976   RDCLRFYGFGKMVACFRYASIDVHSVYLPPSKLDFNYEN-QEWIQHEVNEVIFRAELLFA  1034

Query  182   EISSAVQKLEEKCASVGCDWN-NMNGLHNCILELKDMLMKEKN-YWNDLHQPTHEETSEE  355
             E+ +A++ L EK +    + + N+      I +L+ ML KEK  +  +  Q    E  ++
Sbjct  1035  EVLNAIRLLVEKRSGRQLNSSINVPEARRQISDLEGMLQKEKQEFEQESLQRILMEEVKK  1094

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFD------NNFSSQHPENAVSCINPG  517
             GQ+ +D+LE+NRLR  LL   + WDHRL Y  S+ D       + +S  PE  + C    
Sbjct  1095  GQS-VDILEINRLRRQLLFQSYVWDHRLVYAASMDDKSHWINGDVTSLEPEKPLVC----  1149

Query  518   EWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHS--EHDEPPVPKDA-LSYQQGSSS  688
                 +  F D  L++  + +  + PNS E     L +    DE  V +++ +      S+
Sbjct  1150  ----DDKFTD--LDNCADPS--KCPNSSESVPAILKAGENGDEGSVGQNSHVDAVHQESA  1201

Query  689   TSCNGDKTLETRLGLENAVNK---SPLE-------RAPSAGSI-----LSDKIDCAWTGI  823
                + D  +E   GL  A      S LE       RA SAG       LSD ++ AWTG 
Sbjct  1202  VDFDADCAIEKPPGLPVATKSFCGSHLEESILQRQRALSAGQFPNMESLSDTLEAAWTGE  1261

Query  824   DPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALR---IQERIS  994
               S                      +  +   TCK    P  V +  + +      E   
Sbjct  1262  TTSG---------------------VVVIKGDTCKS-SEPLLVNTLTTGMAEKVYTEDHG  1299

Query  995   KRLPPSPSYLSTLKSFHAYGDYRNMIRDP-VSNIQMICSQALPREAQKLNLLPSSSTTFT  1171
               L  SPS L++ K      D  + +  P +S  +M+    LP  AQKL+ L   +  + 
Sbjct  1300  TILSQSPSLLAS-KGSENMEDAGSWLGMPFISFYRMLNKNFLP-SAQKLDPLGGYNPVYI  1357

Query  1172  S--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGG  1345
             S    S    GARL++P  G  D VI VYD+EPTSIISYAL+S +Y   ++D+    +  
Sbjct  1358  SSFRESDAQSGARLLLPV-GVNDTVIPVYDDEPTSIISYALASHDYHAQLSDELEKFKDA  1416

Query  1346  WGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDP------KLS  1507
                S+ +  S  +S L + Q F  + L+   + S GS D S     L S P       L 
Sbjct  1417  SLDSNFSFHSLDSSNLHSPQSFDEMVLE--SYRSLGSMDES-----LLSLPISRSSFDLD  1469

Query  1508  P-------HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKR  1666
             P       H R+SF D+   + GKVK+SVTCY+AK+F+ALR+ CCPSE+DFIRSLSRCK+
Sbjct  1470  PLSYTKTLHARVSFGDD--GSLGKVKYSVTCYYAKRFEALRRICCPSEMDFIRSLSRCKK  1527

Query  1667  WSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVV  1846
             W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF+YL++S  +GSPTCLAK++
Sbjct  1528  WGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFMKFAPEYFKYLSESIITGSPTCLAKIL  1587

Query  1847  GIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDL  2023
             GIYQV+ K LKGGKE+KMD++VMENL +GR ++R+YDLKGS RSRYN D + +NKVLLD 
Sbjct  1588  GIYQVSSKQLKGGKESKMDVLVMENLLFGRKLARLYDLKGSARSRYNPDASGSNKVLLDQ  1647

Query  2024  NFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDY  2203
             N +ES+ T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELV+GIID+
Sbjct  1648  NLIESMPTSPIFVGNKAKRLLERAVWNDTAFLAAVDVMDYSLLVGVDEEKNELVVGIIDF  1707

Query  2204  MRQYTWDKHLETW  2242
             MRQYTWDKHLETW
Sbjct  1708  MRQYTWDKHLETW  1720



>ref|XP_002303331.2| hypothetical protein POPTR_0003s06990g [Populus trichocarpa]
 gb|EEE78310.2| hypothetical protein POPTR_0003s06990g [Populus trichocarpa]
Length=1819

 Score =   522 bits (1345),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 328/777 (42%), Positives = 463/777 (60%), Gaps = 70/777 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++LSV LPP+ ++F+S++ Q W  KE  E++ +A+ L++
Sbjct  1015  RDCLRFYGFGKMVACFRYASINVLSVYLPPAKVDFSSEN-QEWTQKETDEVVNQAELLFS  1073

Query  182   EISSAVQKLEEKCASVGCDWNNMNGL-----HNCILELKDMLMKEK-NYWNDLHQPTHEE  343
             E+ +A+ ++ EK   +     N +G+        I E + ML KEK  +   LH+  ++E
Sbjct  1074  EVLNALSQISEKRCKIE---QNNSGMKLPESRRQIAEFESMLQKEKAEFEESLHKVLNKE  1130

Query  344   TSEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNF-------SSQHPENAVS  502
               + GQ+ ID+LE+NRLR  LL   + WD+RL Y  S+ +N+F       +S      + 
Sbjct  1131  L-KNGQSVIDILEINRLRRQLLFQSYMWDNRLVYAASLDNNSFHDGSNSSTSGQEVKPLG  1189

Query  503   CINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGS  682
               N  +   E +  D  L  A  +      N+ +C   G   +  + P      S+ +G 
Sbjct  1190  PANSDKLIEENV--DAKLLKASNQQGGFGSNTNQCDAVGQEIDVCQGP------SHGKGG  1241

Query  683   SSTSCNGDKTLETRLGLENAVNKSPLERAPSAG-----SILSDKIDCAWTGIDPSSQDMQ  847
              +   N    +  R   +   +     R  S G     + LSD +D AWTG     ++  
Sbjct  1242  QA---NPFAAMPARDLSDIKESGGNFFRTLSDGQDPVMANLSDTLDAAWTG-----ENQP  1293

Query  848   VHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLS  1027
                + ++   R++        DS   +   +   +        +++++  ++  SPS   
Sbjct  1294  GSGTFKDDNSRLS--------DSAMEESSTTAVGLEGVGLEGHVEDQVGSKVCYSPSPAL  1345

Query  1028  TLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGA  1201
             + K      D  + +R P  N     +      ++KL+ L   +  + S      L + A
Sbjct  1346  STKDPDNMEDSMSWLRMPFLNFYRSFNNNCLTSSEKLDSLREYNPVYISSFRKLKLQDQA  1405

Query  1202  RLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPI  1381
             RL++P  G  D VI VYD+EPTS+ISYAL S+EY   +TD+      G  V ++ + SP 
Sbjct  1406  RLLLPV-GVNDTVIPVYDDEPTSLISYALVSQEYHAQLTDE------GERVKESGEFSPF  1458

Query  1382  ASKLSTWQRFGSLD-LDYMHFGSYGSED-----ASGRIGFLFSDP---KLSPHPRISFED  1534
             +S   T   F S D   +  + S+GS D      SG  G L  DP     + H R+SF D
Sbjct  1459  SSLSDTM--FHSFDETSFDSYRSFGSTDESILSMSGSRGSLILDPLSYTKALHARVSFGD  1516

Query  1535  ESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSL  1714
             +S    GK ++SVTCY+AK+F+ALR+ CCPSELD+IRSLSRCK+W AQGGKSNV+FAK+L
Sbjct  1517  DS--PVGKARYSVTCYYAKRFEALRRICCPSELDYIRSLSRCKKWGAQGGKSNVFFAKTL  1574

Query  1715  DERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKET  1894
             D+RFIIKQ+ KTEL+SF +FAP YF+YL++S SS SPTCLAK++GIYQV  K LKGGKET
Sbjct  1575  DDRFIIKQVTKTELESFIKFAPAYFKYLSESISSRSPTCLAKILGIYQVTSKLLKGGKET  1634

Query  1895  KMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSK  2071
             KMD++VMENL + R ++R+YDLKGS RSRYNSD+  +NKVLLD N +E++ T PIF+G+K
Sbjct  1635  KMDVLVMENLLFRRKVTRLYDLKGSSRSRYNSDSSGSNKVLLDQNLIEAMPTSPIFVGNK  1694

Query  2072  AKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1695  AKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1751



>ref|XP_009766673.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X2 [Nicotiana sylvestris]
Length=1773

 Score =   521 bits (1343),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 333/785 (42%), Positives = 463/785 (59%), Gaps = 91/785 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPPS L+F  ++ Q WI +EV E++ +A+ L++
Sbjct  978   RDCLRFYGFGKMVACFRYASIDVHSVYLPPSKLDFYYEN-QEWIQQEVNEVIGRAELLFS  1036

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             ++ +A++ L EK +  G   N        I +L+ ML KEK  + +  Q    +  ++GQ
Sbjct  1037  DVLNAIRVLVEKRS--GRQLNRRQ-----IADLERMLQKEKEEFEESLQRILMKEVKKGQ  1089

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI------FDNNFSSQHPENAVSCI-----  508
             + +D+LE+NRLR  LL   + WDHRL Y  S+       + + +S  PE  + C      
Sbjct  1090  S-VDILEINRLRRQLLFQSYVWDHRLVYAASLDEKTHWINGDVASSEPEKPLVCNDKFTD  1148

Query  509   --NPG--------------EWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDE  640
               NP               E GG T  +    ++++ ++VH+    E   G   +   ++
Sbjct  1149  LDNPSDSSKYPNNSESANFEAGGNTDEEKSVSQNSHVDSVHQ----ESVVGFDANCAIEK  1204

Query  641   PPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTG  820
             PP     L     S   +   +  L+ R  L +          P+  S LSD ++ AWTG
Sbjct  1205  PP----GLPVATKSFCGTHPAESILQGRRALSDG-------HFPNMES-LSDTLEAAWTG  1252

Query  821   IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKR  1000
                S+  +     L++G     + G    V++                      E    +
Sbjct  1253  ETTSAVGI-----LKDGMADTLTTGVAEKVNTED-----------------HGDEESGTK  1290

Query  1001  LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--  1174
             +  SP  LS+ K      D  + +  P  +     +++    AQKL+ L   +  + S  
Sbjct  1291  MSQSPPLLSS-KGSENVEDSGSWLGMPFISFYRTLNKSFLPSAQKLDPLVGYNPVYVSSF  1349

Query  1175  HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGV  1354
               S    GARL++P  G  D VI VYD+EPTSIISYAL+S +Y   ++D+   S+     
Sbjct  1350  RESDARSGARLLLP-IGVNDTVIPVYDDEPTSIISYALASHDYHAQLSDELEKSKDATLD  1408

Query  1355  SDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDP---KLSP  1510
             S+   +S  +  L + Q    + L+   + S GS D      S     L  DP     + 
Sbjct  1409  SNFAIQSLDSGNLQSPQSIDEMVLE--SYRSLGSMDESILSLSVSRSSLDLDPLSYAKTL  1466

Query  1511  HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKS  1690
             H R+SF D+     GKVK++VTCY+AK+F+ALR+ CCPSE++FIRSLSRCK+W AQGGKS
Sbjct  1467  HARVSFADD--GLVGKVKYTVTCYYAKRFEALRRICCPSEMEFIRSLSRCKKWGAQGGKS  1524

Query  1691  NVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVK  1870
             NV+FAK+LDERFIIKQ+ KTEL+SF +FAP+YF+YL++S SSGSPTCLAKVVGIYQV+ K
Sbjct  1525  NVFFAKTLDERFIIKQVTKTELESFMKFAPEYFKYLSESISSGSPTCLAKVVGIYQVSSK  1584

Query  1871  HLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQT  2047
             HLKGGKE+KMD++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD N +E++ T
Sbjct  1585  HLKGGKESKMDVLVMENLLFGRNLTRLYDLKGSARSRYNPDSSGSNKVLLDQNLIEAMPT  1644

Query  2048  KPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDK  2227
              PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDK
Sbjct  1645  SPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDK  1704

Query  2228  HLETW  2242
             HLETW
Sbjct  1705  HLETW  1709



>ref|XP_010227777.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase 
FAB1C [Brachypodium distachyon]
Length=1603

 Score =   518 bits (1335),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 324/767 (42%), Positives = 456/767 (59%), Gaps = 84/767 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LPPSVL+F     Q W+++E +++  + ++ Y 
Sbjct  857   RDCLRFYGFGSMVAVFRYSPVDILSVNLPPSVLDFAYPIAQDWLIEEASDVANRKENFYR  916

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
              IS  +  +E K  +V  D +   GL+  +++LKD++  E+  ++ L    + E+ +  +
Sbjct  917   AISDKLDCIE-KTVTVQ-DVSTNTGLYKHVVDLKDLIKVERKKYDVLSGFLNIESLQTVE  974

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               IDVLELN LR  L+ D H WD RL+ M S+   N  +   +       P     E+  
Sbjct  975   QVIDVLELNHLRRELVLDSHIWDRRLHMMHSLTKENCHTASTDAHCPKKLPESLLEESND  1034

Query  542   KDGSLEHAYEENVHEFPNSEECPGEG---LHSEHDEPPVP-------------KDALSYQ  673
             +  S +   E ++    +S      G   L  E  +  VP             + A +Y 
Sbjct  1035  EISSKQENMENSLEYTQSSSSITDAGKSLLGGEQGDTTVPLLGLKTNIDEVHHQSADTYV  1094

Query  674   QGSSSTSCNGDKTLETRLGLENAVN-KSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV  850
               +S    +G   +++ +   + V  +S LE+  S+ S LSD+ID AW+G          
Sbjct  1095  DSTSLHFVSGPCEIQSDVAAVDEVKLESTLEKPQSSASNLSDRIDLAWSG----------  1144

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
              +S++     V      + +D P+ + + +P R+ SFDS + I+ R+S            
Sbjct  1145  -SSVE-----VLPVVPAAPMDGPSYQNVVAPIRIKSFDSGINIRNRLSPV----------  1188

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLN--LLPSSSTTFTSHASILPEGAR  1204
                     D  N+      +I+   SQ  PR  ++    L P+ +T       +  EG R
Sbjct  1189  --------DGLNV------SIRRAYSQRPPRAFERTGRGLTPTCTTKLLLPGVMDGEG-R  1233

Query  1205  LMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA  1384
             L++ +     VV+ +YD+EP+S+I++A++  EY ++V   P ++              + 
Sbjct  1234  LLLSQ-CTSSVVVPIYDDEPSSMIAHAMTVPEYHNFVL--PLLN--------------LH  1276

Query  1385  SKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVK  1564
             ++   +    S+D D       GS+    R      D  L+    ++FEDE   +  + K
Sbjct  1277  NESDKFSVSNSVDQDSTSRRLSGSDQPQPRTQIDSKDSHLT----VTFEDEDSCSVDRAK  1332

Query  1565  FSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQ  1744
             FSVTCYFAKQFDA+R+KCCP ELD+IRSLSRCKRWSAQGGKSNVYFAK+LD+RFIIKQ+ 
Sbjct  1333  FSVTCYFAKQFDAIRRKCCPDELDYIRSLSRCKRWSAQGGKSNVYFAKTLDDRFIIKQVT  1392

Query  1745  KTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENL  1924
             +TELDSFE++A +YF+YLT+S SSGSP CLAKV+G+YQV  K++K GKE KM+L+VMEN+
Sbjct  1393  RTELDSFEDYAAEYFKYLTESLSSGSPICLAKVLGLYQVVAKNMKDGKELKMELMVMENI  1452

Query  1925  FYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVW  2101
             F+ R +SR+YDLKGS+RSRYN DT   NKVLLDLN LE+L TKPIFLGSKAKR LER+VW
Sbjct  1453  FFNRKVSRIYDLKGSLRSRYNPDTSGNNKVLLDLNLLETLHTKPIFLGSKAKRRLERSVW  1512

Query  2102  NDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             NDTSFLA V VMDYSLLVG+DEERKELV+GIIDY+RQYTWDK LETW
Sbjct  1513  NDTSFLASVDVMDYSLLVGIDEERKELVMGIIDYLRQYTWDKQLETW  1559



>ref|XP_009338309.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Pyrus x bretschneideri]
Length=1847

 Score =   522 bits (1344),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 330/797 (41%), Positives = 464/797 (58%), Gaps = 88/797 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ ++FN + +Q WI KE  E++ +A+ L++
Sbjct  1023  RDCLRFYGFGKMVACFRYASIDVHSVYLPPAKVDFNYE-KQEWIQKETDEVIDRAELLFS  1081

Query  182   EISSAVQKLEEKCASVGCDWNNM---NGLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
             E+ + ++++ EK +  G   + M      H  I+EL+ ML KEK  + +L Q T    ++
Sbjct  1082  EVLNVLRQIAEKRSGSGSHSSGMVTPESRHQ-IVELEGMLQKEKVEFEELLQKTLNREAK  1140

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFS-------------SQHPEN  493
             +GQ  ID+LE+NRLR  LL   + WDHRL Y  S+ +N                + H E+
Sbjct  1141  KGQPVIDILEINRLRRQLLFQSYMWDHRLVYAASLENNRHGDGLNSSIPDEGKPATHSED  1200

Query  494   AVS--CINPGEW--GGETIFKDGSLEHAYEE------NVH-EFPNSEECPGEGLHSEHDE  640
                   INPG+     ++   D  L   ++        VH E  N E   G     E+++
Sbjct  1201  IAGNVAINPGKSYNSCDSFLVDAMLNKGFDHGEDIANTVHSEMVNKERDGGRNSKYENED  1260

Query  641   PPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTG  820
                  D +S        +C+    L+ R G+  +++             LSD +D AWTG
Sbjct  1261  QCNLSDGVS--------TCDQSDPLKPRAGIRKSLSDGQFPVIMD----LSDTLDTAWTG  1308

Query  821   IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKR  1000
                  ++     + ++  R V   G+     SP    L       + D A   +++   +
Sbjct  1309  -----ENQCGFVTAKDSTRTVPVLGRADSSASPVKDGL-------NLDHA---EDQNGPK  1353

Query  1001  LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--  1174
             L  S S LST K      D  + ++ P  N     ++     +QKL+ L   +  + S  
Sbjct  1354  LAHSASGLST-KGSENMEDSVSWLKMPFLNFYRGFNKNFLSASQKLDTLGEYNPVYVSSF  1412

Query  1175  HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGV  1354
                 L  GARL++P  G  D V+ VYD+EPTS+ISYAL+S +Y+  ++ +   +     V
Sbjct  1413  RELELKGGARLLLPV-GVNDTVVPVYDDEPTSLISYALASPDYQLQISGEGERTRDNGDV  1471

Query  1355  S-----DTNKESPIASKLSTWQR-FGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHP  1516
             S      T    P     S   R FGS +   +   +YGS  + G     ++    + H 
Sbjct  1472  SLSDSLTTQLHHPDDDTTSESHRSFGSTEESLL--STYGSRSSLGLDPLSYTK---ALHA  1526

Query  1517  RISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNV  1696
             R+SF D+S    G+VK+SVTCY+AK+F+ALR+ CCPSELD++RSLSRCK+W AQGGKSNV
Sbjct  1527  RVSFGDDS--PLGQVKYSVTCYYAKRFEALRRICCPSELDYVRSLSRCKKWGAQGGKSNV  1584

Query  1697  YFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHL  1876
             +FAKSLD+RFIIKQ+ KTEL+SF +FAP YF YL+++  + SPTCLAK++GIYQV  KHL
Sbjct  1585  FFAKSLDDRFIIKQVTKTELESFIKFAPGYFRYLSEAIGTKSPTCLAKILGIYQVTSKHL  1644

Query  1877  KGG--------------KETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKV  2011
             KGG              KE+K+D++VMENL +GR+I+R+YDLKGS RSRYN D+  +NKV
Sbjct  1645  KGGKXXXXXXXXXLKGRKESKIDVLVMENLLFGRNITRLYDLKGSSRSRYNPDSSGSNKV  1704

Query  2012  LLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLG  2191
             LLD N +E++ T PIF+G+KAKR LERAVWNDT+FLA + VMDYSLLVGVDEE+ ELVLG
Sbjct  1705  LLDQNLIEAMPTSPIFVGNKAKRVLERAVWNDTAFLASIDVMDYSLLVGVDEEKHELVLG  1764

Query  2192  IIDYMRQYTWDKHLETW  2242
             IID+MRQYTWDKHLETW
Sbjct  1765  IIDFMRQYTWDKHLETW  1781



>gb|EEC80352.1| hypothetical protein OsI_22436 [Oryza sativa Indica Group]
Length=1609

 Score =   518 bits (1333),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 338/794 (43%), Positives = 461/794 (58%), Gaps = 126/794 (16%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LPP+VL+F     Q WI+K+ A++  + +  Y 
Sbjct  851   RDCLRFYGYGSMVAVFRYSPVDILSVNLPPAVLDFTYPMAQDWIIKDAADVASRKEYFYK  910

Query  182   EISSAVQKLEEKCASVGCDWNNMN---GLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
             EI   +  +E   ++      NM+   GL   +++LKD++  E   ++ L +    E   
Sbjct  911   EIFDKLDSIENIVSA-----QNMSMKTGLPKHVIDLKDLIKVEWKKYDVLSRFASTENLN  965

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINP------  514
               +  ID+LELNRLR  L+ D H WD RLY M+++   N  +   +  V C++       
Sbjct  966   TLELAIDILELNRLRRELIVDAHIWDRRLYMMQALTKENCHTVPTD--VQCLDKIPESFV  1023

Query  515   ----GEWGGETIFKDGSLEHAYEENVHEFPNSEE--CPGE---------GLHSEHDEPPV  649
                  E  G     + SLEH    ++    NS +    G+         GL ++      
Sbjct  1024  EKPKVEIPGTHENWENSLEHTQSSSLTVAANSIKPLIRGDQIDTIVTHFGLKTDIKGEVP  1083

Query  650   PKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGI--  823
             P+ A  Y    SS+   G         L + + K+  ER+ S+ + LSD+ID AWTG   
Sbjct  1084  PQSAEDY----SSSVVPGPSERPNDGILTDELEKT-FERSRSSATNLSDRIDLAWTGSSQ  1138

Query  824   ---DPSSQDMQ----VHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
                DPS   ++    V A+L               VD P+ +R+ +P R+ SFDSA+  +
Sbjct  1139  LANDPSKCSIEALPVVPAAL---------------VDDPSYQRVIAPIRINSFDSAINFK  1183

Query  983   ERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSN----IQMICSQALPREAQKLN--L  1144
              R+S                            PV      I+   SQ  P+  ++    L
Sbjct  1184  NRLS----------------------------PVDGSDGIIRRAYSQKPPKALERTGRGL  1215

Query  1145  LPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK  1324
              P+  T  +    +  EG RL++   G  DVV+ +YD+EP+S+I++A++  +Y  ++   
Sbjct  1216  SPTFKTELSVPDIMHGEG-RLLLQNAG--DVVVPIYDDEPSSMIAHAMTVPDYHKFML--  1270

Query  1325  PYMSE----GGWGVSDTNKESPIASKLS---TWQRFGSLDLDYMHFGSYGSEDASGRIGF  1483
             P + +    G + V ++  +   +       TW  +GS   D    G+  S+D       
Sbjct  1271  PLLDQQNDLGRFSVGNSLDQDSSSRSSLDVSTWS-YGS---DQPRTGNNDSKDI------  1320

Query  1484  LFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCK  1663
                      H  +SFED+   +  K KFSVTCYFAKQFDA+R+KCCP EL +IRSLSRCK
Sbjct  1321  ---------HLTVSFEDDDSISVDKAKFSVTCYFAKQFDAIRRKCCPDELYYIRSLSRCK  1371

Query  1664  RWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKV  1843
             RWSAQGGKSNVYFAK+LD+RF+IKQ+ +TELDSFE++A +YF+YLT+S SSGSPTCLAKV
Sbjct  1372  RWSAQGGKSNVYFAKTLDDRFVIKQVTRTELDSFEDYAAEYFKYLTESVSSGSPTCLAKV  1431

Query  1844  VGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLD  2020
             +G+YQVA ++L+ GKE K+D++VMENLFY + ISR+YDLKGS+RSRYN DT   NKVLLD
Sbjct  1432  LGLYQVAARNLRDGKELKLDVMVMENLFYKKKISRIYDLKGSLRSRYNPDTSGNNKVLLD  1491

Query  2021  LNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIID  2200
             LN LE+L TKPIFLGSKAKR LERAVWNDTSFLA V VMDYSLLVG+DEE KELV+GIID
Sbjct  1492  LNLLETLHTKPIFLGSKAKRRLERAVWNDTSFLASVDVMDYSLLVGIDEESKELVMGIID  1551

Query  2201  YMRQYTWDKHLETW  2242
             Y+RQYTWDK LETW
Sbjct  1552  YLRQYTWDKQLETW  1565



>ref|XP_010654371.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Vitis vinifera]
 ref|XP_010654372.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Vitis vinifera]
Length=1845

 Score =   521 bits (1342),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 337/791 (43%), Positives = 454/791 (57%), Gaps = 86/791 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ LEFN ++ Q WI KE  E++ +A+ L++
Sbjct  1030  RDCLRFYGFGKMVACFRYASIDVHSVYLPPAKLEFNYEN-QEWIQKETNEVVDRAELLFS  1088

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ +A+ ++ EK   +G     +    + I EL+ ML KEK  + +  Q      +++GQ
Sbjct  1089  EVCNALHRISEKGHGMGL----ITESRHQIAELEGMLQKEKAEFEESLQKAVSREAKKGQ  1144

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFS-------SQHPENAVSC-----  505
               +D+LE+NRLR  LL   + WDHRL Y  S+  N+         S+H E   +      
Sbjct  1145  PLVDILEINRLRRQLLFQSYVWDHRLIYAASLDKNSIVDNVSVSISEHEEKPQATSDKLI  1204

Query  506   -----INPGEW--GGETIFKDGSLEHAYEENVHEFPNSEECPGEGL---HSEHDEPPVPK  655
                  I PG+     +++  D  L           PN     GEG+    S+HD      
Sbjct  1205  DINRPIKPGKGFSSCDSLLVDAKLNKG--------PNQ----GEGISSQSSQHDTVYQGT  1252

Query  656   DALS------YQQG---SSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDC  808
             D +         QG   +SS  C+    LE+ + +  A++      A      LS  +D 
Sbjct  1253  DMVQDSNHKEEDQGNLPASSNVCDQPDPLESGVVVRRALSDGQFPIAED----LSHTLDA  1308

Query  809   AWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQER  988
              WTG        + H      +    +   L+  DS T   L  P ++   D     +ER
Sbjct  1309  KWTG--------ENHPGTGAPKDNTCALPDLALADSSTA--LVVPEKLELED---HTEER  1355

Query  989   ISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTF  1168
                ++  S S L   K      D  +       N     ++     AQKL+ L   +  +
Sbjct  1356  TGLKVTLSFSSLLPAKGQDTIEDSASWSGMSFLNFYRAFNKNFLGSAQKLDTLGEYNPVY  1415

Query  1169  TS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK-PYMSE  1339
              S      L  GARL++P  G  D VI VYD+EPTSII YAL S +Y   + D+     +
Sbjct  1416  VSSFRELELQGGARLLLPV-GVNDTVIPVYDDEPTSIICYALVSPQYHAQLLDEWERPKD  1474

Query  1340  GGWGVSDTNKESPIASKLSTWQRFGSLDLDYMH-FGSYGSED-----ASGRIGFLFSDP-  1498
             GG  +S ++    +       Q F S D      F ++ S D      SG    L  DP 
Sbjct  1475  GGEPMSSSSLSESV-----NLQSFLSFDETVSESFKNFSSIDDSFLSMSGSRSSLVPDPF  1529

Query  1499  --KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWS  1672
                 + H R+ F D+S    GKVK++VTCY+AK+F+ALR+ CCPSELDF+RSL RCK+W 
Sbjct  1530  SYTKALHARVFFSDDS--PLGKVKYTVTCYYAKRFEALRRICCPSELDFLRSLCRCKKWG  1587

Query  1673  AQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGI  1852
             AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+SF +FAP YF+YL++S S+GSPTCLAK++GI
Sbjct  1588  AQGGKSNVFFAKSLDDRFIIKQVTKTELESFIKFAPAYFKYLSESISTGSPTCLAKILGI  1647

Query  1853  YQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNF  2029
             YQV  KHLKGGKE++MDL+VMENL + R+++R+YDLKGS RSRYN+D+   NKVLLD N 
Sbjct  1648  YQVTSKHLKGGKESRMDLLVMENLLFERTVTRLYDLKGSSRSRYNADSSGNNKVLLDQNL  1707

Query  2030  LESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMR  2209
             +E++ T PIF+G+KAKR LERAVWNDTSFLA V VMDYSLLVGVDEE+ ELVLGIID+MR
Sbjct  1708  IEAMPTSPIFVGNKAKRVLERAVWNDTSFLASVDVMDYSLLVGVDEEKHELVLGIIDFMR  1767

Query  2210  QYTWDKHLETW  2242
             QYTWDKHLETW
Sbjct  1768  QYTWDKHLETW  1778



>gb|EEE65479.1| hypothetical protein OsJ_20877 [Oryza sativa Japonica Group]
Length=1609

 Score =   517 bits (1332),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 338/794 (43%), Positives = 461/794 (58%), Gaps = 126/794 (16%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LPP+VL+F     Q WI+K+ A++  + +  Y 
Sbjct  851   RDCLRFYGYGSMVAVFRYSPVDILSVNLPPAVLDFTYPMAQDWIIKDAADVASRKEYFYK  910

Query  182   EISSAVQKLEEKCASVGCDWNNMN---GLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
             EI   +  +E   ++      NM+   GL   +++LKD++  E   ++ L +    E   
Sbjct  911   EIFDKLDSIENIVSA-----QNMSMKTGLPKHVIDLKDLIRVEWKKYDVLSRFASTENLN  965

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINP------  514
               +  ID+LELNRLR  L+ D H WD RLY M+++   N  +   +  V C++       
Sbjct  966   TLELAIDILELNRLRRELIVDAHIWDRRLYMMQALTKENCHTVPTD--VQCLDKIPERFV  1023

Query  515   ----GEWGGETIFKDGSLEHAYEENVHEFPNSEE--CPGE---------GLHSEHDEPPV  649
                  E  G     + SLEH    ++    NS +    G+         GL ++      
Sbjct  1024  EKSKVEIPGTHENWENSLEHTQSSSLTVAANSIKPLIRGDQIDTIVTHFGLKTDIKGEVP  1083

Query  650   PKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGI--  823
             P+ A  Y    SS+   G         L + + K+  ER+ S+ + LSD+ID AWTG   
Sbjct  1084  PQSAEDY----SSSVVPGPSERPNDGILTDELEKT-FERSRSSATNLSDRIDLAWTGSSQ  1138

Query  824   ---DPSSQDMQ----VHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
                DPS   ++    V A+L               VD P+ +R+ +P R+ SFDSA+  +
Sbjct  1139  LANDPSKCSIEALPVVPAAL---------------VDDPSYQRVIAPIRINSFDSAINFK  1183

Query  983   ERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSN----IQMICSQALPREAQKLN--L  1144
              R+S                            PV      I+   SQ  P+  ++    L
Sbjct  1184  NRLS----------------------------PVDGSDGIIRRAYSQKPPKALERTGRGL  1215

Query  1145  LPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK  1324
              P+  T  +    +  EG RL++   G  DVV+ +YD+EP+S+I++A++  +Y  ++   
Sbjct  1216  SPTFKTELSVPDIMHGEG-RLLLQNAG--DVVVPIYDDEPSSMIAHAMTVPDYHKFML--  1270

Query  1325  PYMSE----GGWGVSDTNKESPIASKLS---TWQRFGSLDLDYMHFGSYGSEDASGRIGF  1483
             P + +    G + V ++  +   +       TW  +GS   D    G+  S+D       
Sbjct  1271  PLLDQQNDLGRFSVGNSLDQDSSSRSSLDVSTWS-YGS---DQPRTGNNDSKDI------  1320

Query  1484  LFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCK  1663
                      H  +SFED+   +  K KFSVTCYFAKQFDA+R+KCCP EL +IRSLSRCK
Sbjct  1321  ---------HLTVSFEDDDSISVDKAKFSVTCYFAKQFDAIRRKCCPDELYYIRSLSRCK  1371

Query  1664  RWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKV  1843
             RWSAQGGKSNVYFAK+LD+RF+IKQ+ +TELDSFE++A +YF+YLT+S SSGSPTCLAKV
Sbjct  1372  RWSAQGGKSNVYFAKTLDDRFVIKQVTRTELDSFEDYAAEYFKYLTESVSSGSPTCLAKV  1431

Query  1844  VGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLD  2020
             +G+YQVA ++L+ GKE K+D++VMENLFY + ISR+YDLKGS+RSRYN DT   NKVLLD
Sbjct  1432  LGLYQVAARNLRDGKELKLDVMVMENLFYKKKISRIYDLKGSLRSRYNPDTSGNNKVLLD  1491

Query  2021  LNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIID  2200
             LN LE+L TKPIFLGSKAKR LERAVWNDTSFLA V VMDYSLLVG+DEE KELV+GIID
Sbjct  1492  LNLLETLHTKPIFLGSKAKRRLERAVWNDTSFLASVDVMDYSLLVGIDEESKELVMGIID  1551

Query  2201  YMRQYTWDKHLETW  2242
             Y+RQYTWDK LETW
Sbjct  1552  YLRQYTWDKQLETW  1565



>ref|XP_006828631.1| hypothetical protein AMTR_s00129p00092160 [Amborella trichopoda]
 gb|ERM96047.1| hypothetical protein AMTR_s00129p00092160 [Amborella trichopoda]
Length=1877

 Score =   521 bits (1343),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 338/795 (43%), Positives = 462/795 (58%), Gaps = 84/795 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ +V LPPS L+F+ Q  Q WI KE AE+  +A+  +A
Sbjct  1052  RDCLRFYGFGRMVACFRYASIDVHNVYLPPSKLDFDYQ-HQEWIKKEAAEVTDRAELFFA  1110

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNC--ILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+  +++++ EK  S    ++N     +   I EL+ ML KEK  + +  Q    +   +
Sbjct  1111  EVFDSLRQIGEKTTSSRPLYSNAKAPESRRRIAELEGMLQKEKAEFEESLQKAISKEFNK  1170

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDN--NFSSQHPENAVSCINPGEWGG  529
             GQ  ID+LELNRLR  LL   + WDHRL +++    N    SS H +      NP +   
Sbjct  1171  GQPVIDILELNRLRRQLLFQSYVWDHRLLFLDLSLKNMAATSSDH-KTREELNNPTKPKA  1229

Query  530   ETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSE-------HDEPPV------PKDALSY  670
              T   +    H  E   ++     E P  G+ S+       H E  +      PK    +
Sbjct  1230  TTNSIETVSIHTSEPKQNDNLTGSESPRLGIKSDEALKGGWHSEEDILGLGDDPKHIEDH  1289

Query  671   QQGSSSTSCNGDKT--LETRLGLENAVNKSPLERAPSAG---------------SILSDK  799
             Q+     + N DK    E++  L N++N +     P AG               + LSD 
Sbjct  1290  QE----NNLNPDKIHQKESQFCLTNSLNITDELNFPEAGIGVRRVLSEGHFPILANLSDT  1345

Query  800   IDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRI  979
             +D AWTG     Q +   AS++ G   VA                K PA V   D+ + I
Sbjct  1346  LDAAWTGEGHPQQSL---ASIESGP--VA----------------KDPALV---DTPVTI  1381

Query  980   QERISKRLPPS--PSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPS  1153
              E    +  P      +  +K      D+ +    P  N     S++    A + + L  
Sbjct  1382  LEPSVVKAKPEEVAQPIVHVKGNDHGEDFASWFGAPFLNFYRAYSKSSSGGAPRYDALGD  1441

Query  1154  SSTTFTSHASILPE--GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKP  1327
              + T+ S    L    GARL++P  G  D V+ VYD EPTS+I++AL S++Y   +++  
Sbjct  1442  YNPTYVSSFRELEHQGGARLLLPV-GINDTVVPVYDEEPTSMIAFALVSQDYHSQISED-  1499

Query  1328  YMSEGGWGVSDTNKESPIASKLS-TWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLF  1489
                E G  + D +  S ++   S  +Q      +      S+GS D      SG    L 
Sbjct  1500  --RERGKEIGDYSIPSSLSDVSSHPFQSSIDDSVSSDSLRSFGSLDDGVSIISGSRNSLS  1557

Query  1490  SDPKL---SPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRC  1660
              DP +   + H R+SF DE     GKVK+SVTCY+AK+FDALR+KCCP+ELDFIRSLSRC
Sbjct  1558  LDPLIFTKALHVRVSFTDE--GPLGKVKYSVTCYYAKRFDALRRKCCPTELDFIRSLSRC  1615

Query  1661  KRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAK  1840
             K+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF+YL++S S+GSPTCLAK
Sbjct  1616  KKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPEYFKYLSESLSTGSPTCLAK  1675

Query  1841  VVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLL  2017
             ++GIYQV  KHLKGGKE++MDL+VMENL + R+++R+YDLKGS RSRYN D+  +NKVLL
Sbjct  1676  ILGIYQVTTKHLKGGKESRMDLMVMENLLFRRNVTRLYDLKGSSRSRYNPDSSGSNKVLL  1735

Query  2018  DLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGII  2197
             D N +E++ T PIF+G+KAKR LERAVWNDT+FLA + VMDYSLLVGVD+E+ ELVLGII
Sbjct  1736  DQNLIEAMPTSPIFVGNKAKRLLERAVWNDTAFLASIDVMDYSLLVGVDQEKHELVLGII  1795

Query  2198  DYMRQYTWDKHLETW  2242
             D+MRQYTWDKHLETW
Sbjct  1796  DFMRQYTWDKHLETW  1810



>ref|NP_001061943.1| Os08g0450800 [Oryza sativa Japonica Group]
 dbj|BAF23857.1| Os08g0450800, partial [Oryza sativa Japonica Group]
Length=817

 Score =   497 bits (1280),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 319/791 (40%), Positives = 438/791 (55%), Gaps = 114/791 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPP  L+F SQ  Q W+ +E  E++  A+ L+ 
Sbjct  30    RDCLRFYGFGEMVACFRYASIKVHSVYLPPPKLDFTSQ-HQEWVEQEANEVVDSAELLFT  88

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ ++ E     G    NM    L   I+EL+++L  EK  + +  +    +   +
Sbjct  89    EVLNALHQISEGRPITGSFDGNMKILELRRNIMELEEILQIEKADFTESLKNLLNKEIRK  148

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYM--------ESIFDNNFSSQHPE-------  490
             G+  ID+LE+N+LR  LL   + WD RL ++        +++      S+  +       
Sbjct  149   GKPFIDILEVNKLRRQLLFLCYLWDQRLIFIANSGGKYCDTLGGLRVGSRSSDSNDKSVD  208

Query  491   -NAVSCINPGEWGGETI--FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDA  661
              NA + +     G E +   K+GSL+ +            + P   LH+   EP  P  +
Sbjct  209   TNATTKLEKSSKGSEVLSNAKEGSLKQS------------QSP---LHANDKEPNQPDQS  253

Query  662   LSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLE-------------RAPSAGSI-----  787
                  G+SS    G   +E  +   N  N + ++             R  S G       
Sbjct  254   ----NGNSSRIGAGLNGMEDAIAKINHSNSADVKDNLDHQESSIGVRRVLSDGQFPVNAD  309

Query  788   LSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDS  967
             +SD +D  W G + +  D  +   L   E       Q   V +     ++S   V    S
Sbjct  310   ISDTLDAKWRGENGTVPDTSILKPLALLEGSADLKNQAKAVPTNASLSVRSGDTVEDLSS  369

Query  968   ALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLL  1147
              L++         P  ++  +L +                      S   PR     +  
Sbjct  370   WLKM---------PYMTFYDSLNT---------------------NSGTAPRFGALADYN  399

Query  1148  PSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKP  1327
             P   T F   +     GARL +P  G  DVVI V+D+EPTSIISYAL S  Y   + D+ 
Sbjct  400   PVYITLFRELSQ--QGGARLFLP-TGANDVVIPVFDDEPTSIISYALVSPMYCHQMLDE-  455

Query  1328  YMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMH-FGSYGSED-----ASGRIGFLF  1489
                      +  NK+ P +S       + S + +  H F  +GS D      SG  G   
Sbjct  456   ---------NSKNKDGPDSSL--PLPVYDSGNFNPFHLFEDFGSADDLASSISGTRGSFV  504

Query  1490  SDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRW  1669
              D     H R+ FED      GKVK++VTCY+AK F+ALR+ CCPSELDF+RS+SRCK+W
Sbjct  505   PD---LVHLRVPFED--GGPLGKVKYTVTCYYAKSFEALRRSCCPSELDFLRSISRCKKW  559

Query  1670  SAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVG  1849
              AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+SF +F   YF+YL++S S+GSPT LAK++G
Sbjct  560   GAQGGKSNVFFAKSLDDRFIIKQVTKTELESFLKFGLDYFKYLSESISTGSPTSLAKILG  619

Query  1850  IYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNF  2029
             IYQV +KH+KGGKE+KMDL+VMENL +GR+I+R+YDLKGS RSRYN+D+ +NKVLLD N 
Sbjct  620   IYQVTIKHVKGGKESKMDLLVMENLLFGRNITRLYDLKGSSRSRYNADSSSNKVLLDQNL  679

Query  2030  LESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMR  2209
             +E++ T PIF+G+KAKR LERAVWNDTSFLAG+ VMDYSLLVGVDEE+ ELVLGIID+MR
Sbjct  680   IEAMPTSPIFVGNKAKRLLERAVWNDTSFLAGIDVMDYSLLVGVDEEKHELVLGIIDFMR  739

Query  2210  QYTWDKHLETW  2242
             QYTWDKHLETW
Sbjct  740   QYTWDKHLETW  750



>dbj|BAD46198.1| finger-containing phosphoinositide kinase-like [Oryza sativa 
Japonica Group]
Length=1651

 Score =   518 bits (1333),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 338/794 (43%), Positives = 461/794 (58%), Gaps = 126/794 (16%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LPP+VL+F     Q WI+K+ A++  + +  Y 
Sbjct  893   RDCLRFYGYGSMVAVFRYSPVDILSVNLPPAVLDFTYPMAQDWIIKDAADVASRKEYFYK  952

Query  182   EISSAVQKLEEKCASVGCDWNNMN---GLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
             EI   +  +E   ++      NM+   GL   +++LKD++  E   ++ L +    E   
Sbjct  953   EIFDKLDSIENIVSA-----QNMSMKTGLPKHVIDLKDLIRVEWKKYDVLSRFASTENLN  1007

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINP------  514
               +  ID+LELNRLR  L+ D H WD RLY M+++   N  +   +  V C++       
Sbjct  1008  TLELAIDILELNRLRRELIVDAHIWDRRLYMMQALTKENCHTVPTD--VQCLDKIPERFV  1065

Query  515   ----GEWGGETIFKDGSLEHAYEENVHEFPNSEE--CPGE---------GLHSEHDEPPV  649
                  E  G     + SLEH    ++    NS +    G+         GL ++      
Sbjct  1066  EKSKVEIPGTHENWENSLEHTQSSSLTVAANSIKPLIRGDQIDTIVTHFGLKTDIKGEVP  1125

Query  650   PKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGI--  823
             P+ A  Y    SS+   G         L + + K+  ER+ S+ + LSD+ID AWTG   
Sbjct  1126  PQSAEDY----SSSVVPGPSERPNDGILTDELEKT-FERSRSSATNLSDRIDLAWTGSSQ  1180

Query  824   ---DPSSQDMQ----VHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
                DPS   ++    V A+L               VD P+ +R+ +P R+ SFDSA+  +
Sbjct  1181  LANDPSKCSIEALPVVPAAL---------------VDDPSYQRVIAPIRINSFDSAINFK  1225

Query  983   ERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSN----IQMICSQALPREAQKLN--L  1144
              R+S                            PV      I+   SQ  P+  ++    L
Sbjct  1226  NRLS----------------------------PVDGSDGIIRRAYSQKPPKALERTGRGL  1257

Query  1145  LPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK  1324
              P+  T  +    +  EG RL++   G  DVV+ +YD+EP+S+I++A++  +Y  ++   
Sbjct  1258  SPTFKTELSVPDIMHGEG-RLLLQNAG--DVVVPIYDDEPSSMIAHAMTVPDYHKFML--  1312

Query  1325  PYMSE----GGWGVSDTNKESPIASKLS---TWQRFGSLDLDYMHFGSYGSEDASGRIGF  1483
             P + +    G + V ++  +   +       TW  +GS   D    G+  S+D       
Sbjct  1313  PLLDQQNDLGRFSVGNSLDQDSSSRSSLDVSTWS-YGS---DQPRTGNNDSKDI------  1362

Query  1484  LFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCK  1663
                      H  +SFED+   +  K KFSVTCYFAKQFDA+R+KCCP EL +IRSLSRCK
Sbjct  1363  ---------HLTVSFEDDDSISVDKAKFSVTCYFAKQFDAIRRKCCPDELYYIRSLSRCK  1413

Query  1664  RWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKV  1843
             RWSAQGGKSNVYFAK+LD+RF+IKQ+ +TELDSFE++A +YF+YLT+S SSGSPTCLAKV
Sbjct  1414  RWSAQGGKSNVYFAKTLDDRFVIKQVTRTELDSFEDYAAEYFKYLTESVSSGSPTCLAKV  1473

Query  1844  VGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLD  2020
             +G+YQVA ++L+ GKE K+D++VMENLFY + ISR+YDLKGS+RSRYN DT   NKVLLD
Sbjct  1474  LGLYQVAARNLRDGKELKLDVMVMENLFYKKKISRIYDLKGSLRSRYNPDTSGNNKVLLD  1533

Query  2021  LNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIID  2200
             LN LE+L TKPIFLGSKAKR LERAVWNDTSFLA V VMDYSLLVG+DEE KELV+GIID
Sbjct  1534  LNLLETLHTKPIFLGSKAKRRLERAVWNDTSFLASVDVMDYSLLVGIDEESKELVMGIID  1593

Query  2201  YMRQYTWDKHLETW  2242
             Y+RQYTWDK LETW
Sbjct  1594  YLRQYTWDKQLETW  1607



>ref|XP_009596386.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Nicotiana tomentosiformis]
Length=1775

 Score =   518 bits (1335),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 332/785 (42%), Positives = 460/785 (59%), Gaps = 91/785 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPPS L+F  ++ Q WI +EV E++ +A+ L++
Sbjct  979   RDCLRFYGFGKMVACFRYASIDVHSVYLPPSKLDFYYEN-QEWIRQEVNEVIGRAELLFS  1037

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             ++ +A++ L EK +  G   N        I +L+ ML KEK  + +  Q    +  ++GQ
Sbjct  1038  DVLNAIRVLVEKRS--GRQLNRRQ-----IADLEGMLQKEKEEFEESLQRVLIKEVKKGQ  1090

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI------FDNNFSSQHPENAVSCI-----  508
             + +D+LE+NRLR  LL   + WDHRL Y  S+       + + +S  PE  + C      
Sbjct  1091  S-VDILEINRLRRQLLFQSYVWDHRLVYAASLDEKTHWINGDVASSEPEKPLVCNDKFSD  1149

Query  509   --NPG--------------EWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDE  640
               NP               E GG+        ++++ ++VH+    E   G   +   ++
Sbjct  1150  LDNPADSSKYPNNSDSANFEAGGKADEGKSVSQNSHVDSVHQ----ESVVGFDANCAIEK  1205

Query  641   PPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTG  820
             PP     L     S   +   +  L+ R  L +          P+  S LSD ++ AWTG
Sbjct  1206  PP----GLPVATKSFCVTHPAESILQGRRALSDG-------HFPNMES-LSDTLEAAWTG  1253

Query  821   IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKR  1000
                S+  M     L+ G     + G    V++                      E    +
Sbjct  1254  ETTSAVGM-----LKGGMADTLTTGVAEKVNTED-----------------HGDEESGTK  1291

Query  1001  LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--  1174
             +  SP  LS+ K      D  + +  P  +     +++    AQKL+ L   +  + S  
Sbjct  1292  MSQSPPLLSS-KGSENMEDSGSWLGMPFISFYRTLNKSFLPSAQKLDPLVGYNPVYVSSF  1350

Query  1175  HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGV  1354
               S    GARL++P  G  D VI VYD+EPTSIISYAL S +Y   ++D+   S+     
Sbjct  1351  RESDARSGARLLLPV-GVNDTVIPVYDDEPTSIISYALVSHDYHAQLSDELEKSKDATLD  1409

Query  1355  SDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDP---KLSP  1510
             S+   +S  +  + + Q    + L+   + S GS D      S     L  DP     + 
Sbjct  1410  SNFAIQSLESGNMQSPQSIDEMVLE--SYRSLGSVDESILSLSISRSSLDLDPLSYGKTL  1467

Query  1511  HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKS  1690
             H R+SF D+     GKVK++VTCY+AK+F+ALR+ CCPSE++FIRSLSRCK+W AQGGKS
Sbjct  1468  HARVSFADD--GLVGKVKYTVTCYYAKRFEALRRICCPSEMEFIRSLSRCKKWGAQGGKS  1525

Query  1691  NVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVK  1870
             NV+FAK+LDERFIIKQ+ KTEL+SF +FAP+YF+YL++S SSGSPTCLAKVVGIYQV+ K
Sbjct  1526  NVFFAKTLDERFIIKQVTKTELESFMKFAPEYFKYLSESISSGSPTCLAKVVGIYQVSSK  1585

Query  1871  HLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQT  2047
             HLKGGKE+KMD++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD N +E++ T
Sbjct  1586  HLKGGKESKMDVLVMENLLFGRNLTRLYDLKGSARSRYNPDSSGSNKVLLDQNLIEAMPT  1645

Query  2048  KPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDK  2227
              PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDK
Sbjct  1646  SPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDK  1705

Query  2228  HLETW  2242
             HLETW
Sbjct  1706  HLETW  1710



>ref|XP_007214898.1| hypothetical protein PRUPE_ppa000102mg [Prunus persica]
 gb|EMJ16097.1| hypothetical protein PRUPE_ppa000102mg [Prunus persica]
Length=1821

 Score =   519 bits (1337),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 330/778 (42%), Positives = 457/778 (59%), Gaps = 70/778 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ L+FN + +Q WI KE  E++ +A+ L++
Sbjct  1016  RDCLRFYGFGKMVACFRYASIDVHSVYLPPAKLDFNYE-KQEWIQKETDEVVERAELLFS  1074

Query  182   EISSAVQKLEEKCASVGCDWNNM---NGLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
             E+ +A++++ EK +  G   + M      H  I+EL+ ML KEK  + +L Q T    + 
Sbjct  1075  EVLNALRQIAEKRSGSGSHTSGMVTPESRHQ-IVELEGMLQKEKVEFEELLQKTLNREAR  1133

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNN-----FSSQHPENAVSCINPG  517
             +GQ  ID+LE+NRLR  LL   + WDHRL Y  ++ DNN      +S  P+     +N G
Sbjct  1134  KGQPVIDILEINRLRRQLLFQSYMWDHRLIYAANL-DNNSLQDGLNSSVPDERKPVVNNG  1192

Query  518   EWGGETI-FKDGSLEHAYEEN-VHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSST  691
                   +  K G   ++ +   V    N E   G    S  D   V      Y+      
Sbjct  1193  NIADMNVAIKPGKCYNSCDSFLVDAMLNKEFDHGGDFDSTADTDMV------YKGRDIGQ  1246

Query  692   SCNGDKTLETRLGLENAV--------NKSPLERAPSAGSI----LSDKIDCAWTGIDPSS  835
               N +K  E  L  E ++         ++ + +  S G      LSD +D AWTG     
Sbjct  1247  DSNNEKEDEANLPGEVSICDQSEPLKPRTSMRKTLSDGQFPIMDLSDTLDTAWTG-----  1301

Query  836   QDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARV-YSFDSA-LRIQERISKRLPP  1009
                +  + +   +    +   L+  DS       SP +   + D A  +   +++  + P
Sbjct  1302  ---ENQSGIGIAKDNTCAVPVLAMADSNA-----SPVKEGLNLDHAEYQNGPKVAHSVSP  1353

Query  1010  SPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HAS  1183
             +   LST K      D  + ++ P  N     ++     AQKL+ L   +  + S     
Sbjct  1354  A---LST-KGSENMEDSVSWLKMPFLNFYRGFNKNFLSAAQKLDTLGEYNPVYVSSFREL  1409

Query  1184  ILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDT  1363
              L  GARL++P  G  D V+ VYD+EPTS+I+YAL S +Y    +D     EG    SD+
Sbjct  1410  ELEGGARLLLPV-GVNDTVVPVYDDEPTSLIAYALVSPDYHLQTSD-----EGDASFSDS  1463

Query  1364  ---NKESPIASKLSTWQR-FGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFE  1531
                    P     S   R FGS +   +     GS ++ G     ++    + H R+SF 
Sbjct  1464  LTMQSHHPDDDTASESHRSFGSTEESILSLS--GSRNSLGLDPLSYTK---ALHARVSFG  1518

Query  1532  DESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKS  1711
             D+     GKVK+SVTCY+A +F+ALR+ CCPSELDF+RSLSRCK+W AQGGKSNV+FAK+
Sbjct  1519  DD--GPLGKVKYSVTCYYANRFEALRRICCPSELDFVRSLSRCKKWGAQGGKSNVFFAKT  1576

Query  1712  LDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKE  1891
              D+RFIIKQ+ KTEL+SF +FAP YF+YL++S  +GSPTCLAK++GIYQV  KHLKGGKE
Sbjct  1577  SDDRFIIKQVTKTELESFIKFAPGYFKYLSESIGTGSPTCLAKILGIYQVTSKHLKGGKE  1636

Query  1892  TKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGS  2068
             +K D++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD N +E++ T PIF+G+
Sbjct  1637  SKTDVLVMENLLFGRNVTRLYDLKGSSRSRYNPDSSGSNKVLLDQNLIEAMPTSPIFVGN  1696

Query  2069  KAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             KAKR LERAVWNDT+FLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1697  KAKRLLERAVWNDTAFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1754



>ref|XP_002438189.1| hypothetical protein SORBIDRAFT_10g009370 [Sorghum bicolor]
 gb|EER89556.1| hypothetical protein SORBIDRAFT_10g009370 [Sorghum bicolor]
Length=1578

 Score =   515 bits (1326),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 336/770 (44%), Positives = 457/770 (59%), Gaps = 103/770 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LP SVL+F     Q W++KE  ++  + + LY 
Sbjct  845   RDCLRFYGLGSMVAVFRYSPVDILSVNLPSSVLDFAYPKAQDWVIKEAVDVCARKEHLYK  904

Query  182   EISSAVQKLEE--KCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             EI   +  +E+  K  ++G      +GLH  + +LK+++  E   ++ +   +  +  + 
Sbjct  905   EIVVKLDCIEKIVKDQNIGMK----SGLHKHVADLKELVKVEWKKYDVVSGFSIIDDLQT  960

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGE-  532
              +  IDVLELNRLR  L+ D+H WD RLY M S+   N  +  P +A       E   E 
Sbjct  961   FEPYIDVLELNRLRRELVLDIHVWDRRLYMMHSLTKENCRTV-PNDAECSEKLTESLLEQ  1019

Query  533   ----TIFKDGSLEHAYEENVHEFPNSEECPGEGLHS-----EHDEPPVPK------DALS  667
                 T  K  ++E++ E+N    P+  E     + S     E     V +        LS
Sbjct  1020  SKDVTSGKHLNVENSLEQNQ---PSMLEVAAVSVKSSSPMMEQTNTCVSRLETNIMGDLS  1076

Query  668   YQQGSSSTS-CNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDM  844
                GS+  S   G   +++   L        L+++ S+ S LSD+ID AWTG   S Q +
Sbjct  1077  MHSGSTVISFAPGPCEMQSEGVLAELEAGKFLQKSQSSASNLSDRIDLAWTG---SGQFV  1133

Query  845   QVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYL  1024
             +  +S  E      SF   S  D P  +++ +P R+ SFDSA+                 
Sbjct  1134  KDSSSSVEA----VSFVPASLKDDPAYQKVIAPIRIKSFDSAV-----------------  1172

Query  1025  STLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASI--LPEG  1198
                         RN + D  ++I+   SQ  P+  ++       S TF +  S+  + +G
Sbjct  1173  ----------SSRN-VDDSNASIRRSYSQRPPKAIERTG--KGLSPTFLNKLSLSGMIDG  1219

Query  1199  -ARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKES  1375
              +RL++ +N   +V++ +YD+EP+S+I++A++  EY+ ++   P +        D N ES
Sbjct  1220  ESRLLLSQN-DSNVIVPIYDDEPSSMIAHAMTIPEYRSFLL--PLL--------DQNNES  1268

Query  1376  PIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGG  1555
              + +                    YGS+      G    D  L+    +SFEDE   +  
Sbjct  1269  SLLN--------------------YGSDQPQPTTGNDSKDNHLT----VSFEDEDSYSVD  1304

Query  1556  KVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIK  1735
             K KFSVTCYFAKQFDA+R+KCCP ELD+IRSLSRCKRWSAQGGKSNVYFAK+LD+RF+IK
Sbjct  1305  KAKFSVTCYFAKQFDAIRRKCCPDELDYIRSLSRCKRWSAQGGKSNVYFAKTLDDRFVIK  1364

Query  1736  QMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVM  1915
             Q+ +TELDSFE++A  YF+YLTDS SSGSPTCL KV+G+YQ+  K+L+ GKE KMD++VM
Sbjct  1365  QVTRTELDSFEDYAVDYFKYLTDSVSSGSPTCLTKVLGLYQITAKNLRDGKELKMDVMVM  1424

Query  1916  ENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLER  2092
             ENLF+ R +SR+YDLKGS+RSRYN DT   NKVLLDLN LE+L TKPIFLGSKAKR LER
Sbjct  1425  ENLFFKRKVSRIYDLKGSLRSRYNPDTSGNNKVLLDLNLLETLHTKPIFLGSKAKRRLER  1484

Query  2093  AVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AVWNDTSFLA V VMDYSLLVG+DEERKELV+GIIDY+RQYTWDK LETW
Sbjct  1485  AVWNDTSFLASVDVMDYSLLVGIDEERKELVMGIIDYLRQYTWDKQLETW  1534



>ref|XP_010096542.1| 1-phosphatidylinositol-3-phosphate 5-kinase [Morus notabilis]
 gb|EXB64662.1| 1-phosphatidylinositol-3-phosphate 5-kinase [Morus notabilis]
Length=1832

 Score =   518 bits (1335),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 330/800 (41%), Positives = 465/800 (58%), Gaps = 111/800 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++LSV LPP  L+FN ++ Q WI KE  +++ + + L++
Sbjct  1023  RDCLRFYGFGKMVACFRYASINVLSVYLPPPKLDFNYEN-QEWIQKETDKVVDRMELLFS  1081

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E  +A+ ++EEK ++ G            I+EL+ +L KEK  + +    T  + +++GQ
Sbjct  1082  EALNALSQIEEKRSNCGLRTPES---RRQIVELEGILQKEKEEFEESLLKTLNKEAKKGQ  1138

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               ID+LE+NRLR  LL   + WDHRL Y  S+ +++F     +N    I+  E  G++I 
Sbjct  1139  PLIDILEINRLRRQLLFQSYMWDHRLIYAASLDNHSFR----DNLSRSISAHE--GKSI-  1191

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHS-----------EHDEPPV-------------  649
                       ENV +  N    PG+G HS           +  + PV             
Sbjct  1192  -------PNSENVADV-NVTIKPGKGYHSCDSFLVDAKVDKSSDYPVKFGSDADQSSTVF  1243

Query  650   PKDALSYQQGS----SSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWT  817
             P+     + G+    S+  C+  +  E+++ +   +++       +    LS+  + AWT
Sbjct  1244  PEPNCEKEDGAHLTPSTNGCDQSELSESKVKVRRVLSEGEFPITTN----LSETFEAAWT  1299

Query  818   GIDPSSQDMQVHASLQEGERRV---------ASFGQLSHVDSPTCKRLKSPARVYSFDSA  970
             G     ++     +L+E    +         ASFG    ++         P  V SF   
Sbjct  1300  G-----ENHTATGTLKEDTNTLSDSTIADSSASFGVTDKLNLDQADEHDEPKVVNSF---  1351

Query  971   LRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLP  1150
                             Y S+ KS     D  + +R P  N     ++      QKL+ L 
Sbjct  1352  ----------------YASSTKSPENLEDSISWLRMPFLNFYRSLNKNFFSSTQKLDPLG  1395

Query  1151  SSSTTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK  1324
               +  + S    S L  G RL++P  G  D VI VYD+EP SIISYAL+S EY   V+D+
Sbjct  1396  VYNPIYVSAFRESELQGGGRLLLPV-GVNDTVIPVYDDEPASIISYALASPEYHLQVSDE  1454

Query  1325  PYMSEGGWG-----VSDTNKESPIASKLSTWQ---RFGSLDLDYMHFGSYGSEDASGRIG  1480
               M + G        SD+N  S  +S+ +  +    FGS +  ++ F    S D      
Sbjct  1455  GEMPKDGGDSMSSLFSDSNFRSFHSSEDTASEARRSFGSSEEGFLSFSGSRSLDP-----  1509

Query  1481  FLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRC  1660
               FS  K + H R+SF ++     GKVK+SVTCY+AK+FDALR+ CCPSELDFIRSLSRC
Sbjct  1510  --FSYAK-ALHARVSFGED--GPLGKVKYSVTCYYAKRFDALRRICCPSELDFIRSLSRC  1564

Query  1661  KRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYL-----TDSHSSGSP  1825
             K+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF+YL     T S ++GSP
Sbjct  1565  KKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPEYFKYLSESITTGSPTTGSP  1624

Query  1826  TCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-  2002
             TCLA+++GIYQV  +H KGGKE+KMD++VMENL +GR+++R+YDLKGS RSRYN+D+   
Sbjct  1625  TCLARILGIYQVTSRHQKGGKESKMDVLVMENLLFGRNVTRLYDLKGSSRSRYNNDSSGR  1684

Query  2003  NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKEL  2182
             NKVLLD N +E++ T PIFLG+KAKR LERAVWNDT+FLA + VMDYSLLVG+DEE+ EL
Sbjct  1685  NKVLLDQNLIEAMPTSPIFLGTKAKRFLERAVWNDTAFLASIDVMDYSLLVGLDEEKHEL  1744

Query  2183  VLGIIDYMRQYTWDKHLETW  2242
             V+GIID+MRQYTWDKHLE+W
Sbjct  1745  VVGIIDFMRQYTWDKHLESW  1764



>ref|XP_004235530.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Solanum lycopersicum]
Length=1782

 Score =   517 bits (1332),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 341/789 (43%), Positives = 470/789 (60%), Gaps = 86/789 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPPS L+FN ++ Q WI  EV E++ +A+ L+A
Sbjct  974   RDCLRFYGFGKMVACFRYASIDVHSVYLPPSKLDFNYEN-QEWIEHEVNEVIFRAELLFA  1032

Query  182   EISSAVQKLEEKCASVGCDWN-NMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEG  358
             E+ +A++ L EK +    + + N+      I +L+ ML KEK  + +  Q    E  ++G
Sbjct  1033  EVLNAIRLLVEKRSGRQLNSSINVPEARRQISDLEGMLQKEKQEFEESLQRILMEEVKKG  1092

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI------FDNNFSSQHPENAVSCINPGE  520
             Q+ +D+LE+NRLR  LL   + WDHRL Y  S+      F  + +S  PE  + C +   
Sbjct  1093  QS-VDILEINRLRRQLLFQSYVWDHRLVYAASMDDKSHWFSGDVTSLEPEKPLVCDD---  1148

Query  521   WGGETIFKDGSLEHAYEENVHEFPNSEE-CPG---EGLHSEHDEPPVPKDALSYQQGSSS  688
                    K   L++  + +    PNS E  P     G + +          +      S+
Sbjct  1149  -------KSTDLDNCADPS--NCPNSSESVPAILKAGENGDEGRSVGQNSHVDAVHQESA  1199

Query  689   TSCNGDKTLETRLGLENAVN--------KSPLER--APSAGSI-----LSDKIDCAWTGI  823
                + D  +E   GL  A          +S L+R  A SAG       LSD ++ AWTG 
Sbjct  1200  VDFDADCAIEKPPGLPVATKSFCGSHPEESILQRRRALSAGQFPNMESLSDTLEAAWTGE  1259

Query  824   DPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRL  1003
               S         + +G+   +S   L  V++ T    +   +VY+ D A  + +      
Sbjct  1260  TTSG------VVVIKGDTCKSSEPHL--VNTLTTGMAE---KVYTEDHATMLSQ------  1302

Query  1004  PPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--H  1177
               +PS L++  S +       +    +S  + +    LP  AQKL+ L   +  + S   
Sbjct  1303  --TPSLLASKGSENMEDAGSWLGVSFISFYRTLNKNFLP-SAQKLDPLGGYNPVYISSFR  1359

Query  1178  ASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVS  1357
              S    GARL++P  G  D VI VYD+EPTSIISYAL+S +Y   ++ +   S+     S
Sbjct  1360  ESDAQSGARLLLPV-GVNDTVIPVYDDEPTSIISYALASHDYHAQLSGELEKSKDASLDS  1418

Query  1358  DTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDP------KLSP---  1510
             + +  S  +S L + Q    + L+   + S GS D S     L S P       L P   
Sbjct  1419  NFSFHSLDSSNLHSPQSVDEMFLE--SYRSLGSMDES-----LLSLPISRSSFDLDPLSY  1471

Query  1511  ----HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQ  1678
                 H R+SF D+   + GKVK+SVTCY+AK+F+ALR+ CCPSE+DFIRSLSRCK+W AQ
Sbjct  1472  TKTLHARVSFGDD--GSLGKVKYSVTCYYAKRFEALRRICCPSEMDFIRSLSRCKKWGAQ  1529

Query  1679  GGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQ  1858
             GGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF+YL++S  +GSPTCLAK++GIYQ
Sbjct  1530  GGKSNVFFAKTLDDRFIIKQVTKTELESFMKFAPEYFKYLSESIITGSPTCLAKILGIYQ  1589

Query  1859  VAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLE  2035
             V+ K LKGGKE+KMD++VMENL +GR ++R+YDLKGS RSRYN D+  +NKVLLD N +E
Sbjct  1590  VSSKQLKGGKESKMDVLVMENLLFGRKLARLYDLKGSARSRYNPDSSGSNKVLLDQNLIE  1649

Query  2036  SLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQY  2215
             S+ T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELV+GIID+MRQY
Sbjct  1650  SMPTSPIFVGNKAKRLLERAVWNDTAFLAAVDVMDYSLLVGVDEEKNELVVGIIDFMRQY  1709

Query  2216  TWDKHLETW  2242
             TWDKHLETW
Sbjct  1710  TWDKHLETW  1718



>ref|XP_011015189.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Populus euphratica]
Length=1818

 Score =   517 bits (1331),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 324/777 (42%), Positives = 458/777 (59%), Gaps = 70/777 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++LSV LPP+ ++F+S++ Q W  KE  E++ +A+ L++
Sbjct  1014  RDCLRFYGFGKMVACFRYASINVLSVYLPPAKVDFSSEN-QEWTQKETDEVVNQAELLFS  1072

Query  182   EISSAVQKLEEKCASVGCDWNNMNGL-----HNCILELKDMLMKEK-NYWNDLHQPTHEE  343
             E+ +A+ ++ E+   +     N +G+        I E + ML KEK  +   LH+  ++E
Sbjct  1073  EVLNALSQISERRCKIE---QNNSGMKLPESRRQIAEFELMLQKEKVEFEESLHKVMNKE  1129

Query  344   TSEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNF-------SSQHPENAVS  502
               + GQ+ ID+LE+NRLR  LL   + WD+RL Y  S+ +N+F       +S   E  + 
Sbjct  1130  L-KNGQSVIDILEINRLRRQLLFQSYMWDNRLVYAASLDNNSFHDGSNSSTSGQEEKPLG  1188

Query  503   CINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGS  682
               N  +   E +  D  L  A  +      N+ +C  +G  ++  + P      S+ +G 
Sbjct  1189  PANSDKLIEENV--DAKLLKASNQQGGFGSNTNQCDADGQETDVCQGP------SHGKGG  1240

Query  683   SSTSCNGDKTLETRLGLENAVNKSPLERAPSAG-----SILSDKIDCAWTGIDPSSQDMQ  847
              +   N    +  R   +   +     R  S G     + LSD +D AWTG     ++  
Sbjct  1241  QA---NPFAAMPARDLSDIKESGGSYFRTLSDGQDPVMANLSDTLDAAWTG-----ENQP  1292

Query  848   VHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLS  1027
                + ++   R++        DS   +   +   +        +++++  ++  SPS   
Sbjct  1293  GSGTFKDDNSRLS--------DSAVEESSTTGVGLEGVGLEGHVEDQVGSKVCYSPSPAL  1344

Query  1028  TLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGA  1201
             + K           +R P  N     +      ++KL+ L   ++ + S      L + A
Sbjct  1345  STKDLDNMEHSVRWLRMPFLNFYRSLNNNCLTSSEKLDSLREYNSVYISSFRKLKLQDQA  1404

Query  1202  RLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK-PYMSEGG-----WGVSDT  1363
             R ++P  G  D VI VYD+EPTS+ISYAL+S+ Y   +TD+     E G        SDT
Sbjct  1405  RRLLPV-GVNDTVIPVYDDEPTSLISYALASQGYHAQLTDEGEREKESGDFSAFLSSSDT  1463

Query  1364  NKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKL---SPHPRISFED  1534
                S   +   +++ FGS D   +          SG  G L  DP     + H R+SF D
Sbjct  1464  AFPSFDETSSDSYRSFGSTDESILSM--------SGSRGALILDPLFFTKAMHARVSFGD  1515

Query  1535  ESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSL  1714
             +S    GK ++SVTCY+AK+F+ALR+ CCPSELD+IRSLSRCK+W AQGGKSNV+FAK+L
Sbjct  1516  DS--PVGKARYSVTCYYAKRFEALRRVCCPSELDYIRSLSRCKKWGAQGGKSNVFFAKTL  1573

Query  1715  DERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKET  1894
             D+RFIIKQ+ KTEL+SF +FAP YF YL+DS SS SPTCLAK++GIYQV  K LKGGKET
Sbjct  1574  DDRFIIKQVTKTELESFIKFAPAYFRYLSDSISSRSPTCLAKILGIYQVTSKLLKGGKET  1633

Query  1895  KMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSK  2071
             KMD++VMENL Y R ++R+YDLKGS RSRYNSD+  +NKVLLD N +E++ T PIF+G+K
Sbjct  1634  KMDVLVMENLLYRRKVTRLYDLKGSSRSRYNSDSSGSNKVLLDQNLIEAMPTSPIFVGNK  1693

Query  2072  AKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1694  AKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1750



>ref|XP_011036541.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Populus euphratica]
Length=1818

 Score =   517 bits (1331),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 324/777 (42%), Positives = 458/777 (59%), Gaps = 70/777 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++LSV LPP+ ++F+S++ Q W  KE  E++ +A+ L++
Sbjct  1014  RDCLRFYGFGKMVACFRYASINVLSVYLPPAKVDFSSEN-QEWTQKETDEVVNQAELLFS  1072

Query  182   EISSAVQKLEEKCASVGCDWNNMNGL-----HNCILELKDMLMKEK-NYWNDLHQPTHEE  343
             E+ +A+ ++ E+   +     N +G+        I E + ML KEK  +   LH+  ++E
Sbjct  1073  EVLNALSQISERRCKIE---QNNSGMKLPESRRQIAEFELMLQKEKVEFEESLHKVMNKE  1129

Query  344   TSEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNF-------SSQHPENAVS  502
               + GQ+ ID+LE+NRLR  LL   + WD+RL Y  S+ +N+F       +S   E  + 
Sbjct  1130  L-KNGQSVIDILEINRLRRQLLFQSYMWDNRLVYAASLDNNSFHDGSNSSTSGQEEKPLG  1188

Query  503   CINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGS  682
               N  +   E +  D  L  A  +      N+ +C  +G  ++  + P      S+ +G 
Sbjct  1189  PANSDKLIEENV--DAKLLKASNQQGGFGSNTNQCDADGQETDVCQGP------SHGKGG  1240

Query  683   SSTSCNGDKTLETRLGLENAVNKSPLERAPSAG-----SILSDKIDCAWTGIDPSSQDMQ  847
              +   N    +  R   +   +     R  S G     + LSD +D AWTG     ++  
Sbjct  1241  QA---NPFAAMPARDLSDIKESGGSYFRTLSDGQDPVMANLSDTLDAAWTG-----ENQP  1292

Query  848   VHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLS  1027
                + ++   R++        DS   +   +   +        +++++  ++  SPS   
Sbjct  1293  GSGTFKDDNSRLS--------DSAVEESSTTGVGLEGVGLEGHVEDQVGSKVCYSPSPAL  1344

Query  1028  TLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGA  1201
             + K           +R P  N     +      ++KL+ L   ++ + S      L + A
Sbjct  1345  STKDLDNMEHSVRWLRMPFLNFYRSLNNNCLTSSEKLDSLREYNSVYISSFRKLKLQDQA  1404

Query  1202  RLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK-PYMSEGG-----WGVSDT  1363
             R ++P  G  D VI VYD+EPTS+ISYAL+S+ Y   +TD+     E G        SDT
Sbjct  1405  RRLLPV-GVNDTVIPVYDDEPTSLISYALASQGYHAQLTDEGEREKESGDFSAFLSSSDT  1463

Query  1364  NKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKL---SPHPRISFED  1534
                S   +   +++ FGS D   +          SG  G L  DP     + H R+SF D
Sbjct  1464  AFPSFDETSSDSYRSFGSTDESILSM--------SGSRGALILDPLFFTKAMHARVSFGD  1515

Query  1535  ESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSL  1714
             +S    GK ++SVTCY+AK+F+ALR+ CCPSELD+IRSLSRCK+W AQGGKSNV+FAK+L
Sbjct  1516  DS--PVGKARYSVTCYYAKRFEALRRVCCPSELDYIRSLSRCKKWGAQGGKSNVFFAKTL  1573

Query  1715  DERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKET  1894
             D+RFIIKQ+ KTEL+SF +FAP YF YL+DS SS SPTCLAK++GIYQV  K LKGGKET
Sbjct  1574  DDRFIIKQVTKTELESFIKFAPAYFRYLSDSISSRSPTCLAKILGIYQVTSKLLKGGKET  1633

Query  1895  KMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSK  2071
             KMD++VMENL Y R ++R+YDLKGS RSRYNSD+  +NKVLLD N +E++ T PIF+G+K
Sbjct  1634  KMDVLVMENLLYRRKVTRLYDLKGSSRSRYNSDSSGSNKVLLDQNLIEAMPTSPIFVGNK  1693

Query  2072  AKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1694  AKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1750



>ref|XP_011015187.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Populus euphratica]
 ref|XP_011015188.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Populus euphratica]
Length=1819

 Score =   517 bits (1331),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 324/777 (42%), Positives = 458/777 (59%), Gaps = 70/777 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++LSV LPP+ ++F+S++ Q W  KE  E++ +A+ L++
Sbjct  1015  RDCLRFYGFGKMVACFRYASINVLSVYLPPAKVDFSSEN-QEWTQKETDEVVNQAELLFS  1073

Query  182   EISSAVQKLEEKCASVGCDWNNMNGL-----HNCILELKDMLMKEK-NYWNDLHQPTHEE  343
             E+ +A+ ++ E+   +     N +G+        I E + ML KEK  +   LH+  ++E
Sbjct  1074  EVLNALSQISERRCKIE---QNNSGMKLPESRRQIAEFELMLQKEKVEFEESLHKVMNKE  1130

Query  344   TSEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNF-------SSQHPENAVS  502
               + GQ+ ID+LE+NRLR  LL   + WD+RL Y  S+ +N+F       +S   E  + 
Sbjct  1131  L-KNGQSVIDILEINRLRRQLLFQSYMWDNRLVYAASLDNNSFHDGSNSSTSGQEEKPLG  1189

Query  503   CINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGS  682
               N  +   E +  D  L  A  +      N+ +C  +G  ++  + P      S+ +G 
Sbjct  1190  PANSDKLIEENV--DAKLLKASNQQGGFGSNTNQCDADGQETDVCQGP------SHGKGG  1241

Query  683   SSTSCNGDKTLETRLGLENAVNKSPLERAPSAG-----SILSDKIDCAWTGIDPSSQDMQ  847
              +   N    +  R   +   +     R  S G     + LSD +D AWTG     ++  
Sbjct  1242  QA---NPFAAMPARDLSDIKESGGSYFRTLSDGQDPVMANLSDTLDAAWTG-----ENQP  1293

Query  848   VHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLS  1027
                + ++   R++        DS   +   +   +        +++++  ++  SPS   
Sbjct  1294  GSGTFKDDNSRLS--------DSAVEESSTTGVGLEGVGLEGHVEDQVGSKVCYSPSPAL  1345

Query  1028  TLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGA  1201
             + K           +R P  N     +      ++KL+ L   ++ + S      L + A
Sbjct  1346  STKDLDNMEHSVRWLRMPFLNFYRSLNNNCLTSSEKLDSLREYNSVYISSFRKLKLQDQA  1405

Query  1202  RLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK-PYMSEGG-----WGVSDT  1363
             R ++P  G  D VI VYD+EPTS+ISYAL+S+ Y   +TD+     E G        SDT
Sbjct  1406  RRLLPV-GVNDTVIPVYDDEPTSLISYALASQGYHAQLTDEGEREKESGDFSAFLSSSDT  1464

Query  1364  NKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKL---SPHPRISFED  1534
                S   +   +++ FGS D   +          SG  G L  DP     + H R+SF D
Sbjct  1465  AFPSFDETSSDSYRSFGSTDESILSM--------SGSRGALILDPLFFTKAMHARVSFGD  1516

Query  1535  ESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSL  1714
             +S    GK ++SVTCY+AK+F+ALR+ CCPSELD+IRSLSRCK+W AQGGKSNV+FAK+L
Sbjct  1517  DS--PVGKARYSVTCYYAKRFEALRRVCCPSELDYIRSLSRCKKWGAQGGKSNVFFAKTL  1574

Query  1715  DERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKET  1894
             D+RFIIKQ+ KTEL+SF +FAP YF YL+DS SS SPTCLAK++GIYQV  K LKGGKET
Sbjct  1575  DDRFIIKQVTKTELESFIKFAPAYFRYLSDSISSRSPTCLAKILGIYQVTSKLLKGGKET  1634

Query  1895  KMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSK  2071
             KMD++VMENL Y R ++R+YDLKGS RSRYNSD+  +NKVLLD N +E++ T PIF+G+K
Sbjct  1635  KMDVLVMENLLYRRKVTRLYDLKGSSRSRYNSDSSGSNKVLLDQNLIEAMPTSPIFVGNK  1694

Query  2072  AKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1695  AKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1751



>ref|XP_011036539.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Populus euphratica]
 ref|XP_011036540.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Populus euphratica]
Length=1819

 Score =   517 bits (1331),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 324/777 (42%), Positives = 458/777 (59%), Gaps = 70/777 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++LSV LPP+ ++F+S++ Q W  KE  E++ +A+ L++
Sbjct  1015  RDCLRFYGFGKMVACFRYASINVLSVYLPPAKVDFSSEN-QEWTQKETDEVVNQAELLFS  1073

Query  182   EISSAVQKLEEKCASVGCDWNNMNGL-----HNCILELKDMLMKEK-NYWNDLHQPTHEE  343
             E+ +A+ ++ E+   +     N +G+        I E + ML KEK  +   LH+  ++E
Sbjct  1074  EVLNALSQISERRCKIE---QNNSGMKLPESRRQIAEFELMLQKEKVEFEESLHKVMNKE  1130

Query  344   TSEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNF-------SSQHPENAVS  502
               + GQ+ ID+LE+NRLR  LL   + WD+RL Y  S+ +N+F       +S   E  + 
Sbjct  1131  L-KNGQSVIDILEINRLRRQLLFQSYMWDNRLVYAASLDNNSFHDGSNSSTSGQEEKPLG  1189

Query  503   CINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGS  682
               N  +   E +  D  L  A  +      N+ +C  +G  ++  + P      S+ +G 
Sbjct  1190  PANSDKLIEENV--DAKLLKASNQQGGFGSNTNQCDADGQETDVCQGP------SHGKGG  1241

Query  683   SSTSCNGDKTLETRLGLENAVNKSPLERAPSAG-----SILSDKIDCAWTGIDPSSQDMQ  847
              +   N    +  R   +   +     R  S G     + LSD +D AWTG     ++  
Sbjct  1242  QA---NPFAAMPARDLSDIKESGGSYFRTLSDGQDPVMANLSDTLDAAWTG-----ENQP  1293

Query  848   VHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLS  1027
                + ++   R++        DS   +   +   +        +++++  ++  SPS   
Sbjct  1294  GSGTFKDDNSRLS--------DSAVEESSTTGVGLEGVGLEGHVEDQVGSKVCYSPSPAL  1345

Query  1028  TLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGA  1201
             + K           +R P  N     +      ++KL+ L   ++ + S      L + A
Sbjct  1346  STKDLDNMEHSVRWLRMPFLNFYRSLNNNCLTSSEKLDSLREYNSVYISSFRKLKLQDQA  1405

Query  1202  RLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK-PYMSEGG-----WGVSDT  1363
             R ++P  G  D VI VYD+EPTS+ISYAL+S+ Y   +TD+     E G        SDT
Sbjct  1406  RRLLPV-GVNDTVIPVYDDEPTSLISYALASQGYHAQLTDEGEREKESGDFSAFLSSSDT  1464

Query  1364  NKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKL---SPHPRISFED  1534
                S   +   +++ FGS D   +          SG  G L  DP     + H R+SF D
Sbjct  1465  AFPSFDETSSDSYRSFGSTDESILSM--------SGSRGALILDPLFFTKAMHARVSFGD  1516

Query  1535  ESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSL  1714
             +S    GK ++SVTCY+AK+F+ALR+ CCPSELD+IRSLSRCK+W AQGGKSNV+FAK+L
Sbjct  1517  DS--PVGKARYSVTCYYAKRFEALRRVCCPSELDYIRSLSRCKKWGAQGGKSNVFFAKTL  1574

Query  1715  DERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKET  1894
             D+RFIIKQ+ KTEL+SF +FAP YF YL+DS SS SPTCLAK++GIYQV  K LKGGKET
Sbjct  1575  DDRFIIKQVTKTELESFIKFAPAYFRYLSDSISSRSPTCLAKILGIYQVTSKLLKGGKET  1634

Query  1895  KMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSK  2071
             KMD++VMENL Y R ++R+YDLKGS RSRYNSD+  +NKVLLD N +E++ T PIF+G+K
Sbjct  1635  KMDVLVMENLLYRRKVTRLYDLKGSSRSRYNSDSSGSNKVLLDQNLIEAMPTSPIFVGNK  1694

Query  2072  AKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1695  AKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1751



>gb|KHN17761.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1 [Glycine soja]
Length=1813

 Score =   516 bits (1329),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 326/795 (41%), Positives = 448/795 (56%), Gaps = 102/795 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPPS LEFN  S Q W+ KE  EL  KA+ L++
Sbjct  1012  RDCLRFYGFGKMVACFRYASIHLHSVYLPPSKLEFNYDS-QDWLQKEANELHNKAEILFS  1070

Query  182   EISSAVQKLEEKCAS--VGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ + + ++ EK +   +    N ++   N + ELK ML+ EK  + D  Q    +  + 
Sbjct  1071  EVCNTLHQISEKVSGPVLQEGGNRVSDFRNLVAELKGMLLYEKEEFEDSLQKLLHKEGKA  1130

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMES----IFDNNFSS-QHPENAVSCINPGE  520
             GQ  ID+LELN+LR  +L   + WD RL Y  +    I   N  S  H E  +       
Sbjct  1131  GQPVIDILELNKLRRHILIHSYVWDQRLIYASNLSKIILQENLKSLNHREKLL-------  1183

Query  521   WGGETIFKDGSLEHAYEENVHEFPNS----------EECPGEGLHSE---HDEPPVPKDA  661
                      GS E   E +V   P            E  P   L+ E   H   PV K  
Sbjct  1184  ---------GSREKVVEADVATRPARGHSSCDSFLLETKPDGNLNLENTSHLSHPVVK--  1232

Query  662   LSYQQGSSSTSCNGDKTLETRLGLEN---------AVNKSPLERAPSAGSILSDKIDCAW  814
              S  +G  +     D +L     + +         AV K+  E      + LSD +D AW
Sbjct  1233  -SEDKGKDTNHDKVDLSLSGGANINDKSDSVEFGGAVRKALSEGESPVVANLSDTLDAAW  1291

Query  815   TGID-PSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFD------SAL  973
             TG   P++  ++ +  L      VA    ++++ +      KS + +Y+ +         
Sbjct  1292  TGEGHPTNSSLKENGCLPPDAAAVAVHSPVANIVTS-----KSNSNIYTANIGGVEAGCT  1346

Query  974   RIQERISKRLPPS---PSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNL  1144
                + +SK L  +     + +   SF+    +        + + ++  + L R+      
Sbjct  1347  NYSKLLSKGLDTTWKGIPFANVFGSFNKTSSFNTEKLVEYNPVHILSFRELERQT-----  1401

Query  1145  LPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK  1324
                              GARL++P  G  D ++ VYD+EPTS+I+Y L S +Y   + + 
Sbjct  1402  -----------------GARLLLPA-GTNDTIVPVYDDEPTSVIAYVLVSMDYHMQMLEY  1443

Query  1325  PYMSEGGWGVSDTNKESPI--ASKLSTWQRFG-SLDLDYMHFGSYGSE--DASGRIGFLF  1489
                 + G    D++   P+  ++ L +   F  ++   Y   GS+       SG      
Sbjct  1444  DRPKDSG----DSSISLPLFDSTSLLSLNSFDETITNTYRSLGSFEENVLSTSGSRSLPA  1499

Query  1490  SDP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRC  1660
              DP       H R+SF D+S  + GKVK++VTCY+AK+F+ALR+ CCPSELDF+RSLSRC
Sbjct  1500  GDPFSYTKDLHARVSFTDDS--SLGKVKYTVTCYYAKRFEALRRTCCPSELDFVRSLSRC  1557

Query  1661  KRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAK  1840
             K+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S S+GSPTCLAK
Sbjct  1558  KKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFTKFAPAYFKYLSESISTGSPTCLAK  1617

Query  1841  VVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLL  2017
             ++GIYQV  KHLKGGKETKMD++VMENL Y R+I R+YDLKGS RSRYN DT  +NKVLL
Sbjct  1618  ILGIYQVTSKHLKGGKETKMDVLVMENLLYRRNIRRLYDLKGSSRSRYNPDTSGSNKVLL  1677

Query  2018  DLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGII  2197
             D N +E++ T PIF+G+KAKR LERAVWNDT+FLA +YVMDYSLLVGVDEE+ ELVLGII
Sbjct  1678  DQNLIEAMPTSPIFVGNKAKRLLERAVWNDTAFLASIYVMDYSLLVGVDEEKHELVLGII  1737

Query  2198  DYMRQYTWDKHLETW  2242
             D+MRQYTWDKHLETW
Sbjct  1738  DFMRQYTWDKHLETW  1752



>ref|XP_010273819.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Nelumbo nucifera]
 ref|XP_010273820.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Nelumbo nucifera]
 ref|XP_010273821.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Nelumbo nucifera]
 ref|XP_010273822.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Nelumbo nucifera]
Length=1852

 Score =   516 bits (1330),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 333/796 (42%), Positives = 454/796 (57%), Gaps = 93/796 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L+FN ++ Q WI KE  E++ +A+  + 
Sbjct  1033  RDCLRFYGFGRMVACFRYASIDVHSVYLPPPKLDFNYEN-QEWIQKEANEVVDRAELFFT  1091

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +++ ++ EK    G   ++M    L   I EL+ ML KEK  + +  Q       ++
Sbjct  1092  EVFNSLHQIAEKRLGAGSLNSSMKAPELKRRIAELEGMLQKEKAEFEESLQKILNSEGKK  1151

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+LE+NRLR  LL   + WDHRL Y  S       +  P+    C +  +   +T
Sbjct  1152  GQPIIDILEINRLRRQLLFQSYVWDHRLIYAAS-------ADSPQEG-PCGSVAKQKEKT  1203

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEG--LHSEHDEPPVPKDAL--------SYQQGSS  685
             +   GS E   E N    P       +   L ++ DE PV K A         S  QG  
Sbjct  1204  L---GSSEKIVEMNCPSKPGKATTSHDSFVLDAKSDEDPVQKGAFGEHPNQPDSVNQGRD  1260

Query  686   STSCNGDKTLETRLGLENAVN----KSPLE------RAPSAGSI-----LSDKIDCAWTG  820
              T  + D   E    L   +N      PL+      R  S G       LSD +D AWTG
Sbjct  1261  -TKQDSDYGKEGTDDLSTIINHCDQSDPLKTGATVRRVLSEGQFPIIANLSDTLDAAWTG  1319

Query  821   IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARV--YSFDSALRIQERIS  994
                     + H           +F   + +DS   + + +   +  +S  S   + + ++
Sbjct  1320  --------ENHPGSTTPSENGYAFSDAALMDSSIIEAVSAKPVLEDHSGQSGAEVVQSLA  1371

Query  995   KRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS  1174
                   P+ +S  K      D  + +  P  N     +++    + K +++   +  + +
Sbjct  1372  ------PALVS--KGADNMEDSISWVGMPFLNFYRSFNKSSSGSSPKFDMVSEYNPIYVT  1423

Query  1175  HASILPE--GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGW  1348
                 L    GARL++P  G  D V+ VYD+EPTSII+YAL S +Y   V+D+    + G 
Sbjct  1424  SFRELERQGGARLLLPV-GVNDTVVPVYDDEPTSIIAYALVSPDYHAQVSDERERPKDGI  1482

Query  1349  GVSDTNKESPIASKLSTWQRFGSLDLDYMH---------FGSYGSED-----ASGRIGFL  1486
                      P  S  S      S++L  +H         F + GS D      S     L
Sbjct  1483  --------EPSVSLPS----IDSVNLHLLHSFDETVSESFRNLGSTDDSILSTSVSRSSL  1530

Query  1487  FSDPKL---SPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSR  1657
               DP L   + H R+SF D+     GK K++VTCY+AK+F+ALR+ CCPSELDFIRSLSR
Sbjct  1531  VLDPLLYTKALHVRVSFSDD--GPLGKAKYTVTCYYAKRFEALRRTCCPSELDFIRSLSR  1588

Query  1658  CKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLA  1837
             CK+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF+YL++S +SGSPTCLA
Sbjct  1589  CKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPEYFKYLSESIASGSPTCLA  1648

Query  1838  KVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVL  2014
             K++GIYQV  KHLKGGKE+KMD++VMENL +GR+++R+YDLKGS RSRYN D+   NKVL
Sbjct  1649  KILGIYQVTSKHLKGGKESKMDVLVMENLLFGRNVTRLYDLKGSSRSRYNPDSSGTNKVL  1708

Query  2015  LDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGI  2194
             LD N +E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGI
Sbjct  1709  LDQNLIEAMPTSPIFVGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELVLGI  1768

Query  2195  IDYMRQYTWDKHLETW  2242
             ID+MRQYTWDKHLETW
Sbjct  1769  IDFMRQYTWDKHLETW  1784



>gb|KHN01471.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1 [Glycine soja]
Length=1825

 Score =   516 bits (1329),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 325/787 (41%), Positives = 447/787 (57%), Gaps = 91/787 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L F+    Q WI +E  E++ +A+ L++
Sbjct  1023  RDCLRFYGFGRMVACFRYASIDVHSVYLPPHTLIFD-YGNQDWIQQESDEVVNRAELLFS  1081

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ + + ++ E+ ++     N      L   + EL+ ML KEK  + +  Q    +    
Sbjct  1082  EVLNGLSQIGEQRSNALQVSNGHKSPELRRQVAELEGMLQKEKLEFEETLQKILNQEKRN  1141

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSS----------QHP--ENAV  499
             GQ  IDVLE+NRL   LL   + WDHRL Y  ++ ++N+ S          + P  EN +
Sbjct  1142  GQPGIDVLEINRLWRQLLFQSYMWDHRLIYAANLVNSNYESGSSSPISEDKEKPTDENQM  1201

Query  500   SCIN-----------PGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPP  646
             S IN           P   GG  +  DG + H       +   ++         + DE  
Sbjct  1202  S-INSIHGDPKLNGSPSHGGGSVVV-DGKISHDASHQEIDMAKNKNL------EKDDESD  1253

Query  647   VPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGID  826
             +P         +S +  +    LE  LG+  A++  P    PS    LS+ +D  WTG +
Sbjct  1254  LP---------NSKSINDQSNLLEPELGVGRALSDGPFPVIPS----LSETLDAKWTGEN  1300

Query  827   PSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLP  1006
              S   +Q   S    +  +A               L + A+  ++    R +++      
Sbjct  1301  HSGYGIQKDNSSVNPDILMAD-------------ALTTSAQKETYYLGDRTEDQNG----  1343

Query  1007  PSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HA  1180
              S S+ S+ K      D  N +  P  N     ++ L    QK + L   +  + S    
Sbjct  1344  -SKSFYSSFKGHDNMEDSSNWLGMPFLNFYRQFNRNLFASTQKFDTLVDYNPVYVSSFRK  1402

Query  1181  SILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSD  1360
               L  GARL++P  G  D VI VYD+EP+SII+YAL S EY   + D     EG      
Sbjct  1403  QELQGGARLLLPI-GVNDTVIPVYDDEPSSIIAYALMSPEYHFQLND-----EGERPTEG  1456

Query  1361  TNKESPIASKLSTWQRFGSLD------------LDYMHFGSYGSEDASGRIGFLFSDPKL  1504
                 S   S   T Q F S+D            ++ M F   GS ++S     L++    
Sbjct  1457  NEFTSSYFSDSGTLQSFSSVDETAFDSQKSFGSIEEMIFSMSGSRNSSILDPMLYTK---  1513

Query  1505  SPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGG  1684
             + H R+SF  +     GKVK+SVTCY+AK+F+ALR+ CCPSELD+IRSLSRCK+W AQGG
Sbjct  1514  AMHARVSFGVDG--PLGKVKYSVTCYYAKRFEALRRVCCPSELDYIRSLSRCKKWGAQGG  1571

Query  1685  KSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVA  1864
             KSNV+FAK+LD+RFIIKQ+ KTEL+SF +F P+YF+YL++S  +GSPTCLAK++GIYQV 
Sbjct  1572  KSNVFFAKTLDDRFIIKQVTKTELESFIKFGPEYFKYLSESIGTGSPTCLAKILGIYQVT  1631

Query  1865  VKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLESL  2041
              KHLKGGKE++MD++VMENL + R+++R+YDLKGS RSRYN+D T  NKVLLD N +E++
Sbjct  1632  SKHLKGGKESRMDVLVMENLLFRRTVTRLYDLKGSSRSRYNADSTGKNKVLLDQNLIEAM  1691

Query  2042  QTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTW  2221
              T PIF+G+KAKR LERAVWNDT FLA V VMDYSLLVGVDEE+ ELV+GIID+MRQYTW
Sbjct  1692  PTSPIFVGNKAKRLLERAVWNDTGFLASVAVMDYSLLVGVDEEKHELVIGIIDFMRQYTW  1751

Query  2222  DKHLETW  2242
             DKHLETW
Sbjct  1752  DKHLETW  1758



>ref|XP_006583188.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X3 [Glycine max]
Length=1800

 Score =   515 bits (1327),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 327/788 (41%), Positives = 448/788 (57%), Gaps = 93/788 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L F+    Q WI +E  E++ +A+ L++
Sbjct  998   RDCLRFYGFGRMVACFRYASIDVHSVYLPPHTLIFD-YGNQDWIQQESDEVVNRAELLFS  1056

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ + + ++ E+ ++     N      L   + EL+ ML KEK  + +  Q    +    
Sbjct  1057  EVLNGLSQIGEQRSNALQVSNGHKSPELRRQVAELEGMLQKEKLEFEETLQKILNQEKRN  1116

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSS----------QHP--ENAV  499
             GQ  IDVLE+NRL   LL   + WDHRL Y  ++ ++N+ S          + P  EN +
Sbjct  1117  GQPGIDVLEINRLWRQLLFQSYMWDHRLIYAANLVNSNYESGSSSPISEDKEKPTDENQM  1176

Query  500   SCIN-----------PGEWGGETIFKDGSLEH-AYEENVHEFPNSEECPGEGLHSEHDEP  643
             S IN           P   GG  +  DG + H A  + +    N           + DE 
Sbjct  1177  S-INSIHGDPKLNGSPSHGGGSVVV-DGKISHDASHQEIDMVKNKN-------LEKDDES  1227

Query  644   PVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGI  823
              +P         +S +  +    LE  LG+  A++  P    PS    LS+ +D  WTG 
Sbjct  1228  DLP---------NSKSINDQSNLLEPELGVGRALSDGPFPVIPS----LSETLDAKWTGE  1274

Query  824   DPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRL  1003
             + S   +Q   S    +  +A               L + A+  ++    R +++     
Sbjct  1275  NHSGYGIQKDNSSVNPDILMAD-------------ALTTSAQKETYYLGDRTEDQNG---  1318

Query  1004  PPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--H  1177
               S S+ S+ K      D  N +  P  N     ++ L    QK + L   +  + S   
Sbjct  1319  --SKSFYSSFKGHDNMEDSSNWLGMPFLNFYRQFNRNLFASTQKFDTLVDYNPVYVSSFR  1376

Query  1178  ASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVS  1357
                L  GARL++P  G  D VI VYD+EP+SII+YAL S EY   + D     EG     
Sbjct  1377  KQELQGGARLLLPI-GVNDTVIPVYDDEPSSIIAYALMSPEYHFQLND-----EGERPRE  1430

Query  1358  DTNKESPIASKLSTWQRFGSLD------------LDYMHFGSYGSEDASGRIGFLFSDPK  1501
                  S   S   T Q F S+D            ++ M F   GS ++S     L++   
Sbjct  1431  GNEFTSSYFSDSGTLQSFSSVDETAFDSQKSFGSIEEMIFSMSGSRNSSILDPMLYTK--  1488

Query  1502  LSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQG  1681
              + H R+SF  +     GKVK+SVTCY+AK+F+ALR+ CCPSELD+IRSLSRCK+W AQG
Sbjct  1489  -AMHARVSFGVDG--PLGKVKYSVTCYYAKRFEALRRVCCPSELDYIRSLSRCKKWGAQG  1545

Query  1682  GKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQV  1861
             GKSNV+FAK+LD+RFIIKQ+ KTEL+SF +F P+YF+YL++S  +GSPTCLAK++GIYQV
Sbjct  1546  GKSNVFFAKTLDDRFIIKQVTKTELESFIKFGPEYFKYLSESIGTGSPTCLAKILGIYQV  1605

Query  1862  AVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLES  2038
               KHLKGGKE++MD++VMENL + R+++R+YDLKGS RSRYN+D T  NKVLLD N +E+
Sbjct  1606  TSKHLKGGKESRMDVLVMENLLFRRTVTRLYDLKGSSRSRYNADSTGKNKVLLDQNLIEA  1665

Query  2039  LQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYT  2218
             + T PIF+G+KAKR LERAVWNDT FLA V VMDYSLLVGVDEE+ ELV+GIID+MRQYT
Sbjct  1666  MPTSPIFVGNKAKRLLERAVWNDTGFLASVAVMDYSLLVGVDEEKHELVIGIIDFMRQYT  1725

Query  2219  WDKHLETW  2242
             WDKHLETW
Sbjct  1726  WDKHLETW  1733



>ref|XP_003529857.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Glycine max]
 ref|XP_006583187.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Glycine max]
Length=1825

 Score =   515 bits (1327),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 327/788 (41%), Positives = 448/788 (57%), Gaps = 93/788 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L F+    Q WI +E  E++ +A+ L++
Sbjct  1023  RDCLRFYGFGRMVACFRYASIDVHSVYLPPHTLIFD-YGNQDWIQQESDEVVNRAELLFS  1081

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ + + ++ E+ ++     N      L   + EL+ ML KEK  + +  Q    +    
Sbjct  1082  EVLNGLSQIGEQRSNALQVSNGHKSPELRRQVAELEGMLQKEKLEFEETLQKILNQEKRN  1141

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSS----------QHP--ENAV  499
             GQ  IDVLE+NRL   LL   + WDHRL Y  ++ ++N+ S          + P  EN +
Sbjct  1142  GQPGIDVLEINRLWRQLLFQSYMWDHRLIYAANLVNSNYESGSSSPISEDKEKPTDENQM  1201

Query  500   SCIN-----------PGEWGGETIFKDGSLEH-AYEENVHEFPNSEECPGEGLHSEHDEP  643
             S IN           P   GG  +  DG + H A  + +    N           + DE 
Sbjct  1202  S-INSIHGDPKLNGSPSHGGGSVVV-DGKISHDASHQEIDMVKNKN-------LEKDDES  1252

Query  644   PVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGI  823
              +P         +S +  +    LE  LG+  A++  P    PS    LS+ +D  WTG 
Sbjct  1253  DLP---------NSKSINDQSNLLEPELGVGRALSDGPFPVIPS----LSETLDAKWTGE  1299

Query  824   DPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRL  1003
             + S   +Q   S    +  +A               L + A+  ++    R +++     
Sbjct  1300  NHSGYGIQKDNSSVNPDILMAD-------------ALTTSAQKETYYLGDRTEDQNG---  1343

Query  1004  PPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--H  1177
               S S+ S+ K      D  N +  P  N     ++ L    QK + L   +  + S   
Sbjct  1344  --SKSFYSSFKGHDNMEDSSNWLGMPFLNFYRQFNRNLFASTQKFDTLVDYNPVYVSSFR  1401

Query  1178  ASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVS  1357
                L  GARL++P  G  D VI VYD+EP+SII+YAL S EY   + D     EG     
Sbjct  1402  KQELQGGARLLLPI-GVNDTVIPVYDDEPSSIIAYALMSPEYHFQLND-----EGERPRE  1455

Query  1358  DTNKESPIASKLSTWQRFGSLD------------LDYMHFGSYGSEDASGRIGFLFSDPK  1501
                  S   S   T Q F S+D            ++ M F   GS ++S     L++   
Sbjct  1456  GNEFTSSYFSDSGTLQSFSSVDETAFDSQKSFGSIEEMIFSMSGSRNSSILDPMLYTK--  1513

Query  1502  LSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQG  1681
              + H R+SF  +     GKVK+SVTCY+AK+F+ALR+ CCPSELD+IRSLSRCK+W AQG
Sbjct  1514  -AMHARVSFGVDG--PLGKVKYSVTCYYAKRFEALRRVCCPSELDYIRSLSRCKKWGAQG  1570

Query  1682  GKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQV  1861
             GKSNV+FAK+LD+RFIIKQ+ KTEL+SF +F P+YF+YL++S  +GSPTCLAK++GIYQV
Sbjct  1571  GKSNVFFAKTLDDRFIIKQVTKTELESFIKFGPEYFKYLSESIGTGSPTCLAKILGIYQV  1630

Query  1862  AVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLES  2038
               KHLKGGKE++MD++VMENL + R+++R+YDLKGS RSRYN+D T  NKVLLD N +E+
Sbjct  1631  TSKHLKGGKESRMDVLVMENLLFRRTVTRLYDLKGSSRSRYNADSTGKNKVLLDQNLIEA  1690

Query  2039  LQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYT  2218
             + T PIF+G+KAKR LERAVWNDT FLA V VMDYSLLVGVDEE+ ELV+GIID+MRQYT
Sbjct  1691  MPTSPIFVGNKAKRLLERAVWNDTGFLASVAVMDYSLLVGVDEEKHELVIGIIDFMRQYT  1750

Query  2219  WDKHLETW  2242
             WDKHLETW
Sbjct  1751  WDKHLETW  1758



>ref|XP_011079346.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Sesamum indicum]
 ref|XP_011079355.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Sesamum indicum]
Length=1823

 Score =   515 bits (1326),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 339/799 (42%), Positives = 469/799 (59%), Gaps = 108/799 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L+FN +S Q WI KE  E+  +A+ L++
Sbjct  1002  RDCLRFYGFGKMVACFRYASIDVHSVHLPPPKLDFNYES-QEWIEKEFNEVASRAELLFS  1060

Query  182   EISSAVQKLEEKCASVGCDWNNMNG------LHNCILELKDMLMKEKNYWNDLHQPTHEE  343
             E+ +A++ L E+ +S       +NG        + +++L+ ML KEK+ + +  Q    +
Sbjct  1061  EVLNALRLLVERNSSSSL----LNGGVKVPESRHHLVDLEGMLQKEKSEFEESLQKVLNK  1116

Query  344   TSEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEW  523
              + +GQ+ ID+LELNRLR  L+   + WDHRL Y +S+ DN   SQ  +  V+C      
Sbjct  1117  EARKGQSAIDILELNRLRRQLVFQSYMWDHRLIYADSL-DNK--SQQDDIEVTC------  1167

Query  524   GGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCN-  700
               E+I    ++     +       SEE  G          P  K   S + G S  S N 
Sbjct  1168  -SESIQTPKAVTQKLLDINVPVKTSEETSGY-------IAPDAKPDQSPEHGVSERSTNH  1219

Query  701   --------GDKTLETRLGLENAVNKSP------------LERAPSAGSI---LSDKIDCA  811
                      D  L + LG +N +   P            + R  S G +   LSD +D A
Sbjct  1220  CPEELHHRTDALLTSDLGNQNLLALKPNDESDTRESNVTVPRVLSDGQVPISLSDTLDAA  1279

Query  812   WTGID-PS---SQDMQVHASLQEGERRVASFGQLSHVDSPT-----CKRLKSPARVYSFD  964
             WTG + P    +++  +  S++      A   +   V+  T      K  +SP+  +S  
Sbjct  1280  WTGENYPGVGITKNNNLSVSVEADNLSTAGTSEKLDVEDNTEDLSVSKVSRSPSFFFS--  1337

Query  965   SALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNL  1144
                      S+ +  + S+L    SF ++  YR++ ++ + +            AQKL+ 
Sbjct  1338  --------KSENMEDAVSWLGM--SFMSF--YRSLNKNFLGS------------AQKLDT  1373

Query  1145  LPSSSTTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT  1318
             L   +  + S    S L  GARL++P  G  D V+ +YD+EPTSIISYAL S +Y   ++
Sbjct  1374  LSEYNPVYISSFRESELKGGARLLLPV-GVNDTVVPIYDDEPTSIISYALLSPDYLVQLS  1432

Query  1319  DKPYMSEGGWGVSDT--NKESPIASKLSTWQRFGSLDLD-YMHFGSYGSEDASGRIGFLF  1489
             D+P   E     SD   + +S  A    ++     + L+ Y  FGS   +D    +    
Sbjct  1433  DEP---ERPKDTSDALFSMQSMDAGHFQSFHSLDEMVLESYRSFGSV--DDTMLPLTASR  1487

Query  1490  SDPKLSP-------HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRS  1648
             S   L P       H R+SF D+     G +K+SVTCY+AK+F+ALR+ CCPSE+DFIRS
Sbjct  1488  SSLPLDPLSYTKALHARMSFTDD--GPLGNMKYSVTCYYAKRFEALRRICCPSEIDFIRS  1545

Query  1649  LSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPT  1828
             LSRCK+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S  SGSPT
Sbjct  1546  LSRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPGYFKYLSESVGSGSPT  1605

Query  1829  CLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-AN  2005
             CLAK++GIYQV  K+LKGGKE+KMD++VMENL +GR+ SR+YDLKGS RSRYN D+  +N
Sbjct  1606  CLAKILGIYQVTSKNLKGGKESKMDVLVMENLLFGRNPSRLYDLKGSSRSRYNPDSSGSN  1665

Query  2006  KVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELV  2185
             KVLLD N +E++ T PIF+G+KAKR LE AVWNDT+FLA V VMDYSLLVGVDEE+ ELV
Sbjct  1666  KVLLDQNLIEAMPTSPIFVGNKAKRLLETAVWNDTAFLASVDVMDYSLLVGVDEEKHELV  1725

Query  2186  LGIIDYMRQYTWDKHLETW  2242
             LGIID+MRQYTWDKHLETW
Sbjct  1726  LGIIDFMRQYTWDKHLETW  1744



>ref|XP_010318454.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Solanum lycopersicum]
 ref|XP_010318455.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Solanum lycopersicum]
 ref|XP_010318456.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Solanum lycopersicum]
 ref|XP_010318457.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Solanum lycopersicum]
 ref|XP_010318458.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Solanum lycopersicum]
Length=1783

 Score =   513 bits (1321),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 341/790 (43%), Positives = 470/790 (59%), Gaps = 87/790 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPPS L+FN ++ Q WI  EV E++ +A+ L+A
Sbjct  974   RDCLRFYGFGKMVACFRYASIDVHSVYLPPSKLDFNYEN-QEWIEHEVNEVIFRAELLFA  1032

Query  182   EISSAVQKLEEKCASVGCDWN-NMNGLHNCILELKDMLMKEKN-YWNDLHQPTHEETSEE  355
             E+ +A++ L EK +    + + N+      I +L+ ML KEK  +  +  Q    E  ++
Sbjct  1033  EVLNAIRLLVEKRSGRQLNSSINVPEARRQISDLEGMLQKEKQEFEQESLQRILMEEVKK  1092

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI------FDNNFSSQHPENAVSCINPG  517
             GQ+ +D+LE+NRLR  LL   + WDHRL Y  S+      F  + +S  PE  + C +  
Sbjct  1093  GQS-VDILEINRLRRQLLFQSYVWDHRLVYAASMDDKSHWFSGDVTSLEPEKPLVCDD--  1149

Query  518   EWGGETIFKDGSLEHAYEENVHEFPNSEE-CPG---EGLHSEHDEPPVPKDALSYQQGSS  685
                     K   L++  + +    PNS E  P     G + +          +      S
Sbjct  1150  --------KSTDLDNCADPS--NCPNSSESVPAILKAGENGDEGRSVGQNSHVDAVHQES  1199

Query  686   STSCNGDKTLETRLGLENAVN--------KSPLER--APSAGSI-----LSDKIDCAWTG  820
             +   + D  +E   GL  A          +S L+R  A SAG       LSD ++ AWTG
Sbjct  1200  AVDFDADCAIEKPPGLPVATKSFCGSHPEESILQRRRALSAGQFPNMESLSDTLEAAWTG  1259

Query  821   IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKR  1000
                S         + +G+   +S   L  V++ T    +   +VY+ D A  + +     
Sbjct  1260  ETTSG------VVVIKGDTCKSSEPHL--VNTLTTGMAE---KVYTEDHATMLSQ-----  1303

Query  1001  LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--  1174
                +PS L++  S +       +    +S  + +    LP  AQKL+ L   +  + S  
Sbjct  1304  ---TPSLLASKGSENMEDAGSWLGVSFISFYRTLNKNFLP-SAQKLDPLGGYNPVYISSF  1359

Query  1175  HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGV  1354
               S    GARL++P  G  D VI VYD+EPTSIISYAL+S +Y   ++ +   S+     
Sbjct  1360  RESDAQSGARLLLPV-GVNDTVIPVYDDEPTSIISYALASHDYHAQLSGELEKSKDASLD  1418

Query  1355  SDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDP------KLSP--  1510
             S+ +  S  +S L + Q    + L+   + S GS D S     L S P       L P  
Sbjct  1419  SNFSFHSLDSSNLHSPQSVDEMFLE--SYRSLGSMDES-----LLSLPISRSSFDLDPLS  1471

Query  1511  -----HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSA  1675
                  H R+SF D+   + GKVK+SVTCY+AK+F+ALR+ CCPSE+DFIRSLSRCK+W A
Sbjct  1472  YTKTLHARVSFGDD--GSLGKVKYSVTCYYAKRFEALRRICCPSEMDFIRSLSRCKKWGA  1529

Query  1676  QGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIY  1855
             QGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF+YL++S  +GSPTCLAK++GIY
Sbjct  1530  QGGKSNVFFAKTLDDRFIIKQVTKTELESFMKFAPEYFKYLSESIITGSPTCLAKILGIY  1589

Query  1856  QVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFL  2032
             QV+ K LKGGKE+KMD++VMENL +GR ++R+YDLKGS RSRYN D+  +NKVLLD N +
Sbjct  1590  QVSSKQLKGGKESKMDVLVMENLLFGRKLARLYDLKGSARSRYNPDSSGSNKVLLDQNLI  1649

Query  2033  ESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQ  2212
             ES+ T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELV+GIID+MRQ
Sbjct  1650  ESMPTSPIFVGNKAKRLLERAVWNDTAFLAAVDVMDYSLLVGVDEEKNELVVGIIDFMRQ  1709

Query  2213  YTWDKHLETW  2242
             YTWDKHLETW
Sbjct  1710  YTWDKHLETW  1719



>ref|XP_011048623.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Populus euphratica]
Length=1830

 Score =   513 bits (1322),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 335/798 (42%), Positives = 456/798 (57%), Gaps = 98/798 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++LSV LPPS ++F+ ++ Q W+ KE  E++ +A+ L +
Sbjct  994   RDCLRFYGFGKMVACFRYASINVLSVYLPPSRVDFSFEN-QEWMQKETDEVVNRAELLRS  1052

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ ++ EK   +    N M    L   I EL+ ML KE   + +  +       + 
Sbjct  1053  EVLNALSQISEKRCKIEQLNNGMKLPELRRQIAELELMLQKEMTEFEEWLRKLLSRKVKN  1112

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+LE+NRLR  LL   + WD+RL Y  S+ DN+F   H ++              
Sbjct  1113  GQPVIDILEINRLRRQLLFQSYMWDNRLIYAASL-DNSF---HDDS--------------  1154

Query  536   IFKDGSLEHAYEENVHEFPNSEEC--------PGEGLHSEHDEPPVPKDAL--SYQQGSS  685
                  S    YEE + E  NS++         PG G  S  D P V    L  S Q+G  
Sbjct  1155  ----NSSTSGYEEKLLEPDNSDKLVEENMGLRPGNGF-SSCDFPSVDAKLLKGSDQKGGF  1209

Query  686   STSCN--------------------GDKTLETRLGLENAVN----KSPLERAPSAGSI--  787
              ++ N                    G   L T +   N  +         R  S G +  
Sbjct  1210  GSNTNLSDKVNQEMDVCPGPSHGKEGHANLCTTMSAHNLSDIKESGGNFFRTLSDGQVPI  1269

Query  788   ---LSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYS  958
                LSD +D AWTG     ++     +L++ + R++        DS   +   +   +  
Sbjct  1270  MANLSDTLDGAWTG-----ENHPGVGTLKDDKNRLS--------DSAMEESSTTAVGLEG  1316

Query  959   FDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKL  1138
              D     ++R   +   SPS   + K      DY + +R P  N     ++     ++KL
Sbjct  1317  VDLEGHAKDRDGSKACYSPSPSLSAKDPDNMEDYMSWLRMPFLNFYRSLNKNFLTSSEKL  1376

Query  1139  NLLPSSSTTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDW  1312
               L   +  + S   +  L  GARL++P  G  D VI VYD+EPTS+ISYAL S EY   
Sbjct  1377  GTLGEYNPVYVSSFRSLELQGGARLLLPV-GVNDTVIPVYDDEPTSLISYALVSPEYHAQ  1435

Query  1313  VTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLD-YMHFGSYGSED---ASGRIG  1480
             +TD+      G  + DT + +  +S   ++     +  D Y  FG Y  E     SG   
Sbjct  1436  LTDE------GERIKDTGESNSFSSLSESFHSLEEVSFDLYKSFG-YTDESILSMSGSRS  1488

Query  1481  FLFSDP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSL  1651
              L  DP     + H R+SF D+  +  GK ++SVTCY+AK+F+ LR+ CCP+ELDF+RSL
Sbjct  1489  SLILDPLSYTKAMHVRVSFGDDGPD--GKARYSVTCYYAKRFETLRRICCPAELDFVRSL  1546

Query  1652  SRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTC  1831
             SRCK+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF YL+DS SS SPTC
Sbjct  1547  SRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFRYLSDSISSRSPTC  1606

Query  1832  LAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANK  2008
             LAK++GIYQV  K+LKGGKETKMD++VMENL Y R ++R+YDLKGS RSRYNSD+  +NK
Sbjct  1607  LAKILGIYQVTSKNLKGGKETKMDVLVMENLLYRRKVTRLYDLKGSSRSRYNSDSSGSNK  1666

Query  2009  VLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVL  2188
             VLLD N +E++ T PIF+G+K+KR LERAVWNDTSFLA + VMDYSLLVGVDEE+ EL L
Sbjct  1667  VLLDQNLIEAMPTSPIFVGNKSKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELAL  1726

Query  2189  GIIDYMRQYTWDKHLETW  2242
             GIID+MRQYTWDKHLETW
Sbjct  1727  GIIDFMRQYTWDKHLETW  1744



>ref|XP_011048619.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Populus euphratica]
 ref|XP_011048620.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Populus euphratica]
 ref|XP_011048622.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Populus euphratica]
Length=1832

 Score =   513 bits (1322),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 335/798 (42%), Positives = 456/798 (57%), Gaps = 98/798 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++LSV LPPS ++F+ ++ Q W+ KE  E++ +A+ L +
Sbjct  996   RDCLRFYGFGKMVACFRYASINVLSVYLPPSRVDFSFEN-QEWMQKETDEVVNRAELLRS  1054

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ ++ EK   +    N M    L   I EL+ ML KE   + +  +       + 
Sbjct  1055  EVLNALSQISEKRCKIEQLNNGMKLPELRRQIAELELMLQKEMTEFEEWLRKLLSRKVKN  1114

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+LE+NRLR  LL   + WD+RL Y  S+ DN+F   H ++              
Sbjct  1115  GQPVIDILEINRLRRQLLFQSYMWDNRLIYAASL-DNSF---HDDS--------------  1156

Query  536   IFKDGSLEHAYEENVHEFPNSEEC--------PGEGLHSEHDEPPVPKDAL--SYQQGSS  685
                  S    YEE + E  NS++         PG G  S  D P V    L  S Q+G  
Sbjct  1157  ----NSSTSGYEEKLLEPDNSDKLVEENMGLRPGNGF-SSCDFPSVDAKLLKGSDQKGGF  1211

Query  686   STSCN--------------------GDKTLETRLGLENAVN----KSPLERAPSAGSI--  787
              ++ N                    G   L T +   N  +         R  S G +  
Sbjct  1212  GSNTNLSDKVNQEMDVCPGPSHGKEGHANLCTTMSAHNLSDIKESGGNFFRTLSDGQVPI  1271

Query  788   ---LSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYS  958
                LSD +D AWTG     ++     +L++ + R++        DS   +   +   +  
Sbjct  1272  MANLSDTLDGAWTG-----ENHPGVGTLKDDKNRLS--------DSAMEESSTTAVGLEG  1318

Query  959   FDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKL  1138
              D     ++R   +   SPS   + K      DY + +R P  N     ++     ++KL
Sbjct  1319  VDLEGHAKDRDGSKACYSPSPSLSAKDPDNMEDYMSWLRMPFLNFYRSLNKNFLTSSEKL  1378

Query  1139  NLLPSSSTTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDW  1312
               L   +  + S   +  L  GARL++P  G  D VI VYD+EPTS+ISYAL S EY   
Sbjct  1379  GTLGEYNPVYVSSFRSLELQGGARLLLPV-GVNDTVIPVYDDEPTSLISYALVSPEYHAQ  1437

Query  1313  VTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLD-YMHFGSYGSED---ASGRIG  1480
             +TD+      G  + DT + +  +S   ++     +  D Y  FG Y  E     SG   
Sbjct  1438  LTDE------GERIKDTGESNSFSSLSESFHSLEEVSFDLYKSFG-YTDESILSMSGSRS  1490

Query  1481  FLFSDP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSL  1651
              L  DP     + H R+SF D+  +  GK ++SVTCY+AK+F+ LR+ CCP+ELDF+RSL
Sbjct  1491  SLILDPLSYTKAMHVRVSFGDDGPD--GKARYSVTCYYAKRFETLRRICCPAELDFVRSL  1548

Query  1652  SRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTC  1831
             SRCK+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF YL+DS SS SPTC
Sbjct  1549  SRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFRYLSDSISSRSPTC  1608

Query  1832  LAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANK  2008
             LAK++GIYQV  K+LKGGKETKMD++VMENL Y R ++R+YDLKGS RSRYNSD+  +NK
Sbjct  1609  LAKILGIYQVTSKNLKGGKETKMDVLVMENLLYRRKVTRLYDLKGSSRSRYNSDSSGSNK  1668

Query  2009  VLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVL  2188
             VLLD N +E++ T PIF+G+K+KR LERAVWNDTSFLA + VMDYSLLVGVDEE+ EL L
Sbjct  1669  VLLDQNLIEAMPTSPIFVGNKSKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELAL  1728

Query  2189  GIIDYMRQYTWDKHLETW  2242
             GIID+MRQYTWDKHLETW
Sbjct  1729  GIIDFMRQYTWDKHLETW  1746



>ref|XP_011048624.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X3 [Populus euphratica]
Length=1814

 Score =   513 bits (1321),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 335/798 (42%), Positives = 456/798 (57%), Gaps = 98/798 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++LSV LPPS ++F+ ++ Q W+ KE  E++ +A+ L +
Sbjct  996   RDCLRFYGFGKMVACFRYASINVLSVYLPPSRVDFSFEN-QEWMQKETDEVVNRAELLRS  1054

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ ++ EK   +    N M    L   I EL+ ML KE   + +  +       + 
Sbjct  1055  EVLNALSQISEKRCKIEQLNNGMKLPELRRQIAELELMLQKEMTEFEEWLRKLLSRKVKN  1114

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+LE+NRLR  LL   + WD+RL Y  S+ DN+F   H ++              
Sbjct  1115  GQPVIDILEINRLRRQLLFQSYMWDNRLIYAASL-DNSF---HDDS--------------  1156

Query  536   IFKDGSLEHAYEENVHEFPNSEEC--------PGEGLHSEHDEPPVPKDAL--SYQQGSS  685
                  S    YEE + E  NS++         PG G  S  D P V    L  S Q+G  
Sbjct  1157  ----NSSTSGYEEKLLEPDNSDKLVEENMGLRPGNGF-SSCDFPSVDAKLLKGSDQKGGF  1211

Query  686   STSCN--------------------GDKTLETRLGLENAVN----KSPLERAPSAGSI--  787
              ++ N                    G   L T +   N  +         R  S G +  
Sbjct  1212  GSNTNLSDKVNQEMDVCPGPSHGKEGHANLCTTMSAHNLSDIKESGGNFFRTLSDGQVPI  1271

Query  788   ---LSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYS  958
                LSD +D AWTG     ++     +L++ + R++        DS   +   +   +  
Sbjct  1272  MANLSDTLDGAWTG-----ENHPGVGTLKDDKNRLS--------DSAMEESSTTAVGLEG  1318

Query  959   FDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKL  1138
              D     ++R   +   SPS   + K      DY + +R P  N     ++     ++KL
Sbjct  1319  VDLEGHAKDRDGSKACYSPSPSLSAKDPDNMEDYMSWLRMPFLNFYRSLNKNFLTSSEKL  1378

Query  1139  NLLPSSSTTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDW  1312
               L   +  + S   +  L  GARL++P  G  D VI VYD+EPTS+ISYAL S EY   
Sbjct  1379  GTLGEYNPVYVSSFRSLELQGGARLLLPV-GVNDTVIPVYDDEPTSLISYALVSPEYHAQ  1437

Query  1313  VTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLD-YMHFGSYGSED---ASGRIG  1480
             +TD+      G  + DT + +  +S   ++     +  D Y  FG Y  E     SG   
Sbjct  1438  LTDE------GERIKDTGESNSFSSLSESFHSLEEVSFDLYKSFG-YTDESILSMSGSRS  1490

Query  1481  FLFSDP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSL  1651
              L  DP     + H R+SF D+  +  GK ++SVTCY+AK+F+ LR+ CCP+ELDF+RSL
Sbjct  1491  SLILDPLSYTKAMHVRVSFGDDGPD--GKARYSVTCYYAKRFETLRRICCPAELDFVRSL  1548

Query  1652  SRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTC  1831
             SRCK+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF YL+DS SS SPTC
Sbjct  1549  SRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFRYLSDSISSRSPTC  1608

Query  1832  LAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANK  2008
             LAK++GIYQV  K+LKGGKETKMD++VMENL Y R ++R+YDLKGS RSRYNSD+  +NK
Sbjct  1609  LAKILGIYQVTSKNLKGGKETKMDVLVMENLLYRRKVTRLYDLKGSSRSRYNSDSSGSNK  1668

Query  2009  VLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVL  2188
             VLLD N +E++ T PIF+G+K+KR LERAVWNDTSFLA + VMDYSLLVGVDEE+ EL L
Sbjct  1669  VLLDQNLIEAMPTSPIFVGNKSKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELAL  1728

Query  2189  GIIDYMRQYTWDKHLETW  2242
             GIID+MRQYTWDKHLETW
Sbjct  1729  GIIDFMRQYTWDKHLETW  1746



>ref|XP_010033658.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Eucalyptus grandis]
 gb|KCW53356.1| hypothetical protein EUGRSUZ_J02598 [Eucalyptus grandis]
Length=1834

 Score =   513 bits (1320),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 336/794 (42%), Positives = 458/794 (58%), Gaps = 100/794 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPPS ++F S   Q WI KE  ++  +A+ L++
Sbjct  1026  RDCLRFYGFGDMVACFRYASIDVHSVYLPPSKVDF-SHENQEWIQKEADKVFDRAELLFS  1084

Query  182   EISSAVQKLEEKC---ASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
             E+ + + + EEK      V C     + L   I++L+ ML +EK  + +  Q   +    
Sbjct  1085  EVLNTLSQFEEKRYVEGHVPCS----SELRRRIVDLEPMLQQEKAEFEESFQKALKGDPT  1140

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDN------NFSSQHPENAVSCINP  514
             +GQ  ID+LE+NRLR  LL     WDHRL Y+ S+  N      + SS+  E +    + 
Sbjct  1141  KGQHVIDILEINRLRRQLLIQSVIWDHRLVYLSSLSSNVEDCPRSLSSEEKETS---FHK  1197

Query  515   GEWGGETIFKDGSLEHAYEENVHEFPNSE---------------ECPGEGLHSEHDEPPV  649
             GE   E     G++ H  E  V    NSE               EC  E          +
Sbjct  1198  GETPSE-----GNVVHKEETVV---SNSESFRLDDRNTSLEGRFECQSEQGDDVCQNDQM  1249

Query  650   PKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAW  814
              + A S +Q  +  S + + + ++   LE+  N   + R  S G       LS+ +D AW
Sbjct  1250  GESASSREQKQAKVSESANASSQSE-PLESGTN---VRRTLSEGQFPTPANLSETLDAAW  1305

Query  815   TGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERIS  994
             TG + S+  ++   S        ++    + +DS   + +     V      L  + ++S
Sbjct  1306  TGKNQSNMAVKKEIS--------SALSDSAIIDSLKGEAVAEGLGVNGCAEDLG-KLKVS  1356

Query  995   KRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS  1174
               LPP    L + K +    D  + +  P+S  + +    L   +QKL++L         
Sbjct  1357  HSLPP----LLSTKDYDDAVDSVSWLGVPISLYRSLNKNNLA-GSQKLDMLGDYDPI---  1408

Query  1175  HASILPE----GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEG  1342
             H S   E    GARL++P  G  D VI VYD+EPTS+ISYAL+S          PY    
Sbjct  1409  HISSFRESEYGGARLLLPA-GINDTVIPVYDDEPTSMISYALAS----------PYYHAQ  1457

Query  1343  GWGVSDTNKESPIASKLSTWQRFG-----SLDLDYMHFGSYGSED-----ASGRIGFLFS  1492
               G ++  K++   + LS+          SLD       S GS D      SG       
Sbjct  1458  LCGEAEKVKDAEPVAALSSLDSMSFHSSQSLDDLTSESRSLGSVDDSMLSMSGSRSSQGL  1517

Query  1493  DP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCK  1663
             DP     + H +I F D+     G+VK+SVTCY+AK+F+ALR+ CCPSE+DF+RSLSRCK
Sbjct  1518  DPLSYTKALHVKIPFSDD-----GQVKYSVTCYYAKRFEALRRICCPSEMDFVRSLSRCK  1572

Query  1664  RWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKV  1843
             +W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S  +G PTCLAK+
Sbjct  1573  KWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESIRTGGPTCLAKI  1632

Query  1844  VGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLD  2020
             +GIYQV  KH+KGGKETKMD++VMENL YGR ++R+YDLKGS RSRYN+D T +NKVLLD
Sbjct  1633  LGIYQVTTKHVKGGKETKMDVLVMENLLYGRKVTRLYDLKGSTRSRYNADSTGSNKVLLD  1692

Query  2021  LNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIID  2200
              N +E+++T PIF+G+KAKR LERAVWNDTSFLA V VMDYSLLVGVDEE+ ELVLGIID
Sbjct  1693  QNLIEAMRTSPIFVGNKAKRLLERAVWNDTSFLALVDVMDYSLLVGVDEEKHELVLGIID  1752

Query  2201  YMRQYTWDKHLETW  2242
             +MRQYTWDKHLETW
Sbjct  1753  FMRQYTWDKHLETW  1766



>ref|XP_004510566.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
[Cicer arietinum]
Length=1814

 Score =   512 bits (1318),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 324/775 (42%), Positives = 445/775 (57%), Gaps = 75/775 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L F+    Q WI KE  E++ +A+ L++
Sbjct  1016  RDCLRFYGFGKMVACFRYASIDVHSVYLPPHKLNFD-YGNQDWIQKESNEVVNRAELLFS  1074

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             EI + + ++ EK +S     +      L   + EL+ ML KEK  + +  +    +    
Sbjct  1075  EILNGLSQIGEKRSSAAQTSSGQKTPELRRQVAELEGMLQKEKLEFEETLEKIMNQEKRN  1134

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSS-------------QHPENA  496
             GQ  ID+LE+NRL   LL   + WD+RL Y  S+ ++N  +             +    A
Sbjct  1135  GQPGIDILEINRLWRQLLFQSYMWDNRLIYAASLSNSNSETCSISEDKEIPPIDESLTTA  1194

Query  497   VSCINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQ  676
             VS    G    ++I  D +   A+ + +    N +        +E +E P          
Sbjct  1195  VSLAGRGFSSVDSIHSDPTQSDAFHQEIDMAKNKQ--------NEKEEQP---------N  1237

Query  677   GSSSTSCNGDK-TLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVH  853
              SSS S N     LE   G+  A+++ P    PS    LSD +D  WTG + S    Q  
Sbjct  1238  LSSSKSINDQSDLLELEWGVRRALSEGPFPVVPS----LSDTLDAKWTGENHSGIGTQKE  1293

Query  854   ASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTL  1033
             ++             + ++D      L +  +  ++    R++++       S S  S  
Sbjct  1294  ST------------SVINLDISMADALTTTTQRETYYLGDRMEDQNG-----SKSIYSAS  1336

Query  1034  KSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASIL--PEGARL  1207
             K   +  D  + +  P  N     ++ L   +QK   L   +  F S    L    GAR+
Sbjct  1337  KGHDSMEDSLSWLGMPFVNFYRQFNKNLFASSQKFETLVDYNPVFVSSFGKLELQGGARM  1396

Query  1208  MVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIAS  1387
             ++P  G  D VI +YD+EP+SII+YAL S EY   + D     EG      +   S   S
Sbjct  1397  LLP-IGVNDTVIPIYDDEPSSIIAYALMSPEYHSQLLD-----EGDRPKEGSELASSYFS  1450

Query  1388  KLSTWQRFGSLDLD-YMHFGSYGS-EDA----SGRIGFLFSDPKL---SPHPRISFEDES  1540
             +   +Q F S D + +    S+GS ED     SG       DP L   + H R+SF ++ 
Sbjct  1451  ESGAFQSFSSADDNAFDSQKSFGSIEDMILSISGSRNSSILDPVLYTKAMHARVSFGED-  1509

Query  1541  CNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDE  1720
                 GKVK+SVT Y+AK+F+ALR+ CCPSELD+IRSLSRCK+W AQGGKSNV+FAK+LD+
Sbjct  1510  -GPLGKVKYSVTGYYAKRFEALRRVCCPSELDYIRSLSRCKKWRAQGGKSNVFFAKTLDD  1568

Query  1721  RFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKM  1900
             RFIIKQ+ KTEL+SF +F P+YF+YL++S  +GSPTCLAK++GIYQV  KHLKGGKE++M
Sbjct  1569  RFIIKQVTKTELESFIKFGPEYFKYLSESIGTGSPTCLAKILGIYQVTSKHLKGGKESRM  1628

Query  1901  DLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLESLQTKPIFLGSKAK  2077
             D++VMENL + R+++R+YDLKGS RSRYN D T  NKVLLD N +E++ T PIF+G+KAK
Sbjct  1629  DVLVMENLLFRRTVTRLYDLKGSSRSRYNPDSTGKNKVLLDQNLIEAMPTSPIFVGNKAK  1688

Query  2078  RSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             R LERAVWNDT FLA V VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1689  RLLERAVWNDTGFLASVDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1743



>ref|XP_009766672.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Nicotiana sylvestris]
Length=1774

 Score =   511 bits (1316),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 329/794 (41%), Positives = 459/794 (58%), Gaps = 108/794 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPPS L+F  ++ Q WI +EV E++ +A+ L++
Sbjct  978   RDCLRFYGFGKMVACFRYASIDVHSVYLPPSKLDFYYEN-QEWIQQEVNEVIGRAELLFS  1036

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCIL---------ELKDMLMKEKNYWNDLHQPT  334
             ++ +A++ L EK +    +   +  L   +           L+ +LMKE           
Sbjct  1037  DVLNAIRVLVEKRSGRQLNRRQIADLERMLQKEKEEFEQESLQRILMKE-----------  1085

Query  335   HEETSEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI------FDNNFSSQHPENA  496
                  ++GQ+ +D+LE+NRLR  LL   + WDHRL Y  S+       + + +S  PE  
Sbjct  1086  ----VKKGQS-VDILEINRLRRQLLFQSYVWDHRLVYAASLDEKTHWINGDVASSEPEKP  1140

Query  497   VSCI-------NPG--------------EWGGETIFKDGSLEHAYEENVHEFPNSEECPG  613
             + C        NP               E GG T  +    ++++ ++VH+    E   G
Sbjct  1141  LVCNDKFTDLDNPSDSSKYPNNSESANFEAGGNTDEEKSVSQNSHVDSVHQ----ESVVG  1196

Query  614   EGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILS  793
                +   ++PP     L     S   +   +  L+ R  L +          P+  S LS
Sbjct  1197  FDANCAIEKPP----GLPVATKSFCGTHPAESILQGRRALSDG-------HFPNMES-LS  1244

Query  794   DKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSAL  973
             D ++ AWTG   S+  +     L++G     + G    V++                   
Sbjct  1245  DTLEAAWTGETTSAVGI-----LKDGMADTLTTGVAEKVNTED-----------------  1282

Query  974   RIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPS  1153
                E    ++  SP  LS+ K      D  + +  P  +     +++    AQKL+ L  
Sbjct  1283  HGDEESGTKMSQSPPLLSS-KGSENVEDSGSWLGMPFISFYRTLNKSFLPSAQKLDPLVG  1341

Query  1154  SSTTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKP  1327
              +  + S    S    GARL++P  G  D VI VYD+EPTSIISYAL+S +Y   ++D+ 
Sbjct  1342  YNPVYVSSFRESDARSGARLLLP-IGVNDTVIPVYDDEPTSIISYALASHDYHAQLSDEL  1400

Query  1328  YMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFS  1492
               S+     S+   +S  +  L + Q    + L+   + S GS D      S     L  
Sbjct  1401  EKSKDATLDSNFAIQSLDSGNLQSPQSIDEMVLE--SYRSLGSMDESILSLSVSRSSLDL  1458

Query  1493  DP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCK  1663
             DP     + H R+SF D+     GKVK++VTCY+AK+F+ALR+ CCPSE++FIRSLSRCK
Sbjct  1459  DPLSYAKTLHARVSFADD--GLVGKVKYTVTCYYAKRFEALRRICCPSEMEFIRSLSRCK  1516

Query  1664  RWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKV  1843
             +W AQGGKSNV+FAK+LDERFIIKQ+ KTEL+SF +FAP+YF+YL++S SSGSPTCLAKV
Sbjct  1517  KWGAQGGKSNVFFAKTLDERFIIKQVTKTELESFMKFAPEYFKYLSESISSGSPTCLAKV  1576

Query  1844  VGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLD  2020
             VGIYQV+ KHLKGGKE+KMD++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD
Sbjct  1577  VGIYQVSSKHLKGGKESKMDVLVMENLLFGRNLTRLYDLKGSARSRYNPDSSGSNKVLLD  1636

Query  2021  LNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIID  2200
              N +E++ T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELVLGIID
Sbjct  1637  QNLIEAMPTSPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVLGIID  1696

Query  2201  YMRQYTWDKHLETW  2242
             +MRQYTWDKHLETW
Sbjct  1697  FMRQYTWDKHLETW  1710



>ref|XP_010314342.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X6 [Solanum lycopersicum]
Length=1682

 Score =   509 bits (1311),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 331/793 (42%), Positives = 454/793 (57%), Gaps = 92/793 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ L+FN +  Q WI +EV E++ +A+ L++
Sbjct  868   RDCLRFYGFGKMVACFRYASIDVHSVCLPPAKLDFNDEKNQDWIQQEVNEVIVRAERLFS  927

Query  182   EISSAVQKLEEKCA----SVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETS  349
             E+ +A++ L EK +    +   + +        I  L+ ML KEK  + +  Q    + +
Sbjct  928   EVLNAIRLLVEKKSGGQVNSSAEASEAPEARGQIAVLEGMLRKEKEEFEESLQKILNKEA  987

Query  350   EEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI---------------FDNNFSSQH  484
             ++ Q  ID+ E+NRLR   +   + WDHRL Y  S+                D +    +
Sbjct  988   KKVQPVIDIFEINRLRRQFIFQSYMWDHRLVYAASLECEDHCVTEEKPLVGNDKSTGPDN  1047

Query  485   PENAVSCINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDAL  664
             P     C+N  +    T      L   Y + V            G    H +        
Sbjct  1048  PSRPSDCLNVIDSVSVTPI----LGEKYNDGV-----------SGSQKNHVD--------  1084

Query  665   SYQQGSS---STSCNGDKT------LETRLGLENAVNKSPLERAPSAGS-----ILSDKI  802
             +  QGS     +SC  +K        E+  GL +A + +   RA S G       LSD +
Sbjct  1085  TVHQGSEVLLDSSCAVEKPAGLPAGTESFCGLNSAESTAEGSRALSDGQSAVMDTLSDTL  1144

Query  803   DCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
             + AWTG   S   +    + +  E  +A        DS T +  +        D    ++
Sbjct  1145  EAAWTGETTSGPGVLKDGTCRSSEPPIA--------DSSTTRLAEK------VDVEDPVE  1190

Query  983   ERISKR--LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSS  1156
             E  +K    PPS S  S+  +  A G +  M    +S    +    LP  AQKL+ L   
Sbjct  1191  ENGTKASGFPPSLSSKSSESAEDA-GGWLGM--SFISFYWSLNKNFLP-SAQKLDTLGEY  1246

Query  1157  STTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPY  1330
             S  + S    S    GARL++P  G  D +I VYD EPTSIISYAL S +Y   ++D+P 
Sbjct  1247  SPVYISSFRESEAQGGARLLLPV-GVNDTIIPVYDEEPTSIISYALVSPDYLAQISDEPE  1305

Query  1331  MSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFS-----D  1495
              S+     S+   +S  +  L + Q    +  + +   S GS D S             D
Sbjct  1306  KSKDASLYSNLPLQSQESGSLQSLQSMDEILSESLR--SLGSIDESFLSSSSSHSSSVLD  1363

Query  1496  P---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKR  1666
             P     + H R+SF D+     GKVK++VTCY+AK+F+ALR+KCCPSE+D+IRSLSRCK+
Sbjct  1364  PLSCTKTMHARVSFSDD--GPLGKVKYNVTCYYAKRFEALRRKCCPSEMDYIRSLSRCKK  1421

Query  1667  WSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVV  1846
             W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S +S SPTCLAK++
Sbjct  1422  WGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESINSRSPTCLAKIL  1481

Query  1847  GIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDL  2023
             GIYQV  KHLKGGKE+K+D++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD 
Sbjct  1482  GIYQVTSKHLKGGKESKLDVLVMENLLFGRNLTRLYDLKGSARSRYNPDSSGSNKVLLDQ  1541

Query  2024  NFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDY  2203
             N +ES+ T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELV+GIID+
Sbjct  1542  NLIESMPTSPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVIGIIDF  1601

Query  2204  MRQYTWDKHLETW  2242
             MRQYTWDKHLETW
Sbjct  1602  MRQYTWDKHLETW  1614



>gb|EYU21277.1| hypothetical protein MIMGU_mgv1a000104mg [Erythranthe guttata]
Length=1780

 Score =   510 bits (1314),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 328/786 (42%), Positives = 455/786 (58%), Gaps = 94/786 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPPS LEFN +  Q W+ +E+ E++ +A+ L++
Sbjct  978   RDCLRFYGFGKMVACFRYASIHVHSVYLPPSKLEFNYEC-QEWLERELNEVVGRAELLFS  1036

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             ++ +A++ L E+ +S+G      +     I +L+ ML KEK  + +  Q   ++ +++GQ
Sbjct  1037  DVLNALRLLIERKSSLG----KTSESKRQIADLEVMLQKEKLEFEESLQKLLKKEAKKGQ  1092

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNN------FSSQHP--------ENAV  499
               ID+LELNR+R  L+   + WDHRL Y +++   N       +S  P        EN +
Sbjct  1093  PIIDILELNRVRRQLIFQSYVWDHRLIYADTLDTKNQSDDMEVASSEPIKKPLVDTENIL  1152

Query  500   SCINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQG  679
                 P     +++  D   E          P+++    EG+H++ D           ++ 
Sbjct  1153  DINIPVLGSPQSLADDAKAEQN--------PDNKASDTEGVHNKIDLLLNCDHGNKIERA  1204

Query  680   SSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGS---ILSDKIDCAWTGIDPSSQDMQV  850
              S  S   D++       +  ++   + RA S G     LSD +D AWTG   +    + 
Sbjct  1205  HSRGSKATDES-------DPLISGVTVRRALSEGQAPICLSDTLDAAWTGESNTGLRSKD  1257

Query  851   HASLQ--EGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYL  1024
             +  L+  EG++  ++ G    +D            +  F   LR+            S L
Sbjct  1258  NGFLESVEGDKNSSTAGASDKLD------------MEDFKEDLRLSHL--------HSVL  1297

Query  1025  STLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEG  1198
             ST KS+ A  D    +  P  +             Q L+ L +    + S    S L  G
Sbjct  1298  ST-KSYDAKDDTGGWLGFPFVSFYRSFHINFLGGGQNLDTLGAYDPVYISSYRESELQGG  1356

Query  1199  ARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESP  1378
             ARL++P  G  D V+ VYD+EPTSIISYAL S +Y   + ++P            +K   
Sbjct  1357  ARLLLPV-GVNDTVVPVYDDEPTSIISYALVSPDYVAQMYEEP------------DKPKD  1403

Query  1379  IASKLSTWQRFGS------LDLDYMHFGSY---GSED-----ASGRIGFLFSDP---KLS  1507
              A  + T Q F +        LD M   SY   GS D      +     L  DP     +
Sbjct  1404  TADSVFTMQSFDAGVFQSFHSLDEMMLESYRNLGSGDDVFLSLTSSRSSLPLDPLSYTKA  1463

Query  1508  PHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGK  1687
              H ++SF D+  N G KVK++VTCYFAK+F+ALR+ CCPSE+DF+RSLSRCK+W AQGGK
Sbjct  1464  LHVKVSFADDGGNLG-KVKYTVTCYFAKRFEALRRICCPSEVDFVRSLSRCKKWGAQGGK  1522

Query  1688  SNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAV  1867
             SNV+FAK+LD+RFIIKQ+ KTEL+SF +FA +YF+YL++S  S SPTCLAK++GIYQV  
Sbjct  1523  SNVFFAKTLDDRFIIKQVTKTELESFTKFASEYFKYLSESICSRSPTCLAKILGIYQVTT  1582

Query  1868  KHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQ  2044
             KHLKGGKETKMDL+VMENL +GR+  R+YDLKGS RSRYN D+  +NKVLLD N +ES+ 
Sbjct  1583  KHLKGGKETKMDLLVMENLLFGRNPIRLYDLKGSSRSRYNPDSSGSNKVLLDQNLIESMP  1642

Query  2045  TKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWD  2224
             T PIF+G++AKR LERAVWNDT FLA + VMDYSLLVGVDEE++ELVLGIID+MRQYTWD
Sbjct  1643  TSPIFVGNRAKRLLERAVWNDTGFLANIDVMDYSLLVGVDEEKQELVLGIIDFMRQYTWD  1702

Query  2225  KHLETW  2242
             KHLETW
Sbjct  1703  KHLETW  1708



>ref|XP_010314341.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X5 [Solanum lycopersicum]
Length=1696

 Score =   509 bits (1311),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 331/793 (42%), Positives = 454/793 (57%), Gaps = 92/793 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ L+FN +  Q WI +EV E++ +A+ L++
Sbjct  882   RDCLRFYGFGKMVACFRYASIDVHSVCLPPAKLDFNDEKNQDWIQQEVNEVIVRAERLFS  941

Query  182   EISSAVQKLEEKCA----SVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETS  349
             E+ +A++ L EK +    +   + +        I  L+ ML KEK  + +  Q    + +
Sbjct  942   EVLNAIRLLVEKKSGGQVNSSAEASEAPEARGQIAVLEGMLRKEKEEFEESLQKILNKEA  1001

Query  350   EEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI---------------FDNNFSSQH  484
             ++ Q  ID+ E+NRLR   +   + WDHRL Y  S+                D +    +
Sbjct  1002  KKVQPVIDIFEINRLRRQFIFQSYMWDHRLVYAASLECEDHCVTEEKPLVGNDKSTGPDN  1061

Query  485   PENAVSCINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDAL  664
             P     C+N  +    T      L   Y + V            G    H +        
Sbjct  1062  PSRPSDCLNVIDSVSVTPI----LGEKYNDGV-----------SGSQKNHVD--------  1098

Query  665   SYQQGSS---STSCNGDKT------LETRLGLENAVNKSPLERAPSAGS-----ILSDKI  802
             +  QGS     +SC  +K        E+  GL +A + +   RA S G       LSD +
Sbjct  1099  TVHQGSEVLLDSSCAVEKPAGLPAGTESFCGLNSAESTAEGSRALSDGQSAVMDTLSDTL  1158

Query  803   DCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
             + AWTG   S   +    + +  E  +A        DS T +  +        D    ++
Sbjct  1159  EAAWTGETTSGPGVLKDGTCRSSEPPIA--------DSSTTRLAEK------VDVEDPVE  1204

Query  983   ERISKR--LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSS  1156
             E  +K    PPS S  S+  +  A G +  M    +S    +    LP  AQKL+ L   
Sbjct  1205  ENGTKASGFPPSLSSKSSESAEDA-GGWLGM--SFISFYWSLNKNFLP-SAQKLDTLGEY  1260

Query  1157  STTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPY  1330
             S  + S    S    GARL++P  G  D +I VYD EPTSIISYAL S +Y   ++D+P 
Sbjct  1261  SPVYISSFRESEAQGGARLLLPV-GVNDTIIPVYDEEPTSIISYALVSPDYLAQISDEPE  1319

Query  1331  MSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFS-----D  1495
              S+     S+   +S  +  L + Q    +  + +   S GS D S             D
Sbjct  1320  KSKDASLYSNLPLQSQESGSLQSLQSMDEILSESLR--SLGSIDESFLSSSSSHSSSVLD  1377

Query  1496  P---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKR  1666
             P     + H R+SF D+     GKVK++VTCY+AK+F+ALR+KCCPSE+D+IRSLSRCK+
Sbjct  1378  PLSCTKTMHARVSFSDD--GPLGKVKYNVTCYYAKRFEALRRKCCPSEMDYIRSLSRCKK  1435

Query  1667  WSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVV  1846
             W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S +S SPTCLAK++
Sbjct  1436  WGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESINSRSPTCLAKIL  1495

Query  1847  GIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDL  2023
             GIYQV  KHLKGGKE+K+D++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD 
Sbjct  1496  GIYQVTSKHLKGGKESKLDVLVMENLLFGRNLTRLYDLKGSARSRYNPDSSGSNKVLLDQ  1555

Query  2024  NFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDY  2203
             N +ES+ T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELV+GIID+
Sbjct  1556  NLIESMPTSPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVIGIIDF  1615

Query  2204  MRQYTWDKHLETW  2242
             MRQYTWDKHLETW
Sbjct  1616  MRQYTWDKHLETW  1628



>ref|XP_010314340.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X4 [Solanum lycopersicum]
Length=1722

 Score =   509 bits (1312),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 331/793 (42%), Positives = 454/793 (57%), Gaps = 92/793 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ L+FN +  Q WI +EV E++ +A+ L++
Sbjct  908   RDCLRFYGFGKMVACFRYASIDVHSVCLPPAKLDFNDEKNQDWIQQEVNEVIVRAERLFS  967

Query  182   EISSAVQKLEEKCA----SVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETS  349
             E+ +A++ L EK +    +   + +        I  L+ ML KEK  + +  Q    + +
Sbjct  968   EVLNAIRLLVEKKSGGQVNSSAEASEAPEARGQIAVLEGMLRKEKEEFEESLQKILNKEA  1027

Query  350   EEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI---------------FDNNFSSQH  484
             ++ Q  ID+ E+NRLR   +   + WDHRL Y  S+                D +    +
Sbjct  1028  KKVQPVIDIFEINRLRRQFIFQSYMWDHRLVYAASLECEDHCVTEEKPLVGNDKSTGPDN  1087

Query  485   PENAVSCINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDAL  664
             P     C+N  +    T      L   Y + V            G    H +        
Sbjct  1088  PSRPSDCLNVIDSVSVTPI----LGEKYNDGV-----------SGSQKNHVD--------  1124

Query  665   SYQQGSS---STSCNGDKT------LETRLGLENAVNKSPLERAPSAGS-----ILSDKI  802
             +  QGS     +SC  +K        E+  GL +A + +   RA S G       LSD +
Sbjct  1125  TVHQGSEVLLDSSCAVEKPAGLPAGTESFCGLNSAESTAEGSRALSDGQSAVMDTLSDTL  1184

Query  803   DCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
             + AWTG   S   +    + +  E  +A        DS T +  +        D    ++
Sbjct  1185  EAAWTGETTSGPGVLKDGTCRSSEPPIA--------DSSTTRLAEK------VDVEDPVE  1230

Query  983   ERISKR--LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSS  1156
             E  +K    PPS S  S+  +  A G +  M    +S    +    LP  AQKL+ L   
Sbjct  1231  ENGTKASGFPPSLSSKSSESAEDA-GGWLGM--SFISFYWSLNKNFLP-SAQKLDTLGEY  1286

Query  1157  STTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPY  1330
             S  + S    S    GARL++P  G  D +I VYD EPTSIISYAL S +Y   ++D+P 
Sbjct  1287  SPVYISSFRESEAQGGARLLLPV-GVNDTIIPVYDEEPTSIISYALVSPDYLAQISDEPE  1345

Query  1331  MSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFS-----D  1495
              S+     S+   +S  +  L + Q    +  + +   S GS D S             D
Sbjct  1346  KSKDASLYSNLPLQSQESGSLQSLQSMDEILSESLR--SLGSIDESFLSSSSSHSSSVLD  1403

Query  1496  P---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKR  1666
             P     + H R+SF D+     GKVK++VTCY+AK+F+ALR+KCCPSE+D+IRSLSRCK+
Sbjct  1404  PLSCTKTMHARVSFSDD--GPLGKVKYNVTCYYAKRFEALRRKCCPSEMDYIRSLSRCKK  1461

Query  1667  WSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVV  1846
             W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S +S SPTCLAK++
Sbjct  1462  WGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESINSRSPTCLAKIL  1521

Query  1847  GIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDL  2023
             GIYQV  KHLKGGKE+K+D++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD 
Sbjct  1522  GIYQVTSKHLKGGKESKLDVLVMENLLFGRNLTRLYDLKGSARSRYNPDSSGSNKVLLDQ  1581

Query  2024  NFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDY  2203
             N +ES+ T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELV+GIID+
Sbjct  1582  NLIESMPTSPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVIGIIDF  1641

Query  2204  MRQYTWDKHLETW  2242
             MRQYTWDKHLETW
Sbjct  1642  MRQYTWDKHLETW  1654



>dbj|BAJ98373.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1796

 Score =   510 bits (1313),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 322/776 (41%), Positives = 442/776 (57%), Gaps = 96/776 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPP  L+F SQ  Q W+ +E  E++  A+ L+ 
Sbjct  1021  RDCLRFYGFGEMVACFRYASIKVHSVYLPPPKLDFTSQ-HQEWVEQEANEVVDSAELLFT  1079

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ ++ EK    G    NM    L   I+EL+D+L  EK  + +  +   ++   +
Sbjct  1080  EVLNALHQISEKRPITGSFDGNMKILELRQNIVELEDILQAEKVDFTESLKNLLKKEIRK  1139

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+LE+N+LR  LL   + WD RL ++ +      S     +A+  +  G    E 
Sbjct  1140  GQLFIDILEVNKLRRQLLFLCYLWDQRLSFIAT------SGGKYCDALGGLRVGSNNSE-  1192

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTL  715
                D S +   + N     NS+      LH++ DE     D  +     ++   NG +  
Sbjct  1193  -INDRSADS--DTNTKLVKNSKGTDSNALHAD-DEEINQHDQSNETNSRNTEELNGAEGT  1248

Query  716   ETRLGLENAVNKSP----------LERAPSAGSI-----LSDKIDCAWTGIDPSSQDMQV  850
               +L   N+VN +           + R  S G       +SDK+D  W G D  + D  +
Sbjct  1249  IAKLNHANSVNVNDHLDHQGSIIGVRRVSSEGQFRVATDISDKLDAKWRGEDRPAPDASL  1308

Query  851   HASLQEGERRVASFG-QLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLS  1027
                L   E   A    Q   V   T   ++S   V    S L++         P  ++ +
Sbjct  1309  VKPLALLEGTAADVKKQAKAVPRHTSASVRSGDTVEDLLSCLKM---------PYMTFYN  1359

Query  1028  TLKS-------FHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASI  1186
             +L +       F    DY  +    +S  + +  Q                         
Sbjct  1360  SLNTNSGTAPTFGTLADYNPVY---ISLFRDLSQQG------------------------  1392

Query  1187  LPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTN  1366
                GARL +P  G  DVVI V+D+EPTSIISYAL S  Y   ++ +          S+ N
Sbjct  1393  ---GARLFLP-TGANDVVIPVFDDEPTSIISYALVSPVYHFQMSVE----------SNQN  1438

Query  1367  KESPIASKLSTWQRFGSLDLDYMHFGSYGSED----ASGRIGFLFSDPKLSPHPRISFED  1534
             K+S  +S        G+ +L ++ F  +GS D    +       F+   L  H R+SF+D
Sbjct  1439  KDSGDSSLSLPVYDSGNFNLFHL-FEDFGSSDDFASSISSSRGSFARDLL--HSRVSFQD  1495

Query  1535  ESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSL  1714
                   GKVK++VTCY+AK F+ LR+ CCPSELD++RS+SRCK+W AQGGKSNV+FAKSL
Sbjct  1496  GG--PLGKVKYTVTCYYAKNFEELRRSCCPSELDYLRSISRCKKWGAQGGKSNVFFAKSL  1553

Query  1715  DERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKET  1894
             D+RFIIKQ+ KTEL+SF +F P YF+YL++S S+GSPTCLAK++GIYQV +KHLKGGKE+
Sbjct  1554  DDRFIIKQVTKTELESFLQFGPDYFKYLSESVSTGSPTCLAKILGIYQVTIKHLKGGKES  1613

Query  1895  KMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKA  2074
             KMDL+VMENL +GR+I+R+YDLKGS RSRYN+D+  NKVLLD N +E++ T PIF+G+KA
Sbjct  1614  KMDLLVMENLLFGRNITRLYDLKGSSRSRYNADSSRNKVLLDQNLIEAMPTSPIFVGNKA  1673

Query  2075  KRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             KR LERAVWNDTSFLAG+ VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1674  KRLLERAVWNDTSFLAGIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1729



>ref|XP_010314339.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X3 [Solanum lycopersicum]
Length=1737

 Score =   509 bits (1310),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 331/793 (42%), Positives = 454/793 (57%), Gaps = 92/793 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ L+FN +  Q WI +EV E++ +A+ L++
Sbjct  923   RDCLRFYGFGKMVACFRYASIDVHSVCLPPAKLDFNDEKNQDWIQQEVNEVIVRAERLFS  982

Query  182   EISSAVQKLEEKCA----SVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETS  349
             E+ +A++ L EK +    +   + +        I  L+ ML KEK  + +  Q    + +
Sbjct  983   EVLNAIRLLVEKKSGGQVNSSAEASEAPEARGQIAVLEGMLRKEKEEFEESLQKILNKEA  1042

Query  350   EEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI---------------FDNNFSSQH  484
             ++ Q  ID+ E+NRLR   +   + WDHRL Y  S+                D +    +
Sbjct  1043  KKVQPVIDIFEINRLRRQFIFQSYMWDHRLVYAASLECEDHCVTEEKPLVGNDKSTGPDN  1102

Query  485   PENAVSCINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDAL  664
             P     C+N  +    T      L   Y + V            G    H +        
Sbjct  1103  PSRPSDCLNVIDSVSVTPI----LGEKYNDGV-----------SGSQKNHVD--------  1139

Query  665   SYQQGSS---STSCNGDKT------LETRLGLENAVNKSPLERAPSAGS-----ILSDKI  802
             +  QGS     +SC  +K        E+  GL +A + +   RA S G       LSD +
Sbjct  1140  TVHQGSEVLLDSSCAVEKPAGLPAGTESFCGLNSAESTAEGSRALSDGQSAVMDTLSDTL  1199

Query  803   DCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
             + AWTG   S   +    + +  E  +A        DS T +  +        D    ++
Sbjct  1200  EAAWTGETTSGPGVLKDGTCRSSEPPIA--------DSSTTRLAEK------VDVEDPVE  1245

Query  983   ERISKR--LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSS  1156
             E  +K    PPS S  S+  +  A G +  M    +S    +    LP  AQKL+ L   
Sbjct  1246  ENGTKASGFPPSLSSKSSESAEDA-GGWLGM--SFISFYWSLNKNFLP-SAQKLDTLGEY  1301

Query  1157  STTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPY  1330
             S  + S    S    GARL++P  G  D +I VYD EPTSIISYAL S +Y   ++D+P 
Sbjct  1302  SPVYISSFRESEAQGGARLLLPV-GVNDTIIPVYDEEPTSIISYALVSPDYLAQISDEPE  1360

Query  1331  MSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFS-----D  1495
              S+     S+   +S  +  L + Q    +  + +   S GS D S             D
Sbjct  1361  KSKDASLYSNLPLQSQESGSLQSLQSMDEILSESLR--SLGSIDESFLSSSSSHSSSVLD  1418

Query  1496  P---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKR  1666
             P     + H R+SF D+     GKVK++VTCY+AK+F+ALR+KCCPSE+D+IRSLSRCK+
Sbjct  1419  PLSCTKTMHARVSFSDD--GPLGKVKYNVTCYYAKRFEALRRKCCPSEMDYIRSLSRCKK  1476

Query  1667  WSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVV  1846
             W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S +S SPTCLAK++
Sbjct  1477  WGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESINSRSPTCLAKIL  1536

Query  1847  GIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDL  2023
             GIYQV  KHLKGGKE+K+D++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD 
Sbjct  1537  GIYQVTSKHLKGGKESKLDVLVMENLLFGRNLTRLYDLKGSARSRYNPDSSGSNKVLLDQ  1596

Query  2024  NFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDY  2203
             N +ES+ T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELV+GIID+
Sbjct  1597  NLIESMPTSPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVIGIIDF  1656

Query  2204  MRQYTWDKHLETW  2242
             MRQYTWDKHLETW
Sbjct  1657  MRQYTWDKHLETW  1669



>emb|CBI35800.3| unnamed protein product [Vitis vinifera]
Length=1652

 Score =   507 bits (1305),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 323/756 (43%), Positives = 427/756 (56%), Gaps = 142/756 (19%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ LEFN ++ Q WI KE  E++ +A+ L++
Sbjct  963   RDCLRFYGFGKMVACFRYASIDVHSVYLPPAKLEFNYEN-QEWIQKETNEVVDRAELLFS  1021

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ +A+ ++ EK   +G     +    + I EL+ ML KEK  + +  Q      +++GQ
Sbjct  1022  EVCNALHRISEKGHGMGL----ITESRHQIAELEGMLQKEKAEFEESLQKAVSREAKKGQ  1077

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LE+NRLR  LL   + WDHRL Y  S+  N+          SC        +++ 
Sbjct  1078  PLVDILEINRLRRQLLFQSYVWDHRLIYAASLDKNSIGFS------SC--------DSLL  1123

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSE---HDEPPVPKDALSYQQGSSSTSCNGDKT  712
              D  L           PN     GEG+ S+   HD         +  QG+       D  
Sbjct  1124  VDAKLNKG--------PNQ----GEGISSQSSQHD---------TVYQGT-------DMV  1155

Query  713   LETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASF  892
              ++    E+  N       P++ + LS  +D  WTG        + H      +    + 
Sbjct  1156  QDSNHKEEDQGN------LPASSNDLSHTLDAKWTG--------ENHPGTGAPKDNTCAL  1201

Query  893   GQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMI  1072
               L+  DS T               AL  Q+ I      S S +S L  + A+   +N +
Sbjct  1202  PDLALADSST---------------ALVGQDTIEDS--ASWSGMSFLNFYRAFN--KNFL  1242

Query  1073  RDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGARLMVPENGQKDVVIA  1246
                               AQKL+ L   +  + S      L  GARL++P  G  D VI 
Sbjct  1243  G----------------SAQKLDTLGEYNPVYVSSFRELELQGGARLLLPV-GVNDTVIP  1285

Query  1247  VYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDL  1426
             VYD+EPTSII YAL S +Y                          A  L  W+R    D 
Sbjct  1286  VYDDEPTSIICYALVSPQYH-------------------------AQLLDEWERPKDDDS  1320

Query  1427  DYMHFGSYGSEDASGRIGFLFSDP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQF  1597
                  GS  S         L  DP     + H R+ F D+S    GKVK++VTCY+AK+F
Sbjct  1321  FLSMSGSRSS---------LVPDPFSYTKALHARVFFSDDS--PLGKVKYTVTCYYAKRF  1369

Query  1598  DALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFA  1777
             +ALR+ CCPSELDF+RSL RCK+W AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+SF +FA
Sbjct  1370  EALRRICCPSELDFLRSLCRCKKWGAQGGKSNVFFAKSLDDRFIIKQVTKTELESFIKFA  1429

Query  1778  PKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYD  1957
             P YF+YL++S S+GSPTCLAK++GIYQV  KHLKGGKE++MDL+VMENL + R+++R+YD
Sbjct  1430  PAYFKYLSESISTGSPTCLAKILGIYQVTSKHLKGGKESRMDLLVMENLLFERTVTRLYD  1489

Query  1958  LKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYV  2134
             LKGS RSRYN+D+   NKVLLD N +E++ T PIF+G+KAKR LERAVWNDTSFLA V V
Sbjct  1490  LKGSSRSRYNADSSGNNKVLLDQNLIEAMPTSPIFVGNKAKRVLERAVWNDTSFLASVDV  1549

Query  2135  MDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             MDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1550  MDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1585



>gb|KEH18518.1| 1-phosphatidylinositol-3-phosphate 5-kinase [Medicago truncatula]
Length=1819

 Score =   509 bits (1311),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 321/775 (41%), Positives = 448/775 (58%), Gaps = 68/775 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L F+    Q WI KE  E++ +A+ L++
Sbjct  1014  RDCLRFYGFGKMVACFRYASIDVHSVYLPPHKLNFD-YGNQDWIQKETDEVVNRAELLFS  1072

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNC------ILELKDMLMKEKNYWNDLHQPTHEE  343
             EI + + ++ EK +S     + +N  H        + EL+ ML +EK  + +  Q    +
Sbjct  1073  EILNGLGQIGEKRSSA----SQINSGHKTPEIRRQVAELEGMLQREKLEFEETLQKILNQ  1128

Query  344   TSEEGQ--TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNN----FSSQHPENAVSC  505
                 GQ  T ID+LE+NRL   LL   + WDHRL Y +S+ ++N     SS   E+    
Sbjct  1129  EKRNGQPGTGIDILEVNRLWRQLLFQSYMWDHRLIYADSLANSNNETGLSSSISEDMEIP  1188

Query  506   INPGEWGGETIFKDGSLE---HAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQ  676
             I+      E +  D SL     +  +++    +++    +  H E D     ++    Q 
Sbjct  1189  ID------ENLTTDVSLAGRGFSSVDSICGVVDAKSSQSDAFHQEVDMVKNKQNEKEEQP  1242

Query  677   GSSSTSCNGDKT--LETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV  850
               S +    D++  LE  LG+  A+++ P    PS    LS+ +D  WTG + S    Q 
Sbjct  1243  NLSISKSINDQSDLLEPELGVRRALSEGPFPVVPS----LSETLDAKWTGENQSGIGTQK  1298

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
              ++               + D+ T   L +  +  ++    R +++   +     S  S 
Sbjct  1299  DSTS-------------VNPDTSTADALTATVQREAYHLGDRTEDQNGYK-----SIFSA  1340

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASIL--PEGAR  1204
              K      D  + +  P  N     ++ L   +QK   L   +  F S    L    GAR
Sbjct  1341  PKGHDNMEDSLSWLGMPFLNFYRQFNKNLFASSQKFETLVDYNPVFVSSFGKLELQGGAR  1400

Query  1205  LMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA  1384
             +++P  G  D VI +YD+EP+SII+YAL S EY   ++D     + G     +   S   
Sbjct  1401  MLLPI-GINDTVIPIYDDEPSSIIAYALMSPEYHFQLSDDGERPKDG----SSELASSYF  1455

Query  1385  SKLSTWQRFGSLDLDYMHFGSYGS-EDASGRIGFLFSDPKLSP-------HPRISFEDES  1540
             S    +Q F S D  +    S+GS ED    +    +   L P       H R+SF ++ 
Sbjct  1456  SDSGAFQSFSSADDAFDSQKSFGSIEDMILSMSGTRNSSMLDPVTHTKAMHARVSFGEDG  1515

Query  1541  CNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDE  1720
                 GKVK+SVT Y+AK+F+ALR+ CCPSELD+IRSLSRCK+W AQGGKSNV+FAK+LD+
Sbjct  1516  LL--GKVKYSVTGYYAKRFEALRRVCCPSELDYIRSLSRCKKWRAQGGKSNVFFAKTLDD  1573

Query  1721  RFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKM  1900
             RFIIKQ+ KTEL+SF +F P+YF+YL++S ++GSPTCLAK++GIYQV  KHLKGGKE+KM
Sbjct  1574  RFIIKQVTKTELESFIKFGPEYFKYLSESIATGSPTCLAKILGIYQVTSKHLKGGKESKM  1633

Query  1901  DLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLESLQTKPIFLGSKAK  2077
             D++VMENL + R+++R+YDLKGS RSRYN D T  NKVLLD N +E++ T PIF+G+KAK
Sbjct  1634  DVLVMENLLFRRTVTRLYDLKGSSRSRYNPDSTGKNKVLLDQNLIEAMPTSPIFVGNKAK  1693

Query  2078  RSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             R LER VWNDT FLA V VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1694  RLLERGVWNDTGFLASVDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1748



>ref|XP_003627444.1| 1-phosphatidylinositol-3-phosphate 5-kinase [Medicago truncatula]
 gb|AET01920.1| 1-phosphatidylinositol-3-phosphate 5-kinase [Medicago truncatula]
Length=1811

 Score =   509 bits (1311),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 321/775 (41%), Positives = 448/775 (58%), Gaps = 68/775 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L F+    Q WI KE  E++ +A+ L++
Sbjct  1006  RDCLRFYGFGKMVACFRYASIDVHSVYLPPHKLNFD-YGNQDWIQKETDEVVNRAELLFS  1064

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNC------ILELKDMLMKEKNYWNDLHQPTHEE  343
             EI + + ++ EK +S     + +N  H        + EL+ ML +EK  + +  Q    +
Sbjct  1065  EILNGLGQIGEKRSSA----SQINSGHKTPEIRRQVAELEGMLQREKLEFEETLQKILNQ  1120

Query  344   TSEEGQ--TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNN----FSSQHPENAVSC  505
                 GQ  T ID+LE+NRL   LL   + WDHRL Y +S+ ++N     SS   E+    
Sbjct  1121  EKRNGQPGTGIDILEVNRLWRQLLFQSYMWDHRLIYADSLANSNNETGLSSSISEDMEIP  1180

Query  506   INPGEWGGETIFKDGSLE---HAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQ  676
             I+      E +  D SL     +  +++    +++    +  H E D     ++    Q 
Sbjct  1181  ID------ENLTTDVSLAGRGFSSVDSICGVVDAKSSQSDAFHQEVDMVKNKQNEKEEQP  1234

Query  677   GSSSTSCNGDKT--LETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV  850
               S +    D++  LE  LG+  A+++ P    PS    LS+ +D  WTG + S    Q 
Sbjct  1235  NLSISKSINDQSDLLEPELGVRRALSEGPFPVVPS----LSETLDAKWTGENQSGIGTQK  1290

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
              ++               + D+ T   L +  +  ++    R +++   +     S  S 
Sbjct  1291  DSTS-------------VNPDTSTADALTATVQREAYHLGDRTEDQNGYK-----SIFSA  1332

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASIL--PEGAR  1204
              K      D  + +  P  N     ++ L   +QK   L   +  F S    L    GAR
Sbjct  1333  PKGHDNMEDSLSWLGMPFLNFYRQFNKNLFASSQKFETLVDYNPVFVSSFGKLELQGGAR  1392

Query  1205  LMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA  1384
             +++P  G  D VI +YD+EP+SII+YAL S EY   ++D     + G     +   S   
Sbjct  1393  MLLPI-GINDTVIPIYDDEPSSIIAYALMSPEYHFQLSDDGERPKDG----SSELASSYF  1447

Query  1385  SKLSTWQRFGSLDLDYMHFGSYGS-EDASGRIGFLFSDPKLSP-------HPRISFEDES  1540
             S    +Q F S D  +    S+GS ED    +    +   L P       H R+SF ++ 
Sbjct  1448  SDSGAFQSFSSADDAFDSQKSFGSIEDMILSMSGTRNSSMLDPVTHTKAMHARVSFGEDG  1507

Query  1541  CNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDE  1720
                 GKVK+SVT Y+AK+F+ALR+ CCPSELD+IRSLSRCK+W AQGGKSNV+FAK+LD+
Sbjct  1508  LL--GKVKYSVTGYYAKRFEALRRVCCPSELDYIRSLSRCKKWRAQGGKSNVFFAKTLDD  1565

Query  1721  RFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKM  1900
             RFIIKQ+ KTEL+SF +F P+YF+YL++S ++GSPTCLAK++GIYQV  KHLKGGKE+KM
Sbjct  1566  RFIIKQVTKTELESFIKFGPEYFKYLSESIATGSPTCLAKILGIYQVTSKHLKGGKESKM  1625

Query  1901  DLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLESLQTKPIFLGSKAK  2077
             D++VMENL + R+++R+YDLKGS RSRYN D T  NKVLLD N +E++ T PIF+G+KAK
Sbjct  1626  DVLVMENLLFRRTVTRLYDLKGSSRSRYNPDSTGKNKVLLDQNLIEAMPTSPIFVGNKAK  1685

Query  2078  RSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             R LER VWNDT FLA V VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1686  RLLERGVWNDTGFLASVDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1740



>ref|XP_008797353.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
isoform X2 [Phoenix dactylifera]
Length=1856

 Score =   509 bits (1312),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 335/798 (42%), Positives = 458/798 (57%), Gaps = 101/798 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+PI++ SV LPP  L+FN Q  Q W+ KEV E+   A+ L+ 
Sbjct  1038  RDCLRFYGFGRMVACFRYAPINLHSVYLPPPKLDFNYQ-HQEWVEKEVNEVAEAAELLFT  1096

Query  182   EISSAVQKLEEKCASVGCDWNNM--NGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ ++ E+    G    NM  + L   I+EL+ +L KEK  + +  Q   ++ + +
Sbjct  1097  EVLNALCQISERKPKTGSLDGNMKVSELRRAIIELEGILQKEKAEFEESIQKIMKKETRK  1156

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYY-------------------------MESIF  460
             G+ +ID+LE+N+LR  LL   + WD RL Y                          E + 
Sbjct  1157  GKPSIDILEVNKLRRQLLFQSYFWDQRLIYAAGSHNGRHEVLSGFMTRNKEKLNCTEKLV  1216

Query  461   DNNFSSQHPENAV--SCINPGEWGGETIF-------KDGSLEHAYEENV-HEFPNSEECP  610
             D N + +   + +     +P   G E+I         +  L+H  + NV  +  N E+  
Sbjct  1217  DFNTAPRLQRSFIRLETASPSSRGDESIVGSTCPTDHEEGLDHFNQPNVSQQKRNHEKAN  1276

Query  611   GEGLHSEHDEPPVPKDALSYQQGSSSTSCN-GDKT--LETRLGLENAVNKSPLERAPSAG  781
               G  S                G+ +TS N GD+   LE  LG+   V+           
Sbjct  1277  INGKRS---------------NGNLATSINAGDQLDPLEPGLGVRRVVSDGQF----PVM  1317

Query  782   SILSDKIDCAWTGID-PSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYS  958
             + LSD +D  W G + P+  D    AS+  G   V +   +S ++    +      ++  
Sbjct  1318  ADLSDTLDAKWRGENGPALAD----ASMSNGSASVEAETTVSVLEDSEEQSRADTTKL--  1371

Query  959   FDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKL  1138
             F SAL  + R S     S    S++K       + N  RD   N     S + PR     
Sbjct  1372  FASALPARWRDS-----SEDLSSSIKM-----PFVNFYRDINKN-----SGSAPRFGVLS  1416

Query  1139  NLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT  1318
                P   ++F     +   GARL++P  G  D VI +YD+EPTSIISYAL S +Y   ++
Sbjct  1417  EYNPLYVSSFRDL--VCQGGARLLLP-IGVNDTVIPIYDDEPTSIISYALVSPDYHFQMS  1473

Query  1319  DKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLD-LDYMHFGSYGSEDAS-----GRIG  1480
             ++   +  G    DT+   P       +Q F S D     +F S+GS D S     G   
Sbjct  1474  EEWEKARDG---GDTSFPLPNYDS-ENFQPFQSFDDASSENFKSFGSVDESILSLSGSRA  1529

Query  1481  FLFSDPKLSP---HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSL  1651
              L  DP  S    H R+SF D+     GK K++VTCY+AK F+ALR+ CCPSEL F+RSL
Sbjct  1530  PLVLDPVASTKAMHIRVSFGDD--GPLGKAKYTVTCYYAKSFEALRRICCPSELGFVRSL  1587

Query  1652  SRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTC  1831
             SRCK+W AQGGKSNV+FAKSLD+RF+IKQ+ KTEL+SF +FAP+YF+YL++S  +GSPTC
Sbjct  1588  SRCKKWGAQGGKSNVFFAKSLDDRFVIKQVTKTELESFIKFAPEYFKYLSESIKTGSPTC  1647

Query  1832  LAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NK  2008
             LAK++GIYQV +KHLKGGKE++MDL+VMENL + R+++R+YDLKGS RSRYN D+   NK
Sbjct  1648  LAKILGIYQVTIKHLKGGKESRMDLLVMENLLFRRNVTRLYDLKGSSRSRYNPDSSGNNK  1707

Query  2009  VLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVL  2188
             VLLD N +E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELVL
Sbjct  1708  VLLDQNLIEAMPTSPIFMGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELVL  1767

Query  2189  GIIDYMRQYTWDKHLETW  2242
             GIID+MRQYTWDKHLETW
Sbjct  1768  GIIDFMRQYTWDKHLETW  1785



>gb|EYU45914.1| hypothetical protein MIMGU_mgv1a000120mg [Erythranthe guttata]
Length=1732

 Score =   507 bits (1306),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 321/779 (41%), Positives = 468/779 (60%), Gaps = 82/779 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ L+FN +S Q WI +E  E+  +A+ L++
Sbjct  934   RDCLRFYGFGKMVACFRYASIDVHSVYLPPAKLDFNYES-QDWIEQEWNEVAGRAELLFS  992

Query  182   EISSAVQKLEEKCASVGCDWNNM--NGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A++ L EK + +    + M  +     + +L+ ML +EK+ + +  Q    + +++
Sbjct  993   EVLNALRLLVEKRSGLNLLNSGMEVSEFRRHLTDLEGMLQREKSEFEESLQKIWNKEAKQ  1052

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSS-QHPENAVSCINPGEWGGE  532
             GQ  ID+LELNRLR  L+     WDHRL Y +S+   N      P  + S   P     E
Sbjct  1053  GQPAIDILELNRLRRQLVFQSFVWDHRLLYADSLDKKNKPDYMEPTFSESNEKPLSVTDE  1112

Query  533   TIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDA----LSYQQGSSSTSCN  700
              +  +  ++      V  F  S+      +  E    P+P+D     + +Q+  + ++ +
Sbjct  1113  LLHINVPVK-----TVEVFDYSDP-----IAVEAKPVPIPEDGDQSPVLHQKTDAFSNSD  1162

Query  701   --GDKTLETRLGLENAVNKSPLERAPSAGSI-LSDKIDCAWTGIDPSSQDMQVHASLQEG  871
               G K  +    +E+ V   P   +     I L D +D AWTG +  ++ ++V+ ++   
Sbjct  1163  PIGTKATDESDTMESDVTTHPSTLSEGQAPICLPDTLDAAWTGKNHLNEAVEVYNNISTV  1222

Query  872   ERRV---ASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSF  1042
                V       ++  V+    K   SP+   ++ S+ +I++        + S+L    SF
Sbjct  1223  GLSVKPDVEDHRIEDVNVNMPKLSPSPS-FMAYKSSDQIED--------TASWLGM--SF  1271

Query  1043  HAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGARLMVP  1216
               +  YR++ ++ + N            AQKL+ +      + S    S +  GA+L++P
Sbjct  1272  MTF--YRSLNKNFLGN------------AQKLDTVGEYDPIYISSFRESEIQGGAKLLLP  1317

Query  1217  ENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKL-  1393
               G  D VI +YD+EPTS+ISYAL + EY   ++D+P        + DT         L 
Sbjct  1318  V-GVNDTVIPIYDDEPTSVISYALLTPEYLVQLSDEPER------LKDTADSIYSMQSLD  1370

Query  1394  -STWQRFGSLDLDYMHFG-SYGSEDASGRIGFLFSDP------KLSP-------HPRISF  1528
              +++Q F SLD   +    S GS D      F+ S         L P       H R+SF
Sbjct  1371  SASFQSFHSLDELMLETSRSLGSVDE-----FMLSSTYSRNSLPLDPLSYTKALHARVSF  1425

Query  1529  EDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAK  1708
              DE  +  GKVK+SVTCY+AK+F+ALR+ CCP+E+D+IRSLSRCK+W AQGGKSNV+FAK
Sbjct  1426  ADEGPH--GKVKYSVTCYYAKRFEALRRICCPTEIDYIRSLSRCKKWGAQGGKSNVFFAK  1483

Query  1709  SLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGK  1888
             +LD+RFI+KQ+ KTEL+SF +FAP YF+YL++S  +GSPTCLAK++GIYQV  KH+KGGK
Sbjct  1484  TLDDRFIVKQVTKTELESFIKFAPGYFKYLSESIGTGSPTCLAKILGIYQVTTKHVKGGK  1543

Query  1889  ETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLG  2065
             E+KMD++VMENL + R+++R+YDLKGS RSRYN D+  +NKVLLD N +E++ T PIF+G
Sbjct  1544  ESKMDVLVMENLLFRRNLTRLYDLKGSTRSRYNPDSSGSNKVLLDQNLIEAMPTCPIFVG  1603

Query  2066  SKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             +KAKR LERAVWNDT+FLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1604  NKAKRRLERAVWNDTAFLASIDVMDYSLLVGVDEEKNELVLGIIDFMRQYTWDKHLETW  1662



>ref|XP_009776139.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Nicotiana sylvestris]
Length=1770

 Score =   508 bits (1307),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 335/788 (43%), Positives = 451/788 (57%), Gaps = 89/788 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ L+FN +  Q WI +EV E++ +A+ L++
Sbjct  965   RDCLRFYGFGKMVACFRYASIDVHSVCLPPAKLDFNYEKNQDWIQQEVNEVVSRAERLFS  1024

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A++ L EK  SVG   +++        I  L+ ML KEK  + +  Q    + +++
Sbjct  1025  EVLNAIRLLVEK-RSVGQFNSSVKAPEARGQIAVLEGMLQKEKEEFEESLQKILTKEAKK  1083

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI------------FDNNFSSQHPENAV  499
              Q  +D+ E+NRLR  L+   + WDHRL Y  S+              +N     P+   
Sbjct  1084  VQPMVDIFEINRLRRQLIFQSYMWDHRLVYAASLECEAHCVTGEKPLVSNDKYTDPDRPS  1143

Query  500   SCINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQG  679
              C+N             S   +   NV    N      +  H + D            QG
Sbjct  1144  DCLNV------------SGSRSTTTNVGATSNEGVGVSQKNHVDAD-----------HQG  1180

Query  680   SSS---TSCNGDK------TLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAWT  817
             S     +SC  +K        E+  GL +A +     RA S G       LSD ++ AWT
Sbjct  1181  SDDLVDSSCAIEKPSGLPVVTESFYGLNSAESNIEGSRALSDGQFPIMDNLSDTLEAAWT  1240

Query  818   GIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISK  997
             G   S+  +    + +  E   A        DS T +  +   +V   D         + 
Sbjct  1241  GETTSAVGVLKDGTCRSSEPLTA--------DSSTTRLAE---KVDIEDPGEEHGGTKAS  1289

Query  998   RLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS-  1174
               PPS S   + ++    G +  M    +S  + +    LP  AQKL+ L   S  + S 
Sbjct  1290  GFPPSLSSKGS-ENVEDVGGWLGM--SFISFYRSLNKNFLP-SAQKLDTLGEYSPVYISS  1345

Query  1175  -HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWG  1351
                S    GARL++P  G  D +I VYD+EPTSIISYAL S++Y   + D+   S     
Sbjct  1346  FRESEAQGGARLLLPV-GINDTIIPVYDDEPTSIISYALVSQDYIAQLADELEKS-----  1399

Query  1352  VSDTNKESPIASKLS-TWQRFGSLDLDYMH-FGSYGSEDASGRIGFLFS-----DP---K  1501
              S  +   P+ S  S + Q   S+D   +  + S GS D S             DP    
Sbjct  1400  -SSLDSNLPLQSLESGSLQSLQSMDEIVLESYRSLGSADESILSSSSSHSSSVLDPLSYT  1458

Query  1502  LSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQG  1681
              + H R+SF D+     GKVK++VTCYFAK+F+ALR+ CCP E+DFIRSLSRCK+W AQG
Sbjct  1459  KAMHARVSFSDD--GPLGKVKYTVTCYFAKRFEALRRICCPFEMDFIRSLSRCKKWGAQG  1516

Query  1682  GKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQV  1861
             GKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S SS SPTCLAK++GIYQV
Sbjct  1517  GKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESVSSRSPTCLAKILGIYQV  1576

Query  1862  AVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLES  2038
               KH KGGKE+KMD++VMENL +GR+++R+YDLKGS RSRYN D + +NKVLLD N +ES
Sbjct  1577  TSKHFKGGKESKMDVLVMENLLFGRNLTRLYDLKGSSRSRYNPDCSGSNKVLLDQNLIES  1636

Query  2039  LQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYT  2218
             + T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELVLGIID+MRQYT
Sbjct  1637  MPTSPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVLGIIDFMRQYT  1696

Query  2219  WDKHLETW  2242
             WDKHLETW
Sbjct  1697  WDKHLETW  1704



>ref|XP_009776138.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Nicotiana sylvestris]
Length=1772

 Score =   508 bits (1307),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 335/788 (43%), Positives = 451/788 (57%), Gaps = 89/788 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ L+FN +  Q WI +EV E++ +A+ L++
Sbjct  967   RDCLRFYGFGKMVACFRYASIDVHSVCLPPAKLDFNYEKNQDWIQQEVNEVVSRAERLFS  1026

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A++ L EK  SVG   +++        I  L+ ML KEK  + +  Q    + +++
Sbjct  1027  EVLNAIRLLVEK-RSVGQFNSSVKAPEARGQIAVLEGMLQKEKEEFEESLQKILTKEAKK  1085

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI------------FDNNFSSQHPENAV  499
              Q  +D+ E+NRLR  L+   + WDHRL Y  S+              +N     P+   
Sbjct  1086  VQPMVDIFEINRLRRQLIFQSYMWDHRLVYAASLECEAHCVTGEKPLVSNDKYTDPDRPS  1145

Query  500   SCINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQG  679
              C+N             S   +   NV    N      +  H + D            QG
Sbjct  1146  DCLNV------------SGSRSTTTNVGATSNEGVGVSQKNHVDAD-----------HQG  1182

Query  680   SSS---TSCNGDK------TLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAWT  817
             S     +SC  +K        E+  GL +A +     RA S G       LSD ++ AWT
Sbjct  1183  SDDLVDSSCAIEKPSGLPVVTESFYGLNSAESNIEGSRALSDGQFPIMDNLSDTLEAAWT  1242

Query  818   GIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISK  997
             G   S+  +    + +  E   A        DS T +  +   +V   D         + 
Sbjct  1243  GETTSAVGVLKDGTCRSSEPLTA--------DSSTTRLAE---KVDIEDPGEEHGGTKAS  1291

Query  998   RLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS-  1174
               PPS S   + ++    G +  M    +S  + +    LP  AQKL+ L   S  + S 
Sbjct  1292  GFPPSLSSKGS-ENVEDVGGWLGM--SFISFYRSLNKNFLP-SAQKLDTLGEYSPVYISS  1347

Query  1175  -HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWG  1351
                S    GARL++P  G  D +I VYD+EPTSIISYAL S++Y   + D+   S     
Sbjct  1348  FRESEAQGGARLLLPV-GINDTIIPVYDDEPTSIISYALVSQDYIAQLADELEKS-----  1401

Query  1352  VSDTNKESPIASKLS-TWQRFGSLDLDYMH-FGSYGSEDASGRIGFLFS-----DP---K  1501
              S  +   P+ S  S + Q   S+D   +  + S GS D S             DP    
Sbjct  1402  -SSLDSNLPLQSLESGSLQSLQSMDEIVLESYRSLGSADESILSSSSSHSSSVLDPLSYT  1460

Query  1502  LSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQG  1681
              + H R+SF D+     GKVK++VTCYFAK+F+ALR+ CCP E+DFIRSLSRCK+W AQG
Sbjct  1461  KAMHARVSFSDD--GPLGKVKYTVTCYFAKRFEALRRICCPFEMDFIRSLSRCKKWGAQG  1518

Query  1682  GKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQV  1861
             GKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S SS SPTCLAK++GIYQV
Sbjct  1519  GKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESVSSRSPTCLAKILGIYQV  1578

Query  1862  AVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLES  2038
               KH KGGKE+KMD++VMENL +GR+++R+YDLKGS RSRYN D + +NKVLLD N +ES
Sbjct  1579  TSKHFKGGKESKMDVLVMENLLFGRNLTRLYDLKGSSRSRYNPDCSGSNKVLLDQNLIES  1638

Query  2039  LQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYT  2218
             + T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELVLGIID+MRQYT
Sbjct  1639  MPTSPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVLGIIDFMRQYT  1698

Query  2219  WDKHLETW  2242
             WDKHLETW
Sbjct  1699  WDKHLETW  1706



>ref|XP_010314338.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Solanum lycopersicum]
Length=1775

 Score =   507 bits (1306),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 331/793 (42%), Positives = 454/793 (57%), Gaps = 92/793 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ L+FN +  Q WI +EV E++ +A+ L++
Sbjct  961   RDCLRFYGFGKMVACFRYASIDVHSVCLPPAKLDFNDEKNQDWIQQEVNEVIVRAERLFS  1020

Query  182   EISSAVQKLEEKCA----SVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETS  349
             E+ +A++ L EK +    +   + +        I  L+ ML KEK  + +  Q    + +
Sbjct  1021  EVLNAIRLLVEKKSGGQVNSSAEASEAPEARGQIAVLEGMLRKEKEEFEESLQKILNKEA  1080

Query  350   EEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI---------------FDNNFSSQH  484
             ++ Q  ID+ E+NRLR   +   + WDHRL Y  S+                D +    +
Sbjct  1081  KKVQPVIDIFEINRLRRQFIFQSYMWDHRLVYAASLECEDHCVTEEKPLVGNDKSTGPDN  1140

Query  485   PENAVSCINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDAL  664
             P     C+N  +    T      L   Y + V            G    H +        
Sbjct  1141  PSRPSDCLNVIDSVSVTPI----LGEKYNDGV-----------SGSQKNHVD--------  1177

Query  665   SYQQGSS---STSCNGDKT------LETRLGLENAVNKSPLERAPSAGS-----ILSDKI  802
             +  QGS     +SC  +K        E+  GL +A + +   RA S G       LSD +
Sbjct  1178  TVHQGSEVLLDSSCAVEKPAGLPAGTESFCGLNSAESTAEGSRALSDGQSAVMDTLSDTL  1237

Query  803   DCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
             + AWTG   S   +    + +  E  +A        DS T +  +        D    ++
Sbjct  1238  EAAWTGETTSGPGVLKDGTCRSSEPPIA--------DSSTTRLAEK------VDVEDPVE  1283

Query  983   ERISKR--LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSS  1156
             E  +K    PPS S  S+  +  A G +  M    +S    +    LP  AQKL+ L   
Sbjct  1284  ENGTKASGFPPSLSSKSSESAEDA-GGWLGM--SFISFYWSLNKNFLP-SAQKLDTLGEY  1339

Query  1157  STTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPY  1330
             S  + S    S    GARL++P  G  D +I VYD EPTSIISYAL S +Y   ++D+P 
Sbjct  1340  SPVYISSFRESEAQGGARLLLPV-GVNDTIIPVYDEEPTSIISYALVSPDYLAQISDEPE  1398

Query  1331  MSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFS-----D  1495
              S+     S+   +S  +  L + Q    +  + +   S GS D S             D
Sbjct  1399  KSKDASLYSNLPLQSQESGSLQSLQSMDEILSESLR--SLGSIDESFLSSSSSHSSSVLD  1456

Query  1496  P---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKR  1666
             P     + H R+SF D+     GKVK++VTCY+AK+F+ALR+KCCPSE+D+IRSLSRCK+
Sbjct  1457  PLSCTKTMHARVSFSDD--GPLGKVKYNVTCYYAKRFEALRRKCCPSEMDYIRSLSRCKK  1514

Query  1667  WSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVV  1846
             W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S +S SPTCLAK++
Sbjct  1515  WGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESINSRSPTCLAKIL  1574

Query  1847  GIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDL  2023
             GIYQV  KHLKGGKE+K+D++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD 
Sbjct  1575  GIYQVTSKHLKGGKESKLDVLVMENLLFGRNLTRLYDLKGSARSRYNPDSSGSNKVLLDQ  1634

Query  2024  NFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDY  2203
             N +ES+ T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELV+GIID+
Sbjct  1635  NLIESMPTSPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVIGIIDF  1694

Query  2204  MRQYTWDKHLETW  2242
             MRQYTWDKHLETW
Sbjct  1695  MRQYTWDKHLETW  1707



>gb|KDO53776.1| hypothetical protein CISIN_1g0002782mg, partial [Citrus sinensis]
Length=1618

 Score =   504 bits (1299),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 327/794 (41%), Positives = 457/794 (58%), Gaps = 102/794 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L+F ++  Q WI KE  E++ +A+ L++
Sbjct  815   RDCLRFYGFGKMVACFRYASIDVHSVYLPPHKLDFINEY-QEWIQKEADEVVSQAELLFS  873

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ + +  + +K   VG +      L + I+EL+ ML +EK  + +  Q      + +GQ
Sbjct  874   EVLNNLSPILDK--KVGPE------LRHQIVELEGMLQREKAEFEESVQKALSREASKGQ  925

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMES--IFDNNFSSQHPENAVSCINPGEWGGET  535
               ID+LE+NRLR  LL   + WDHRL Y  +  I  N   S+  E            GE 
Sbjct  926   PVIDILEINRLRRQLLFQSYMWDHRLVYAANLDIDSNGLKSEISEQ-----------GEK  974

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTL  715
             I   G  E   + NV   P +     + L ++     + K +   + G SST+ +     
Sbjct  975   IPTSG--EKVVQMNVLAMPETGSSFYDSLLAD---AKLDKSSDREEGGDSSTTLSDGFLQ  1029

Query  716   ETRLG-------------------------LENAVNKSPLERAPSAGSI-----LSDKID  805
             ET +G                         LE+ VN   + R  S G +     LSD ++
Sbjct  1030  ETIMGQDSNLLENDQGNISASISFCEQSGSLESEVN---VRRTLSEGQVPVVANLSDTLE  1086

Query  806   CAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ-  982
              AWTG     ++ QV+ +    +  +        VDS T   +         +  + +Q 
Sbjct  1087  AAWTG-----ENYQVNNTYGLSDSPL--------VDSSTVAVM---TEGLDLEDHMEVQT  1130

Query  983   -ERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSS  1159
               ++++ L P+ S     K      +     R P  N     ++     +QKL+ +   +
Sbjct  1131  GAKVTQSLSPALSS----KGPDNMEEPVAWFRMPFLNFYHSLNKNFLSSSQKLDTMSGYN  1186

Query  1160  TTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKD--WVTDKP  1327
               + S    S L  GARL +P  G  D V+ VYD+EPTSII+YAL S EY     V D  
Sbjct  1187  PIYFSSFRDSELKGGARLFLPV-GVNDTVVPVYDDEPTSIIAYALVSTEYHVGLMVDDGE  1245

Query  1328  YMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFS  1492
                EGG    D      ++  ++      + +L    + S GS D      SG    L  
Sbjct  1246  KTKEGG----DVMSSFSLSDSVNLQSHLSADELTLDLYRSLGSTDESILSLSGSRSSLIL  1301

Query  1493  DP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCK  1663
             DP     + HP++SF+D+     G+VK+SVTCY+A++F+ALRK CCPSELD++RSLSRCK
Sbjct  1302  DPLSYTKAFHPKVSFKDD--GPLGQVKYSVTCYYARRFEALRKICCPSELDYVRSLSRCK  1359

Query  1664  RWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKV  1843
             +W A+GGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF+YL++S S+GSPTCLAK+
Sbjct  1360  KWGAKGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPEYFKYLSESISTGSPTCLAKI  1419

Query  1844  VGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLD  2020
             +GIYQV  KHLKGG+E+KMD++VMENL + RS++++YDLKGS RSRYN D+  +NKVLLD
Sbjct  1420  LGIYQVTTKHLKGGRESKMDVLVMENLLFSRSVTQLYDLKGSSRSRYNPDSSGSNKVLLD  1479

Query  2021  LNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIID  2200
              N +E++ T PIF+G+KAKR LERAVWNDT+FLA + VMDYSLLVGVDEE  +LVLGIID
Sbjct  1480  QNLIEAMPTSPIFVGNKAKRLLERAVWNDTAFLASIDVMDYSLLVGVDEENHQLVLGIID  1539

Query  2201  YMRQYTWDKHLETW  2242
             +MRQYTWDKHLETW
Sbjct  1540  FMRQYTWDKHLETW  1553



>ref|XP_007012515.1| Phosphatidylinositol-4-phosphate 5-kinase family protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007012518.1| Phosphatidylinositol-4-phosphate 5-kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY30134.1| Phosphatidylinositol-4-phosphate 5-kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY30137.1| Phosphatidylinositol-4-phosphate 5-kinase family protein, putative 
isoform 1 [Theobroma cacao]
Length=1842

 Score =   508 bits (1308),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 330/788 (42%), Positives = 450/788 (57%), Gaps = 81/788 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G  +ACFRY+ ID+ SV LPP  LEFN  + Q WI  E  E+  +A+ L+ 
Sbjct  1027  RDCLRFYGFGRRVACFRYAAIDVHSVYLPPPKLEFNYDN-QEWIQSEANEVTNRAEFLFR  1085

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHN--CILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+QK+ EK    G     +       CI EL+ ML K++  + +  Q    +  + 
Sbjct  1086  EVYNALQKMSEKLLGPGFQDGGIKSPEKRICIEELEAMLQKDREEFQESLQEVLCKEVKV  1145

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNF----SSQHPENAVSCINPGEW  523
             GQ  ID+LE+N+L+  +L   + WD RL +  S   NN     SS  P+  +  ++  E 
Sbjct  1146  GQPVIDILEINKLQRQILFLSYVWDQRLIHAFSSIVNNIQEVMSSSIPKLGLKPVSSVEK  1205

Query  524   GGETIFK----------DGSLEHAYEE-NVHEFPNSEECPGEGLHSEHDEPPVPKDALSY  670
               E              D +L     + N+++  N+ E    G   +H E  + +D  S 
Sbjct  1206  LVEINVSPKPSKALSSCDSALVQTKPDININQEGNTGEISEPG--GDHREKGMDQDLNSR  1263

Query  671   QQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAWTGIDPSS  835
              +  SS SC+ + T E    LE+      + RA S G       LSD ++ AWTG     
Sbjct  1264  NEAESSLSCSAN-TSEKSDSLESG---KVVRRALSEGEFPIMANLSDTLEAAWTG-----  1314

Query  836   QDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSP  1015
                         E   AS G   +  S +   +   +   + D   R  +R    +  SP
Sbjct  1315  ------------ESHPASVGPKENGYSVSDTVVVDLSTAANSDMGNRTSDRGEVEVACSP  1362

Query  1016  SYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPE  1195
                   K         +    P  N   + ++     AQKL++   +    +S   +  +
Sbjct  1363  QSALPTKGPENMEKTMSWASMPFPNFYSLFNKNSSFNAQKLSISEYNPVYVSSLRELERQ  1422

Query  1196  -GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKE  1372
              GARL++P  G  D V+ VYD+EPTSII+YAL S +Y   +++     +          +
Sbjct  1423  SGARLLLPI-GVNDTVVPVYDDEPTSIIAYALVSSDYYSQMSELEKPKDAA--------D  1473

Query  1373  SPIASKLSTWQRFGSLDLDYMH---------FGSYGSED-----ASGRIGFLFSDPKLSP  1510
             S ++S L     F S++L  ++         F S+GS D      SG    L SDP L  
Sbjct  1474  SAVSSSL-----FDSVNLLLLNSFNDSSSDTFRSFGSGDESILSISGSYSSLVSDPLLDT  1528

Query  1511  ---HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQG  1681
                H R+SF D+     GKVK SVTCY+AK F++LR+ CCPSELDFIRSLSRCK+W AQG
Sbjct  1529  KNFHARVSFTDD--GPLGKVKHSVTCYYAKWFESLRRTCCPSELDFIRSLSRCKKWGAQG  1586

Query  1682  GKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQV  1861
             GKSNV+FAK+LD+RFIIKQ+ KTEL+SF +F P YF+YL+DS S+ SPTCLAK++GIYQV
Sbjct  1587  GKSNVFFAKTLDDRFIIKQVTKTELESFIKFGPAYFKYLSDSISTRSPTCLAKILGIYQV  1646

Query  1862  AVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLES  2038
             + K+LKGGKE+KMD++V+ENL + R+++R+YDLKGS RSRYN DT  +NKVLLD N +E+
Sbjct  1647  SSKYLKGGKESKMDVLVIENLLFRRNVTRLYDLKGSSRSRYNPDTSGSNKVLLDQNLIEA  1706

Query  2039  LQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYT  2218
             + T PIF+GSKAKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYT
Sbjct  1707  MPTSPIFVGSKAKRLLERAVWNDTSFLALIDVMDYSLLVGVDEEKHELVLGIIDFMRQYT  1766

Query  2219  WDKHLETW  2242
             WDKHLETW
Sbjct  1767  WDKHLETW  1774



>ref|XP_004252409.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Solanum lycopersicum]
 ref|XP_010314337.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Solanum lycopersicum]
Length=1801

 Score =   507 bits (1306),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 331/793 (42%), Positives = 454/793 (57%), Gaps = 92/793 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ L+FN +  Q WI +EV E++ +A+ L++
Sbjct  987   RDCLRFYGFGKMVACFRYASIDVHSVCLPPAKLDFNDEKNQDWIQQEVNEVIVRAERLFS  1046

Query  182   EISSAVQKLEEKCA----SVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETS  349
             E+ +A++ L EK +    +   + +        I  L+ ML KEK  + +  Q    + +
Sbjct  1047  EVLNAIRLLVEKKSGGQVNSSAEASEAPEARGQIAVLEGMLRKEKEEFEESLQKILNKEA  1106

Query  350   EEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI---------------FDNNFSSQH  484
             ++ Q  ID+ E+NRLR   +   + WDHRL Y  S+                D +    +
Sbjct  1107  KKVQPVIDIFEINRLRRQFIFQSYMWDHRLVYAASLECEDHCVTEEKPLVGNDKSTGPDN  1166

Query  485   PENAVSCINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDAL  664
             P     C+N  +    T      L   Y + V            G    H +        
Sbjct  1167  PSRPSDCLNVIDSVSVTPI----LGEKYNDGV-----------SGSQKNHVD--------  1203

Query  665   SYQQGSS---STSCNGDKT------LETRLGLENAVNKSPLERAPSAGS-----ILSDKI  802
             +  QGS     +SC  +K        E+  GL +A + +   RA S G       LSD +
Sbjct  1204  TVHQGSEVLLDSSCAVEKPAGLPAGTESFCGLNSAESTAEGSRALSDGQSAVMDTLSDTL  1263

Query  803   DCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
             + AWTG   S   +    + +  E  +A        DS T +  +        D    ++
Sbjct  1264  EAAWTGETTSGPGVLKDGTCRSSEPPIA--------DSSTTRLAEK------VDVEDPVE  1309

Query  983   ERISKR--LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSS  1156
             E  +K    PPS S  S+  +  A G +  M    +S    +    LP  AQKL+ L   
Sbjct  1310  ENGTKASGFPPSLSSKSSESAEDA-GGWLGM--SFISFYWSLNKNFLP-SAQKLDTLGEY  1365

Query  1157  STTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPY  1330
             S  + S    S    GARL++P  G  D +I VYD EPTSIISYAL S +Y   ++D+P 
Sbjct  1366  SPVYISSFRESEAQGGARLLLPV-GVNDTIIPVYDEEPTSIISYALVSPDYLAQISDEPE  1424

Query  1331  MSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFS-----D  1495
              S+     S+   +S  +  L + Q    +  + +   S GS D S             D
Sbjct  1425  KSKDASLYSNLPLQSQESGSLQSLQSMDEILSESLR--SLGSIDESFLSSSSSHSSSVLD  1482

Query  1496  P---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKR  1666
             P     + H R+SF D+     GKVK++VTCY+AK+F+ALR+KCCPSE+D+IRSLSRCK+
Sbjct  1483  PLSCTKTMHARVSFSDD--GPLGKVKYNVTCYYAKRFEALRRKCCPSEMDYIRSLSRCKK  1540

Query  1667  WSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVV  1846
             W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S +S SPTCLAK++
Sbjct  1541  WGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESINSRSPTCLAKIL  1600

Query  1847  GIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDL  2023
             GIYQV  KHLKGGKE+K+D++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD 
Sbjct  1601  GIYQVTSKHLKGGKESKLDVLVMENLLFGRNLTRLYDLKGSARSRYNPDSSGSNKVLLDQ  1660

Query  2024  NFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDY  2203
             N +ES+ T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELV+GIID+
Sbjct  1661  NLIESMPTSPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVIGIIDF  1720

Query  2204  MRQYTWDKHLETW  2242
             MRQYTWDKHLETW
Sbjct  1721  MRQYTWDKHLETW  1733



>ref|XP_007012516.1| Phosphatidylinositol-4-phosphate 5-kinase family protein, putative 
isoform 2, partial [Theobroma cacao]
 gb|EOY30135.1| Phosphatidylinositol-4-phosphate 5-kinase family protein, putative 
isoform 2, partial [Theobroma cacao]
Length=1822

 Score =   508 bits (1307),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 330/788 (42%), Positives = 450/788 (57%), Gaps = 81/788 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G  +ACFRY+ ID+ SV LPP  LEFN  + Q WI  E  E+  +A+ L+ 
Sbjct  1027  RDCLRFYGFGRRVACFRYAAIDVHSVYLPPPKLEFNYDN-QEWIQSEANEVTNRAEFLFR  1085

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHN--CILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+QK+ EK    G     +       CI EL+ ML K++  + +  Q    +  + 
Sbjct  1086  EVYNALQKMSEKLLGPGFQDGGIKSPEKRICIEELEAMLQKDREEFQESLQEVLCKEVKV  1145

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNF----SSQHPENAVSCINPGEW  523
             GQ  ID+LE+N+L+  +L   + WD RL +  S   NN     SS  P+  +  ++  E 
Sbjct  1146  GQPVIDILEINKLQRQILFLSYVWDQRLIHAFSSIVNNIQEVMSSSIPKLGLKPVSSVEK  1205

Query  524   GGETIFK----------DGSLEHAYEE-NVHEFPNSEECPGEGLHSEHDEPPVPKDALSY  670
               E              D +L     + N+++  N+ E    G   +H E  + +D  S 
Sbjct  1206  LVEINVSPKPSKALSSCDSALVQTKPDININQEGNTGEISEPG--GDHREKGMDQDLNSR  1263

Query  671   QQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAWTGIDPSS  835
              +  SS SC+ + T E    LE+      + RA S G       LSD ++ AWTG     
Sbjct  1264  NEAESSLSCSAN-TSEKSDSLESG---KVVRRALSEGEFPIMANLSDTLEAAWTG-----  1314

Query  836   QDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSP  1015
                         E   AS G   +  S +   +   +   + D   R  +R    +  SP
Sbjct  1315  ------------ESHPASVGPKENGYSVSDTVVVDLSTAANSDMGNRTSDRGEVEVACSP  1362

Query  1016  SYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPE  1195
                   K         +    P  N   + ++     AQKL++   +    +S   +  +
Sbjct  1363  QSALPTKGPENMEKTMSWASMPFPNFYSLFNKNSSFNAQKLSISEYNPVYVSSLRELERQ  1422

Query  1196  -GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKE  1372
              GARL++P  G  D V+ VYD+EPTSII+YAL S +Y   +++     +          +
Sbjct  1423  SGARLLLPI-GVNDTVVPVYDDEPTSIIAYALVSSDYYSQMSELEKPKDAA--------D  1473

Query  1373  SPIASKLSTWQRFGSLDLDYMH---------FGSYGSED-----ASGRIGFLFSDPKLSP  1510
             S ++S L     F S++L  ++         F S+GS D      SG    L SDP L  
Sbjct  1474  SAVSSSL-----FDSVNLLLLNSFNDSSSDTFRSFGSGDESILSISGSYSSLVSDPLLDT  1528

Query  1511  ---HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQG  1681
                H R+SF D+     GKVK SVTCY+AK F++LR+ CCPSELDFIRSLSRCK+W AQG
Sbjct  1529  KNFHARVSFTDD--GPLGKVKHSVTCYYAKWFESLRRTCCPSELDFIRSLSRCKKWGAQG  1586

Query  1682  GKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQV  1861
             GKSNV+FAK+LD+RFIIKQ+ KTEL+SF +F P YF+YL+DS S+ SPTCLAK++GIYQV
Sbjct  1587  GKSNVFFAKTLDDRFIIKQVTKTELESFIKFGPAYFKYLSDSISTRSPTCLAKILGIYQV  1646

Query  1862  AVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLES  2038
             + K+LKGGKE+KMD++V+ENL + R+++R+YDLKGS RSRYN DT  +NKVLLD N +E+
Sbjct  1647  SSKYLKGGKESKMDVLVIENLLFRRNVTRLYDLKGSSRSRYNPDTSGSNKVLLDQNLIEA  1706

Query  2039  LQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYT  2218
             + T PIF+GSKAKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYT
Sbjct  1707  MPTSPIFVGSKAKRLLERAVWNDTSFLALIDVMDYSLLVGVDEEKHELVLGIIDFMRQYT  1766

Query  2219  WDKHLETW  2242
             WDKHLETW
Sbjct  1767  WDKHLETW  1774



>ref|XP_009596384.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009596385.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Nicotiana tomentosiformis]
Length=1776

 Score =   506 bits (1304),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 332/786 (42%), Positives = 459/786 (58%), Gaps = 92/786 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPPS L+F  ++ Q WI +EV E++ +A+ L++
Sbjct  979   RDCLRFYGFGKMVACFRYASIDVHSVYLPPSKLDFYYEN-QEWIRQEVNEVIGRAELLFS  1037

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLH-QPTHEETSEEG  358
             ++ +A++ L EK +  G   N        I +L+ ML KEK  +     Q    +  ++G
Sbjct  1038  DVLNAIRVLVEKRS--GRQLNRRQ-----IADLEGMLQKEKEEFEQESLQRVLIKEVKKG  1090

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI------FDNNFSSQHPENAVSCI----  508
             Q+ +D+LE+NRLR  LL   + WDHRL Y  S+       + + +S  PE  + C     
Sbjct  1091  QS-VDILEINRLRRQLLFQSYVWDHRLVYAASLDEKTHWINGDVASSEPEKPLVCNDKFS  1149

Query  509   ---NPG--------------EWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHD  637
                NP               E GG+        ++++ ++VH+    E   G   +   +
Sbjct  1150  DLDNPADSSKYPNNSDSANFEAGGKADEGKSVSQNSHVDSVHQ----ESVVGFDANCAIE  1205

Query  638   EPPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWT  817
             +PP     L     S   +   +  L+ R  L +          P+  S LSD ++ AWT
Sbjct  1206  KPP----GLPVATKSFCVTHPAESILQGRRALSDG-------HFPNMES-LSDTLEAAWT  1253

Query  818   GIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISK  997
             G   S+  M     L+ G     + G    V++                      E    
Sbjct  1254  GETTSAVGM-----LKGGMADTLTTGVAEKVNTED-----------------HGDEESGT  1291

Query  998   RLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS-  1174
             ++  SP  LS+ K      D  + +  P  +     +++    AQKL+ L   +  + S 
Sbjct  1292  KMSQSPPLLSS-KGSENMEDSGSWLGMPFISFYRTLNKSFLPSAQKLDPLVGYNPVYVSS  1350

Query  1175  -HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWG  1351
                S    GARL++P  G  D VI VYD+EPTSIISYAL S +Y   ++D+   S+    
Sbjct  1351  FRESDARSGARLLLPV-GVNDTVIPVYDDEPTSIISYALVSHDYHAQLSDELEKSKDATL  1409

Query  1352  VSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDP---KLS  1507
              S+   +S  +  + + Q    + L+   + S GS D      S     L  DP     +
Sbjct  1410  DSNFAIQSLESGNMQSPQSIDEMVLE--SYRSLGSVDESILSLSISRSSLDLDPLSYGKT  1467

Query  1508  PHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGK  1687
              H R+SF D+     GKVK++VTCY+AK+F+ALR+ CCPSE++FIRSLSRCK+W AQGGK
Sbjct  1468  LHARVSFADD--GLVGKVKYTVTCYYAKRFEALRRICCPSEMEFIRSLSRCKKWGAQGGK  1525

Query  1688  SNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAV  1867
             SNV+FAK+LDERFIIKQ+ KTEL+SF +FAP+YF+YL++S SSGSPTCLAKVVGIYQV+ 
Sbjct  1526  SNVFFAKTLDERFIIKQVTKTELESFMKFAPEYFKYLSESISSGSPTCLAKVVGIYQVSS  1585

Query  1868  KHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQ  2044
             KHLKGGKE+KMD++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD N +E++ 
Sbjct  1586  KHLKGGKESKMDVLVMENLLFGRNLTRLYDLKGSARSRYNPDSSGSNKVLLDQNLIEAMP  1645

Query  2045  TKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWD  2224
             T PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ ELVLGIID+MRQYTWD
Sbjct  1646  TSPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWD  1705

Query  2225  KHLETW  2242
             KHLETW
Sbjct  1706  KHLETW  1711



>ref|XP_009609632.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
[Nicotiana tomentosiformis]
 ref|XP_009609633.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
[Nicotiana tomentosiformis]
 ref|XP_009609635.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
[Nicotiana tomentosiformis]
Length=1788

 Score =   506 bits (1304),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 325/770 (42%), Positives = 450/770 (58%), Gaps = 66/770 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             R+CLR+YG G+M+ACFRY+PID+ SV LPP  LEF S     WI KE  E+ R+A +L+A
Sbjct  998   RECLRFYGFGTMVACFRYAPIDVYSVFLPPPKLEF-SHDNHEWIQKEGDEVHRRANALFA  1056

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S A+    EK  SV       N +   I E++++L KEK  +  L         + GQ
Sbjct  1057  EVSKALHAKLEK-FSVDSSLKAPN-ISEQIAEMEEILEKEKTVFEGLLCKALSGEVKVGQ  1114

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQ---HPENAVSCINPGEWGGE  532
               +D+LE+NRLR  L+   + WD RL ++ S    N  +Q    P+    C +  E   E
Sbjct  1115  PAVDILEINRLRRQLVFHAYLWDRRLIHLSSSHGKNSQTQGSLTPQLKEKCFSSSEELSE  1174

Query  533   --TIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGD  706
                I + G    +Y+ +V ++  +E    EG H++     +P D +  +        +G 
Sbjct  1175  RNAIPRPGKSLGSYD-SVLQYGKTEITSNEGRHNQ-----IP-DGVHERLNIDENLTHGK  1227

Query  707   KTLETRLG--LENAVNKSPL---ERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEG  871
              T  T  G  LE   N + +    + PS  S LSD +D AWTG        + H +++E 
Sbjct  1228  DTQATGDGNVLEPGKNVTRVLSDGKFPSVES-LSDTLDAAWTG--------EGHLAIKEH  1278

Query  872   ERRVASFGQLSHVDSPTCKRLKSPARVYS--FDSALRIQERISKRLPPSPSYLSTLKSFH  1045
                 ++F     VDS     + + + V       +  +   +S +   +  YL T  + H
Sbjct  1279  N---SAFPDSFLVDSSALTGVTANSDVERSMCGKSGAVTSHLSAK-SDNADYL-TWSTAH  1333

Query  1046  AYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENG  1225
                 YR   ++  SN Q I             L   +    +S + +L +G   ++   G
Sbjct  1334  FSNFYRYFNKNITSNPQFIG-----------KLDEHNPVYISSFSELLHQGGARLLMAVG  1382

Query  1226  QKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQ  1405
               D+V+ VYD+EPTSIISYAL S +Y + ++D+P        + + +K S     L +  
Sbjct  1383  VNDIVVPVYDDEPTSIISYALVSPDYHNQMSDEPQ------NLKENHKSSASLPFLDSLN  1436

Query  1406  RFGSLDLDYMHFGS---YGSEDASGRIGFLFSDPKLSP-------HPRISFEDESCNTGG  1555
                   +D +   S   +G  D S    F   +  + P       H RISF D+     G
Sbjct  1437  LLSHSSVDEVVSNSPRSFGFTDESMSSSFSSRNSNMDPPAYINALHARISFSDDG--PLG  1494

Query  1556  KVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIK  1735
             KVK++VTCY+AK F+ LRK CCP ELDFIRSL RCK+W AQGGKSNV+FAK+LD+RFIIK
Sbjct  1495  KVKYTVTCYYAKHFETLRKSCCPYELDFIRSLCRCKKWGAQGGKSNVFFAKTLDDRFIIK  1554

Query  1736  QMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVM  1915
             Q+ KTEL+SF +FAP YF+YL++S +SGSPTCLAK++GIYQVA KHLKGGKE++MD++VM
Sbjct  1555  QVTKTELESFIKFAPAYFKYLSESIASGSPTCLAKILGIYQVASKHLKGGKESRMDVLVM  1614

Query  1916  ENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLER  2092
             ENL + R+I+++YDLKGS RSRYN D+  +NKVLLD N +E++ T PIF+G+KAKR L+R
Sbjct  1615  ENLLFKRNITKLYDLKGSSRSRYNPDSSGSNKVLLDQNLIEAMPTSPIFVGTKAKRLLQR  1674

Query  2093  AVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1675  AVWNDTSFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1724



>gb|EYU30054.1| hypothetical protein MIMGU_mgv1a0181643mg, partial [Erythranthe 
guttata]
Length=374

 Score =   468 bits (1204),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 249/409 (61%), Positives = 297/409 (73%), Gaps = 44/409 (11%)
 Frame = +2

Query  890   FGQLSHVDSPTCKRL--KSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYR  1063
             F  +    +P  +RL   SPARV+SFDSA R+QE + K LP        L+SFHA GDYR
Sbjct  2     FKTIQKEKNPAFRRLLLSSPARVHSFDSAQRVQESLRKVLP--------LRSFHASGDYR  53

Query  1064  NMIRDPVSN-IQMICSQALPREAQKLNLLPSSSTT--FTSHASILPEGARLMVPENGQKD  1234
              M+RDPVS+ +Q   SQ   REA+KLNL PS++T+  F S  S+LPEGARL+     QKD
Sbjct  54    YMLRDPVSSMVQRTHSQVSSREAEKLNLTPSAATSPSFISSVSLLPEGARLIA--GPQKD  111

Query  1235  VVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFG  1414
             + + VYDNEPTSIISYALSSK+Y DWV DKP      +             KL+TWQ FG
Sbjct  112   ITVIVYDNEPTSIISYALSSKDYTDWV-DKPSGPARSY------------RKLTTWQSFG  158

Query  1415  SLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQ  1594
             SLDL+Y   GSY SED S              H RISFEDES    G+V+FSVTCYFA++
Sbjct  159   SLDLEYS--GSYASEDTSS-------------HLRISFEDESLEGSGRVRFSVTCYFARE  203

Query  1595  FDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEF  1774
             FDALR++CCP E+DFIRS+SRC+RW+ QGGKSNVYFAKS DERFIIKQ+ KTE DSFEEF
Sbjct  204   FDALRRRCCPDEVDFIRSMSRCRRWTPQGGKSNVYFAKSFDERFIIKQVTKTEFDSFEEF  263

Query  1775  APKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVY  1954
             AP+YF+YLTD+ SSGSPT LAKV+G+YQV VK  KGGKET+MDL+VMEN+F+G++ISRVY
Sbjct  264   APEYFKYLTDALSSGSPTSLAKVLGVYQVTVKQPKGGKETRMDLMVMENIFFGKNISRVY  323

Query  1955  DLKGSVRSRYNSD-TKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAV  2098
             DLKGS R+RYN D T  NKVLLD+N LE+  T PI+L SKAKR LERAV
Sbjct  324   DLKGSARARYNPDKTGPNKVLLDMNLLEASCTNPIYLESKAKRRLERAV  372



>gb|KHN45046.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1 [Glycine soja]
Length=1812

 Score =   506 bits (1302),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 329/798 (41%), Positives = 448/798 (56%), Gaps = 108/798 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPPS LEFN  S Q W+ KE  EL  KA+ L++
Sbjct  1011  RDCLRFYGFGKMVACFRYASIHLHSVYLPPSKLEFNYDS-QDWLQKEANELHNKAEILFS  1069

Query  182   EISSAVQKLEEKCAS--VGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ + + ++ EK +   +    N ++   N + ELK ML+ EK  + D  Q    +  + 
Sbjct  1070  EVCNVLHQISEKVSGPVLQEGGNRVSDFRNLVAELKGMLLYEKEEFEDSLQRLLHKEGKV  1129

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMES----IFDNNFSS-QHPENAVSCINPGE  520
             GQ  ID+LELN+L   +    + WD RL Y  +    I   N  S  H E  +       
Sbjct  1130  GQPVIDILELNKLCRHIHIHSYVWDQRLIYASNLSKIILQENLKSLNHREKLL-------  1182

Query  521   WGGETIFKDGSLEHAYEENVHEFP--NSEEC--------PGEGLHSE---HDEPPVPKDA  661
                      GS E   E +V   P      C        P   L+ E   H   PV K  
Sbjct  1183  ---------GSREKVIEADVATRPPRGHSSCDSFLLGTKPDGNLNLENTSHLSHPVVK--  1231

Query  662   LSYQQGSSSTSCNGDKTLETRLGLENAVNKS-------PLERAPSAG-----SILSDKID  805
              S  +G  +   N DK   +  G  N  +KS        + RA S G     + LSD +D
Sbjct  1232  -SEDKGKDT---NHDKVDLSLSGGANINDKSDSVEFGGAVRRALSEGESPFVANLSDTLD  1287

Query  806   CAWTGID-PSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFD------  964
              AWTG   P++  ++ +  L      VA    ++++ +      KS + +YS +      
Sbjct  1288  AAWTGEGHPTNLSLKENGCLPPDAAAVAVHSPVANIVTS-----KSNSDIYSANIGGIEA  1342

Query  965   SALRIQERISKRLPP---SPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQK  1135
                   + +SK L        + +   SF+    +        + + ++  + L R+   
Sbjct  1343  GCTNYSKLLSKGLDTKWKGIPFANVFGSFNKTSSFNTEKLVEYNPVHILSFRELERQT--  1400

Query  1136  LNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWV  1315
                                 GARL++P +   D ++ VYD+EPTS+I+Y L S +Y   +
Sbjct  1401  --------------------GARLLLPAS-TNDTIVPVYDDEPTSVIAYVLVSMDYHMQM  1439

Query  1316  TDKPYMSEGGWGVSDTNKESPI--ASKLSTWQRFG-SLDLDYMHFGSYGSE--DASGRIG  1480
              +     E G    D++   P+  ++ L +   F  ++   Y   GS+       SG   
Sbjct  1440  LEYDRPKESG----DSSISLPLFDSTSLLSLNSFDETITNTYRSLGSFDENVLPTSGSRS  1495

Query  1481  FLFSDP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSL  1651
                 DP       H R+SF D+   + GKVK++VTCY+AK+F+ALR+ CCPSELDF+RSL
Sbjct  1496  LPAGDPFSYTKDLHARVSFTDD--GSLGKVKYTVTCYYAKRFEALRRTCCPSELDFVRSL  1553

Query  1652  SRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTC  1831
             SRCK+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S S+GSPTC
Sbjct  1554  SRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFTKFAPAYFKYLSESISTGSPTC  1613

Query  1832  LAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANK  2008
             LAK++GIYQV  KHLKGGKETKMD++VMENL Y R+I R+YDLKGS RSRYN DT  +NK
Sbjct  1614  LAKILGIYQVTSKHLKGGKETKMDVLVMENLLYRRNIRRLYDLKGSSRSRYNPDTSGSNK  1673

Query  2009  VLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVL  2188
             VLLD N +E++ T PIF+G+KAKR LERAVWNDT+FLA +YVMDYSLLVGVDEE+ ELVL
Sbjct  1674  VLLDQNLIEAMPTSPIFVGNKAKRLLERAVWNDTAFLASIYVMDYSLLVGVDEEKHELVL  1733

Query  2189  GIIDYMRQYTWDKHLETW  2242
             GIID+MRQYTWDKHLETW
Sbjct  1734  GIIDFMRQYTWDKHLETW  1751



>ref|XP_009601607.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Nicotiana tomentosiformis]
Length=1775

 Score =   504 bits (1299),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 334/785 (43%), Positives = 453/785 (58%), Gaps = 81/785 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ L+FN +  Q WI +EV E++ +A+ L++
Sbjct  968   RDCLRFYGFGKMVACFRYASIDVHSVCLPPAKLDFNYEKNQDWIQQEVNEVVSRAERLFS  1027

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A++ L EK  SVG   +++        I  L+ ML KEK  + +  Q    + +++
Sbjct  1028  EVLNAIRLLVEK-RSVGQFNSSVKAPEARGQIAVLEGMLQKEKEEFEESLQKILTKEAKK  1086

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGE--WGG  529
              Q  +D+ E+NRLR  L+   + WDHRL Y  S+          E    C+  GE    G
Sbjct  1087  VQPVVDIFEINRLRRQLIFQSYMWDHRLVYAASL----------ECEAHCVT-GEKPLVG  1135

Query  530   ETIFKDGSLEHAY---------EENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGS  682
                + D      Y            +    N     G+  H + D            QGS
Sbjct  1136  NDKYADPDRTSDYLNVSGSVSATRVLDAKSNDGASFGQKNHVDAD-----------HQGS  1184

Query  683   S---STSCNGDKT------LETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAWTG  820
                  +SC  +K        E+  GL +A +     RA S G       LSD ++ AWTG
Sbjct  1185  EVLFDSSCAIEKPSDLPVGTESFYGLNSAESNIEGSRALSDGQSPIMDNLSDTLEAAWTG  1244

Query  821   IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKR  1000
                S+  +    + +  E   A        DS T +  +   +V   D         +  
Sbjct  1245  ETTSAVGVLKDGTCRSSEPLTA--------DSSTTRLAE---KVDVEDPGEEHGGAKASG  1293

Query  1001  LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--  1174
              PPS S  S+ ++    G +  M    +S  + +    LP  AQKL+ L   S  + S  
Sbjct  1294  FPPSLSSKSS-ENVEDAGGWLGM--SFISFYRSLNKNFLP-SAQKLDTLGEYSPVYISSF  1349

Query  1175  HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGV  1354
               S    GARL++P  G  D +I VYD EPTSIISYAL S++Y   + D+   S+     
Sbjct  1350  RESEAQGGARLLLPV-GVNDTIIPVYDVEPTSIISYALVSQDYIAQLADELEKSKDSSLD  1408

Query  1355  SDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFS-----DP---KLSP  1510
             S+   +S  +  L + Q    + L+   + S GS D S             DP     + 
Sbjct  1409  SNLPLQSLESGSLQSLQSMDEMVLE--SYRSLGSADESILSSSSSHSSSVLDPLSYTKAM  1466

Query  1511  HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKS  1690
             H R+SF D+     GKVK++VTCY+AK+F+ALR+ CCPSE+DFIRSLSRCK+W AQGGKS
Sbjct  1467  HARVSFSDD--GPLGKVKYTVTCYYAKRFEALRRICCPSEMDFIRSLSRCKKWGAQGGKS  1524

Query  1691  NVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVK  1870
             NV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S +S SPTCLAK++GIYQV  K
Sbjct  1525  NVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESINSRSPTCLAKILGIYQVTSK  1584

Query  1871  HLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQT  2047
             HLKGGKE+KMD++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD N +ES+ T
Sbjct  1585  HLKGGKESKMDVLVMENLLFGRNLTRLYDLKGSSRSRYNPDSSGSNKVLLDQNLIESMPT  1644

Query  2048  KPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDK  2227
              PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVG+DEE+ ELVLGIID+MRQYTWDK
Sbjct  1645  SPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGIDEEKHELVLGIIDFMRQYTWDK  1704

Query  2228  HLETW  2242
             HLETW
Sbjct  1705  HLETW  1709



>ref|XP_006465809.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Citrus sinensis]
 ref|XP_006465810.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Citrus sinensis]
 ref|XP_006465811.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X3 [Citrus sinensis]
 ref|XP_006465812.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X4 [Citrus sinensis]
Length=1827

 Score =   505 bits (1301),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 328/794 (41%), Positives = 457/794 (58%), Gaps = 102/794 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L+F ++  Q WI KE  E++ +A+ L++
Sbjct  1024  RDCLRFYGFGKMVACFRYASIDVHSVYLPPHKLDFINEY-QEWIQKEADEVVSQAELLFS  1082

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ + +  + +K   VG +      L + I+EL+ ML +EK  + +  Q      + +GQ
Sbjct  1083  EVLNNLSPILDK--KVGPE------LRHQIVELEGMLQREKAEFEESVQKALSREASKGQ  1134

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMES--IFDNNFSSQHPENAVSCINPGEWGGET  535
               ID+LE+NRLR  LL   + WDHRL Y  +  I  N   S+  E            GE 
Sbjct  1135  PVIDILEINRLRRQLLFQSYMWDHRLVYAANLDINSNGLKSEISEQ-----------GEK  1183

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTL  715
             I   G  E   + NV   P +     + L ++     + K +   + G SST+ +     
Sbjct  1184  IPTSG--EKVVQMNVLAMPETGSSFYDSLLAD---AKLDKSSDREEGGDSSTTLSDGFLQ  1238

Query  716   ETRLG-------------------------LENAVNKSPLERAPSAGSI-----LSDKID  805
             ET +G                         LE+ VN   + R  S G +     LSD ++
Sbjct  1239  ETIMGQDSNLLENDQGNISASISFCEQSGSLESEVN---VRRTLSEGQVPVVANLSDTLE  1295

Query  806   CAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ-  982
              AWTG     ++ QV+ +    +  +        VDS T   +         +  + +Q 
Sbjct  1296  AAWTG-----ENYQVNNTYGLSDSPL--------VDSSTVAVM---TEGLDLEDHMEVQT  1339

Query  983   -ERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSS  1159
               ++++ L P+ S           G +R     P  N     ++     +QKL+ +   +
Sbjct  1340  GAKVTQSLSPALSSKGPDNMEEPVGWFRM----PFLNFYRSLNKNFLLSSQKLDTMSGYN  1395

Query  1160  TTFTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKD--WVTDKP  1327
               + S    S L  GARL +P  G  D V+ VYD+EPTSII+YAL S EY     V D  
Sbjct  1396  PIYFSSFRDSELNGGARLFLPV-GVNDTVVPVYDDEPTSIIAYALVSTEYHVGLMVDDGE  1454

Query  1328  YMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFS  1492
                EGG    D      ++  ++      + +L    + S GS D      SG    L  
Sbjct  1455  KTKEGG----DVMSSFSLSDSVNLQSHLSADELTLDLYRSLGSTDESILSLSGSRSSLIL  1510

Query  1493  DP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCK  1663
             DP     + HP++SF+D+     G+VK+SVTCY+A++F+ALRK CCPSELD++RSLSRCK
Sbjct  1511  DPLSYTKAFHPKVSFKDD--GPLGQVKYSVTCYYARRFEALRKICCPSELDYVRSLSRCK  1568

Query  1664  RWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKV  1843
             +W A+GGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF+YL++S S+GSPTCLAK+
Sbjct  1569  KWGAKGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPEYFKYLSESISTGSPTCLAKI  1628

Query  1844  VGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLD  2020
             +GIYQV  KHLKGG+E+KMD++VMENL + RS++R+YDLKGS RSRYN D+  +NKVLLD
Sbjct  1629  LGIYQVTTKHLKGGRESKMDVLVMENLLFSRSVTRLYDLKGSSRSRYNPDSSGSNKVLLD  1688

Query  2021  LNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIID  2200
              N +E++ T PIF+G+KAKR LERAVWNDT+FLA + VMDYSLLVGVDEE  +LVLGIID
Sbjct  1689  QNLIEAMPTSPIFVGNKAKRLLERAVWNDTAFLASIDVMDYSLLVGVDEENHQLVLGIID  1748

Query  2201  YMRQYTWDKHLETW  2242
             +MRQYTWDKHLETW
Sbjct  1749  FMRQYTWDKHLETW  1762



>ref|XP_009601608.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Nicotiana tomentosiformis]
Length=1773

 Score =   504 bits (1299),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 334/785 (43%), Positives = 453/785 (58%), Gaps = 81/785 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP+ L+FN +  Q WI +EV E++ +A+ L++
Sbjct  966   RDCLRFYGFGKMVACFRYASIDVHSVCLPPAKLDFNYEKNQDWIQQEVNEVVSRAERLFS  1025

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A++ L EK  SVG   +++        I  L+ ML KEK  + +  Q    + +++
Sbjct  1026  EVLNAIRLLVEK-RSVGQFNSSVKAPEARGQIAVLEGMLQKEKEEFEESLQKILTKEAKK  1084

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGE--WGG  529
              Q  +D+ E+NRLR  L+   + WDHRL Y  S+          E    C+  GE    G
Sbjct  1085  VQPVVDIFEINRLRRQLIFQSYMWDHRLVYAASL----------ECEAHCVT-GEKPLVG  1133

Query  530   ETIFKDGSLEHAY---------EENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGS  682
                + D      Y            +    N     G+  H + D            QGS
Sbjct  1134  NDKYADPDRTSDYLNVSGSVSATRVLDAKSNDGASFGQKNHVDAD-----------HQGS  1182

Query  683   S---STSCNGDKT------LETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAWTG  820
                  +SC  +K        E+  GL +A +     RA S G       LSD ++ AWTG
Sbjct  1183  EVLFDSSCAIEKPSDLPVGTESFYGLNSAESNIEGSRALSDGQSPIMDNLSDTLEAAWTG  1242

Query  821   IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKR  1000
                S+  +    + +  E   A        DS T +  +   +V   D         +  
Sbjct  1243  ETTSAVGVLKDGTCRSSEPLTA--------DSSTTRLAE---KVDVEDPGEEHGGAKASG  1291

Query  1001  LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--  1174
              PPS S  S+ ++    G +  M    +S  + +    LP  AQKL+ L   S  + S  
Sbjct  1292  FPPSLSSKSS-ENVEDAGGWLGM--SFISFYRSLNKNFLP-SAQKLDTLGEYSPVYISSF  1347

Query  1175  HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGV  1354
               S    GARL++P  G  D +I VYD EPTSIISYAL S++Y   + D+   S+     
Sbjct  1348  RESEAQGGARLLLPV-GVNDTIIPVYDVEPTSIISYALVSQDYIAQLADELEKSKDSSLD  1406

Query  1355  SDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFS-----DP---KLSP  1510
             S+   +S  +  L + Q    + L+   + S GS D S             DP     + 
Sbjct  1407  SNLPLQSLESGSLQSLQSMDEMVLE--SYRSLGSADESILSSSSSHSSSVLDPLSYTKAM  1464

Query  1511  HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKS  1690
             H R+SF D+     GKVK++VTCY+AK+F+ALR+ CCPSE+DFIRSLSRCK+W AQGGKS
Sbjct  1465  HARVSFSDD--GPLGKVKYTVTCYYAKRFEALRRICCPSEMDFIRSLSRCKKWGAQGGKS  1522

Query  1691  NVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVK  1870
             NV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S +S SPTCLAK++GIYQV  K
Sbjct  1523  NVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESINSRSPTCLAKILGIYQVTSK  1582

Query  1871  HLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQT  2047
             HLKGGKE+KMD++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD N +ES+ T
Sbjct  1583  HLKGGKESKMDVLVMENLLFGRNLTRLYDLKGSSRSRYNPDSSGSNKVLLDQNLIESMPT  1642

Query  2048  KPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDK  2227
              PIF+G+KAKR LERAVWNDT+FLA V VMDYSLLVG+DEE+ ELVLGIID+MRQYTWDK
Sbjct  1643  SPIFVGNKAKRLLERAVWNDTAFLASVDVMDYSLLVGIDEEKHELVLGIIDFMRQYTWDK  1702

Query  2228  HLETW  2242
             HLETW
Sbjct  1703  HLETW  1707



>ref|XP_008797354.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
isoform X3 [Phoenix dactylifera]
 ref|XP_008797355.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
isoform X3 [Phoenix dactylifera]
Length=1844

 Score =   504 bits (1299),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 335/799 (42%), Positives = 458/799 (57%), Gaps = 102/799 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSL-Y  178
             RDCLR+YG G M+ACFRY+PI++ SV LPP  L+FN Q  Q W+ KEV E + +A  L +
Sbjct  1025  RDCLRFYGFGRMVACFRYAPINLHSVYLPPPKLDFNYQ-HQEWVEKEVNEQVAEAAELLF  1083

Query  179   AEISSAVQKLEEKCASVGCDWNNM--NGLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
              E+ +A+ ++ E+    G    NM  + L   I+EL+ +L KEK  + +  Q   ++ + 
Sbjct  1084  TEVLNALCQISERKPKTGSLDGNMKVSELRRAIIELEGILQKEKAEFEESIQKIMKKETR  1143

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYY-------------------------MESI  457
             +G+ +ID+LE+N+LR  LL   + WD RL Y                          E +
Sbjct  1144  KGKPSIDILEVNKLRRQLLFQSYFWDQRLIYAAGSHNGRHEVLSGFMTRNKEKLNCTEKL  1203

Query  458   FDNNFSSQHPENAV--SCINPGEWGGETIF-------KDGSLEHAYEENV-HEFPNSEEC  607
              D N + +   + +     +P   G E+I         +  L+H  + NV  +  N E+ 
Sbjct  1204  VDFNTAPRLQRSFIRLETASPSSRGDESIVGSTCPTDHEEGLDHFNQPNVSQQKRNHEKA  1263

Query  608   PGEGLHSEHDEPPVPKDALSYQQGSSSTSCN-GDKT--LETRLGLENAVNKSPLERAPSA  778
                G  S                G+ +TS N GD+   LE  LG+   V+          
Sbjct  1264  NINGKRS---------------NGNLATSINAGDQLDPLEPGLGVRRVVSDGQF----PV  1304

Query  779   GSILSDKIDCAWTGID-PSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVY  955
              + LSD +D  W G + P+  D    AS+  G   V +   +S ++    +      ++ 
Sbjct  1305  MADLSDTLDAKWRGENGPALAD----ASMSNGSASVEAETTVSVLEDSEEQSRADTTKL-  1359

Query  956   SFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQK  1135
              F SAL  + R S     S    S++K       + N  RD   N     S + PR    
Sbjct  1360  -FASALPARWRDS-----SEDLSSSIKM-----PFVNFYRDINKN-----SGSAPRFGVL  1403

Query  1136  LNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWV  1315
                 P   ++F     +   GARL++P  G  D VI +YD+EPTSIISYAL S +Y   +
Sbjct  1404  SEYNPLYVSSFRDL--VCQGGARLLLP-IGVNDTVIPIYDDEPTSIISYALVSPDYHFQM  1460

Query  1316  TDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLD-LDYMHFGSYGSEDAS-----GRI  1477
             +++   +  G    DT+   P       +Q F S D     +F S+GS D S     G  
Sbjct  1461  SEEWEKARDG---GDTSFPLPNYDS-ENFQPFQSFDDASSENFKSFGSVDESILSLSGSR  1516

Query  1478  GFLFSDPKLSP---HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRS  1648
               L  DP  S    H R+SF D+     GK K++VTCY+AK F+ALR+ CCPSEL F+RS
Sbjct  1517  APLVLDPVASTKAMHIRVSFGDD--GPLGKAKYTVTCYYAKSFEALRRICCPSELGFVRS  1574

Query  1649  LSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPT  1828
             LSRCK+W AQGGKSNV+FAKSLD+RF+IKQ+ KTEL+SF +FAP+YF+YL++S  +GSPT
Sbjct  1575  LSRCKKWGAQGGKSNVFFAKSLDDRFVIKQVTKTELESFIKFAPEYFKYLSESIKTGSPT  1634

Query  1829  CLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-N  2005
             CLAK++GIYQV +KHLKGGKE++MDL+VMENL + R+++R+YDLKGS RSRYN D+   N
Sbjct  1635  CLAKILGIYQVTIKHLKGGKESRMDLLVMENLLFRRNVTRLYDLKGSSRSRYNPDSSGNN  1694

Query  2006  KVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELV  2185
             KVLLD N +E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELV
Sbjct  1695  KVLLDQNLIEAMPTSPIFMGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELV  1754

Query  2186  LGIIDYMRQYTWDKHLETW  2242
             LGIID+MRQYTWDKHLETW
Sbjct  1755  LGIIDFMRQYTWDKHLETW  1773



>ref|XP_008797351.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008797352.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
isoform X1 [Phoenix dactylifera]
Length=1857

 Score =   505 bits (1300),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 335/799 (42%), Positives = 458/799 (57%), Gaps = 102/799 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSL-Y  178
             RDCLR+YG G M+ACFRY+PI++ SV LPP  L+FN Q  Q W+ KEV E + +A  L +
Sbjct  1038  RDCLRFYGFGRMVACFRYAPINLHSVYLPPPKLDFNYQ-HQEWVEKEVNEQVAEAAELLF  1096

Query  179   AEISSAVQKLEEKCASVGCDWNNM--NGLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
              E+ +A+ ++ E+    G    NM  + L   I+EL+ +L KEK  + +  Q   ++ + 
Sbjct  1097  TEVLNALCQISERKPKTGSLDGNMKVSELRRAIIELEGILQKEKAEFEESIQKIMKKETR  1156

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYY-------------------------MESI  457
             +G+ +ID+LE+N+LR  LL   + WD RL Y                          E +
Sbjct  1157  KGKPSIDILEVNKLRRQLLFQSYFWDQRLIYAAGSHNGRHEVLSGFMTRNKEKLNCTEKL  1216

Query  458   FDNNFSSQHPENAV--SCINPGEWGGETIF-------KDGSLEHAYEENV-HEFPNSEEC  607
              D N + +   + +     +P   G E+I         +  L+H  + NV  +  N E+ 
Sbjct  1217  VDFNTAPRLQRSFIRLETASPSSRGDESIVGSTCPTDHEEGLDHFNQPNVSQQKRNHEKA  1276

Query  608   PGEGLHSEHDEPPVPKDALSYQQGSSSTSCN-GDKT--LETRLGLENAVNKSPLERAPSA  778
                G  S                G+ +TS N GD+   LE  LG+   V+          
Sbjct  1277  NINGKRS---------------NGNLATSINAGDQLDPLEPGLGVRRVVSDGQF----PV  1317

Query  779   GSILSDKIDCAWTGID-PSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVY  955
              + LSD +D  W G + P+  D    AS+  G   V +   +S ++    +      ++ 
Sbjct  1318  MADLSDTLDAKWRGENGPALAD----ASMSNGSASVEAETTVSVLEDSEEQSRADTTKL-  1372

Query  956   SFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQK  1135
              F SAL  + R S     S    S++K       + N  RD   N     S + PR    
Sbjct  1373  -FASALPARWRDS-----SEDLSSSIKM-----PFVNFYRDINKN-----SGSAPRFGVL  1416

Query  1136  LNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWV  1315
                 P   ++F     +   GARL++P  G  D VI +YD+EPTSIISYAL S +Y   +
Sbjct  1417  SEYNPLYVSSFRDL--VCQGGARLLLP-IGVNDTVIPIYDDEPTSIISYALVSPDYHFQM  1473

Query  1316  TDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLD-LDYMHFGSYGSEDAS-----GRI  1477
             +++   +  G    DT+   P       +Q F S D     +F S+GS D S     G  
Sbjct  1474  SEEWEKARDG---GDTSFPLPNYDS-ENFQPFQSFDDASSENFKSFGSVDESILSLSGSR  1529

Query  1478  GFLFSDPKLSP---HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRS  1648
               L  DP  S    H R+SF D+     GK K++VTCY+AK F+ALR+ CCPSEL F+RS
Sbjct  1530  APLVLDPVASTKAMHIRVSFGDD--GPLGKAKYTVTCYYAKSFEALRRICCPSELGFVRS  1587

Query  1649  LSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPT  1828
             LSRCK+W AQGGKSNV+FAKSLD+RF+IKQ+ KTEL+SF +FAP+YF+YL++S  +GSPT
Sbjct  1588  LSRCKKWGAQGGKSNVFFAKSLDDRFVIKQVTKTELESFIKFAPEYFKYLSESIKTGSPT  1647

Query  1829  CLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-N  2005
             CLAK++GIYQV +KHLKGGKE++MDL+VMENL + R+++R+YDLKGS RSRYN D+   N
Sbjct  1648  CLAKILGIYQVTIKHLKGGKESRMDLLVMENLLFRRNVTRLYDLKGSSRSRYNPDSSGNN  1707

Query  2006  KVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELV  2185
             KVLLD N +E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELV
Sbjct  1708  KVLLDQNLIEAMPTSPIFMGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELV  1767

Query  2186  LGIIDYMRQYTWDKHLETW  2242
             LGIID+MRQYTWDKHLETW
Sbjct  1768  LGIIDFMRQYTWDKHLETW  1786



>ref|XP_006593969.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Glycine max]
 ref|XP_006593970.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Glycine max]
 ref|XP_006593971.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X3 [Glycine max]
Length=1812

 Score =   504 bits (1297),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 328/798 (41%), Positives = 447/798 (56%), Gaps = 108/798 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPP  LEFN  S Q W+ KE  EL  KA+ L++
Sbjct  1011  RDCLRFYGFGKMVACFRYASIHLHSVYLPPPKLEFNYDS-QDWLQKEANELHNKAEILFS  1069

Query  182   EISSAVQKLEEKCAS--VGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ + + ++ EK +   +    N ++   N + ELK ML+ EK  + D  Q    +  + 
Sbjct  1070  EVCNVLHQISEKVSGPVLQEGGNRVSDFRNLVAELKGMLLYEKEEFEDSLQRLLHKEGKV  1129

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMES----IFDNNFSS-QHPENAVSCINPGE  520
             GQ  ID+LELN+L   +    + WD RL Y  +    I   N  S  H E  +       
Sbjct  1130  GQPVIDILELNKLCRHIHIHSYVWDQRLIYASNLSKIILQENLKSLNHREKLL-------  1182

Query  521   WGGETIFKDGSLEHAYEENVHEFP--NSEEC--------PGEGLHSE---HDEPPVPKDA  661
                      GS E   E +V   P      C        P   L+ E   H   PV K  
Sbjct  1183  ---------GSREKVIEADVATRPARGHSSCDSFLLGTKPDGNLNLENTSHLSHPVVK--  1231

Query  662   LSYQQGSSSTSCNGDKTLETRLGLENAVNKS-------PLERAPSAG-----SILSDKID  805
              S  +G  +   N DK   +  G  N  +KS        + RA S G     + LSD +D
Sbjct  1232  -SEDKGKDT---NHDKVDLSLSGGANINDKSDSVEFGGAVRRALSEGESPFVANLSDTLD  1287

Query  806   CAWTGID-PSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFD------  964
              AWTG   P++  ++ +  L      VA    ++++ +      KS + +YS +      
Sbjct  1288  AAWTGEGHPTNLSLKENGCLPPDAAAVAVHSPVANIVTS-----KSNSDIYSANIGGIEA  1342

Query  965   SALRIQERISKRLPP---SPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQK  1135
                   + +SK L        + +   SF+    +        + + ++  + L R+   
Sbjct  1343  GCTNYSKLLSKGLDTKWKGIPFANVFGSFNKTSSFNTEKLVEYNPVHILSFRELERQT--  1400

Query  1136  LNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWV  1315
                                 GARL++P +   D ++ VYD+EPTS+I+Y L S +Y   +
Sbjct  1401  --------------------GARLLLPAS-TNDTIVPVYDDEPTSVIAYVLVSMDYHMQM  1439

Query  1316  TDKPYMSEGGWGVSDTNKESPI--ASKLSTWQRFG-SLDLDYMHFGSYGSE--DASGRIG  1480
              +     E G    D++   P+  ++ L +   F  ++   Y   GS+       SG   
Sbjct  1440  LEYDRPKESG----DSSISLPLFDSTSLLSLNSFDETITNTYRSLGSFDENVLPTSGSRS  1495

Query  1481  FLFSDP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSL  1651
                 DP       H R+SF D+   + GKVK++VTCY+AK+F+ALR+ CCPSELDF+RSL
Sbjct  1496  LPAGDPFSYTKDLHARVSFTDD--GSLGKVKYTVTCYYAKRFEALRRTCCPSELDFVRSL  1553

Query  1652  SRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTC  1831
             SRCK+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S S+GSPTC
Sbjct  1554  SRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFTKFAPAYFKYLSESISTGSPTC  1613

Query  1832  LAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANK  2008
             LAK++GIYQV  KHLKGGKETKMD++VMENL Y R+I R+YDLKGS RSRYN DT  +NK
Sbjct  1614  LAKILGIYQVTSKHLKGGKETKMDVLVMENLLYRRNIRRLYDLKGSSRSRYNPDTSGSNK  1673

Query  2009  VLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVL  2188
             VLLD N +E++ T PIF+G+KAKR LERAVWNDT+FLA +YVMDYSLLVGVDEE+ ELVL
Sbjct  1674  VLLDQNLIEAMPTSPIFVGNKAKRLLERAVWNDTAFLASIYVMDYSLLVGVDEEKHELVL  1733

Query  2189  GIIDYMRQYTWDKHLETW  2242
             GIID+MRQYTWDKHLETW
Sbjct  1734  GIIDFMRQYTWDKHLETW  1751



>ref|XP_009357937.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
[Pyrus x bretschneideri]
Length=1833

 Score =   504 bits (1297),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 319/782 (41%), Positives = 453/782 (58%), Gaps = 74/782 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPP+ ++FN + +Q WI KE  E++ +A+ L++
Sbjct  1025  RDCLRFYGFGKMVACFRYASIYVHSVYLPPAKVDFNYE-KQEWIQKETDEVIDRAELLFS  1083

Query  182   EISSAVQKLEEKCASVGCDWNNM---NGLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
             E+ +A++++ EK +  G   + M      H  I+EL+ ML KEK  + +L Q T    ++
Sbjct  1084  EVLNALRQIAEKRSGSGSHSSGMVTPESRHQ-IVELEGMLQKEKVEFEELLQKTLNREAK  1142

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFS-------SQHPENAVS---  502
             +GQ  +D+LE+NRLR  LL   + WDHRL Y  S+ +N ++       S   + A S   
Sbjct  1143  KGQPVVDILEINRLRRQLLFQSYMWDHRLVYAASLDNNRYNDGLNSSISDEGKPATSSEK  1202

Query  503   -----CINPGEW--GGETIFKDGSLEHAYEE------NVH-EFPNSEECPGEGLHSEHDE  640
                   IN G+     ++   D  L   ++        VH E  N E   G     E+++
Sbjct  1203  IADNVAINLGKSYNSCDSFLVDAMLNKGFDHGGDVANTVHAEMLNKERDSGRDSKYENED  1262

Query  641   PPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTG  820
                  D +S        +C+    L+ R G+  +++             LSD +D AWTG
Sbjct  1263  QVNLSDRVS--------TCDQSDPLKPRAGIHRSLSDGQFPVIMD----LSDTLDTAWTG  1310

Query  821   IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKR  1000
                  ++     + ++  R     G      SP    L       + D A   +++    
Sbjct  1311  -----ENQCGFGTAKDNTRTAPVLGIADSSASPVKDEL-------NLDHA---EDQNGPM  1355

Query  1001  LPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHA  1180
             +  S S   + K      D  + ++ P  N     ++     AQKL+ L   +  + S  
Sbjct  1356  IAHSASPALSTKGSENIEDSVSWLKMPFLNFYRGFNKNFLSAAQKLDTLGEYNPVYVSSF  1415

Query  1181  SILP-EGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVS  1357
               L  EG  +++   G  D V+ VYD+EPTS+ISYAL S +Y   ++D+   +     VS
Sbjct  1416  RELELEGGAMLLLPVGINDTVVPVYDDEPTSLISYALVSPDYHSQISDEGERTRNSGDVS  1475

Query  1358  -----DTNKESPIASKLSTWQR-FGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPR  1519
                   T    P         R FGS +   +   +YGS  + G     ++    + H +
Sbjct  1476  LSDSFTTQSHHPDDDTTPESHRSFGSTEESLL--STYGSRSSLGLDPLSYTK---ALHAK  1530

Query  1520  ISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVY  1699
             +SF D+S    G+VK+SVTCY AK+F+ALR+ CCPSELD++RSLSRCK+W AQGGKSNV+
Sbjct  1531  VSFGDDS--PLGQVKYSVTCYHAKRFEALRRICCPSELDYVRSLSRCKKWGAQGGKSNVF  1588

Query  1700  FAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLK  1879
             FAKSLD+RFIIKQ+ KTEL+SF +FAP YF+YL++S  + SPTCLAK++GIYQV  KHLK
Sbjct  1589  FAKSLDDRFIIKQVTKTELESFIKFAPGYFKYLSESIGTKSPTCLAKILGIYQVKSKHLK  1648

Query  1880  GGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPI  2056
             GG   K+D++VMENL +GR+I+R+YDLKGS RSRYN D+  ++KVLLD N +E++ T PI
Sbjct  1649  GG---KIDVLVMENLMFGRNITRLYDLKGSSRSRYNPDSSGSDKVLLDQNLIEAMPTSPI  1705

Query  2057  FLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLE  2236
             F+G+KAKR LERAVWNDT+FLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLE
Sbjct  1706  FVGNKAKRLLERAVWNDTAFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLE  1765

Query  2237  TW  2242
             TW
Sbjct  1766  TW  1767



>ref|XP_008647401.1| PREDICTED: uncharacterized protein LOC100193462 isoform X1 [Zea 
mays]
 gb|AFW76939.1| putative 1-phosphatidylinositol-4-phosphate 5-kinase/ zinc ion 
binding family [Zea mays]
Length=1596

 Score =   500 bits (1287),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 328/770 (43%), Positives = 448/770 (58%), Gaps = 102/770 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+A FRYSP+DILSV LP SVL+F     Q WI+KE  ++  + + LY 
Sbjct  862   RDCLRFYGLGSMVAVFRYSPVDILSVNLPSSVLDFACPKAQDWIIKEAVDVCARKEHLYR  921

Query  182   EISSAVQKLEE--KCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             EI + +  +E+  K  ++G      +GLH  + +LK+++  E   ++ +   +  +  + 
Sbjct  922   EIVAKLDCIEKIVKDQNIGMK----SGLHKHVADLKELVKVEWKKYDVVSAFSIVDNLQT  977

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNN---------FSSQHPENAVSCI  508
              +  IDVLELN LR  L+ D+H WD RLY M S+   N         FS +  E+++   
Sbjct  978   FEPYIDVLELNLLRRELVHDIHVWDRRLYMMHSLTKENCRTMPNDAQFSEKFTESSLE-Q  1036

Query  509   NPGEWGGETIFKDGSLEH-------AYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALS  667
             +     G+ +  + SLE            +V   P +E+      H    E  +  DA  
Sbjct  1037  SKDVTSGKHLNAESSLEQNQPSTLEVAAVSVKSSPMTEQTNTSISHLAL-ETTIMGDASM  1095

Query  668   YQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQ  847
             +   +  +   G   +++   L        L+++ S+ S LSD+ID AWTG   S Q + 
Sbjct  1096  HSVSTVISFAPGSYEMQSEGVLAELEAGKTLQKSQSSASNLSDRIDLAWTG---SGQLVN  1152

Query  848   VHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLS  1027
               +S  E      SF   S  D+P  +++ +P R+ SFDSA+                  
Sbjct  1153  DSSSSMEA----VSFIPASLKDNPAYQKVIAPIRIKSFDSAI------------------  1190

Query  1028  TLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASI---LPEG  1198
                        RN + D  ++I+   SQ  P+  ++       S TF +  S+   +   
Sbjct  1191  ---------SSRN-VDDSNASIRRSYSQRPPKAIERTG--KGLSPTFLNKLSLPGMIHGE  1238

Query  1199  ARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMS-EGGWGVSDTNKES  1375
             +RL++ +N    V++ +YD+EP+S+I++A++  EY  ++    Y + E       +++  
Sbjct  1239  SRLLLSQN-DSGVIVPIYDDEPSSMIAHAMTVPEYHSFLLPLLYQNNESNLLNYGSDQPQ  1297

Query  1376  PIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGG  1555
             PI             D  Y HF                          ISFEDE  N+  
Sbjct  1298  PITRN----------DSKYNHF-------------------------TISFEDEDSNSVD  1322

Query  1556  KVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIK  1735
             K KFSVTCYFAKQFDA+R+KCCP ELD+IRSLSRCKRWSAQGGKSNVYFAK+LD+RF+IK
Sbjct  1323  KAKFSVTCYFAKQFDAIRRKCCPDELDYIRSLSRCKRWSAQGGKSNVYFAKTLDDRFVIK  1382

Query  1736  QMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVM  1915
             Q+ +TELDSFE++A  YF+YL DS SSGSPTCL KV+G+YQ+  K+L+ GKE KMD++VM
Sbjct  1383  QVTRTELDSFEDYAADYFKYLIDSVSSGSPTCLTKVLGLYQIIAKNLRDGKELKMDVMVM  1442

Query  1916  ENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLER  2092
             ENLF+ R +SR+YDLKGS+RSRYN DT   NKVLLDLN LE+L TKPIFLGSKAKR LER
Sbjct  1443  ENLFFKRKVSRIYDLKGSLRSRYNPDTSGNNKVLLDLNLLETLHTKPIFLGSKAKRRLER  1502

Query  2093  AVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AVWNDTSFLA V VMDYSLLVG+DEERKELV+GIIDY+RQYTWDK LETW
Sbjct  1503  AVWNDTSFLASVDVMDYSLLVGIDEERKELVMGIIDYLRQYTWDKQLETW  1552



>gb|KHN39576.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1 [Glycine soja]
Length=1815

 Score =   502 bits (1292),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 331/791 (42%), Positives = 446/791 (56%), Gaps = 109/791 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L F+    Q WI +E  E++ +A+ L++
Sbjct  1022  RDCLRFYGFGRMVACFRYASIDVHSVYLPPHTLIFD-YGNQDWIQQESDEVVNRAELLFS  1080

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ + + ++ EK ++     N      L   + EL+ ML KEK  + +  Q    +    
Sbjct  1081  EVLNGLSQIVEKRSNAVQVSNGHKSPELRRQVAELEGMLQKEKLEFEETLQKILNQEKRN  1140

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSS----------QHP--ENAV  499
             GQ  IDVLE+NRL   LL   + WDHRL Y  ++  +N  S          + P  EN +
Sbjct  1141  GQPGIDVLEINRLWRQLLFQSYMWDHRLIYAANLVHSNNESGSCSPISEDKEKPTDENQM  1200

Query  500   SCIN-----------PGEWGGETIFKDG--SLEHAYEE-NVHEFPNSEECPGEGLHSEHD  637
             S IN           P   GG  +F DG  SL+  ++E ++ +  N E+       +EH+
Sbjct  1201  S-INSIYGDLKLNDSPSHGGGSVVF-DGKFSLDAVHQEIDMAKNKNHEK------DAEHN  1252

Query  638   EPPVPKDALSYQQGSSSTSCNGDKTL-ETRLGLENAVNKSPLERAPSAGSILSDKIDCAW  814
                           S+S S N    L E  LG+  A++  P    PS    LS+ +D  W
Sbjct  1253  L-------------SNSKSINDQSNLLEPELGVRRALSDGPFPVIPS----LSETLDAKW  1295

Query  815   TGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERIS  994
             TG + S   +Q   S    +  +A        D+ T    K    +Y        Q    
Sbjct  1296  TGENHSGYGIQKDNSSVNPDILMA--------DALTTSAQK---EIYYLGDRTEDQ----  1340

Query  995   KRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS  1174
                          K      D  + +  P  N     ++ L    QK + L   +  + S
Sbjct  1341  -------------KGHDNMEDSSSWLGMPFLNFYRQFNKNLFASTQKFDTLVDYNPVYVS  1387

Query  1175  --HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGW  1348
                   L  GARL++P  G  + VI VYD+EP+SII+YAL S EY   +TD     EG  
Sbjct  1388  CFRKQELLGGARLLLPI-GVNETVIPVYDDEPSSIIAYALMSPEYHLQLTD-----EGER  1441

Query  1349  GVSDTNKESPIASKLSTWQRFGSLD------------LDYMHFGSYGSEDASGRIGFLFS  1492
                     S   S   T Q F S+D            ++ M F   GS ++S     L++
Sbjct  1442  PREGNEFISSYFSDSGTLQSFSSVDETAFDSQKSFGSIEEMIFSMSGSRNSSILDPMLYT  1501

Query  1493  DPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWS  1672
                 + H R+SF  +     GKVK+SVTCY+AK+F+ALR+ CCPSELD+IRSLSRCK+W 
Sbjct  1502  K---AMHARVSFGVDG--PLGKVKYSVTCYYAKRFEALRRVCCPSELDYIRSLSRCKKWG  1556

Query  1673  AQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGI  1852
             AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +F P+YF+YL++S  +GSPTCLAK++GI
Sbjct  1557  AQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFGPEYFKYLSESIGTGSPTCLAKILGI  1616

Query  1853  YQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNF  2029
             YQV  KHLKGGKE++MD++VMENL + R+++R+YDLKGS RSRYN+D T  NKVLLD N 
Sbjct  1617  YQVTSKHLKGGKESRMDVLVMENLLFRRTVTRLYDLKGSSRSRYNADSTGKNKVLLDQNL  1676

Query  2030  LESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMR  2209
             +E++ T PIF+G+KAKR LERAVWNDT FLA V VMDYSLLVGVDEE+ ELV+GIID+MR
Sbjct  1677  IEAMPTSPIFVGNKAKRLLERAVWNDTGFLASVDVMDYSLLVGVDEEKHELVIGIIDFMR  1736

Query  2210  QYTWDKHLETW  2242
             QYTWDKHLETW
Sbjct  1737  QYTWDKHLETW  1747



>ref|XP_010323385.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Solanum lycopersicum]
 ref|XP_010323386.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Solanum lycopersicum]
Length=1773

 Score =   501 bits (1289),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 322/789 (41%), Positives = 452/789 (57%), Gaps = 99/789 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+P+ + SV LPP  LEF S   Q WI KE  E+ R+A +L+A
Sbjct  998   RDCLRFYGFGKMVACFRYAPVHVYSVFLPPPKLEF-SYDNQEWIQKEGDEVRRRANALFA  1056

Query  182   EISSAVQ-KLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEG  358
             E+S  +  KLE+            +     I E++++L KEK  +  L +       + G
Sbjct  1057  EVSKVLHVKLEKFSVDSSLKAPKTS---EQITEMEEILEKEKTEFEGLLRKALSREIKVG  1113

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGE--  532
             Q T+D+LE+N+LR  L+   + WD RL ++ S    N  S+ P +            E  
Sbjct  1114  QPTVDILEINQLRRQLVFHAYLWDRRLIHLSSSHGKN--SRTPGSLTQLKEKPLSSSEEL  1171

Query  533   ----TIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCN  700
                  I + G    +Y+  +     +E    EG H +     +P     +++ ++  +  
Sbjct  1172  PERTAILRPGKSLGSYDSALQNV-KTEITSSEGRHGQ-----IPDGV--HERLTTDENLT  1223

Query  701   GDKTLETRLGLENAVNKSPLE------------RAPSAGSILSDKIDCAWTGIDPSSQDM  844
               K  E    + N  + + LE            + PS GS LSD +D AWTG        
Sbjct  1224  HGKDCEIFCAIRNTGDGNVLEPGKNVRRVLSDAKFPSVGS-LSDTLDAAWTG--------  1274

Query  845   QVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLP------  1006
             + H +++E     ++F     VDS     + +     + D    + ++    +P      
Sbjct  1275  ESHLAIKEHN---SAFPGSFVVDSTALTGVSA-----NTDVERSLCDKNGAEIPHLSAKS  1326

Query  1007  PSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASI  1186
              +  YL T  + H    YR+  ++  +N         P+   KLN    +     S + +
Sbjct  1327  DNTDYL-TWATAHFSNFYRSFNKNITAN---------PQYVAKLN--EHNPVYILSFSEL  1374

Query  1187  LPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTN  1366
             L +G   ++   G+ D+VI VYD+EPTSIISYAL S +Y++       MS+    + + +
Sbjct  1375  LHQGGARLLTAVGENDIVIPVYDDEPTSIISYALVSPDYRN------QMSDESQNLKENH  1428

Query  1367  KESPIASKLSTWQRFGSLDLDYMHF---------GSYGSEDASGRIGFLFSDPKLSP---  1510
             K S   S L       SL+L  +H           S+GS + S   G+      + P   
Sbjct  1429  KFSASLSFLD------SLNLLPLHSVDGVVSESPRSFGSTNESMSSGYSSRSSNMDPPAY  1482

Query  1511  ----HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQ  1678
                 H RISF D+     GKVK++VTCY+AKQF+ LRK CCP+E DFIRSLSRCK+W AQ
Sbjct  1483  INALHARISFSDD--GPPGKVKYTVTCYYAKQFETLRKSCCPNESDFIRSLSRCKKWGAQ  1540

Query  1679  GGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQ  1858
             GGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL+DS +SGSPTCLAK++GIYQ
Sbjct  1541  GGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSDSIASGSPTCLAKILGIYQ  1600

Query  1859  VAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLE  2035
             V  KHLKGGKE++MD++VMENL + R+I+R+YDLKGS RSRYN D+  +NKVLLD N +E
Sbjct  1601  VTSKHLKGGKESRMDVLVMENLLFKRNITRLYDLKGSSRSRYNPDSSGSNKVLLDQNLIE  1660

Query  2036  SLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQY  2215
             ++ T PIF+G++AKR L+RAVWNDTSFLA + VMDYSLLVGVDE+++ELVLGIID+MRQY
Sbjct  1661  AMPTSPIFVGTQAKRLLQRAVWNDTSFLASIDVMDYSLLVGVDEKKQELVLGIIDFMRQY  1720

Query  2216  TWDKHLETW  2242
             TWDKHLETW
Sbjct  1721  TWDKHLETW  1729



>ref|XP_009766174.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X3 [Nicotiana sylvestris]
Length=1682

 Score =   499 bits (1286),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 318/772 (41%), Positives = 443/772 (57%), Gaps = 65/772 (8%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+PI + SV LPP  LEF S     WI KE  E+  +A +L+A
Sbjct  887   RDCLRFYGFGTMVACFRYAPIGVYSVFLPPPKLEF-SHDNHEWIQKEGDEVHSRANALFA  945

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S A+    EK  SV       N +   I+ ++++L KEK  +  L         + GQ
Sbjct  946   EVSKALHAKLEKI-SVDSSLKAPN-ISEQIVAMEEILEKEKTEFEGLLCRALSGEVKVGQ  1003

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQ---HPENAVSCINPGEWGGE  532
               +D+LE+NRLR  L+   + WD RL ++ S    N  +Q    P+    C +  E   E
Sbjct  1004  PAVDILEINRLRRQLVFHAYLWDRRLIHLSSSHGKNSQTQGSLTPQLKEKCFSSSEELSE  1063

Query  533   --TIFKDG----SLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVP------KDALSYQQ  676
               TI + G    S +   +    E  ++E    +  H  H+   +       KDA  +  
Sbjct  1064  RNTIPRPGKSLGSCDSVLQNVKTEITSNEGRDSQIPHGVHERLNIDENLSRGKDAEVF--  1121

Query  677   GSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHA  856
               S  +  G   LE    + + ++     + PS  S LSD +D AWTG        + H 
Sbjct  1122  -CSIRTTGGGNVLEPGKNVRSVLSDG---KFPSVES-LSDTLDAAWTG--------EGHL  1168

Query  857   SLQEGERRVASFGQLSHVDSPTCKRLKSPARVYS--FDSALRIQERISKRLPPSPSYLST  1030
             +++E     ++F     VDS     + + + V       +  +   +S +   +  YL T
Sbjct  1169  AIKEHN---SAFPDSFLVDSSALTGVAANSDVERSMCGKSGAVTPHLSAK-SDNADYL-T  1223

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLM  1210
               + H    YR+  ++  S+ Q +             L   +    +S + +L +G   +
Sbjct  1224  WATAHFSNFYRSFNKNITSDPQFVG-----------KLGEHNPVYISSFSELLHQGGARL  1272

Query  1211  VPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASK  1390
             +   G  D+V+ VYD+EPTSIISYAL S +Y + ++D+P   +       ++   P    
Sbjct  1273  LMAVGVSDIVVPVYDDEPTSIISYALVSPDYHNQMSDEPQNLKD----HKSSASLPFLDS  1328

Query  1391  LSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSP-------HPRISFEDESCNT  1549
             L+        ++      S+G  D S    F   +  + P       H RISF D+    
Sbjct  1329  LNLLSHSSVDEVVSNSSRSFGFTDESMPSSFSSRNSNMDPPAYINALHARISFSDD--GP  1386

Query  1550  GGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFI  1729
              GKVK++VTCY+AK F+ LRK CCP ELDFIRSLSRCK+W AQGGKSNV+FAK+LD+RFI
Sbjct  1387  LGKVKYTVTCYYAKHFETLRKSCCPYELDFIRSLSRCKKWGAQGGKSNVFFAKTLDDRFI  1446

Query  1730  IKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLI  1909
             IKQ+ KTELDSF +FAP YF+YL++S +SGSPTCLAK++GIYQV  KHLKGGKE++MD++
Sbjct  1447  IKQVTKTELDSFIKFAPAYFKYLSESIASGSPTCLAKILGIYQVTSKHLKGGKESRMDVL  1506

Query  1910  VMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSL  2086
             VMENL + R+I+++YDLKGS RSRYN D+  +NKVLLD N +E++ T PIF+G+KAKR L
Sbjct  1507  VMENLLFKRNITKLYDLKGSSRSRYNPDSSGSNKVLLDQNLIEAMPTSPIFVGTKAKRLL  1566

Query  2087  ERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
              RAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1567  LRAVWNDTSFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1618



>ref|XP_010261689.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010261690.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010261691.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Nelumbo nucifera]
Length=1864

 Score =   501 bits (1291),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 324/793 (41%), Positives = 447/793 (56%), Gaps = 87/793 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY  ID+ SV LPPS L+FN  S Q WI KE  E++ + + L+ 
Sbjct  1045  RDCLRFYGFGRMVACFRYGSIDVHSVYLPPSKLDFNYGS-QEWIQKEAKEVVDRTELLFT  1103

Query  182   EISSAVQKLEEKCASVGCDWNNMNGL--HNCILELKDMLMKEK-NYWNDLHQPTHEETSE  352
             E+ +++ ++ EK + +G   + +      + + EL+ ++ KEK  +   LH+  + E ++
Sbjct  1104  EVLNSLHEIVEKRSGLGFLKSGVKAAESRHRVAELEGIIQKEKAEFEESLHKALNRE-AK  1162

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYY--------------------------MES  454
             +GQ  ID+LE+NRL+  LL   + WD RL Y                          +E 
Sbjct  1163  KGQPIIDILEINRLQRQLLFQSYVWDRRLIYTANLDNDHQEGLSSSMAKSKEKTLDSIEK  1222

Query  455   IFDNNFSSQHPENAVSCINPGEWGG---ETIFKDGSLEHAYEENVHEFPNSEECPGEGLH  625
             + + N S+   +   SC +   W G   E++ + GS E          PN +    +G  
Sbjct  1223  LVEMNTSNNTSKALSSCDSI--WDGKPDESLNQGGSGEQ---------PNQDALASQGRE  1271

Query  626   SEHDEPPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERA--PSAGSILSDK  799
                D P   K+ + Y          G K  +    LE+ V +  L     P   S LSD 
Sbjct  1272  MNQD-PNNEKEGMVYLS-------TGQKFDDQFDPLESGVIRRVLSEGHFPIMAS-LSDT  1322

Query  800   IDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRI  979
             +D AWTG        + H           +F   + VDS     +             R 
Sbjct  1323  LDAAWTG--------ENHPGSATPRENSCTFPDAAVVDSSVMIDVAVAKPELEEHLENRD  1374

Query  980   QERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSS  1159
                IS+ L P+ +   T   +    D  + +  P  N     ++     A KL+ L    
Sbjct  1375  GAEISQSLGPARAIKGTDNVY----DTTSWVSMPFLNFYRSFNKISSGSAPKLDTLSGYD  1430

Query  1160  TTFTSHASILPE--GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYM  1333
               + +    L    G R ++P  G  D V+ VYD+EPTSIISYAL S++Y   ++D+   
Sbjct  1431  PVYVTSFRDLERQGGTRFLLP-IGFNDTVVPVYDDEPTSIISYALVSQDYHAQMSDERDR  1489

Query  1334  SEGGWGVSDTNKESPIASKLSTWQRFGSLD-LDYMHFGSYGSED-----ASGRIGFLFSD  1495
              + G    D+    P +  L  +  F   D +    F S GS D      SG    L  +
Sbjct  1490  PKDG---GDSLVSLP-SFDLVNFHSFHLFDEMTSESFRSLGSTDDSILSMSGSRSSLMLE  1545

Query  1496  PKLSP---HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKR  1666
             P LS    H R+S  D+     GKV+++VTCY+AK+F+ALR+ CCP ELDFIRSLSRCK+
Sbjct  1546  PLLSTKALHVRVSVTDD--GPLGKVRYTVTCYYAKRFEALRRTCCPFELDFIRSLSRCKK  1603

Query  1667  WSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVV  1846
             W AQGGKSNV+FAK+LD+RFI+KQ+ KTEL+SF +FAP+YF+YL+DS  +GSPTCLAK++
Sbjct  1604  WGAQGGKSNVFFAKTLDDRFIVKQVTKTELESFIKFAPEYFKYLSDSIGTGSPTCLAKIL  1663

Query  1847  GIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDL  2023
             GIYQV  KHLKGGKE++MD++VMENL +GR+++R+YDLKGS RSRYN D+   NKVLLD 
Sbjct  1664  GIYQVTSKHLKGGKESRMDVLVMENLLFGRNVTRLYDLKGSSRSRYNPDSSGTNKVLLDQ  1723

Query  2024  NFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDY  2203
             N +E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDE + ELV+GIID+
Sbjct  1724  NLIEAMPTSPIFVGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGVDEVKHELVVGIIDF  1783

Query  2204  MRQYTWDKHLETW  2242
             MRQYTWDKHLETW
Sbjct  1784  MRQYTWDKHLETW  1796



>ref|XP_003547898.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Glycine max]
 ref|XP_006598853.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Glycine max]
 ref|XP_006598854.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X3 [Glycine max]
Length=1815

 Score =   500 bits (1288),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 331/791 (42%), Positives = 446/791 (56%), Gaps = 109/791 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L F+    Q WI +E  E++ +A+ L++
Sbjct  1022  RDCLRFYGFGRMVACFRYASIDVHSVYLPPHTLIFD-YGNQDWIQQESDEVVNRAELLFS  1080

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ + + ++ EK ++     N      L   + EL+ ML KEK  + +  Q    +    
Sbjct  1081  EVLNGLSQIVEKRSNAVQVSNGHKSPELRRQVAELEGMLQKEKLEFEETLQKILNQEKRN  1140

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSS----------QHP--ENAV  499
             GQ  IDVLE+NRL   LL   + WDHRL Y  ++  +N  S          + P  EN +
Sbjct  1141  GQPGIDVLEINRLWRQLLFQSYMWDHRLIYAANLVHSNNESGSCSPISEDKEKPTDENQM  1200

Query  500   SCIN-----------PGEWGGETIFKDG--SLEHAYEE-NVHEFPNSEECPGEGLHSEHD  637
             S IN           P   GG  +F DG  SL+  ++E ++ +  N E+       +EH+
Sbjct  1201  S-INSIYGDLKLNDSPSHGGGSVVF-DGKFSLDAVHQEIDMAKNKNHEK------DAEHN  1252

Query  638   EPPVPKDALSYQQGSSSTSCNGDKTL-ETRLGLENAVNKSPLERAPSAGSILSDKIDCAW  814
                           S+S S N    L E  LG+  A++  P    PS    LS+ +D  W
Sbjct  1253  L-------------SNSKSINDQSNLLEPELGVCRALSDGPFPVIPS----LSETLDAKW  1295

Query  815   TGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERIS  994
             TG + S   +Q   S    +  +A        D+ T    K    +Y        Q    
Sbjct  1296  TGENHSGYGIQKDNSSVNPDILMA--------DALTTSAQK---EIYYLGDRTEDQ----  1340

Query  995   KRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS  1174
                          K      D  + +  P  N     ++ L    QK + L   +  + S
Sbjct  1341  -------------KGHDNMEDSSSWLGMPFLNFYRQFNKNLFASTQKFDTLVDYNPVYVS  1387

Query  1175  --HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGW  1348
                   L  GARL++P  G  + VI VYD+EP+SII+YAL S EY   +TD     EG  
Sbjct  1388  CFRKQELLGGARLLLPI-GVNETVIPVYDDEPSSIIAYALMSPEYHLQLTD-----EGER  1441

Query  1349  GVSDTNKESPIASKLSTWQRFGSLD------------LDYMHFGSYGSEDASGRIGFLFS  1492
                     S   S   T Q F S+D            ++ M F   GS ++S     L++
Sbjct  1442  PREGNEFISSYFSDSGTLQSFSSVDETAFDSQKSFGSIEEMIFSMSGSRNSSILDPMLYT  1501

Query  1493  DPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWS  1672
                 + H R+SF  +     GKVK+SVTCY+AK+F+ALR+ CCPSELD+IRSLSRCK+W 
Sbjct  1502  K---AMHARVSFGVDG--PLGKVKYSVTCYYAKRFEALRRVCCPSELDYIRSLSRCKKWG  1556

Query  1673  AQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGI  1852
             AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +F P+YF+YL++S  +GSPTCLAK++GI
Sbjct  1557  AQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFGPEYFKYLSESIGTGSPTCLAKILGI  1616

Query  1853  YQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNF  2029
             YQV  KHLKGGKE++MD++VMENL + R+++R+YDLKGS RSRYN+D T  NKVLLD N 
Sbjct  1617  YQVTSKHLKGGKESRMDVLVMENLLFRRTVTRLYDLKGSSRSRYNADSTGKNKVLLDQNL  1676

Query  2030  LESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMR  2209
             +E++ T PIF+G+KAKR LERAVWNDT FLA V VMDYSLLVGVDEE+ ELV+GIID+MR
Sbjct  1677  IEAMPTSPIFVGNKAKRLLERAVWNDTGFLASVDVMDYSLLVGVDEEKHELVIGIIDFMR  1736

Query  2210  QYTWDKHLETW  2242
             QYTWDKHLETW
Sbjct  1737  QYTWDKHLETW  1747



>ref|XP_002867192.1| hypothetical protein ARALYDRAFT_491361 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43451.1| hypothetical protein ARALYDRAFT_491361 [Arabidopsis lyrata subsp. 
lyrata]
Length=1755

 Score =   499 bits (1285),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 318/771 (41%), Positives = 439/771 (57%), Gaps = 82/771 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPP+ LEFN+++ Q W+ KE  E+++KA+ L+ 
Sbjct  970   RDCLRFYGFGRMVACFRYASINIFAVFLPPAKLEFNNEN-QEWLQKESKEVIKKAEVLFN  1028

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K    G   +  N +   + EL  +L  ++K Y   L Q  +    ++G
Sbjct  1029  EVQEALSQISLKTMGTGSKGSTPNKIKLSLEELAGLLEQRKKEYKESLQQMLN--VVKDG  1086

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q TID+L +N+LR  +L D +AWD  L    S+  NN+S + P+N+ S         + +
Sbjct  1087  QPTIDILLINKLRRLILFDSYAWDECLARAASMVRNNYS-EAPKNSAS---------KVM  1136

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTS----CNGD  706
              ++ SLE   +E +   P+      + L  + +         S+   S   +       D
Sbjct  1137  GRNVSLEKLSDEKLKSIPSHVASSNDSLLQDAEYETCRNQGKSFADTSGKFAIPEDVGPD  1196

Query  707   KTLETRL-------GLENAVNKSPLERAPSA-----GSILSDKIDCAWTGIDPSSQDMQV  850
                E R+       G +N V  S + +A  +      + LSD +D AW G          
Sbjct  1197  IPPECRMEFDPSEGGKDNFVESSQVVKAVHSESQYQATDLSDTLDAAWIG---------E  1247

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
               +L+ G  R  S    ++       RL       +F       E  ++   PSPS+  +
Sbjct  1248  QTTLENGISRPPSRAASTNGTQIPDLRLLGSESELNFKGGPTNDEHTTQVQLPSPSFYYS  1307

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLM  1210
             L   ++    ++++                  A+   +  SS       +     GARL+
Sbjct  1308  LNKNYSLNTRKHIM------------------AEDRPVYVSSYRELEWRS-----GARLL  1344

Query  1211  VPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT--DKP---YMSEGGWGVSDTNKES  1375
             +P  G  D+V+ VYD+EPTSII+YAL+S EYK  ++  DK      S G + + D+    
Sbjct  1345  LPL-GCNDLVLPVYDDEPTSIIAYALTSSEYKAQMSGSDKSRDRLDSGGSFSLFDSVNLL  1403

Query  1376  PIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSP-HPRISFEDESCNTG  1552
              + S             D     S   E  S     L S   L   H R+SF DE     
Sbjct  1404  SLNSLSDLSV-------DMSRSLSSADEQVSQ---LLHSSLYLKDLHARVSFTDE--GPP  1451

Query  1553  GKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFII  1732
             GKVK+SVTCY+AK+F+ALR  CCPSE DFIRSL RC++W AQGGKSNV+FAKSLD+RFII
Sbjct  1452  GKVKYSVTCYYAKEFEALRMICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKSLDDRFII  1511

Query  1733  KQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIV  1912
             KQ+ KTEL+SF +F P YF+YLT+S S+ SPT LAK++GIYQV+ KHLKGGKE KMD++V
Sbjct  1512  KQVTKTELESFIKFGPAYFKYLTESISTKSPTSLAKILGIYQVSSKHLKGGKEFKMDVLV  1571

Query  1913  MENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLE  2089
             MENL + R+ +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR LE
Sbjct  1572  MENLLFKRNFTRLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRLLE  1631

Query  2090  RAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             RAVWNDTSFLA ++VMDYSLLVGVDEER ELVLGIID+MRQYTWDKHLETW
Sbjct  1632  RAVWNDTSFLASIHVMDYSLLVGVDEERNELVLGIIDFMRQYTWDKHLETW  1682



>ref|XP_002277309.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Vitis vinifera]
 ref|XP_010656078.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Vitis vinifera]
Length=1865

 Score =   500 bits (1288),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 330/793 (42%), Positives = 446/793 (56%), Gaps = 70/793 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACF Y+ ID+ SV LPP  LEFNS   Q WI KE  E+  +A+ L+ 
Sbjct  1029  RDCLRFYGFGGMVACFCYASIDVHSVYLPPPKLEFNSDI-QEWIQKEADEVHNRAEQLFT  1087

Query  182   EISSAVQKLEEKCASVGCDWNNMNGL------HNCILELKDMLMKEK-----NYWNDLHQ  328
             E+  A++++ EK +       +++G+      HN I EL+ ML KEK     + WN LH+
Sbjct  1088  EVYKALRQILEKTSGT----ESLDGMKAPESRHN-IAELEVMLEKEKGEFEESLWNALHR  1142

Query  329   PTHEETSEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCI  508
                    + GQ  +D+LE+NRL+  L+   + WD RL Y  S+  NN  +    + +   
Sbjct  1143  EV-----KAGQPAVDILEINRLQRQLVFHSYVWDQRLIYAASLGSNNLQAGLSSSTLKLK  1197

Query  509   NPGEWGGETIFKDGSLEHAYEE-NVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSS  685
                    E +        A +  + H+    +  P   L+      PV + +  ++    
Sbjct  1198  EKPLTSVEKVVDMNVTSKAGKGFSSHDLILLDMNPNIVLNLGGKVGPVSQPSRVHKGKDM  1257

Query  686   STSCNGDKTLETRLGLENAVN--KSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHAS  859
                 N  K  E  L   + VN    P+E       +LSD       G DP      V   
Sbjct  1258  DQGLNNRKEAEICLSSSSNVNDQSDPVESGKIVRRVLSD-------GQDPVESRNLVRRV  1310

Query  860   LQEGERRV---------ASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLP--  1006
             L +G   +         A++   SH  S T K             +L   E ++  L   
Sbjct  1311  LSDGHFPIMGNLSDTLDAAWAGESHAGSKTSKENGYLCADTVVVESLATVEPVAADLEME  1370

Query  1007  PSPSYLSTLKSFHAYGDYRNM------------IRDPVSNIQMICSQALPREAQKLNLLP  1150
                ++ S ++  H++G   +M            +  P SN   + S+     AQKL ++ 
Sbjct  1371  NCTNHQSEVEVAHSHGSSSSMKGPEKMENSMTPVGVPFSNFSYMFSKNSSWNAQKLGIIC  1430

Query  1151  SSSTTFTSHASILPE--GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDK  1324
               +  +      L    GARL++P  G  + V+ VYD+EPTSIISYAL S +Y   V+++
Sbjct  1431  EYNPAYVLSFRELEHQGGARLLLPV-GVNETVVPVYDDEPTSIISYALVSPDYHAQVSNE  1489

Query  1325  PYMSEGGWGVSDTNKESPIASKLSTWQRFG-SLDLDYMHFGSYGSE--DASGRIGFLFSD  1495
                 E      +++   PI   L +   F  +    Y +  S        SG    L  D
Sbjct  1490  ---LERQKDSGESSVSLPIFENLLSLHSFDETASESYKNLVSTDENILSLSGSRSSLVLD  1546

Query  1496  PKLSP---HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKR  1666
             P L     H R+SF D+   + GKVK++VTCY+AKQF ALRK CCPSELDFIRSLSRCK+
Sbjct  1547  PLLYTKDFHARVSFTDD--GSLGKVKYTVTCYYAKQFYALRKTCCPSELDFIRSLSRCKK  1604

Query  1667  WSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVV  1846
             W AQGGKSNV+FAK+LD+RFIIKQ+ K EL+SF +FAP YF+YL++S S+GSPTCLAK++
Sbjct  1605  WGAQGGKSNVFFAKTLDDRFIIKQVTKIELESFIKFAPAYFKYLSESISTGSPTCLAKIL  1664

Query  1847  GIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDL  2023
             GIYQV  K LKGGKE+KMD++VMENL Y R+I+R+YDLKGS RSRYN D+  +NKVLLD 
Sbjct  1665  GIYQVTSKQLKGGKESKMDVLVMENLLYRRNITRLYDLKGSSRSRYNPDSSGSNKVLLDQ  1724

Query  2024  NFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDY  2203
             N +E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGIID+
Sbjct  1725  NLIEAMPTSPIFVGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELVLGIIDF  1784

Query  2204  MRQYTWDKHLETW  2242
             MRQYTWDKHLETW
Sbjct  1785  MRQYTWDKHLETW  1797



>ref|XP_010432594.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A 
isoform X5 [Camelina sativa]
Length=1737

 Score =   498 bits (1283),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 317/761 (42%), Positives = 434/761 (57%), Gaps = 85/761 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPPS LEFN Q+ Q W+ KE  E+++KA+ L+ 
Sbjct  974   RDCLRFYGFGRMVACFRYASINIYAVFLPPSKLEFNYQN-QEWLQKESKEVIQKAEVLFN  1032

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K    G   +  N +   + EL  +L  ++K Y   L Q       ++G
Sbjct  1033  EVQEALGQISAKTMDAGSKGSTPNKIKLSLEELAGLLEQRKKEYKESLQQML--SVFKDG  1090

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q TID+L +N+LR  +L D +AWD  L    S+   N+S + P N+           + +
Sbjct  1091  QPTIDILLINKLRRLILFDSYAWDECLAGAASMVRYNYS-EAPRNSAP---------KVM  1140

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHD-EPPVPKDALSYQQGSSSTSCNGDKTL  715
              ++ SLE   +E +   P   +  G+      D    VP+D     + S     N  +  
Sbjct  1141  GRNVSLEKLGDEKIRSIPTHVDSSGKIAAIPEDVGSDVPQDCRMEFEPSEGGKDNFAEPA  1200

Query  716   ETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFG  895
             +          K+ L  + S  + LSD +D AW G     + +     +     R AS  
Sbjct  1201  QDV--------KTVLSESQSQATDLSDTLDAAWIG-----EQIISDNGISRPPSRAASAN  1247

Query  896   QLSHVDSPTCKRLKSPARVYSFDSALRIQ------ERISKRLPPSPSYLSTLKSFHAYGD  1057
             ++   D           R+   +S L I+      E  ++   PSPS+  +L   ++   
Sbjct  1248  EIQIPD----------LRLLGSESGLNIKGVPTSDEHTTQVQMPSPSFYYSLNKNYSLNS  1297

Query  1058  YRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDV  1237
              ++++                  A+   +  SS       +     GARL++P  G  D+
Sbjct  1298  RKHIM------------------AEDRPVYVSSYRELEWRS-----GARLLLPL-GVNDL  1333

Query  1238  VIAVYDNEPTSIISYALSSKEYKDWVT--DKP---YMSEGGWGVSDTNKESPIASKLSTW  1402
             V+ VYD+EPTSII+YAL+S EYK  ++  DK      S G + + D+     + S     
Sbjct  1334  VLPVYDDEPTSIIAYALTSSEYKAQMSGSDKSRDRLDSGGSFSLFDSVNLLSLNSLSDLS  1393

Query  1403  QRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCY  1582
                     D     S   E  S  +        L  H R+SF DE     GKVK+SVTCY
Sbjct  1394  V-------DMSRSLSSADEQVSQLLQSSLYLKDL--HARVSFTDE--GPPGKVKYSVTCY  1442

Query  1583  FAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDS  1762
             +AK+F+ALRK CCPSE DFIRSL RC++W AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+S
Sbjct  1443  YAKEFEALRKICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKSLDDRFIIKQVTKTELES  1502

Query  1763  FEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSI  1942
             F +F P YF+YLT+S S+ SPT LAK++GIYQV+ KHLKGGKE KMD++VMENL + R+ 
Sbjct  1503  FIKFGPAYFKYLTESISTKSPTSLAKILGIYQVSSKHLKGGKEFKMDVLVMENLLFKRNF  1562

Query  1943  SRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFL  2119
             +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR LERAVWNDTSFL
Sbjct  1563  TRLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRLLERAVWNDTSFL  1622

Query  2120  AGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             A ++VMDYSLLVGVDEER ELVLGIID+MRQYTWDKHLETW
Sbjct  1623  ASIHVMDYSLLVGVDEERNELVLGIIDFMRQYTWDKHLETW  1663



>ref|XP_010656079.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X2 [Vitis vinifera]
Length=1843

 Score =   499 bits (1286),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 331/792 (42%), Positives = 444/792 (56%), Gaps = 90/792 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACF Y+ ID+ SV LPP  LEFNS   Q WI KE  E+  +A+ L+ 
Sbjct  1029  RDCLRFYGFGGMVACFCYASIDVHSVYLPPPKLEFNSDI-QEWIQKEADEVHNRAEQLFT  1087

Query  182   EISSAVQKLEEKCASVGCDWNNMNGL------HNCILELKDMLMKEK-----NYWNDLHQ  328
             E+  A++++ EK +       +++G+      HN I EL+ ML KEK     + WN LH+
Sbjct  1088  EVYKALRQILEKTSGT----ESLDGMKAPESRHN-IAELEVMLEKEKGEFEESLWNALHR  1142

Query  329   PTHEETSEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCI  508
                    + GQ  +D+LE+NRL+  L+   + WD RL Y  S+  NN  +          
Sbjct  1143  EV-----KAGQPAVDILEINRLQRQLVFHSYVWDQRLIYAASLGSNNLQA----------  1187

Query  509   NPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSS  688
               G        K+  L     E V +   + +  G+         PV + +  ++     
Sbjct  1188  --GLSSSTLKLKEKPLTSV--EKVVDMNVTSKAGGK-------VGPVSQPSRVHKGKDMD  1236

Query  689   TSCNGDKTLETRLGLENAVN--KSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASL  862
                N  K  E  L   + VN    P+E       +LSD       G DP      V   L
Sbjct  1237  QGLNNRKEAEICLSSSSNVNDQSDPVESGKIVRRVLSD-------GQDPVESRNLVRRVL  1289

Query  863   QEGERRV---------ASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLP--P  1009
              +G   +         A++   SH  S T K             +L   E ++  L    
Sbjct  1290  SDGHFPIMGNLSDTLDAAWAGESHAGSKTSKENGYLCADTVVVESLATVEPVAADLEMEN  1349

Query  1010  SPSYLSTLKSFHAYGDYRNM------------IRDPVSNIQMICSQALPREAQKLNLLPS  1153
               ++ S ++  H++G   +M            +  P SN   + S+     AQKL ++  
Sbjct  1350  CTNHQSEVEVAHSHGSSSSMKGPEKMENSMTPVGVPFSNFSYMFSKNSSWNAQKLGIICE  1409

Query  1154  SSTTFTSHASILPE--GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKP  1327
              +  +      L    GARL++P  G  + V+ VYD+EPTSIISYAL S +Y   V+++ 
Sbjct  1410  YNPAYVLSFRELEHQGGARLLLPV-GVNETVVPVYDDEPTSIISYALVSPDYHAQVSNE-  1467

Query  1328  YMSEGGWGVSDTNKESPIASKLSTWQRFG-SLDLDYMHFGSYGSE--DASGRIGFLFSDP  1498
                E      +++   PI   L +   F  +    Y +  S        SG    L  DP
Sbjct  1468  --LERQKDSGESSVSLPIFENLLSLHSFDETASESYKNLVSTDENILSLSGSRSSLVLDP  1525

Query  1499  KLSP---HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRW  1669
              L     H R+SF D+   + GKVK++VTCY+AKQF ALRK CCPSELDFIRSLSRCK+W
Sbjct  1526  LLYTKDFHARVSFTDD--GSLGKVKYTVTCYYAKQFYALRKTCCPSELDFIRSLSRCKKW  1583

Query  1670  SAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVG  1849
              AQGGKSNV+FAK+LD+RFIIKQ+ K EL+SF +FAP YF+YL++S S+GSPTCLAK++G
Sbjct  1584  GAQGGKSNVFFAKTLDDRFIIKQVTKIELESFIKFAPAYFKYLSESISTGSPTCLAKILG  1643

Query  1850  IYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLN  2026
             IYQV  K LKGGKE+KMD++VMENL Y R+I+R+YDLKGS RSRYN D+  +NKVLLD N
Sbjct  1644  IYQVTSKQLKGGKESKMDVLVMENLLYRRNITRLYDLKGSSRSRYNPDSSGSNKVLLDQN  1703

Query  2027  FLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYM  2206
              +E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGIID+M
Sbjct  1704  LIEAMPTSPIFVGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEKHELVLGIIDFM  1763

Query  2207  RQYTWDKHLETW  2242
             RQYTWDKHLETW
Sbjct  1764  RQYTWDKHLETW  1775



>ref|XP_009766171.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009766172.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Nicotiana sylvestris]
Length=1794

 Score =   499 bits (1284),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 318/772 (41%), Positives = 443/772 (57%), Gaps = 65/772 (8%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+PI + SV LPP  LEF S     WI KE  E+  +A +L+A
Sbjct  999   RDCLRFYGFGTMVACFRYAPIGVYSVFLPPPKLEF-SHDNHEWIQKEGDEVHSRANALFA  1057

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+S A+    EK  SV       N +   I+ ++++L KEK  +  L         + GQ
Sbjct  1058  EVSKALHAKLEK-ISVDSSLKAPN-ISEQIVAMEEILEKEKTEFEGLLCRALSGEVKVGQ  1115

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQ---HPENAVSCINPGEWGGE  532
               +D+LE+NRLR  L+   + WD RL ++ S    N  +Q    P+    C +  E   E
Sbjct  1116  PAVDILEINRLRRQLVFHAYLWDRRLIHLSSSHGKNSQTQGSLTPQLKEKCFSSSEELSE  1175

Query  533   --TIFKDG----SLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVP------KDALSYQQ  676
               TI + G    S +   +    E  ++E    +  H  H+   +       KDA  +  
Sbjct  1176  RNTIPRPGKSLGSCDSVLQNVKTEITSNEGRDSQIPHGVHERLNIDENLSRGKDAEVF--  1233

Query  677   GSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHA  856
               S  +  G   LE    + + ++     + PS  S LSD +D AWTG        + H 
Sbjct  1234  -CSIRTTGGGNVLEPGKNVRSVLSDG---KFPSVES-LSDTLDAAWTG--------EGHL  1280

Query  857   SLQEGERRVASFGQLSHVDSPTCKRLKSPARVYS--FDSALRIQERISKRLPPSPSYLST  1030
             +++E     ++F     VDS     + + + V       +  +   +S +   +  YL T
Sbjct  1281  AIKEHN---SAFPDSFLVDSSALTGVAANSDVERSMCGKSGAVTPHLSAK-SDNADYL-T  1335

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLM  1210
               + H    YR+  ++  S+ Q +             L   +    +S + +L +G   +
Sbjct  1336  WATAHFSNFYRSFNKNITSDPQFVG-----------KLGEHNPVYISSFSELLHQGGARL  1384

Query  1211  VPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASK  1390
             +   G  D+V+ VYD+EPTSIISYAL S +Y + ++D+P   +       ++   P    
Sbjct  1385  LMAVGVSDIVVPVYDDEPTSIISYALVSPDYHNQMSDEPQNLKD----HKSSASLPFLDS  1440

Query  1391  LSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSP-------HPRISFEDESCNT  1549
             L+        ++      S+G  D S    F   +  + P       H RISF D+    
Sbjct  1441  LNLLSHSSVDEVVSNSSRSFGFTDESMPSSFSSRNSNMDPPAYINALHARISFSDD--GP  1498

Query  1550  GGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFI  1729
              GKVK++VTCY+AK F+ LRK CCP ELDFIRSLSRCK+W AQGGKSNV+FAK+LD+RFI
Sbjct  1499  LGKVKYTVTCYYAKHFETLRKSCCPYELDFIRSLSRCKKWGAQGGKSNVFFAKTLDDRFI  1558

Query  1730  IKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLI  1909
             IKQ+ KTELDSF +FAP YF+YL++S +SGSPTCLAK++GIYQV  KHLKGGKE++MD++
Sbjct  1559  IKQVTKTELDSFIKFAPAYFKYLSESIASGSPTCLAKILGIYQVTSKHLKGGKESRMDVL  1618

Query  1910  VMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSL  2086
             VMENL + R+I+++YDLKGS RSRYN D+  +NKVLLD N +E++ T PIF+G+KAKR L
Sbjct  1619  VMENLLFKRNITKLYDLKGSSRSRYNPDSSGSNKVLLDQNLIEAMPTSPIFVGTKAKRLL  1678

Query  2087  ERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
              RAVWNDTSFLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1679  LRAVWNDTSFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1730



>emb|CDX68958.1| BnaC01g04950D [Brassica napus]
Length=1694

 Score =   497 bits (1280),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 315/773 (41%), Positives = 439/773 (57%), Gaps = 112/773 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPP+ LEFN ++ Q W+ KE  E++ KA+ L+ 
Sbjct  933   RDCLRFYGFGKMVACFRYASINIFAVSLPPAKLEFNCEN-QDWLQKESKEVINKAEVLFN  991

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K      D   ++     + EL  +L  ++K Y   L Q      S++G
Sbjct  992   EVQEALSQISVKTMGSIPDKIKLS-----LEELAGLLEQRKKEYKESLQQML--SVSKDG  1044

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q T+D+L +N+LR  +L D +AWD  L    S+  NN+S     ++           + +
Sbjct  1045  QPTVDILLINKLRRLILFDSYAWDECLTGAASMVRNNYSEALRTSS----------SKVM  1094

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDA---LSYQQGSSSTSCNGDK  709
              +D SLE   +E      +S +              +P+DA    S ++G S +  +G  
Sbjct  1095  GRDVSLEKLRDEKEKSIASSNDS-------------LPQDAEYDKSLKKGKSFSDISGKG  1141

Query  710   TLETRLG-----------LENAVNKSPLERA------PSAGSILSDKIDCAWTGIDPSSQ  838
             T+   +G            EN V  S + +A        A + LSD +D AW G   +S+
Sbjct  1142  TIPEDVGSDIPSESSEGGKENVVEPSQVVKAILSESQTQATTDLSDTLDAAWIGEQTASE  1201

Query  839   DMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPS  1018
             +      +     R AS       D           ++   +S L  +E+  +   PSPS
Sbjct  1202  N----NGISRPPSRAASANGTQSYD----------LKLSDSESGLTFEEQTMQVQMPSPS  1247

Query  1019  YLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEG  1198
             +  +L   ++    ++++                  A+   +  SS       +     G
Sbjct  1248  FYYSLNKNYSLNSRKHIM------------------AEDRPVYVSSYRELEWQS-----G  1284

Query  1199  ARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESP  1378
             ARL++P  G  D+V+ VYD+EPTSII+YAL+S EY   +             S ++K   
Sbjct  1285  ARLLLPL-GINDLVLPVYDDEPTSIIAYALTSSEYNAQM-------------SGSDKARD  1330

Query  1379  IASKLSTWQRFGSLDLDYMH----FGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCN  1546
                   ++  F S++L  ++    F S   E  S  +        L  H RISF DES  
Sbjct  1331  RLDSGGSFSLFDSVNLLSLNSLSDFLSSADEQVSQLLQSSLYLKDL--HARISFTDES--  1386

Query  1547  TGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERF  1726
               GKVK++VTCY+AK+F+ALRK CCPSE DFIRSL RC++W AQGGKSNV+FAK+LD+RF
Sbjct  1387  PPGKVKYAVTCYYAKEFEALRKICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKTLDDRF  1446

Query  1727  IIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDL  1906
             IIKQ+ KTEL+SF +FAP YF+YLTDS  + SPT LAK++GIYQV+ KH KGGKE KMD+
Sbjct  1447  IIKQVTKTELESFIKFAPAYFKYLTDSICTKSPTSLAKILGIYQVSSKHFKGGKEFKMDV  1506

Query  1907  IVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRS  2083
             +VMENL + R+ +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR 
Sbjct  1507  LVMENLLFQRNFARLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRL  1566

Query  2084  LERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LERAVWNDTSFLA ++VMDYSLLVGVDEER ELVLG ID+MRQYTWDKHLETW
Sbjct  1567  LERAVWNDTSFLASIHVMDYSLLVGVDEERSELVLGTIDFMRQYTWDKHLETW  1619



>ref|XP_006426793.1| hypothetical protein CICLE_v10027324mg, partial [Citrus clementina]
 gb|ESR40033.1| hypothetical protein CICLE_v10027324mg, partial [Citrus clementina]
Length=1812

 Score =   498 bits (1282),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 324/792 (41%), Positives = 454/792 (57%), Gaps = 98/792 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L+F ++  Q WI KE  E++ +A+ L++
Sbjct  1024  RDCLRFYGFGKMVACFRYASIDVHSVYLPPHKLDFINEY-QEWIQKEADEVVSQAELLFS  1082

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ + +  + +K   VG +      L + I+EL+ ML +EK  + +  Q      + +GQ
Sbjct  1083  EVLNNLSPILDK--KVGPE------LRHQIVELEGMLQREKAEFEESVQKALSREASKGQ  1134

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMES--IFDNNFSSQHPENAVSCINPGEWGGET  535
               ID+LE+NRLR  LL     WDHRL Y  +  I  N   S+  +            GE 
Sbjct  1135  PVIDILEINRLRRQLLFQSFLWDHRLVYAANLDIDSNGLKSEISKQ-----------GEK  1183

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTL  715
             I   G  E   + NV   P +     + L ++     + K +   + G SST+ +     
Sbjct  1184  IPTSG--EKVVQMNVLAMPETGSSFYDSLLAD---AKLDKSSDREEGGDSSTTLSDGFLQ  1238

Query  716   ETRLG-------------------------LENAVNKSPLERAPSAGSI-----LSDKID  805
             ET +G                         LE+ VN   + R  S G +     LSD ++
Sbjct  1239  ETIMGQDSNLLENDQGNISASISFCEQSGSLESEVN---VRRTLSEGQVPIVANLSDTLE  1295

Query  806   CAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQE  985
              AW G     ++ QV+ +    +  +        VDS T   +     +      ++   
Sbjct  1296  AAWMG-----ENYQVNNTYGLSDSPL--------VDSSTVAVMTEGLDLEDHKE-VQTGA  1341

Query  986   RISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTT  1165
             ++++ L P+ S     K      +     R P  N     ++     +QKL+ +   +  
Sbjct  1342  KVTQSLSPALSS----KGPDNMEEPVAWFRMPFLNFYHSLNKNFLSSSQKLDTMSGYNPI  1397

Query  1166  FTS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKD--WVTDKPYM  1333
             + S    S L  GARL +P  G  D V+ VYD+EPTSII+YAL S EY     V D    
Sbjct  1398  YFSSFRDSELKGGARLFLPV-GVNDTVVPVYDDEPTSIIAYALVSTEYHVGLMVDDGEKT  1456

Query  1334  SEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDP  1498
              EGG    D      ++  ++      + +L    + S GS D      SG    L  DP
Sbjct  1457  KEGG----DVMSSFSLSDSVNLQSHLSADELTLDLYRSLGSTDESILSLSGSRSSLILDP  1512

Query  1499  ---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRW  1669
                  + HP++SF+D+     G+VK+SVTCY+A++F+ALRK CCPSELD++RSLSRCK+W
Sbjct  1513  LSYTKAFHPKVSFKDD--GPLGQVKYSVTCYYARRFEALRKICCPSELDYVRSLSRCKKW  1570

Query  1670  SAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVG  1849
              A+GGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF+YL++S S+GSPTCLAK++G
Sbjct  1571  GAKGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPEYFKYLSESISTGSPTCLAKILG  1630

Query  1850  IYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLN  2026
             IYQV  KHLKGG+E+KMD++VMENL + RS++++YDLKGS RSRYN D+  +NKVLLD N
Sbjct  1631  IYQVTTKHLKGGRESKMDVLVMENLLFSRSVTQLYDLKGSSRSRYNPDSSGSNKVLLDQN  1690

Query  2027  FLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYM  2206
              +E++ T PIF+G+KAKR LERAVWNDT+FLA + VMDYSLLVGVDEE  +LVLGIID+M
Sbjct  1691  LIEAMPTSPIFVGNKAKRLLERAVWNDTAFLASIDVMDYSLLVGVDEENHQLVLGIIDFM  1750

Query  2207  RQYTWDKHLETW  2242
             RQYTWDKHLETW
Sbjct  1751  RQYTWDKHLETW  1762



>ref|XP_006282992.1| hypothetical protein CARUB_v10003977mg [Capsella rubella]
 gb|EOA15890.1| hypothetical protein CARUB_v10003977mg [Capsella rubella]
Length=1757

 Score =   497 bits (1280),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 317/779 (41%), Positives = 440/779 (56%), Gaps = 97/779 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPP+ LEFN ++ Q W+ KE  E+++KA+ L+ 
Sbjct  970   RDCLRFYGFGRMVACFRYASINIYAVFLPPAKLEFNYEN-QEWLQKESKEVIKKAEVLFN  1028

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+  A+ ++  K    G + +  N +   + EL  +L + K  + +  Q      S++GQ
Sbjct  1029  EVQEALSQISAKTMRAGSNGSTPNKIKLSLEELGGLLEQRKEEYKESLQ-QMLSVSKDGQ  1087

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              TID+L +N+LR  +L D +AWD  L    S+  NN+S + P N            + + 
Sbjct  1088  PTIDILLINKLRRLILFDSYAWDECLAGAASMVRNNYS-EAPRNPAP---------KVMG  1137

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGL--HSEHD---EPPVPKDALSYQQGSSSTSCNGD  706
             ++ SLE   +E +   P S     + +   +E+D   +   P   LS +  +       D
Sbjct  1138  RNISLEELGDEKIRSTPTSVASSNDSILQDAEYDTCLKQGKPFADLSGKIAAIPEHVGSD  1197

Query  707   KTLETRLGLE------------NAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV  850
                + R+  E            + V K+ L  + S  + LSD +D AW G     +   +
Sbjct  1198  IPPDCRIDFEPREGGKDNFLEPSQVVKTVLSESQSQATDLSDTLDAAWIG-----EQTTL  1252

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
               S+     R AS  +    D     RL       +  S     E+ ++   PSPS+  +
Sbjct  1253  ENSISRPPSRAASANETQIPD----LRLLGSESGMNIKSGPTSDEQTTQVQMPSPSFYYS  1308

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLM  1210
             L   ++    ++++                  A+   +  SS       +     GARL+
Sbjct  1309  LNKNYSLNSRKHIM------------------AEDRPVYVSSYRELEWRS-----GARLL  1345

Query  1211  VPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASK  1390
             +P  G  D+V+ VYD+EPTSII+YAL+S EYK  ++            SD +++     +
Sbjct  1346  LPL-GVNDLVLPVYDDEPTSIIAYALTSSEYKAQMSG-----------SDKSRD-----R  1388

Query  1391  LSTWQRFGSLDL--------------DYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISF  1528
             L +   F   D               D     S   E  S  +        L  H R+SF
Sbjct  1389  LDSGGSFSLFDSVNLLSLNSLSDLSVDMSRSLSSADEQVSQLLQSSLYMKDL--HARVSF  1446

Query  1529  EDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAK  1708
              DE     GKVK+SVTCY+AK+F+ALRK CCPSE DFIRSL RC++W AQGGKSNV+FAK
Sbjct  1447  TDE--GPPGKVKYSVTCYYAKEFEALRKICCPSETDFIRSLGRCRKWGAQGGKSNVFFAK  1504

Query  1709  SLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGK  1888
             SLD+RFIIKQ+ KTEL+SF +F P YF+YLT+S S+ SPT LAK++GIYQV+ KHLKGGK
Sbjct  1505  SLDDRFIIKQVTKTELESFIKFGPAYFKYLTESISTKSPTSLAKILGIYQVSSKHLKGGK  1564

Query  1889  ETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLG  2065
             E KMD++VMENL + R+ +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+G
Sbjct  1565  EFKMDVLVMENLLFKRNFTRLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVG  1624

Query  2066  SKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             SKAKR LERAVWNDTSFLA ++VMDYSLLVGVDEER ELVLGIID+MRQYTWDKHLETW
Sbjct  1625  SKAKRLLERAVWNDTSFLASIHVMDYSLLVGVDEERNELVLGIIDFMRQYTWDKHLETW  1683



>ref|XP_010487226.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Camelina sativa]
Length=1781

 Score =   497 bits (1280),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 322/768 (42%), Positives = 458/768 (60%), Gaps = 73/768 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+ ID+ SV LPPS+L FN ++ Q WI +E  E++ +A+ L++
Sbjct  998   RDCLRFYGFGNMVACFRYATIDVHSVYLPPSILSFNYEN-QDWIQRETDEVIERAELLFS  1056

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEK-NYWNDLHQPTHEETSEEG  358
             E+ +A+ ++ EK            G    I EL+++L +EK  +  ++ +  H E  +EG
Sbjct  1057  EVLNAISQIAEK------------GFRRRIGELEEVLQREKAEFEENMRKMLHRE-GKEG  1103

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRL------YYMESIFDNNFSSQHPENAVSCINPGE  520
             Q  +D+LEL R+R  LL   + WDHRL      + +E+  D     + P  A S   P  
Sbjct  1104  QPLVDILELYRIRRQLLFQSYMWDHRLINASTLHKLENSDDTKRDFEKPPLAKSQTLP--  1161

Query  521   WGGETIFKDGSLEHAYEENVHEFPNSEECPGE--GLHSEHDEPPVPKDALSYQQGSSSTS  694
                E   ++ SL    E N++  P+ +  PG+   LH+   E     D    Q+      
Sbjct  1162  ---EMNAENNSLLTGSEVNLN--PDGDS-PGDTGSLHNVQKEADTNPDL--NQEKDDGGE  1213

Query  695   CNGDKTL-ETRLGLENAVNKSPLERAPSAGSI----LSDKIDCAWTGIDPSSQDMQVHAS  859
              +  KTL +T   LEN ++   + R  S G I    LS  +D AW G   +S ++ V+  
Sbjct  1214  VSPSKTLPDTSCPLENKLD---VRRTQSDGQIVMKNLSATLDAAWIGERQTSVEIPVNNK  1270

Query  860   LQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKS  1039
             +      +++F     + S   K +  P +   F  A           P SP+ LS  K+
Sbjct  1271  VLLPPSSMSNFSTFPPI-SEGLKPINLPEQQNEFKVAY----------PVSPAVLS--KN  1317

Query  1040  FHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGARLMV  1213
             +    D  + +  P  N     ++     +QKL+     S  + S    + L  G RL++
Sbjct  1318  YENSEDSVSWLSVPFLNFYRSINKNFLLSSQKLDKFGEHSPIYISSFREAELQGGPRLLL  1377

Query  1214  PENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVS---DTNKESPIA  1384
             P  G  D+V+ VYD+EPTS+I+YAL S EY+   +      EG   VS   + N   P+ 
Sbjct  1378  PV-GLNDIVVPVYDDEPTSMIAYALMSPEYQRQTS-----VEGESLVSYPSELNIPRPVD  1431

Query  1385  SKLSTWQRF-GSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKV  1561
               +    R  GS+D + +   S     +      L++    + H R+S+ ++   T GKV
Sbjct  1432  DTIFDPSRSNGSVD-ESILSMSSSRSSSLLLDPLLYTK---ALHARVSYGED--GTLGKV  1485

Query  1562  KFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQM  1741
             K++VTCY+AK+F+ALR  C PSEL+FIRSLSRCK+W AQGGKSNV+FAK+LD+RFIIKQ+
Sbjct  1486  KYTVTCYYAKRFEALRGICLPSELEFIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIIKQV  1545

Query  1742  QKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMEN  1921
              KTEL+SF +FAP YF+YL++S S+ SPTCLAK++GIYQVA K LK GKETKMD+++MEN
Sbjct  1546  TKTELESFIKFAPAYFKYLSESISTKSPTCLAKILGIYQVATKQLKSGKETKMDVLIMEN  1605

Query  1922  LFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAV  2098
             L +GR++ R+YDLKGS R+RYN D+  +NKVLLD N +E++ T PIF+G+KAKR LERAV
Sbjct  1606  LLFGRTVKRLYDLKGSSRARYNPDSSGSNKVLLDQNLIEAMPTCPIFVGNKAKRLLERAV  1665

Query  2099  WNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             WNDT+FLA   VMDYSLLVGVDEE+ ELVLGIID++RQYTWDKHLE+W
Sbjct  1666  WNDTAFLALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESW  1713



>gb|KHG26950.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1 [Gossypium arboreum]
Length=1732

 Score =   496 bits (1278),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 330/798 (41%), Positives = 455/798 (57%), Gaps = 107/798 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  LEF+ +  Q WI KE  +++ +A+ L++
Sbjct  924   RDCLRFYGFGRMVACFRYASIDVHSVYLPPPKLEFDYEI-QEWIQKEKDKVVDRAEHLFS  982

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+  ++ ++ EK  S G   + +      N I EL+ +L KEK  + +  Q        +
Sbjct  983   EVLKSLNQIAEKKISKGAPNSTVKSPESRNQISELEGILQKEKLEFEESLQKALNREVRK  1042

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+LELN LR  LL   + WDHRL     +F  N  +  P++  S +  G+   +T
Sbjct  1043  GQPVIDILELNWLRRQLLFQSYMWDHRL-----VFATNLENCRPQDNFSNLISGD-EEKT  1096

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGD---  706
             +  D  L+     ++ E     EC         D  PV +      +GS     NG+   
Sbjct  1097  VTDDEKLKDV---DILEHGKGPEC--------CDLSPVDE---KLDRGSDQRELNGNADK  1142

Query  707   -----KTLETR----LGLENAVNKSP----------------LERAPSAGSI-----LSD  796
                  + LE      LG+E   + S                 + R  S G       LSD
Sbjct  1143  SDVIQRELEVSGDLSLGIEEYGSLSASQSMYDQSDCEKPTATVRRVLSEGHFPVIEDLSD  1202

Query  797   KIDCAWTG--------IDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARV  952
              ++ AWTG            S D+   A+      R+      +H +         P  +
Sbjct  1203  TLEAAWTGEIQQTVVLCKKDSCDLSDSAAAGTATERL---NLENHSEGKIV-----PKAL  1254

Query  953   YSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQ  1132
             +SF  +L    R S+ L  S S+L+    F ++  YR++ ++ + +            A 
Sbjct  1255  FSFSPSLST--RGSENLEDSISWLTM--PFLSF--YRSLNKNFLGS------------AS  1296

Query  1133  KLNLLPSSSTTFTSHASILP--EGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYK  1306
             KL+        + S    L   +GARL++P  G  D VI VY++EPTS+ISYAL+S EY 
Sbjct  1297  KLDTFSEYDPVYVSSFRELEMQDGARLLLPL-GVNDTVIPVYNDEPTSMISYALASPEYH  1355

Query  1307  DWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYM--HFGSYGSEDASGRIG  1480
               V++      G       +  + +++  ST + F S+D      H      +D SG   
Sbjct  1356  FQVSNN-----GDRHKDSGDITTSVSADSSTLRSFLSVDESTFDPHQSFSSIDDGSGSRS  1410

Query  1481  FLFSDP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSL  1651
              +  DP     + H ++SF D+   +  KVK++VTCY+AK F+ALR+ CCPSELD+IRSL
Sbjct  1411  LIM-DPLSRTKALHVQVSFGDD--GSADKVKYTVTCYYAKGFEALRRMCCPSELDYIRSL  1467

Query  1652  SRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTC  1831
             SRCK+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S SS SPTC
Sbjct  1468  SRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPGYFKYLSESISSRSPTC  1527

Query  1832  LAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANK  2008
             LAK++GIYQVA KHLKGGKETK+D++ MENL + R+ +R+YDLKGS RSRYN DT  +NK
Sbjct  1528  LAKILGIYQVATKHLKGGKETKIDVLAMENLLFRRTCTRLYDLKGSSRSRYNPDTSGSNK  1587

Query  2009  VLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVL  2188
             VLLD NF+ES+ T PIF+G+KAKR LERAVWNDT+FLA   VMDYSLLVG+DEE+ ELVL
Sbjct  1588  VLLDQNFIESMPTSPIFVGNKAKRLLERAVWNDTAFLASSDVMDYSLLVGIDEEKHELVL  1647

Query  2189  GIIDYMRQYTWDKHLETW  2242
             GIID+MRQYTWDKHLETW
Sbjct  1648  GIIDFMRQYTWDKHLETW  1665



>ref|XP_009417532.1| PREDICTED: LOW QUALITY PROTEIN: 1-phosphatidylinositol-3-phosphate 
5-kinase FAB1B-like [Musa acuminata subsp. malaccensis]
Length=1822

 Score =   498 bits (1281),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 320/765 (42%), Positives = 447/765 (58%), Gaps = 69/765 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACF+Y+ I++ SV LPP  LEFN Q  Q W+ +E  ++++ A  L+ 
Sbjct  1028  RDCLRFYGYGEMVACFKYASINVHSVYLPPPKLEFNFQ-HQKWVQEEANKVVKTANDLFI  1086

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNC--ILELKDMLMKEKNYWNDLHQPTHEETSEE  355
              +  +++++EEK  + G    NM  L +   ++EL+ +L KE+  + +  Q   ++ ++ 
Sbjct  1087  AVRKSLRQVEEKVLNTGSHDGNMEVLESRRRLIELEGILQKEQAEFEESKQTVMKKDAKM  1146

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+L++NRL+  LL   + WD RL +    F N      P   ++ +        T
Sbjct  1147  GQPFIDILDVNRLQKQLLLQSYVWDKRLKFAAGSFSN------PHELLNGLMTRNKEDLT  1200

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTL  715
             +    S       +V     +E   G G  +EHD+         Y+Q +++         
Sbjct  1201  LRAQRSF---MSSDVLVSAVAEPLNGSGTRNEHDQ---------YKQSTTN---------  1239

Query  716   ETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDP----SSQDMQVHASLQEG-ERR  880
             + RL LE   N   L    S  + +SD+ D    G+D     S     V A L +  + +
Sbjct  1240  QQRLDLEQDKNTKLL----STSTSVSDQFDPPECGLDVRRVLSDGQFPVMADLSDTLDAK  1295

Query  881   VASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGDY  1060
                    + VD    K L S     +  S+  ++E I   + P+ S  S  K+       
Sbjct  1296  WRGENGSALVDGSKLKSLTSVEEAPANSSSENLEESICTDMMPARSGESA-KAISILT--  1352

Query  1061  RNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEG-ARLMVPENGQKDV  1237
             +    D  + +   C  AL          P   + F     ++ +G ARL++P  G  D 
Sbjct  1353  KTSFSDLYAFLNKNCDSALSE------YHPEYISLFKE---LMQQGWARLLLPL-GVNDT  1402

Query  1238  VIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGS  1417
             VI VYD+EPTS ISYAL   +Y   +TD+   S+ G   S     S +  +    Q F S
Sbjct  1403  VIPVYDDEPTSAISYALVCPDYHFQITDEFEKSKDGREPSI----SLMIQESGNSQSFQS  1458

Query  1418  L-DLDYMHFGSYGSEDASGRIGF-----LFSDPKLSP---HPRISFEDESCNTGGKVKFS  1570
             + D+ +  F S+GS D S          +  DP  S    H R+SF  +  +  GKV++S
Sbjct  1459  VEDIPFESFRSFGSVDDSTSSTSGSKSSVILDPLASTKSLHVRVSFAVDGPH--GKVRYS  1516

Query  1571  VTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKT  1750
             VTCY+AK FDALR+ CCPSELDFIRSLSRCK+W AQGGKSNV+FAKSLD+RFIIKQ+ KT
Sbjct  1517  VTCYYAKYFDALRRTCCPSELDFIRSLSRCKKWGAQGGKSNVFFAKSLDDRFIIKQVTKT  1576

Query  1751  ELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFY  1930
             EL+SF +FAP+YF+YL +S S+ SPTCLAK++GIYQVAVK+LKGGKE++MD++VMENL +
Sbjct  1577  ELESFIKFAPEYFKYLLESKSTSSPTCLAKILGIYQVAVKNLKGGKESRMDVLVMENLLF  1636

Query  1931  GRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWND  2107
             GRS+  +YDLKGS RSRYN+D    NKVLLD N +E+++T PIF+G+KAKR LERAVWND
Sbjct  1637  GRSVKWLYDLKGSSRSRYNADISGNNKVLLDQNLIEAMRTSPIFVGNKAKRLLERAVWND  1696

Query  2108  TSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             T+FLA + VMDYSLLVGVDE ++ELV+GIID+MRQYTWDKHLETW
Sbjct  1697  TAFLASIDVMDYSLLVGVDENKRELVVGIIDFMRQYTWDKHLETW  1741



>ref|XP_006659465.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
[Oryza brachyantha]
Length=1801

 Score =   497 bits (1279),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 315/772 (41%), Positives = 433/772 (56%), Gaps = 84/772 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPP  L+F SQ  Q W+ +E  E++  A+ L+ 
Sbjct  1022  RDCLRFYGFGEMVACFRYASIMVHSVYLPPPKLDFTSQ-HQEWVEQEANEVVDSAELLFT  1080

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ ++ E     G    NM    L   I+EL+++L  EK  + +  +   ++   +
Sbjct  1081  EVLNALHQISEGRPITGSFDGNMKILELRRNIMELEEILQIEKADFTESLKNLLKKEIRK  1140

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+LE+N+LR  LL   + WD RL     IF  N   ++ +  +  +  G    ++
Sbjct  1141  GQPFIDILEVNKLRRQLLFLCYLWDQRL-----IFIANSGGKYCDT-LGGLQVGSRSSDS  1194

Query  536   IFKDGSLEHAYEENVHEFPNSEEC----------PGEGLHSEHDEPPVPKDALSYQQGSS  685
                D S+  +    + + P   E              G    +DE P     +S   G  
Sbjct  1195  --NDKSVGTSASTKLEKAPKGPEVLSNSKDGSLNQSSGPLHANDEEPNSSRIVSGLNGME  1252

Query  686   ST--SCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAWTGIDPSSQDM  844
              T    N   + + +  L++  +   + R  S G       +SD +D  W G + +  D 
Sbjct  1253  DTIAKINHSNSADVKDNLDHQESNIGVRRVFSDGQFPVNADISDTLDAKWRGENGTVPDT  1312

Query  845   QVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYL  1024
              +   L   E       Q   V + +   ++S   V    S L++         P   + 
Sbjct  1313  SILKPLALLEGTADLKNQAKAVAAQSSLSVRSGDTVEDLSSWLKM---------PYMKFY  1363

Query  1025  STLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGAR  1204
              +L         RN             S   P+     +  P   T F   +     GAR
Sbjct  1364  DSLN--------RN-------------SGTAPKFGALADYSPVYITLFRELSQ--QGGAR  1400

Query  1205  LMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA  1384
             L +P  G  D+VI V+D+EPTSIISYAL S  Y     D            ++NK    A
Sbjct  1401  LFLP-TGANDIVIPVFDDEPTSIISYALISPMYCFQTLD------------ESNKNKDGA  1447

Query  1385  SKLSTWQRFGSLDLDYMH-FGSYGSED-----ASGRIGFLFSDPKLSPHPRISFEDESCN  1546
               + +   + S + +  H F  +GS D      SG  G    D     H R+SFED    
Sbjct  1448  DSMLSLPVYDSGNFNPFHLFEDFGSTDDFTSSISGTRGSFVPD---LIHLRVSFEDG--G  1502

Query  1547  TGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERF  1726
               GKVK++VTCY+AK F+ALR+ CCPSE+DF+RS+SRCK+W AQGGKSNV+FAKSLD+RF
Sbjct  1503  PLGKVKYTVTCYYAKSFEALRRSCCPSEVDFLRSISRCKKWGAQGGKSNVFFAKSLDDRF  1562

Query  1727  IIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDL  1906
             IIKQ+ KTEL+SF +F   YF+YL++S S+GSPTCLAK++GIYQV +KH+KGGKE+KMDL
Sbjct  1563  IIKQVTKTELESFLKFGLDYFKYLSESISTGSPTCLAKILGIYQVTIKHVKGGKESKMDL  1622

Query  1907  IVMENLFYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNFLESLQTKPIFLGSKAKRSL  2086
             +VMENL +GR+I+R+YDLKGS RSRYN+D+ +NKVLLD N +E++ T PIF+G+KAKR L
Sbjct  1623  LVMENLLFGRNITRLYDLKGSSRSRYNADSSSNKVLLDQNLIEAMPTSPIFVGNKAKRLL  1682

Query  2087  ERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             ERAVWNDTSFLAG+ VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1683  ERAVWNDTSFLAGIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1734



>ref|XP_006344562.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X5 [Solanum tuberosum]
Length=1794

 Score =   497 bits (1279),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 327/791 (41%), Positives = 444/791 (56%), Gaps = 103/791 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+P+ + SV LPP  LEF S   Q WI KE  E+ R+A +L+A
Sbjct  999   RDCLRFYGFGKMVACFRYAPVHVYSVFLPPLKLEF-SYDNQEWIQKEGDEVRRRANALFA  1057

Query  182   EISSAVQ-KLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEG  358
             E+S  +  KLE+           ++     I E++++L KEK  +  L +       + G
Sbjct  1058  EVSKVLHVKLEKLSVDSSLKAPKIS---EQISEMEEILEKEKTEFEGLLRKALSREVKVG  1114

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             +  +D+LE+NRLR  L+   + WD RL ++        SS H +N+ +            
Sbjct  1115  EPVLDILEINRLRRQLVFHAYLWDRRLIHL--------SSSHGKNSQT------------  1154

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNG-----  703
                GSL    E+      +SEE P     S H +     D++     +  TS  G     
Sbjct  1155  --QGSLTQLKEK---PLSSSEELPERTTISRHGKSLGSYDSVLQNVKTDITSNEGRHGQI  1209

Query  704   -DKTLETRLGLENAVNKSPLE-----RAPSAGSIL---------------------SDKI  802
              D   E     EN  +    E     R+   G++L                     SD +
Sbjct  1210  PDGVHERLTTDENLTHGKDSEDICAKRSTGDGNVLEPGKNVRRVLSDAKFPSVESLSDTL  1269

Query  803   DCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
             D AWTG   S   ++ H S   G   V S   L+ V + T  +     R     +   I 
Sbjct  1270  DAAWTG--ESHLAIKEHNSAFPGSFVVDSTA-LTGVSANTDVK-----RSTGDKNGAEIP  1321

Query  983   ERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSST  1162
                +K    +  YL T  + H    YR+  ++  +N         P+   KLN    +  
Sbjct  1322  HLSAKS--DNTDYL-TWATEHFSNFYRSFNKNITAN---------PQYVAKLN--EHNPV  1367

Query  1163  TFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEG  1342
                S + +  +G   ++   G+ D+VI VYD+EPTSIISYAL S EY++       MS+ 
Sbjct  1368  YILSFSELQHQGGARLLMAVGENDIVIPVYDDEPTSIISYALVSPEYRN------QMSDE  1421

Query  1343  GWGVSDTNKESPIASKLSTWQRFGSLDLDYM---HFGSYGSEDASGRIGFLFSDPKLSP-  1510
                + + +K S   S L +        +D +      S+GS + S   G    +  + P 
Sbjct  1422  SQNLKENHKFSASLSFLDSLNLLSLHSVDEIVSESPRSFGSTNESMSSGLSSRNSNMDPP  1481

Query  1511  ------HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWS  1672
                   H RISF D+     GKVK++VTCY+AKQF+ LRK CCP E DFIRSLSRCK+W 
Sbjct  1482  AYINALHARISFSDD--GPLGKVKYTVTCYYAKQFETLRKSCCPCESDFIRSLSRCKKWG  1539

Query  1673  AQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGI  1852
             AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL+DS +SGSPTCLAK++GI
Sbjct  1540  AQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSDSIASGSPTCLAKILGI  1599

Query  1853  YQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNF  2029
             YQV  KHLKGGKE++MD++VMENL + R+I+R+YDLKGS RSRYNSD+  +NKVLLD N 
Sbjct  1600  YQVTSKHLKGGKESRMDVLVMENLLFKRNITRLYDLKGSSRSRYNSDSSGSNKVLLDQNL  1659

Query  2030  LESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMR  2209
             +E++ T PIF+G++AKR L+RAVWNDTSFLA + VMDYSLLVGVDEE++ELVLGIID+MR
Sbjct  1660  IEAMPTSPIFVGTQAKRLLQRAVWNDTSFLASIDVMDYSLLVGVDEEKQELVLGIIDFMR  1719

Query  2210  QYTWDKHLETW  2242
             QYTWDKHLETW
Sbjct  1720  QYTWDKHLETW  1730



>ref|XP_010432591.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A 
isoform X2 [Camelina sativa]
Length=1738

 Score =   496 bits (1277),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 317/761 (42%), Positives = 433/761 (57%), Gaps = 85/761 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPPS LEFN Q+ Q W+ KE  E+++KA+ L+ 
Sbjct  975   RDCLRFYGFGRMVACFRYASINIYAVFLPPSKLEFNYQN-QEWLQKESKEVIQKAEVLFN  1033

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K    G   +  N +   + EL  +L  ++K Y   L Q       ++G
Sbjct  1034  EVQEALGQISAKTMDAGSKGSTPNKIKLSLEELAGLLEQRKKEYKESLQQML--SVFKDG  1091

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q TID+L +N+LR  +L D +AWD  L    S+   N+S + P N+           + +
Sbjct  1092  QPTIDILLINKLRRLILFDSYAWDECLAGAASMVRYNYS-EAPRNSAP---------KVM  1141

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHD-EPPVPKDALSYQQGSSSTSCNGDKTL  715
              ++ SLE   +E +   P   +  G+      D    VP+D     + S     N  +  
Sbjct  1142  GRNVSLEKLGDEKIRSIPTHVDSSGKIAAIPEDVGSDVPQDCRMEFEPSEGGKDNFAEPA  1201

Query  716   ETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFG  895
             +          K+ L  + S  + L D +D AW G    S +      +     R AS  
Sbjct  1202  QDV--------KTVLSESQSQATDLYDTLDAAWIGEQTISDNC-----ISRPPSRAASAN  1248

Query  896   QLSHVDSPTCKRLKSPARVYSFDSALRIQ------ERISKRLPPSPSYLSTLKSFHAYGD  1057
             ++   D           R+   +S L I+      E  ++   PSPS+  +L   ++   
Sbjct  1249  EIQIPD----------LRLLGSESGLNIKGVPTSDEHTTQVQMPSPSFYYSLNKNYSLNS  1298

Query  1058  YRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDV  1237
              ++++                  A+   +  SS       +     GARL++P  G  D+
Sbjct  1299  RKHIM------------------AEDRPVYVSSYRELEWRS-----GARLLLPL-GVNDL  1334

Query  1238  VIAVYDNEPTSIISYALSSKEYKDWVT--DKP---YMSEGGWGVSDTNKESPIASKLSTW  1402
             V+ VYD+EPTSII+YAL+S EYK  ++  DK      S G + + D+     + S     
Sbjct  1335  VLPVYDDEPTSIIAYALTSSEYKAQMSGSDKSRDRLDSGGSFSLFDSVNLLSLNSLSDLS  1394

Query  1403  QRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCY  1582
                     D     S   E  S  +        L  H R+SF DE     GKVK+SVTCY
Sbjct  1395  V-------DMSRSLSSADEQVSQLLQSSLYLKDL--HARVSFTDE--GPPGKVKYSVTCY  1443

Query  1583  FAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDS  1762
             +AK+F+ALRK CCPSE DFIRSL RC++W AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+S
Sbjct  1444  YAKEFEALRKICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKSLDDRFIIKQVTKTELES  1503

Query  1763  FEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSI  1942
             F +F P YF+YLT+S S+ SPT LAK++GIYQV+ KHLKGGKE KMD++VMENL + R+ 
Sbjct  1504  FIKFGPAYFKYLTESISTKSPTSLAKILGIYQVSSKHLKGGKEFKMDVLVMENLLFKRNF  1563

Query  1943  SRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFL  2119
             +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR LERAVWNDTSFL
Sbjct  1564  TRLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRLLERAVWNDTSFL  1623

Query  2120  AGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             A ++VMDYSLLVGVDEER ELVLGIID+MRQYTWDKHLETW
Sbjct  1624  ASIHVMDYSLLVGVDEERNELVLGIIDFMRQYTWDKHLETW  1664



>ref|XP_010432593.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A 
isoform X4 [Camelina sativa]
Length=1737

 Score =   496 bits (1276),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 317/761 (42%), Positives = 433/761 (57%), Gaps = 85/761 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPPS LEFN Q+ Q W+ KE  E+++KA+ L+ 
Sbjct  974   RDCLRFYGFGRMVACFRYASINIYAVFLPPSKLEFNYQN-QEWLQKESKEVIQKAEVLFN  1032

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K    G   +  N +   + EL  +L  ++K Y   L Q       ++G
Sbjct  1033  EVQEALGQISAKTMDAGSKGSTPNKIKLSLEELAGLLEQRKKEYKESLQQML--SVFKDG  1090

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q TID+L +N+LR  +L D +AWD  L    S+   N+S + P N+           + +
Sbjct  1091  QPTIDILLINKLRRLILFDSYAWDECLAGAASMVRYNYS-EAPRNSAP---------KVM  1140

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHD-EPPVPKDALSYQQGSSSTSCNGDKTL  715
              ++ SLE   +E +   P   +  G+      D    VP+D     + S     N  +  
Sbjct  1141  GRNVSLEKLGDEKIRSIPTHVDSSGKIAAIPEDVGSDVPQDCRMEFEPSEGGKDNFAEPA  1200

Query  716   ETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFG  895
             +          K+ L  + S  + L D +D AW G    S +      +     R AS  
Sbjct  1201  QDV--------KTVLSESQSQATDLYDTLDAAWIGEQTISDNC-----ISRPPSRAASAN  1247

Query  896   QLSHVDSPTCKRLKSPARVYSFDSALRIQ------ERISKRLPPSPSYLSTLKSFHAYGD  1057
             ++   D           R+   +S L I+      E  ++   PSPS+  +L   ++   
Sbjct  1248  EIQIPD----------LRLLGSESGLNIKGVPTSDEHTTQVQMPSPSFYYSLNKNYSLNS  1297

Query  1058  YRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDV  1237
              ++++                  A+   +  SS       +     GARL++P  G  D+
Sbjct  1298  RKHIM------------------AEDRPVYVSSYRELEWRS-----GARLLLPL-GVNDL  1333

Query  1238  VIAVYDNEPTSIISYALSSKEYKDWVT--DKP---YMSEGGWGVSDTNKESPIASKLSTW  1402
             V+ VYD+EPTSII+YAL+S EYK  ++  DK      S G + + D+     + S     
Sbjct  1334  VLPVYDDEPTSIIAYALTSSEYKAQMSGSDKSRDRLDSGGSFSLFDSVNLLSLNSLSDLS  1393

Query  1403  QRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCY  1582
                     D     S   E  S  +        L  H R+SF DE     GKVK+SVTCY
Sbjct  1394  V-------DMSRSLSSADEQVSQLLQSSLYLKDL--HARVSFTDE--GPPGKVKYSVTCY  1442

Query  1583  FAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDS  1762
             +AK+F+ALRK CCPSE DFIRSL RC++W AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+S
Sbjct  1443  YAKEFEALRKICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKSLDDRFIIKQVTKTELES  1502

Query  1763  FEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSI  1942
             F +F P YF+YLT+S S+ SPT LAK++GIYQV+ KHLKGGKE KMD++VMENL + R+ 
Sbjct  1503  FIKFGPAYFKYLTESISTKSPTSLAKILGIYQVSSKHLKGGKEFKMDVLVMENLLFKRNF  1562

Query  1943  SRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFL  2119
             +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR LERAVWNDTSFL
Sbjct  1563  TRLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRLLERAVWNDTSFL  1622

Query  2120  AGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             A ++VMDYSLLVGVDEER ELVLGIID+MRQYTWDKHLETW
Sbjct  1623  ASIHVMDYSLLVGVDEERNELVLGIIDFMRQYTWDKHLETW  1663



>gb|KHG22978.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1 [Gossypium arboreum]
Length=1844

 Score =   497 bits (1280),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 322/777 (41%), Positives = 452/777 (58%), Gaps = 60/777 (8%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPPS LEFN  + Q WI  E  E+  +A+ L+ 
Sbjct  1027  RDCLRFYGFGRMVACFRYASIDVHSVYLPPSKLEFNYDN-QEWIQCEANEVRNRAEFLFT  1085

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHN--CILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A++K+ EK +  G     +       CI EL+ ML K++    +  Q    +  + 
Sbjct  1086  EMYNALRKISEKLSGPGSQDCGIKAPERNICIEELEAMLQKDREELQESLQEALCKELKA  1145

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNF----SSQHPENAVSCINPGEW  523
             GQ  ID+LE+N+LR  +L   + WD RL ++    +NN     SS  P+  +  +N  E 
Sbjct  1146  GQPVIDILEMNKLRRQILFLSYVWDQRLIHVCGSINNNIQEVMSSPIPKLGLKPVNSMEK  1205

Query  524   GGETIFK---DGSLEHAYEENVHEFPNSEECPG------EGLHSEHDEPPVPKDALSYQQ  676
               E         S  +     V   PN +   G      +    +H E  + +D  + ++
Sbjct  1206  LPEMNVSPKPSKSFNNCESALVETKPNIKMNQGGNAGVIDKSGGDHPEKGIGEDFNNRKE  1265

Query  677   GSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAWTGIDPSSQD  841
                S S     ++ T    ++  +   ++RA S G +     LSD ++ AWTG       
Sbjct  1266  AEPSVS----SSINTSENSDSPESGKVVQRARSEGELPIMANLSDTLEAAWTG-------  1314

Query  842   MQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSY  1021
              + H +    +    S      VD      L     V + D   R +  +++   P PS 
Sbjct  1315  -KSHPASMNSKENGYSAPDSVAVDVSGAVNLD--LGVLASD---RGEGEVTRS--PQPSL  1366

Query  1022  LST-LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPE-  1195
              +  L+S      + NM   P  N     ++      +KL++   S    +S   +  + 
Sbjct  1367  PAKKLESLEKSMSWANM---PFPNFYSSFNKNSSFNPRKLSINDHSPVYVSSFMELERQC  1423

Query  1196  GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKES  1375
             GARL++P  G  D V+ VYD+EPTSII+YAL S +Y   +++     E     +D+   S
Sbjct  1424  GARLLLPL-GVNDTVVPVYDDEPTSIIAYALVSSDYHSQMSE----VERPKDAADSAVSS  1478

Query  1376  PIASKLSTWQRFGSLDLDYMHFGSYGSED----ASGRIGFLFSDPKLSP---HPRISFED  1534
              +   ++        D+    + S+GS D    +    G L SDP L     H R+SF D
Sbjct  1479  SLFESVNLLSLNSFSDVSSEAYRSFGSGDDSILSLSGSGSLVSDPLLYTKDLHARVSFTD  1538

Query  1535  ESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSL  1714
             +     GKVK+SVTCY+AK+F++LR+ CCPSELDF+RSLSRCK+W AQGGKSNV+FAK+L
Sbjct  1539  D--GPLGKVKYSVTCYYAKRFESLRRTCCPSELDFVRSLSRCKKWGAQGGKSNVFFAKTL  1596

Query  1715  DERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKET  1894
             D+RFIIKQ+ KTEL+SF +F P YF+YL++S ++ SPTCLAK++G+YQV+ KHLKGGKE+
Sbjct  1597  DDRFIIKQVTKTELESFVKFGPAYFKYLSESINTRSPTCLAKILGMYQVSSKHLKGGKES  1656

Query  1895  KMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSK  2071
             KMD++VMENL + R+I+R+YDLKGS RSRYN DT  +NKVLLD N +E++ T PIF+GSK
Sbjct  1657  KMDMLVMENLLFRRNITRLYDLKGSSRSRYNPDTSGSNKVLLDQNLIEAMPTSPIFVGSK  1716

Query  2072  AKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ EL+LGIID+MRQYTWDKHLETW
Sbjct  1717  AKRLLERAVWNDTSFLALIDVMDYSLLVGVDEEKNELILGIIDFMRQYTWDKHLETW  1773



>ref|XP_010432592.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A 
isoform X3 [Camelina sativa]
Length=1737

 Score =   496 bits (1276),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 317/761 (42%), Positives = 433/761 (57%), Gaps = 85/761 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPPS LEFN Q+ Q W+ KE  E+++KA+ L+ 
Sbjct  974   RDCLRFYGFGRMVACFRYASINIYAVFLPPSKLEFNYQN-QEWLQKESKEVIQKAEVLFN  1032

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K    G   +  N +   + EL  +L  ++K Y   L Q       ++G
Sbjct  1033  EVQEALGQISAKTMDAGSKGSTPNKIKLSLEELAGLLEQRKKEYKESLQQML--SVFKDG  1090

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q TID+L +N+LR  +L D +AWD  L    S+   N+S + P N+           + +
Sbjct  1091  QPTIDILLINKLRRLILFDSYAWDECLAGAASMVRYNYS-EAPRNSAP---------KVM  1140

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHD-EPPVPKDALSYQQGSSSTSCNGDKTL  715
              ++ SLE   +E +   P   +  G+      D    VP+D     + S     N  +  
Sbjct  1141  GRNVSLEKLGDEKIRSIPTHVDSSGKIAAIPEDVGSDVPQDCRMEFEPSEGGKDNFAEPA  1200

Query  716   ETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFG  895
             +          K+ L  + S  + L D +D AW G    S +      +     R AS  
Sbjct  1201  QDV--------KTVLSESQSQATDLYDTLDAAWIGEQTISDNC-----ISRPPSRAASAN  1247

Query  896   QLSHVDSPTCKRLKSPARVYSFDSALRIQ------ERISKRLPPSPSYLSTLKSFHAYGD  1057
             ++   D           R+   +S L I+      E  ++   PSPS+  +L   ++   
Sbjct  1248  EIQIPD----------LRLLGSESGLNIKGVPTSDEHTTQVQMPSPSFYYSLNKNYSLNS  1297

Query  1058  YRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDV  1237
              ++++                  A+   +  SS       +     GARL++P  G  D+
Sbjct  1298  RKHIM------------------AEDRPVYVSSYRELEWRS-----GARLLLPL-GVNDL  1333

Query  1238  VIAVYDNEPTSIISYALSSKEYKDWVT--DKP---YMSEGGWGVSDTNKESPIASKLSTW  1402
             V+ VYD+EPTSII+YAL+S EYK  ++  DK      S G + + D+     + S     
Sbjct  1334  VLPVYDDEPTSIIAYALTSSEYKAQMSGSDKSRDRLDSGGSFSLFDSVNLLSLNSLSDLS  1393

Query  1403  QRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCY  1582
                     D     S   E  S  +        L  H R+SF DE     GKVK+SVTCY
Sbjct  1394  V-------DMSRSLSSADEQVSQLLQSSLYLKDL--HARVSFTDE--GPPGKVKYSVTCY  1442

Query  1583  FAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDS  1762
             +AK+F+ALRK CCPSE DFIRSL RC++W AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+S
Sbjct  1443  YAKEFEALRKICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKSLDDRFIIKQVTKTELES  1502

Query  1763  FEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSI  1942
             F +F P YF+YLT+S S+ SPT LAK++GIYQV+ KHLKGGKE KMD++VMENL + R+ 
Sbjct  1503  FIKFGPAYFKYLTESISTKSPTSLAKILGIYQVSSKHLKGGKEFKMDVLVMENLLFKRNF  1562

Query  1943  SRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFL  2119
             +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR LERAVWNDTSFL
Sbjct  1563  TRLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRLLERAVWNDTSFL  1622

Query  2120  AGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             A ++VMDYSLLVGVDEER ELVLGIID+MRQYTWDKHLETW
Sbjct  1623  ASIHVMDYSLLVGVDEERNELVLGIIDFMRQYTWDKHLETW  1663



>ref|XP_010432587.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A 
isoform X1 [Camelina sativa]
 ref|XP_010432588.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A 
isoform X1 [Camelina sativa]
 ref|XP_010432589.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A 
isoform X1 [Camelina sativa]
Length=1738

 Score =   496 bits (1276),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 317/761 (42%), Positives = 433/761 (57%), Gaps = 85/761 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPPS LEFN Q+ Q W+ KE  E+++KA+ L+ 
Sbjct  975   RDCLRFYGFGRMVACFRYASINIYAVFLPPSKLEFNYQN-QEWLQKESKEVIQKAEVLFN  1033

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K    G   +  N +   + EL  +L  ++K Y   L Q       ++G
Sbjct  1034  EVQEALGQISAKTMDAGSKGSTPNKIKLSLEELAGLLEQRKKEYKESLQQML--SVFKDG  1091

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q TID+L +N+LR  +L D +AWD  L    S+   N+S + P N+           + +
Sbjct  1092  QPTIDILLINKLRRLILFDSYAWDECLAGAASMVRYNYS-EAPRNSAP---------KVM  1141

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHD-EPPVPKDALSYQQGSSSTSCNGDKTL  715
              ++ SLE   +E +   P   +  G+      D    VP+D     + S     N  +  
Sbjct  1142  GRNVSLEKLGDEKIRSIPTHVDSSGKIAAIPEDVGSDVPQDCRMEFEPSEGGKDNFAEPA  1201

Query  716   ETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFG  895
             +          K+ L  + S  + L D +D AW G    S +      +     R AS  
Sbjct  1202  QDV--------KTVLSESQSQATDLYDTLDAAWIGEQTISDNC-----ISRPPSRAASAN  1248

Query  896   QLSHVDSPTCKRLKSPARVYSFDSALRIQ------ERISKRLPPSPSYLSTLKSFHAYGD  1057
             ++   D           R+   +S L I+      E  ++   PSPS+  +L   ++   
Sbjct  1249  EIQIPD----------LRLLGSESGLNIKGVPTSDEHTTQVQMPSPSFYYSLNKNYSLNS  1298

Query  1058  YRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDV  1237
              ++++                  A+   +  SS       +     GARL++P  G  D+
Sbjct  1299  RKHIM------------------AEDRPVYVSSYRELEWRS-----GARLLLPL-GVNDL  1334

Query  1238  VIAVYDNEPTSIISYALSSKEYKDWVT--DKP---YMSEGGWGVSDTNKESPIASKLSTW  1402
             V+ VYD+EPTSII+YAL+S EYK  ++  DK      S G + + D+     + S     
Sbjct  1335  VLPVYDDEPTSIIAYALTSSEYKAQMSGSDKSRDRLDSGGSFSLFDSVNLLSLNSLSDLS  1394

Query  1403  QRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCY  1582
                     D     S   E  S  +        L  H R+SF DE     GKVK+SVTCY
Sbjct  1395  V-------DMSRSLSSADEQVSQLLQSSLYLKDL--HARVSFTDE--GPPGKVKYSVTCY  1443

Query  1583  FAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDS  1762
             +AK+F+ALRK CCPSE DFIRSL RC++W AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+S
Sbjct  1444  YAKEFEALRKICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKSLDDRFIIKQVTKTELES  1503

Query  1763  FEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSI  1942
             F +F P YF+YLT+S S+ SPT LAK++GIYQV+ KHLKGGKE KMD++VMENL + R+ 
Sbjct  1504  FIKFGPAYFKYLTESISTKSPTSLAKILGIYQVSSKHLKGGKEFKMDVLVMENLLFKRNF  1563

Query  1943  SRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFL  2119
             +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR LERAVWNDTSFL
Sbjct  1564  TRLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRLLERAVWNDTSFL  1623

Query  2120  AGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             A ++VMDYSLLVGVDEER ELVLGIID+MRQYTWDKHLETW
Sbjct  1624  ASIHVMDYSLLVGVDEERNELVLGIIDFMRQYTWDKHLETW  1664



>ref|XP_010543031.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Tarenaya hassleriana]
Length=1739

 Score =   495 bits (1275),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 324/766 (42%), Positives = 445/766 (58%), Gaps = 93/766 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+ ID+ SV LPPS L FN ++ Q W+  E+ E++ +A+ L++
Sbjct  980   RDCLRFYGFGNMVACFRYATIDVHSVYLPPSTLNFNYEN-QDWVQIEIDEVVERAELLFS  1038

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ +A+ ++ EK          +      I EL+  L +EK  + D  Q   +   +EGQ
Sbjct  1039  EVLNAISQIAEK---------GLKESRRRIGELEAALQREKVEFEDNMQKILKREVKEGQ  1089

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LEL R+R  LL   + WDHRL           ++ H ++                
Sbjct  1090  PLVDILELYRIRRQLLFQSYMWDHRL----------INAAHLDS---------------L  1124

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLET  721
             + GS  +A E   HE P ++      +++  D   +  D     + ++S   N +K  E 
Sbjct  1125  EAGS--NATEREEHEKPLAKSQTLPEMNAGTDSLYLNPDG----ESATSLDLNREKENEG  1178

Query  722   RLGL--ENAVNKSPLE--RAPSAGSI----LSDKIDCAWTGIDPSSQDMQVHASLQEGER  877
              L L  E+  ++S L+  R  S G I    LS  ++ AWTG        QV      G  
Sbjct  1179  NLTLPDESDASESKLDVRRTQSDGEIVMKNLSATLEAAWTG----EHRAQVEIPKDSGNL  1234

Query  878   RVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGD  1057
              + +   LS  DS T      P+ V         Q       P SP+  S  K++    D
Sbjct  1235  -LPNVAALS--DSSTL-----PSSVLDLSEQ---QNEFKVSRPVSPALPS--KNYENSED  1281

Query  1058  YRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS---HASILPEGARLMVPENGQ  1228
               + +     N     +++ P  +QKL+ L S S  + S    + +   G RL++P  G 
Sbjct  1282  SVSWLGMSFFNFYRSINKSFPASSQKLDTLGSYSPVYISSFRESELQGGGPRLLLPV-GI  1340

Query  1229  KDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTW--  1402
              D+V+ V+D+EPTSII+YAL S EY   ++      EG   VS  ++ S   S   T   
Sbjct  1341  NDIVVPVHDDEPTSIIAYALMSPEYHRIIS-----GEGESLVSYPSELSLSRSVDDTIFD  1395

Query  1403  --QRFGSLDLDYMHFGSYGSEDASGRIGFLFSDP---KLSPHPRISFEDESCNTGGKVKF  1567
               +  GS+D   +   +  S         L  DP     + H R+SF ++   T GKVK+
Sbjct  1396  PSRSLGSVDESILSMSTSRST--------LLLDPLSYTKALHARVSFGED--GTLGKVKY  1445

Query  1568  SVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQK  1747
             +V+CY+AK+F+ALR  C PSELD+IRSLSRCK+W AQGGKSNV+FAK+LD+RFIIKQ+ K
Sbjct  1446  TVSCYYAKRFEALRSVCIPSELDYIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTK  1505

Query  1748  TELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLF  1927
             TEL+SF +FAP YF+YL+DS  + SPTCLAK++GIYQVAVK LK GKETKMD++VMENL 
Sbjct  1506  TELESFIKFAPAYFKYLSDSIDTKSPTCLAKILGIYQVAVKQLKSGKETKMDVLVMENLL  1565

Query  1928  YGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWN  2104
             +GR++ RVYDLKGS R+RYN D+  ANKVLLD N +E++ T PIF+G+KAKR LERAVWN
Sbjct  1566  FGRTVKRVYDLKGSSRARYNPDSSGANKVLLDQNLIEAMPTSPIFVGNKAKRLLERAVWN  1625

Query  2105  DTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             DT+FLA V VMDYSLLVGVDEE  ELVLGIID++RQYTWDKHLETW
Sbjct  1626  DTAFLALVDVMDYSLLVGVDEENHELVLGIIDFLRQYTWDKHLETW  1671



>ref|XP_007135367.1| hypothetical protein PHAVU_010G123500g [Phaseolus vulgaris]
 gb|ESW07361.1| hypothetical protein PHAVU_010G123500g [Phaseolus vulgaris]
Length=1830

 Score =   496 bits (1277),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 318/786 (40%), Positives = 444/786 (56%), Gaps = 98/786 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L F+    Q WI +E  E++ +A+ L++
Sbjct  1036  RDCLRFYGFGRMVACFRYASIDVHSVYLPPHTLIFD-YGNQDWIQQESDEVVNRAELLFS  1094

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ + + ++ EK ++ G        L   + EL+ ML KEK  + +  +    +    G 
Sbjct  1095  EVLNGLSQIGEKRSNAG-------QLRRQVTELEGMLQKEKLEFEETLRKILNQEKRNGP  1147

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIF--------------DNNFSSQHPENAV  499
               ID+LE+NRL   L+   + WDHRL Y  ++               D        + ++
Sbjct  1148  PGIDILEINRLWRQLIFQSYMWDHRLIYAANLVNSNNGSGSSSPVSEDKEKPVDENQISI  1207

Query  500   SCINPGE-------WGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKD  658
             + I+ G         GG ++  DG L    ++ +H+   SE    E  + E  E PV   
Sbjct  1208  NSIHGGPKVNENPCLGGGSVVVDGKLSQ--DDALHQ--ESEMAKKE--NHEKGEGPV---  1258

Query  659   ALSYQQGSSSTSCNGDK-TLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSS  835
                    S+S S N     LE  LG+   ++  P    PS    LS+ +D  WTG + S 
Sbjct  1259  -------SNSKSINDQSGLLEPELGVLRTLSDGPFPVIPS----LSETLDAKWTGENHSG  1307

Query  836   QDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSP  1015
                Q   S    +  +A    +S              +  ++    R +++       S 
Sbjct  1308  FGAQKDNSFVNPDIHLADSSMIS-------------VQKETYYVGDRTEDQNG-----SK  1349

Query  1016  SYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASIL  1189
             S+ S+ K      +  + +  P  N     ++ L    QK + L   +  + S      L
Sbjct  1350  SFYSSFKGHDNMEESSSWLGMPFLNFYRQFNKNLFASTQKFDTLVDYNPVYMSSFRKQEL  1409

Query  1190  PEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNK  1369
               GARL++P  G  D VI VYD+E +S+I+YAL S EY   +TD     EG         
Sbjct  1410  QGGARLLLPI-GVNDTVIPVYDDELSSVIAYALMSPEYHFQLTD-----EGERPREGNEF  1463

Query  1370  ESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFS-----------DPKL---S  1507
              S   S   T+Q F S+D       ++ S+ + G I  +             DP L   +
Sbjct  1464  TSSYFSDSGTFQSFSSVDET-----AFDSQKSFGSIEEMILSMSGSRSSSMLDPMLHTKA  1518

Query  1508  PHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGK  1687
              H R+SF ++     GKVK+SVTCY+AK+F+ALR+  CPSELD+IRSLSRCK+W AQGGK
Sbjct  1519  MHARVSFGEDG--PLGKVKYSVTCYYAKRFEALRRVSCPSELDYIRSLSRCKKWGAQGGK  1576

Query  1688  SNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAV  1867
             SNV+FAK+LD+RFIIKQ+ KTEL+SF +F P+YF+YL++S ++GSPTCLAK++GIYQV  
Sbjct  1577  SNVFFAKTLDDRFIIKQVTKTELESFIKFGPEYFKYLSESIATGSPTCLAKILGIYQVTS  1636

Query  1868  KHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLESLQ  2044
             KH KGGKE++MD++VMENL Y R+++R+YDLKGS RSRYN+D T  NKVLLD N +E++ 
Sbjct  1637  KHTKGGKESRMDVLVMENLLYRRTVTRLYDLKGSSRSRYNADSTGKNKVLLDQNLIEAMP  1696

Query  2045  TKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWD  2224
             T PIF+G+KAKRSLERAVWNDT FLA V VMDYSLLVG+DEE+ ELV+GIID+MRQYTWD
Sbjct  1697  TSPIFVGNKAKRSLERAVWNDTGFLASVDVMDYSLLVGMDEEKHELVIGIIDFMRQYTWD  1756

Query  2225  KHLETW  2242
             KHLETW
Sbjct  1757  KHLETW  1762



>ref|NP_188044.1| phosphatidylinositol-3P 5-kinase-like [Arabidopsis thaliana]
 sp|Q9LUM0.1|FAB1B_ARATH RecName: Full=1-phosphatidylinositol-3-phosphate 5-kinase FAB1B; 
Short=Phosphatidylinositol 3-phosphate 5-kinase; AltName: 
Full=FYVE finger-containing phosphoinositide kinase; AltName: 
Full=PIKfyve; AltName: Full=Phosphatidylinositol 3-phosphate 
5-kinase type III; Short=PIPkin-III; Short=Type III PIP 
kinase; AltName: Full=Protein FORMS APLOID AND BINUCLEATE CELLS 
1B [Arabidopsis thaliana]
 dbj|BAB01033.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE75496.1| phosphatidylinositol-3P 5-kinase-like [Arabidopsis thaliana]
Length=1791

 Score =   495 bits (1274),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 317/775 (41%), Positives = 444/775 (57%), Gaps = 87/775 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+ ID+ SV LPPS+L FN ++ Q WI +E  E++ +A+ L++
Sbjct  1008  RDCLRFYGFGNMVACFRYATIDVHSVYLPPSILSFNYEN-QDWIQRETDEVIERAELLFS  1066

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ +A+ ++ EK            G    I EL+++L KEK  + +  Q        EGQ
Sbjct  1067  EVLNAISQIAEK------------GFRRRIGELEEVLQKEKAEFEENMQKILHREVNEGQ  1114

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI--FDNNFSSQHPENAVSCINPGEWGGET  535
               +D+LEL R+   LL   + WDHRL    ++   +N+  ++  EN    +   +   E 
Sbjct  1115  PLVDILELYRIHRQLLFQSYMWDHRLINASTLHKLENSDDTKREENEKPPLAKSQTLPEM  1174

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEG-LHSEHDEPPVPKDALSYQQGSSSTSCNGDKT  712
                  SL    E N++  P+ +     G L++   E     D   YQ+       +  KT
Sbjct  1175  NAGTNSLLTGSEVNLN--PDGDSTGDTGSLNNVQKEADTNSDL--YQEKDDGGEVSPSKT  1230

Query  713   L-ETRLGLENAVNKSPLERAPSAGSI----LSDKIDCAWTGIDPSSQDMQVHASLQEGER  877
             L +T   LEN V+   + R  S G I    LS  +D AW G                 ER
Sbjct  1231  LPDTSYPLENKVD---VRRTQSDGQIVMKNLSATLDAAWIG-----------------ER  1270

Query  878   RVASFGQLSHVDSPTCKRLKSPARVYSFDSAL-------------RIQERISKRLPPSPS  1018
             + +       V+ PT  ++  P    S  S                 Q       P SP+
Sbjct  1271  QTS-------VEIPTNNKVSLPPSTMSNSSTFPPISEGLMPIDLPEQQNEFKVAYPVSPA  1323

Query  1019  YLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILP  1192
               S  K++    D  + +  P  N     ++     +QKL+     S  + S    + L 
Sbjct  1324  LPS--KNYENSEDSVSWLSVPFLNFYRSINKNFLLSSQKLDTFGEHSPIYISSFREAELQ  1381

Query  1193  EGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVS---DT  1363
              G RL++P  G  D+V+ VYD+EPTS+I+YAL S EY+   +     +EG   VS   + 
Sbjct  1382  GGPRLLLPV-GLNDIVVPVYDDEPTSMIAYALMSPEYQRQTS-----AEGESLVSYPSEL  1435

Query  1364  NKESPIASKLSTWQRF-GSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDES  1540
             N   P+   +    R  GS+D   +   S  S      + +       + H R+S+ ++ 
Sbjct  1436  NIPRPVDDTIFDPSRSNGSVDESILSISSSRSTSLLDPLSY-----TKALHARVSYGED-  1489

Query  1541  CNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDE  1720
               T GKVK++VTCY+AK+F+ALR  C PSEL++IRSLSRCK+W AQGGKSNV+FAK+LD+
Sbjct  1490  -GTLGKVKYTVTCYYAKRFEALRGICLPSELEYIRSLSRCKKWGAQGGKSNVFFAKTLDD  1548

Query  1721  RFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKM  1900
             RFIIKQ+ KTEL+SF +FAP YF+YL++S S+ SPTCLAK++GIYQVA K LK GKETKM
Sbjct  1549  RFIIKQVTKTELESFIKFAPAYFKYLSESISTKSPTCLAKILGIYQVATKQLKSGKETKM  1608

Query  1901  DLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAK  2077
             D+++MENL +GR++ R+YDLKGS R+RYN D+  +NKVLLD N +E++ T PIF+G+KAK
Sbjct  1609  DVLIMENLLFGRTVKRLYDLKGSSRARYNPDSSGSNKVLLDQNLIEAMPTSPIFVGNKAK  1668

Query  2078  RSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             R LERAVWNDT+FLA   VMDYSLLVGVDEE+ ELVLGIID++RQYTWDKHLE+W
Sbjct  1669  RLLERAVWNDTAFLALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESW  1723



>ref|XP_002444449.1| hypothetical protein SORBIDRAFT_07g022110 [Sorghum bicolor]
 gb|EES13944.1| hypothetical protein SORBIDRAFT_07g022110 [Sorghum bicolor]
Length=1798

 Score =   494 bits (1273),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 318/795 (40%), Positives = 453/795 (57%), Gaps = 122/795 (15%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPPS L+F S+  Q W+ +E  E+   A+ L++
Sbjct  1011  RDCLRFYGFGEMVACFRYASIKVHSVYLPPSKLDFTSE-HQEWVEEEAKEVDDSAELLFS  1069

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ K+       G    N+    L   I EL+++L+ EK  + +      ++   +
Sbjct  1070  EVLNALHKISGGRPITGSFDGNLKILELRRNIGELEEILVAEKTDFMESLNNLLKKDMRK  1129

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPG----EW  523
             GQ  ID+LE+N+LR  LL   + WD RL ++ +      S     +A++ +  G    ++
Sbjct  1130  GQPFIDILEVNKLRRHLLLLSYLWDQRLKFIAN------SGGKYCDALASLRIGSGNSDF  1183

Query  524   GGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNG  703
              G+++    + +      V E  ++ +   EGL  +   PP  +D    Q   S+ + +G
Sbjct  1184  NGKSVGAGPAPKLEKGSKVTEILSTAK---EGLLQQSSCPPHGEDEGFNQANESNENSSG  1240

Query  704   D-----------------KTLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAWT  817
             +                  + + +  L+N  +++ + R  S G       + D +D  W 
Sbjct  1241  NVAELNGTEDSIAKINHATSADVKDRLDNQESRTGVRRVVSDGQFPVTTDIPDTLDAKWR  1300

Query  818   GID---PSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQER  988
             G D   P S   +   S+++    V +  +  H  S T         V S D+A  +   
Sbjct  1301  GQDGPAPDSNSAKPLPSVEDTAVDVKNQAKAVHTSSFT---------VRSGDAAEELLRW  1351

Query  989   ISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTF  1168
             +  ++P    Y+++  S                                LN+  SS   F
Sbjct  1352  L--KMP----YMTSNSS--------------------------------LNITSSSPLRF  1373

Query  1169  TSHASILPE------------GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDW  1312
             TS A  +P+            GARL +P  G  D+VI V+D+EPTS+ISYAL S  Y   
Sbjct  1374  TSLADYIPKYVELFCELSQKGGARLFLP-TGPNDIVIPVFDDEPTSVISYALVSPMYCFQ  1432

Query  1313  VTDKPYMSEGGWGVSDTNKESPIASKLSTWQ--RFGSLDLDYMHFGSY--GSEDASGRIG  1480
             ++D+          S  N+E   +  L  +    F    L +  FGS+   +   SG  G
Sbjct  1433  LSDE----------SSKNREKDSSLPLPVYDSGNFNPFHL-FEEFGSHYDVTSSVSGVRG  1481

Query  1481  FLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRC  1660
                 D     H  +SFED      GKVK++VTCY+AK+F+ALR+ CCPSELDF+RS+SRC
Sbjct  1482  SFAPD---QVHLSVSFEDG--GPLGKVKYNVTCYYAKKFEALRRSCCPSELDFLRSISRC  1536

Query  1661  KRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAK  1840
             K+W AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+SF +F  +YF+YL++S S+GSPTCLAK
Sbjct  1537  KKWGAQGGKSNVFFAKSLDDRFIIKQVTKTELESFLKFGTEYFKYLSESISTGSPTCLAK  1596

Query  1841  VVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLL  2017
             ++GIYQV +KH+KGGKE+KMDL+VMENL +GR+I+R+YDLKGS RSRYN+D+  +NKVLL
Sbjct  1597  ILGIYQVTIKHVKGGKESKMDLLVMENLLFGRNITRLYDLKGSSRSRYNADSNGSNKVLL  1656

Query  2018  DLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGII  2197
             D N +E++ T PIF+G+KAKR LERAVWNDTSFLAG+ VMDYSLLVGVDEE+ ELVLGII
Sbjct  1657  DQNLIEAMPTSPIFVGNKAKRLLERAVWNDTSFLAGIDVMDYSLLVGVDEEKHELVLGII  1716

Query  2198  DYMRQYTWDKHLETW  2242
             D+MRQYTWDKHLETW
Sbjct  1717  DFMRQYTWDKHLETW  1731



>emb|CDO97796.1| unnamed protein product [Coffea canephora]
Length=1840

 Score =   494 bits (1272),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 321/790 (41%), Positives = 457/790 (58%), Gaps = 72/790 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L+FN ++ Q W+ +E+ E++  A+ L++
Sbjct  1013  RDCLRFYGFGQMVACFRYASIDVHSVYLPPPKLDFNFEN-QEWVQQELNEVVGWAELLFS  1071

Query  182   EISSAVQKLEEKCASVGCDWNNMNG--LHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A++ L EK    G   +        + + +L+ ML KEK  + D       + + +
Sbjct  1072  EVLNALRLLVEKNFGPGLPSSGKKAPESRHQMADLEAMLQKEKVEFEDALNKILNKEARK  1131

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYM---------ESIFDNNFSSQHPENAVSCI  508
             GQ  +D+LE+NRLR  LL   + WDHRL Y+         E    N+     P   +  +
Sbjct  1132  GQPAVDILEINRLRRQLLFQSYMWDHRLIYVASSDNICQREMAVANSAPDVRPNEEICDL  1191

Query  509   N----PGEWGGETIFK--DGSLEHAYEENVH--EFPNSEEC---------PGEGLHSEHD  637
             N    PG+    +     D +L+ ++   V   E P    C         P   +H E D
Sbjct  1192  NVSVRPGQGFDSSNLASPDVNLDESHHHGVSGGEDPPEFICDRGVGGLKNPAVLVHQETD  1251

Query  638   --EPPVPKDALSYQQGSSSTSCNGDK-TLETRLGLENAVNKSPLERAPSAGSILSDKIDC  808
                P   K  LS+   SS T    +  +LE+ + +   ++        S    LS+ +D 
Sbjct  1252  GSNPNSVKGNLSFP--SSVTDIRDESVSLESNVSVHGVLSDGQFPVMVS----LSETLDA  1305

Query  809   AWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQER  988
             AWTG        + +  L      +      + +DS T     +       D+    +E 
Sbjct  1306  AWTG--------ETNPGLGLSMDDMHKVSDTASLDSST-----TGGAAEMLDTEGHGEEL  1352

Query  989   ISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTF  1168
                ++ PSP +LS+  S +   D  + +  P  +     ++      QKL+ L   +  +
Sbjct  1353  TGAKIVPSP-FLSSRVSDNVE-DTVSWLGLPFISFYRSLNKNFLGNNQKLDTLSEYNPVY  1410

Query  1169  TS--HASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEG  1342
              S      L  GARL++P  G  D V+ VYD+EPTS+I+YAL+S +Y   ++D     E 
Sbjct  1411  ISSFRQLELQGGARLLLPV-GFNDTVVPVYDDEPTSVIAYALASPDYLVQLSDD---LER  1466

Query  1343  GWGVSDTNKESPIASKLSTWQRFGSLD-LDYMHFGSYGSEDAS-----GRIGFLFSDP--  1498
                ++D    S ++    ++Q F S+D +    + S GS D S             DP  
Sbjct  1467  LKDMADLTS-SLLSFDSGSFQSFHSMDEIALEPYRSLGSADESILSMSSTRSSSVLDPFS  1525

Query  1499  -KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSA  1675
                + H R+S  D+     GKVK++VTCY+AK+F+ALR+ CCPSE+DFIRSLSRCK+W A
Sbjct  1526  YTKAMHARVSLTDD--GPLGKVKYTVTCYYAKRFEALRRICCPSEIDFIRSLSRCKKWGA  1583

Query  1676  QGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIY  1855
             QGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S  SGSPTCLAK++GIY
Sbjct  1584  QGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPGYFKYLSESIGSGSPTCLAKILGIY  1643

Query  1856  QVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFL  2032
             QV  KH+KGGKE+K D++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD N +
Sbjct  1644  QVTSKHVKGGKESKRDVLVMENLLFGRNLTRLYDLKGSSRSRYNPDSSGSNKVLLDQNLI  1703

Query  2033  ESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQ  2212
             E++ T PIF+G+KAKR LERAVWNDT+FLA + VMDYSLLVGVD+E+ ELVLGIID+MRQ
Sbjct  1704  EAMPTSPIFVGNKAKRLLERAVWNDTAFLASIDVMDYSLLVGVDQEKHELVLGIIDFMRQ  1763

Query  2213  YTWDKHLETW  2242
             YTWDKHLETW
Sbjct  1764  YTWDKHLETW  1773



>ref|NP_001078484.4| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A [Arabidopsis 
thaliana]
 gb|AEE86195.1| 1-phosphatidylinositol-3-phosphate (PtdIns3P) 5-kinase-like protein 
[Arabidopsis thaliana]
Length=1756

 Score =   493 bits (1268),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 314/771 (41%), Positives = 440/771 (57%), Gaps = 82/771 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPP+ L FN ++ Q W+ KE  E+++KA+ L+ 
Sbjct  971   RDCLRFYGFGRMVACFRYASINIYAVTLPPAKLYFNYEN-QEWLQKESKEVIKKAEVLFN  1029

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K    G   +  N +   + EL  +L  ++K Y + L Q  +    ++G
Sbjct  1030  EVQEALSQISAKTMGAGSKGSTPNKIKLSLEELAGLLEQRKKEYKDSLQQMLN--VVKDG  1087

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q TID+L +N+LR  ++ D +AWD  L    ++  NN+  + P+N+           + +
Sbjct  1088  QPTIDILLINKLRRLIIFDSYAWDECLAGAANMVRNNYL-EAPKNSAP---------KVM  1137

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTS----CNGD  706
              ++ SLE   +E V   P       + L  + D         S+   S   +       D
Sbjct  1138  GRNVSLEKLSDEKVKSIPTHVAICNDSLLQDADYETCLNQGKSFADTSGKFAIPEDVGSD  1197

Query  707   KTLETRL-------GLENAVNKSPLERAPSA-----GSILSDKIDCAWTGIDPSSQDMQV  850
             +  + R+       G +N V  S + +          + LSD +D AW G   +S++   
Sbjct  1198  RPPDCRMEFDPSEGGKDNFVESSQVVKPAHTESQFQATDLSDTLDAAWIGEQTTSEN---  1254

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
                 +   R  ++ G       P  + L S + + +F       E  ++   PSPS+  +
Sbjct  1255  -GIFRPPSRAASTNG----TQIPDLRLLGSESEL-NFKGGPTNDEHTTQVQLPSPSFYYS  1308

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLM  1210
             L   ++    ++++                  A+   +  SS       +     GARL+
Sbjct  1309  LNKNYSLNSRKHIM------------------AEDRPVYVSSYRELEWRS-----GARLL  1345

Query  1211  VPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT--DKP---YMSEGGWGVSDTNKES  1375
             +P  G  D+V+ VYD+EPTSII+YAL+S EYK  ++  DK      S G + + D+    
Sbjct  1346  LPL-GCNDLVLPVYDDEPTSIIAYALTSSEYKAQMSGSDKSRDRLDSGGSFSLFDSVNLL  1404

Query  1376  PIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSP-HPRISFEDESCNTG  1552
              + S            +D     S   E  S     L S   L   H RISF DE     
Sbjct  1405  SLNSLSDL-------SVDMSRSLSSADEQVSQ---LLHSSLYLKDLHARISFTDE--GPP  1452

Query  1553  GKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFII  1732
             GKVK+SVTCY+AK+F+ALR  CCPSE DFIRSL RC++W AQGGKSNV+FAKSLD+RFII
Sbjct  1453  GKVKYSVTCYYAKEFEALRMICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKSLDDRFII  1512

Query  1733  KQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIV  1912
             KQ+ KTEL+SF +F P YF+YLT+S S+ SPT LAK++GIYQV+ KHLKGGKE KMD++V
Sbjct  1513  KQVTKTELESFIKFGPAYFKYLTESISTKSPTSLAKILGIYQVSSKHLKGGKEFKMDVLV  1572

Query  1913  MENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLE  2089
             MENL + R+ +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR LE
Sbjct  1573  MENLLFKRNFTRLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRLLE  1632

Query  2090  RAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             RAVWNDTSFLA ++VMDYSLLVGVDEER ELVLGIID+MRQYTWDKHLETW
Sbjct  1633  RAVWNDTSFLASIHVMDYSLLVGVDEERNELVLGIIDFMRQYTWDKHLETW  1683



>emb|CAB36798.1| putative protein [Arabidopsis thaliana]
 emb|CAB80041.1| putative protein [Arabidopsis thaliana]
Length=1757

 Score =   493 bits (1268),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 314/771 (41%), Positives = 440/771 (57%), Gaps = 82/771 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPP+ L FN ++ Q W+ KE  E+++KA+ L+ 
Sbjct  972   RDCLRFYGFGRMVACFRYASINIYAVTLPPAKLYFNYEN-QEWLQKESKEVIKKAEVLFN  1030

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K    G   +  N +   + EL  +L  ++K Y + L Q  +    ++G
Sbjct  1031  EVQEALSQISAKTMGAGSKGSTPNKIKLSLEELAGLLEQRKKEYKDSLQQMLN--VVKDG  1088

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q TID+L +N+LR  ++ D +AWD  L    ++  NN+  + P+N+           + +
Sbjct  1089  QPTIDILLINKLRRLIIFDSYAWDECLAGAANMVRNNYL-EAPKNSAP---------KVM  1138

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTS----CNGD  706
              ++ SLE   +E V   P       + L  + D         S+   S   +       D
Sbjct  1139  GRNVSLEKLSDEKVKSIPTHVAICNDSLLQDADYETCLNQGKSFADTSGKFAIPEDVGSD  1198

Query  707   KTLETRL-------GLENAVNKSPLERAPSA-----GSILSDKIDCAWTGIDPSSQDMQV  850
             +  + R+       G +N V  S + +          + LSD +D AW G   +S++   
Sbjct  1199  RPPDCRMEFDPSEGGKDNFVESSQVVKPAHTESQFQATDLSDTLDAAWIGEQTTSEN---  1255

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
                 +   R  ++ G       P  + L S + + +F       E  ++   PSPS+  +
Sbjct  1256  -GIFRPPSRAASTNG----TQIPDLRLLGSESEL-NFKGGPTNDEHTTQVQLPSPSFYYS  1309

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLM  1210
             L   ++    ++++                  A+   +  SS       +     GARL+
Sbjct  1310  LNKNYSLNSRKHIM------------------AEDRPVYVSSYRELEWRS-----GARLL  1346

Query  1211  VPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT--DKP---YMSEGGWGVSDTNKES  1375
             +P  G  D+V+ VYD+EPTSII+YAL+S EYK  ++  DK      S G + + D+    
Sbjct  1347  LPL-GCNDLVLPVYDDEPTSIIAYALTSSEYKAQMSGSDKSRDRLDSGGSFSLFDSVNLL  1405

Query  1376  PIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSP-HPRISFEDESCNTG  1552
              + S            +D     S   E  S     L S   L   H RISF DE     
Sbjct  1406  SLNSLSDL-------SVDMSRSLSSADEQVSQ---LLHSSLYLKDLHARISFTDE--GPP  1453

Query  1553  GKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFII  1732
             GKVK+SVTCY+AK+F+ALR  CCPSE DFIRSL RC++W AQGGKSNV+FAKSLD+RFII
Sbjct  1454  GKVKYSVTCYYAKEFEALRMICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKSLDDRFII  1513

Query  1733  KQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIV  1912
             KQ+ KTEL+SF +F P YF+YLT+S S+ SPT LAK++GIYQV+ KHLKGGKE KMD++V
Sbjct  1514  KQVTKTELESFIKFGPAYFKYLTESISTKSPTSLAKILGIYQVSSKHLKGGKEFKMDVLV  1573

Query  1913  MENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLE  2089
             MENL + R+ +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR LE
Sbjct  1574  MENLLFKRNFTRLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRLLE  1633

Query  2090  RAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             RAVWNDTSFLA ++VMDYSLLVGVDEER ELVLGIID+MRQYTWDKHLETW
Sbjct  1634  RAVWNDTSFLASIHVMDYSLLVGVDEERNELVLGIIDFMRQYTWDKHLETW  1684



>ref|NP_195050.6| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A [Arabidopsis 
thaliana]
 sp|Q0WUR5.1|FAB1A_ARATH RecName: Full=1-phosphatidylinositol-3-phosphate 5-kinase FAB1A; 
Short=Phosphatidylinositol 3-phosphate 5-kinase; AltName: 
Full=FYVE finger-containing phosphoinositide kinase; AltName: 
Full=PIKfyve; AltName: Full=Phosphatidylinositol 3-phosphate 
5-kinase type III; Short=PIPkin-III; Short=Type III PIP 
kinase; AltName: Full=Protein FORMS APLOID AND BINUCLEATE CELLS 
1A [Arabidopsis thaliana]
 dbj|BAE99133.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86194.1| 1-phosphatidylinositol-3-phosphate (PtdIns3P) 5-kinase-like protein 
[Arabidopsis thaliana]
Length=1757

 Score =   493 bits (1268),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 314/771 (41%), Positives = 440/771 (57%), Gaps = 82/771 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPP+ L FN ++ Q W+ KE  E+++KA+ L+ 
Sbjct  972   RDCLRFYGFGRMVACFRYASINIYAVTLPPAKLYFNYEN-QEWLQKESKEVIKKAEVLFN  1030

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K    G   +  N +   + EL  +L  ++K Y + L Q  +    ++G
Sbjct  1031  EVQEALSQISAKTMGAGSKGSTPNKIKLSLEELAGLLEQRKKEYKDSLQQMLN--VVKDG  1088

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q TID+L +N+LR  ++ D +AWD  L    ++  NN+  + P+N+           + +
Sbjct  1089  QPTIDILLINKLRRLIIFDSYAWDECLAGAANMVRNNYL-EAPKNSAP---------KVM  1138

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTS----CNGD  706
              ++ SLE   +E V   P       + L  + D         S+   S   +       D
Sbjct  1139  GRNVSLEKLSDEKVKSIPTHVAICNDSLLQDADYETCLNQGKSFADTSGKFAIPEDVGSD  1198

Query  707   KTLETRL-------GLENAVNKSPLERAPSA-----GSILSDKIDCAWTGIDPSSQDMQV  850
             +  + R+       G +N V  S + +          + LSD +D AW G   +S++   
Sbjct  1199  RPPDCRMEFDPSEGGKDNFVESSQVVKPAHTESQFQATDLSDTLDAAWIGEQTTSEN---  1255

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
                 +   R  ++ G       P  + L S + + +F       E  ++   PSPS+  +
Sbjct  1256  -GIFRPPSRAASTNG----TQIPDLRLLGSESEL-NFKGGPTNDEHTTQVQLPSPSFYYS  1309

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLM  1210
             L   ++    ++++                  A+   +  SS       +     GARL+
Sbjct  1310  LNKNYSLNSRKHIM------------------AEDRPVYVSSYRELEWRS-----GARLL  1346

Query  1211  VPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT--DKP---YMSEGGWGVSDTNKES  1375
             +P  G  D+V+ VYD+EPTSII+YAL+S EYK  ++  DK      S G + + D+    
Sbjct  1347  LPL-GCNDLVLPVYDDEPTSIIAYALTSSEYKAQMSGSDKSRDRLDSGGSFSLFDSVNLL  1405

Query  1376  PIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSP-HPRISFEDESCNTG  1552
              + S            +D     S   E  S     L S   L   H RISF DE     
Sbjct  1406  SLNSLSDL-------SVDMSRSLSSADEQVSQ---LLHSSLYLKDLHARISFTDE--GPP  1453

Query  1553  GKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFII  1732
             GKVK+SVTCY+AK+F+ALR  CCPSE DFIRSL RC++W AQGGKSNV+FAKSLD+RFII
Sbjct  1454  GKVKYSVTCYYAKEFEALRMICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKSLDDRFII  1513

Query  1733  KQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIV  1912
             KQ+ KTEL+SF +F P YF+YLT+S S+ SPT LAK++GIYQV+ KHLKGGKE KMD++V
Sbjct  1514  KQVTKTELESFIKFGPAYFKYLTESISTKSPTSLAKILGIYQVSSKHLKGGKEFKMDVLV  1573

Query  1913  MENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLE  2089
             MENL + R+ +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR LE
Sbjct  1574  MENLLFKRNFTRLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRLLE  1633

Query  2090  RAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             RAVWNDTSFLA ++VMDYSLLVGVDEER ELVLGIID+MRQYTWDKHLETW
Sbjct  1634  RAVWNDTSFLASIHVMDYSLLVGVDEERNELVLGIIDFMRQYTWDKHLETW  1684



>dbj|BAD08735.1| 1-phosphatidylinositol-3-phosphate 5-kinase-like [Oryza sativa 
Japonica Group]
Length=1821

 Score =   493 bits (1269),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 319/791 (40%), Positives = 435/791 (55%), Gaps = 114/791 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPP  L+F SQ  Q W+ +E  E++  A+ L+ 
Sbjct  1034  RDCLRFYGFGEMVACFRYASIKVHSVYLPPPKLDFTSQ-HQEWVEQEANEVVDSAELLFT  1092

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ ++ E     G    NM    L   I+EL+++L  EK  + +  +    +   +
Sbjct  1093  EVLNALHQISEGRPITGSFDGNMKILELRRNIMELEEILQIEKADFTESLKNLLNKEIRK  1152

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLY--------YMESIFDNNFSSQHPE-------  490
             G+  ID+LE+N+LR  LL   + WD RL         Y +++      S+  +       
Sbjct  1153  GKPFIDILEVNKLRRQLLFLCYLWDQRLIFIANSGGKYCDTLGGLRVGSRSSDSNDKSVD  1212

Query  491   -NAVSCINPGEWGGETI--FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDA  661
              NA + +     G E +   K+GSL+ +                  LH+   EP  P  +
Sbjct  1213  TNATTKLEKSSKGSEVLSNAKEGSLKQSQSP---------------LHANDKEPNQPDQS  1257

Query  662   LSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLE-------------RAPSAGSI-----  787
                  G+SS    G   +E  +   N  N + ++             R  S G       
Sbjct  1258  ----NGNSSRIGAGLNGMEDAIAKINHSNSADVKDNLDHQESSIGVRRVLSDGQFPVNAD  1313

Query  788   LSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDS  967
             +SD +D  W G + +  D  +   L   E       Q   V +     ++S   V    S
Sbjct  1314  ISDTLDAKWRGENGTVPDTSILKPLALLEGSADLKNQAKAVPTNASLSVRSGDTVEDLSS  1373

Query  968   ALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLL  1147
              L++         P  ++  +L +                      S   PR     +  
Sbjct  1374  WLKM---------PYMTFYDSLNTN---------------------SGTAPRFGALADYN  1403

Query  1148  PSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKP  1327
             P   T F   +     GARL +P  G  DVVI V+D+EPTSIISYAL S  Y   + D+ 
Sbjct  1404  PVYITLFRELSQ--QGGARLFLP-TGANDVVIPVFDDEPTSIISYALVSPMYCHQMLDE-  1459

Query  1328  YMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMH-FGSYGSED-----ASGRIGFLF  1489
                      +  NK+ P +S       + S + +  H F  +GS D      SG  G   
Sbjct  1460  ---------NSKNKDGPDSSL--PLPVYDSGNFNPFHLFEDFGSADDLASSISGTRGSFV  1508

Query  1490  SDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRW  1669
              D     H R+ FED      GKVK++VTCY+AK F+ALR+ CCPSELDF+RS+SRCK+W
Sbjct  1509  PD---LVHLRVPFEDG--GPLGKVKYTVTCYYAKSFEALRRSCCPSELDFLRSISRCKKW  1563

Query  1670  SAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVG  1849
              AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+SF +F   YF+YL++S S+GSPT LAK++G
Sbjct  1564  GAQGGKSNVFFAKSLDDRFIIKQVTKTELESFLKFGLDYFKYLSESISTGSPTSLAKILG  1623

Query  1850  IYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNF  2029
             IYQV +KH+KGGKE+KMDL+VMENL +GR+I+R+YDLKGS RSRYN+D+ +NKVLLD N 
Sbjct  1624  IYQVTIKHVKGGKESKMDLLVMENLLFGRNITRLYDLKGSSRSRYNADSSSNKVLLDQNL  1683

Query  2030  LESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMR  2209
             +E++ T PIF+G+KAKR LERAVWNDTSFLAG+ VMDYSLLVGVDEE+ ELVLGIID+MR
Sbjct  1684  IEAMPTSPIFVGNKAKRLLERAVWNDTSFLAGIDVMDYSLLVGVDEEKHELVLGIIDFMR  1743

Query  2210  QYTWDKHLETW  2242
             QYTWDKHLETW
Sbjct  1744  QYTWDKHLETW  1754



>ref|XP_010685217.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010685219.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010685220.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Beta vulgaris subsp. vulgaris]
Length=1811

 Score =   493 bits (1268),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 321/781 (41%), Positives = 445/781 (57%), Gaps = 82/781 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YGCG M+ACFRY+ ID+ SV LPP+ ++FN ++ Q WI KE  E++R+A+ L+ 
Sbjct  1014  RDCLRFYGCGKMVACFRYASIDVYSVYLPPAKVDFNYET-QDWIQKEADEVVRRAELLFT  1072

Query  182   EISSAVQKL-EEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEG  358
             E+ +A++++ E K   +G     +    +    L+ +L  E   + ++   +      +G
Sbjct  1073  EVRNAIRQIAERKNGGLGA---GIISSESRFATLEGLLRNEMTEFQEVCLKSSIREVRKG  1129

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHP-------------ENAV  499
                 D+LE+NRLR  LL   + WDHRL         +     P             +NAV
Sbjct  1130  HPAQDILEINRLRKQLLFQSYLWDHRLVNAAKDDGQDEDRAFPNADFMGLDILPRSKNAV  1189

Query  500   SCINPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQG  679
             +        GE +  D ++      N+ E   +   P E        P   +D       
Sbjct  1190  A-------SGEALPTDPNI--IRNSNLEEGTKNAVKPPETDFQTRASPDRTRDFEYVGDH  1240

Query  680   SSSTSC-NGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHA  856
             S+ST        LE    +  A++ S           LSD +D AWTG        Q   
Sbjct  1241  STSTGIYEQSDRLEYGPTVRRALSDSHFLN-------LSDTLDAAWTG------KTQPGV  1287

Query  857   SLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTL-  1033
              L   +   +  G +S VDS    +L   A   + ++  R++E+   ++  SPS +++  
Sbjct  1288  GLSR-DNNFSLTGSIS-VDS----QLAVVAERLALEN--RVEEKGVAKVTSSPSPVASTN  1339

Query  1034  -KSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHAS--ILPEGAR  1204
              K   +  D  + +  P  N     ++     AQKL+     ++T+ S A    L  GA+
Sbjct  1340  SKGSDSAEDTISWLGMPFLNFYRSLNKNFLGSAQKLDSFGGCNSTYISSARELGLQGGAK  1399

Query  1205  LMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTD---KPYMSEGGWGVSDTNKES  1375
              ++PE G  + VI VYD+EPTSIISYAL S++Y   ++D   +P   E    +      S
Sbjct  1400  WLLPE-GPYETVIPVYDDEPTSIISYALISQDYYSQLSDDGERPKDIESASSLPMQESAS  1458

Query  1376  -----PIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKL---SPHPRISFE  1531
                  P+   ++   R  SL +D   F + G+  +        SDP L   S H R++F 
Sbjct  1459  FHQLLPVDEPMNESNR--SLSIDDNIFSTSGARSS------FMSDPLLYTKSLHIRVAF-  1509

Query  1532  DESCNTGG---KVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYF  1702
                    G   K+K+SVTCY+AK FD LRK CCPSELDF+RSLSRCK+W AQGGKSNV+F
Sbjct  1510  ----TVNGPIDKMKYSVTCYYAKHFDTLRKICCPSELDFVRSLSRCKKWGAQGGKSNVFF  1565

Query  1703  AKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKG  1882
             AKSLDERFI+KQ+ KTEL+SF +FAP+YF+YL  +  + SPTCLAK++GIYQV  K+LKG
Sbjct  1566  AKSLDERFIVKQVTKTELESFIKFAPEYFKYLIGAIDTKSPTCLAKILGIYQVTTKNLKG  1625

Query  1883  GKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIF  2059
             GKETKMD++VMENL + R+++R+YDLKGS RSRYN D+   NKVLLD N +E++ T PIF
Sbjct  1626  GKETKMDVLVMENLLFRRNVTRLYDLKGSSRSRYNPDSSGDNKVLLDQNLIEAMPTSPIF  1685

Query  2060  LGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLET  2239
             +G++AKR LERAVWNDTSFLA V VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLET
Sbjct  1686  VGNRAKRLLERAVWNDTSFLASVDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLET  1745

Query  2240  W  2242
             W
Sbjct  1746  W  1746



>ref|XP_002882874.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59133.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=1789

 Score =   493 bits (1268),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 308/762 (40%), Positives = 443/762 (58%), Gaps = 61/762 (8%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+ ID+ SV LPPS+L FN ++ Q WI +E  E++ +A+ L++
Sbjct  1006  RDCLRFYGFGNMVACFRYATIDVHSVYLPPSILSFNYEN-QDWIQRETDEVIERAELLFS  1064

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ +A+ ++ EK            G    I EL+++L +EK+ + +  Q        EGQ
Sbjct  1065  EVLNAISQIAEK------------GFRRRIGELEEVLQREKSEFEENMQKMLHREVNEGQ  1112

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI--FDNNFSSQHPENAVSCINPGEWGGET  535
               +D+LEL R+R  LL   + WDHRL    ++   +N+  ++  EN    +   +   E 
Sbjct  1113  PLVDILELYRIRRQLLFQSYMWDHRLINASTLHKLENSDDTKREENEKPPLAKSQTLPEM  1172

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEG-LHSEHDEPPVPKDALSYQQGSSSTSCNGDKT  712
                  SL    E N++  P+ +     G L++   E     D L++++            
Sbjct  1173  NAGTNSLLTGSEVNLN--PDGDSTGDTGSLNNVQKEADTNSD-LNHEKNDGGEVSPSKTL  1229

Query  713   LETRLGLENAVNKSPLERAPSAGSI----LSDKIDCAWTGIDPSSQDMQVHASLQEGERR  880
              +T   LEN V+   + R  S G I    LS  +D AW G      + Q    +    + 
Sbjct  1230  PDTSYPLENKVD---VRRTQSDGQIVMKNLSATLDAAWIG------ERQTSVEIPTNNKV  1280

Query  881   VASFGQLSHVDS-PTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGD  1057
             +     +S+  + P       P  +    +  ++   +S  LP         K++    D
Sbjct  1281  LLPPSTMSNSSTFPPISEGLMPIDLPEQQNEFKVAYPVSPALPS--------KNYENSED  1332

Query  1058  YRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGARLMVPENGQK  1231
               + +  P  N     ++     +QKL+     S  + S    + L  G RL++P  G  
Sbjct  1333  SVSWLSVPFLNFYRSINKNFLLSSQKLDTFGEHSPIYISSFREAELQGGPRLLLPV-GLN  1391

Query  1232  DVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVS---DTNKESPIASKLSTW  1402
             D+V+ VYD+EPTS+I+YAL S EY+   +      EG   VS   + N   P+   +   
Sbjct  1392  DIVVPVYDDEPTSMIAYALMSPEYQRQTS-----VEGESLVSYPSELNIPRPVDDTIFDP  1446

Query  1403  QRF-GSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTC  1579
              R  GS+D   +   S  S      + +       + H R+S+ ++   T GKVK++VTC
Sbjct  1447  SRSNGSVDESILSISSSRSSSLLDPLSY-----TKALHARVSYGED--GTLGKVKYTVTC  1499

Query  1580  YFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELD  1759
             Y+AK+F+ALR  C PSEL+FIRSLSRCK+W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+
Sbjct  1500  YYAKRFEALRGICLPSELEFIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELE  1559

Query  1760  SFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRS  1939
             SF +FAP YF+YL++S S+ SPTCLAK++GIYQVA K LK GKETKMD+++MENL +GR+
Sbjct  1560  SFIKFAPAYFKYLSESISTKSPTCLAKILGIYQVATKQLKSGKETKMDVLIMENLLFGRT  1619

Query  1940  ISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSF  2116
             + R+YDLKGS R+RYN D+  +NKVLLD N +E++ T PIF+G+KAKR LERAVWNDT+F
Sbjct  1620  VKRLYDLKGSSRARYNPDSSGSNKVLLDQNLIEAMPTSPIFVGNKAKRLLERAVWNDTAF  1679

Query  2117  LAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LA   VMDYSLLVGVDEE+ ELVLGIID++RQYTWDKHLE+W
Sbjct  1680  LALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESW  1721



>ref|XP_006344558.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006344559.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006344560.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006344561.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X4 [Solanum tuberosum]
Length=1795

 Score =   492 bits (1267),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 327/792 (41%), Positives = 444/792 (56%), Gaps = 104/792 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAE-LLRKAKSLY  178
             RDCLR+YG G M+ACFRY+P+ + SV LPP  LEF S   Q WI KE  E + R+A +L+
Sbjct  999   RDCLRFYGFGKMVACFRYAPVHVYSVFLPPLKLEF-SYDNQEWIQKEGDEKVRRRANALF  1057

Query  179   AEISSAVQ-KLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             AE+S  +  KLE+           ++     I E++++L KEK  +  L +       + 
Sbjct  1058  AEVSKVLHVKLEKLSVDSSLKAPKIS---EQISEMEEILEKEKTEFEGLLRKALSREVKV  1114

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             G+  +D+LE+NRLR  L+   + WD RL ++        SS H +N+ +           
Sbjct  1115  GEPVLDILEINRLRRQLVFHAYLWDRRLIHL--------SSSHGKNSQT-----------  1155

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNG----  703
                 GSL    E+      +SEE P     S H +     D++     +  TS  G    
Sbjct  1156  ---QGSLTQLKEK---PLSSSEELPERTTISRHGKSLGSYDSVLQNVKTDITSNEGRHGQ  1209

Query  704   --DKTLETRLGLENAVNKSPLE-----RAPSAGSIL---------------------SDK  799
               D   E     EN  +    E     R+   G++L                     SD 
Sbjct  1210  IPDGVHERLTTDENLTHGKDSEDICAKRSTGDGNVLEPGKNVRRVLSDAKFPSVESLSDT  1269

Query  800   IDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRI  979
             +D AWTG   S   ++ H S   G   V S   L+ V + T  +     R     +   I
Sbjct  1270  LDAAWTG--ESHLAIKEHNSAFPGSFVVDSTA-LTGVSANTDVK-----RSTGDKNGAEI  1321

Query  980   QERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSS  1159
                 +K    +  YL T  + H    YR+  ++  +N         P+   KLN    + 
Sbjct  1322  PHLSAKS--DNTDYL-TWATEHFSNFYRSFNKNITAN---------PQYVAKLN--EHNP  1367

Query  1160  TTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSE  1339
                 S + +  +G   ++   G+ D+VI VYD+EPTSIISYAL S EY++       MS+
Sbjct  1368  VYILSFSELQHQGGARLLMAVGENDIVIPVYDDEPTSIISYALVSPEYRN------QMSD  1421

Query  1340  GGWGVSDTNKESPIASKLSTWQRFGSLDLDYM---HFGSYGSEDASGRIGFLFSDPKLSP  1510
                 + + +K S   S L +        +D +      S+GS + S   G    +  + P
Sbjct  1422  ESQNLKENHKFSASLSFLDSLNLLSLHSVDEIVSESPRSFGSTNESMSSGLSSRNSNMDP  1481

Query  1511  -------HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRW  1669
                    H RISF D+     GKVK++VTCY+AKQF+ LRK CCP E DFIRSLSRCK+W
Sbjct  1482  PAYINALHARISFSDD--GPLGKVKYTVTCYYAKQFETLRKSCCPCESDFIRSLSRCKKW  1539

Query  1670  SAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVG  1849
              AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL+DS +SGSPTCLAK++G
Sbjct  1540  GAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSDSIASGSPTCLAKILG  1599

Query  1850  IYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLN  2026
             IYQV  KHLKGGKE++MD++VMENL + R+I+R+YDLKGS RSRYNSD+  +NKVLLD N
Sbjct  1600  IYQVTSKHLKGGKESRMDVLVMENLLFKRNITRLYDLKGSSRSRYNSDSSGSNKVLLDQN  1659

Query  2027  FLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYM  2206
              +E++ T PIF+G++AKR L+RAVWNDTSFLA + VMDYSLLVGVDEE++ELVLGIID+M
Sbjct  1660  LIEAMPTSPIFVGTQAKRLLQRAVWNDTSFLASIDVMDYSLLVGVDEEKQELVLGIIDFM  1719

Query  2207  RQYTWDKHLETW  2242
             RQYTWDKHLETW
Sbjct  1720  RQYTWDKHLETW  1731



>gb|EAZ42938.1| hypothetical protein OsJ_27527 [Oryza sativa Japonica Group]
Length=1831

 Score =   493 bits (1268),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 319/791 (40%), Positives = 435/791 (55%), Gaps = 114/791 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPP  L+F SQ  Q W+ +E  E++  A+ L+ 
Sbjct  1044  RDCLRFYGFGEMVACFRYASIKVHSVYLPPPKLDFTSQ-HQEWVEQEANEVVDSAELLFT  1102

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ ++ E     G    NM    L   I+EL+++L  EK  + +  +    +   +
Sbjct  1103  EVLNALHQISEGRPITGSFDGNMKILELRRNIMELEEILQIEKADFTESLKNLLNKEIRK  1162

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLY--------YMESIFDNNFSSQHPE-------  490
             G+  ID+LE+N+LR  LL   + WD RL         Y +++      S+  +       
Sbjct  1163  GKPFIDILEVNKLRRQLLFLCYLWDQRLIFIANSGGKYCDTLGGLRVGSRSSDSNDKSVD  1222

Query  491   -NAVSCINPGEWGGETI--FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDA  661
              NA + +     G E +   K+GSL+ +                  LH+   EP  P  +
Sbjct  1223  TNATTKLEKSSKGSEVLSNAKEGSLKQSQSP---------------LHANDKEPNQPDQS  1267

Query  662   LSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLE-------------RAPSAGSI-----  787
                  G+SS    G   +E  +   N  N + ++             R  S G       
Sbjct  1268  ----NGNSSRIGAGLNGMEDAIAKINHSNSADVKDNLDHQESSIGVRRVLSDGQFPVNAD  1323

Query  788   LSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDS  967
             +SD +D  W G + +  D  +   L   E       Q   V +     ++S   V    S
Sbjct  1324  ISDTLDAKWRGENGTVPDTSILKPLALLEGSADLKNQAKAVPTNASLSVRSGDTVEDLSS  1383

Query  968   ALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLL  1147
              L++         P  ++  +L +                      S   PR     +  
Sbjct  1384  WLKM---------PYMTFYDSLNTN---------------------SGTAPRFGALADYN  1413

Query  1148  PSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKP  1327
             P   T F   +     GARL +P  G  DVVI V+D+EPTSIISYAL S  Y   + D+ 
Sbjct  1414  PVYITLFRELSQ--QGGARLFLP-TGANDVVIPVFDDEPTSIISYALVSPMYCHQMLDE-  1469

Query  1328  YMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMH-FGSYGSED-----ASGRIGFLF  1489
                      +  NK+ P +S       + S + +  H F  +GS D      SG  G   
Sbjct  1470  ---------NSKNKDGPDSSL--PLPVYDSGNFNPFHLFEDFGSADDLASSISGTRGSFV  1518

Query  1490  SDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRW  1669
              D     H R+ FED      GKVK++VTCY+AK F+ALR+ CCPSELDF+RS+SRCK+W
Sbjct  1519  PD---LVHLRVPFEDG--GPLGKVKYTVTCYYAKSFEALRRSCCPSELDFLRSISRCKKW  1573

Query  1670  SAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVG  1849
              AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+SF +F   YF+YL++S S+GSPT LAK++G
Sbjct  1574  GAQGGKSNVFFAKSLDDRFIIKQVTKTELESFLKFGLDYFKYLSESISTGSPTSLAKILG  1633

Query  1850  IYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNF  2029
             IYQV +KH+KGGKE+KMDL+VMENL +GR+I+R+YDLKGS RSRYN+D+ +NKVLLD N 
Sbjct  1634  IYQVTIKHVKGGKESKMDLLVMENLLFGRNITRLYDLKGSSRSRYNADSSSNKVLLDQNL  1693

Query  2030  LESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMR  2209
             +E++ T PIF+G+KAKR LERAVWNDTSFLAG+ VMDYSLLVGVDEE+ ELVLGIID+MR
Sbjct  1694  IEAMPTSPIFVGNKAKRLLERAVWNDTSFLAGIDVMDYSLLVGVDEEKHELVLGIIDFMR  1753

Query  2210  QYTWDKHLETW  2242
             QYTWDKHLETW
Sbjct  1754  QYTWDKHLETW  1764



>gb|EEC83663.1| hypothetical protein OsI_29434 [Oryza sativa Indica Group]
Length=1831

 Score =   492 bits (1267),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 319/791 (40%), Positives = 435/791 (55%), Gaps = 114/791 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPP  L+F SQ  Q W+ +E  E++  A+ L+ 
Sbjct  1044  RDCLRFYGFGEMVACFRYASIKVHSVYLPPPKLDFTSQ-HQEWVEQEANEVVDSAELLFT  1102

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ ++ E     G    NM    L   I+EL+++L  EK  + +  +    +   +
Sbjct  1103  EVLNALHQISEGRPITGSFDGNMKILELRRNIMELEEILQIEKADFTESLKNLLNKEIRK  1162

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLY--------YMESIFDNNFSSQHPE-------  490
             G+  ID+LE+N+LR  LL   + WD RL         Y +++      S+  +       
Sbjct  1163  GKPFIDILEVNKLRRQLLFLCYLWDQRLIFIANSGGKYCDTLGGLRVGSRSSDSNDKSVD  1222

Query  491   -NAVSCINPGEWGGETI--FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDA  661
              NA + +     G E +   K+GSL+ +                  LH+   EP  P  +
Sbjct  1223  TNATTKLEKSSKGSEVLSNAKEGSLKQSQSP---------------LHANDKEPNQPDQS  1267

Query  662   LSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLE-------------RAPSAGSI-----  787
                  G+SS    G   +E  +   N  N + ++             R  S G       
Sbjct  1268  ----NGNSSRIGAGLNGMEDAIAKINHSNSADVKDNLDHQESSIGVRRVLSDGQFPVNAD  1323

Query  788   LSDKIDCAWTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDS  967
             +SD +D  W G + +  D  +   L   E       Q   V +     ++S   V    S
Sbjct  1324  ISDTLDAKWRGENGTVPDTSILKPLALLEGSADLKNQAKVVPTNASLSVRSGDTVEDLSS  1383

Query  968   ALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLL  1147
              L++         P  ++  +L +                      S   PR     +  
Sbjct  1384  WLKM---------PYMTFYDSLNTN---------------------SGTAPRFGALADYN  1413

Query  1148  PSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKP  1327
             P   T F   +     GARL +P  G  DVVI V+D+EPTSIISYAL S  Y   + D+ 
Sbjct  1414  PVYITLFRELSQ--QGGARLFLP-TGANDVVIPVFDDEPTSIISYALVSPMYCHQMLDE-  1469

Query  1328  YMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMH-FGSYGSED-----ASGRIGFLF  1489
                      +  NK+ P +S       + S + +  H F  +GS D      SG  G   
Sbjct  1470  ---------NSKNKDGPDSSL--PLPVYDSGNFNPFHLFEDFGSADDLASSISGTRGSFV  1518

Query  1490  SDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRW  1669
              D     H R+ FED      GKVK++VTCY+AK F+ALR+ CCPSELDF+RS+SRCK+W
Sbjct  1519  PD---LVHLRVPFEDG--GPLGKVKYTVTCYYAKSFEALRRSCCPSELDFLRSISRCKKW  1573

Query  1670  SAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVG  1849
              AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+SF +F   YF+YL++S S+GSPT LAK++G
Sbjct  1574  GAQGGKSNVFFAKSLDDRFIIKQVTKTELESFLKFGLDYFKYLSESISTGSPTSLAKILG  1633

Query  1850  IYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKANKVLLDLNF  2029
             IYQV +KH+KGGKE+KMDL+VMENL +GR+I+R+YDLKGS RSRYN+D+ +NKVLLD N 
Sbjct  1634  IYQVTIKHVKGGKESKMDLLVMENLLFGRNITRLYDLKGSSRSRYNADSSSNKVLLDQNL  1693

Query  2030  LESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMR  2209
             +E++ T PIF+G+KAKR LERAVWNDTSFLAG+ VMDYSLLVGVDEE+ ELVLGIID+MR
Sbjct  1694  IEAMPTSPIFVGNKAKRLLERAVWNDTSFLAGIDVMDYSLLVGVDEEKHELVLGIIDFMR  1753

Query  2210  QYTWDKHLETW  2242
             QYTWDKHLETW
Sbjct  1754  QYTWDKHLETW  1764



>emb|CDX75341.1| BnaA01g03610D [Brassica napus]
Length=1712

 Score =   489 bits (1260),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 316/774 (41%), Positives = 445/774 (57%), Gaps = 113/774 (15%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPP+ LEFN ++ Q W+ KE  E++ KA+ L+ 
Sbjct  951   RDCLRFYGFGKMVACFRYASINIFAVSLPPAKLEFNCEN-QDWLQKESKEVINKAEVLFN  1009

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K        +    +   + EL  +L  ++K Y   L Q      S++G
Sbjct  1010  EVQEALSQISAKTMG-----SIPEKIKLSLEELAGLLDQRKKEYKESLQQML--SVSKDG  1062

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q T+D+L +N+LR  +L D +AWD  L    S+  NN+S +   N+ S         + +
Sbjct  1063  QPTVDILLINKLRRLILFDSYAWDECLTGAASMVRNNYS-EALRNSSS---------KVM  1112

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDA---LSYQQGSSSTSCNG--  703
              +D SLE   +E      +S +              +P+DA    S ++G S +  +G  
Sbjct  1113  GRDVSLEKLGDEKEKSIASSNDS-------------LPQDAEYDKSLKKGKSFSDISGKG  1159

Query  704   --------DKTLET-RLGLENAVNKSPL-------ERAPSAGSILSDKIDCAWTGIDPSS  835
                     DK  E+   G EN V  S +        +  +  + LSD +D AW G   +S
Sbjct  1160  VIPEDVGSDKPSESSEGGKENVVEPSQMVKVMLSESQTQATTTDLSDTLDAAWIGEQTAS  1219

Query  836   QDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSP  1015
             ++  +    +   R  ++ G  S+      K L S +   + +  +++Q        PSP
Sbjct  1220  ENNGIS---RPPSRTASANGTQSY----DLKLLDSESGPTNEEHTMQVQM-------PSP  1265

Query  1016  SYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPE  1195
             S+  +L   ++    ++++                  A+   +  SS       +     
Sbjct  1266  SFYYSLNKNYSLNSRKHIM------------------AEDRPVYVSSYRELEWQS-----  1302

Query  1196  GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKES  1375
             GARL++P  G  ++V+ VYD+EPTSII+YAL+S EY   +             S ++K  
Sbjct  1303  GARLLLPL-GINELVLPVYDDEPTSIIAYALTSSEYNAQM-------------SGSDKAR  1348

Query  1376  PIASKLSTWQRFGSLDLDYMH----FGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESC  1543
                    ++  F S++L  ++    F S   E  S  +        L  H R+SF DES 
Sbjct  1349  DRLDSGGSFSLFDSVNLLSLNSLSDFLSSADEQVSQLLQSSLYLKDL--HARVSFTDES-  1405

Query  1544  NTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDER  1723
                GKVK+SVTCY+AK+F+ALRK CCPSE DFIRSL RC++W AQGGKSNV+FAK+LD+R
Sbjct  1406  -PPGKVKYSVTCYYAKEFEALRKICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKTLDDR  1464

Query  1724  FIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMD  1903
             FIIKQ+ KTEL+SF +FAP YF+YLTDS  + SPT LAK++GIYQV+ KHLKGGKE KMD
Sbjct  1465  FIIKQVTKTELESFIKFAPAYFKYLTDSICTKSPTSLAKILGIYQVSSKHLKGGKEFKMD  1524

Query  1904  LIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKR  2080
             ++VMENL + R+ +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR
Sbjct  1525  VLVMENLLFKRNFARLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKR  1584

Query  2081  SLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
              LERAVWNDTSFLA ++VMDYSLLVGVDEER ELVLG ID+MRQYTWDKHLETW
Sbjct  1585  LLERAVWNDTSFLASIHVMDYSLLVGVDEERSELVLGTIDFMRQYTWDKHLETW  1638



>ref|XP_010465319.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
[Camelina sativa]
Length=1781

 Score =   491 bits (1263),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 316/766 (41%), Positives = 453/766 (59%), Gaps = 69/766 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+ ID+ SV LPPS+L FN ++ Q WI +E  E++ +A+ L++
Sbjct  998   RDCLRFYGFGNMVACFRYATIDVHSVYLPPSILSFNYEN-QDWIQRETDEVIERAELLFS  1056

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEK-NYWNDLHQPTHEETSEEG  358
             E+ +A+ ++ EK            G    I EL+++L +EK  +  ++ +  H E  +EG
Sbjct  1057  EVLNAISQIAEK------------GFRRRIGELEEVLQREKAEFEENMRKMLHRE-GKEG  1103

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRL------YYMESIFDNNFSSQHPENAVSCINPGE  520
             Q  +D+LEL R+R  LL   + WDHRL      + +E+  D     + P  A S   P  
Sbjct  1104  QPLVDILELYRIRRQLLFQSYMWDHRLINASTLHKLENSDDTKRDFEKPPLAKSQTLP--  1161

Query  521   WGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCN  700
                E   ++ SL    E N++   +S    G   + + +   +P      Q+       +
Sbjct  1162  ---EMNAENNSLLTGSEVNLNPDDDSTGDTGSLNNVQQEADTIPD---LNQEKEDGGEVS  1215

Query  701   GDKTL-ETRLGLENAVNKSPLERAPSAGSI----LSDKIDCAWTGIDPSSQDMQVHASLQ  865
               KTL +T   LEN ++   + R  S G I    LS  +D AW G   +S ++  +  + 
Sbjct  1216  PSKTLPDTSYPLENKLD---VRRTQSDGQIVMKNLSATLDAAWIGERQTSVEIPTNNKVL  1272

Query  866   EGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFH  1045
                  +++      + S   K +  P +   F  A           P SP+ LS  K++ 
Sbjct  1273  LPPSSMSNSSTFPPI-SEGLKPIDLPEQQNEFKVAY----------PVSPAMLS--KNYE  1319

Query  1046  AYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGARLMVPE  1219
                D  + +  P  N     ++     +QKL+     S  + S    + L  G RL++P 
Sbjct  1320  NSEDSVSWLSVPFLNFYRSINKNFLLSSQKLDTFGEHSPIYISSFREAELQGGPRLLLPV  1379

Query  1220  NGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVS---DTNKESPIASK  1390
              G  D+V+ VYD+EPTS+I+YAL S EY+   +      EG   VS   + N   P+   
Sbjct  1380  -GLNDIVVPVYDDEPTSMIAYALMSPEYQRQTS-----VEGESLVSYPSELNIARPVDDT  1433

Query  1391  LSTWQR-FGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKF  1567
             +    R  GS+D + +   S     +      L++    + H R+S+ ++   T GKVK+
Sbjct  1434  IFDPSRSTGSVD-ESILSMSSSRSSSLLLDPLLYTK---ALHARVSYGED--GTLGKVKY  1487

Query  1568  SVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQK  1747
             +VTCY+AK+F+ALR  C PSEL+FIRSLSRCK+W AQGGKSNV+FAK+LD+RFIIKQ+ K
Sbjct  1488  TVTCYYAKRFEALRGICLPSELEFIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTK  1547

Query  1748  TELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLF  1927
             TEL+SF +FAP YF+YL++S S+ SPTCLAK++GIYQVA K LK GKETKMD+++MENL 
Sbjct  1548  TELESFIKFAPAYFKYLSESISTKSPTCLAKILGIYQVATKQLKSGKETKMDVLIMENLL  1607

Query  1928  YGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWN  2104
             +GR++ R+YDLKGS R+RYN D+  +NKVLLD N +E++ T PIF+G+KAKR LERAVWN
Sbjct  1608  FGRTVKRLYDLKGSSRARYNPDSSGSNKVLLDQNLIEAMPTCPIFVGNKAKRLLERAVWN  1667

Query  2105  DTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             DT+FLA   VMDYSLLVGVDEE+ ELVLGIID++RQYTWDKHLE+W
Sbjct  1668  DTAFLALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESW  1713



>ref|XP_010917369.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Elaeis guineensis]
 ref|XP_010917370.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Elaeis guineensis]
 ref|XP_010917371.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Elaeis guineensis]
 ref|XP_010917372.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Elaeis guineensis]
Length=1854

 Score =   491 bits (1264),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 323/797 (41%), Positives = 445/797 (56%), Gaps = 99/797 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++ SV LPP  L+FN Q  Q W+ KE  E+   A+ L+ 
Sbjct  1036  RDCLRFYGFGRMVACFRYASINLHSVYLPPPKLDFNYQ-HQEWVEKEANEVAELAELLFT  1094

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHN--CILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ + ++++ E+  + G    NM    +    +EL+ +L KEK  + +  Q   ++ + +
Sbjct  1095  EVLNDLRQIAERKPNTGSFDGNMKVTESRRATIELEGILQKEKAEFEESIQKIMKKEARK  1154

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCI---NPGEWG  526
             G+  ID+LE+N+LR  LL   + WD RL Y         S   P   +S     N  +  
Sbjct  1155  GKPPIDILEVNKLRRQLLFQSYFWDQRLSYSAG------SHNGPHEVLSAFMTRNKEKLN  1208

Query  527   GETIFKDGS----LEHAYEENVHEFPNSE--------ECPG---EGLHSEHDEPPVPKDA  661
                   D +    L+ ++      F NS          CP    EGL    ++    +  
Sbjct  1209  STEKLVDSNTAPRLQRSFMSLGTAFSNSRGEDSIMGSTCPADHEEGL-DHFNQRNASQQK  1267

Query  662   LSYQQ---------GSSSTSCN-GDK--TLETRLGLENAVNKSPLERAPSAGSILSDKID  805
              +++Q         GS STS N GD+   LE  LG+   ++           + LSD ++
Sbjct  1268  RNHEQANMNRKRSNGSLSTSINAGDQLDPLEPGLGVRRVLSDGQF----PVRADLSDTLN  1323

Query  806   CAWTG-IDPSSQD--MQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALR  976
               W G   P+  D  M   ++  E E  V +             +L        F SAL 
Sbjct  1324  AKWGGESGPALADASMSNTSASVEAETTVPALEDSEEQSRADATKL--------FASALP  1375

Query  977   IQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMIC-----SQALPREAQKLN  1141
              + R S                    D+ N I+ P   +   C     S   PR +    
Sbjct  1376  ARWRDSSE------------------DFSNFIKMPF--VTFYCDINKNSGNTPRFSALSE  1415

Query  1142  LLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTD  1321
               P   ++F     ++ +G   ++   G  D VI +YD+EPTSIISYAL S +Y   +++
Sbjct  1416  YNPVYVSSFR---DLVRQGGARLLLPIGVNDTVIPIYDDEPTSIISYALVSPDYHFQMSE  1472

Query  1322  KPYMSEGGWGVSDTNKESPIASKLSTWQRFGSL-DLDYMHFGSYGSEDA-----SGRIGF  1483
             K   +  G    D++   PI      +  F  L D     F S+G  D      SG  G 
Sbjct  1473  KREKARDG---RDSSLSLPIYDS-ENFHSFQCLDDASSESFKSFGLVDESILSLSGSRGP  1528

Query  1484  LFSDPKLSP---HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLS  1654
             L  DP  S    H R+SF D+     GK +++VTCY+AK F+ALR+ CCPSELDF+RSLS
Sbjct  1529  LVLDPVASTKAMHIRVSFGDD--GPLGKARYTVTCYYAKSFEALRRICCPSELDFVRSLS  1586

Query  1655  RCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCL  1834
             RCK+W AQGGKSNV+FAKSLD+RF+IKQ+ KTEL+SF +FAP+YF+YL++S  +GSPTCL
Sbjct  1587  RCKKWGAQGGKSNVFFAKSLDDRFVIKQVTKTELESFIKFAPEYFKYLSESIKTGSPTCL  1646

Query  1835  AKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKV  2011
             AK++GIYQV +KHLKGGKE++MDL+VMENL +GR+++R+YDLKGS RSRYN D+   NKV
Sbjct  1647  AKILGIYQVTIKHLKGGKESRMDLLVMENLLFGRNVTRLYDLKGSSRSRYNPDSSGNNKV  1706

Query  2012  LLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLG  2191
             LLD N +E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDE++ ELVLG
Sbjct  1707  LLDQNLIEAMPTSPIFMGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGVDEDKHELVLG  1766

Query  2192  IIDYMRQYTWDKHLETW  2242
             IID+MRQYTWDK LETW
Sbjct  1767  IIDFMRQYTWDKQLETW  1783



>ref|NP_001190899.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A [Arabidopsis 
thaliana]
 gb|AEE86196.1| 1-phosphatidylinositol-3-phosphate (PtdIns3P) 5-kinase-like protein 
[Arabidopsis thaliana]
Length=1753

 Score =   490 bits (1261),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 311/770 (40%), Positives = 436/770 (57%), Gaps = 84/770 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPP+ L FN ++ Q W+ KE  E+++KA+ L+ 
Sbjct  972   RDCLRFYGFGRMVACFRYASINIYAVTLPPAKLYFNYEN-QEWLQKESKEVIKKAEVLFN  1030

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+  A+ ++  K    G   +  N +   + EL  +L + K  +  +         ++GQ
Sbjct  1031  EVQEALSQISAKTMGAGSKGSTPNKIKLSLEELAGLLEQRKKEYKQMLN-----VVKDGQ  1085

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
              TID+L +N+LR  ++ D +AWD  L    ++  NN+  + P+N+           + + 
Sbjct  1086  PTIDILLINKLRRLIIFDSYAWDECLAGAANMVRNNYL-EAPKNSAP---------KVMG  1135

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTS----CNGDK  709
             ++ SLE   +E V   P       + L  + D         S+   S   +       D+
Sbjct  1136  RNVSLEKLSDEKVKSIPTHVAICNDSLLQDADYETCLNQGKSFADTSGKFAIPEDVGSDR  1195

Query  710   TLETRL-------GLENAVNKSPLERAPSA-----GSILSDKIDCAWTGIDPSSQDMQVH  853
               + R+       G +N V  S + +          + LSD +D AW G   +S++    
Sbjct  1196  PPDCRMEFDPSEGGKDNFVESSQVVKPAHTESQFQATDLSDTLDAAWIGEQTTSEN----  1251

Query  854   ASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTL  1033
                +   R  ++ G       P  + L S + + +F       E  ++   PSPS+  +L
Sbjct  1252  GIFRPPSRAASTNG----TQIPDLRLLGSESEL-NFKGGPTNDEHTTQVQLPSPSFYYSL  1306

Query  1034  KSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMV  1213
                ++    ++++                  A+   +  SS       +     GARL++
Sbjct  1307  NKNYSLNSRKHIM------------------AEDRPVYVSSYRELEWRS-----GARLLL  1343

Query  1214  PENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT--DKP---YMSEGGWGVSDTNKESP  1378
             P  G  D+V+ VYD+EPTSII+YAL+S EYK  ++  DK      S G + + D+     
Sbjct  1344  PL-GCNDLVLPVYDDEPTSIIAYALTSSEYKAQMSGSDKSRDRLDSGGSFSLFDSVNLLS  1402

Query  1379  IASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSP-HPRISFEDESCNTGG  1555
             + S            +D     S   E  S     L S   L   H RISF DE     G
Sbjct  1403  LNSLSDL-------SVDMSRSLSSADEQVSQ---LLHSSLYLKDLHARISFTDE--GPPG  1450

Query  1556  KVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIK  1735
             KVK+SVTCY+AK+F+ALR  CCPSE DFIRSL RC++W AQGGKSNV+FAKSLD+RFIIK
Sbjct  1451  KVKYSVTCYYAKEFEALRMICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKSLDDRFIIK  1510

Query  1736  QMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVM  1915
             Q+ KTEL+SF +F P YF+YLT+S S+ SPT LAK++GIYQV+ KHLKGGKE KMD++VM
Sbjct  1511  QVTKTELESFIKFGPAYFKYLTESISTKSPTSLAKILGIYQVSSKHLKGGKEFKMDVLVM  1570

Query  1916  ENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLER  2092
             ENL + R+ +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR LER
Sbjct  1571  ENLLFKRNFTRLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRLLER  1630

Query  2093  AVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AVWNDTSFLA ++VMDYSLLVGVDEER ELVLGIID+MRQYTWDKHLETW
Sbjct  1631  AVWNDTSFLASIHVMDYSLLVGVDEERNELVLGIIDFMRQYTWDKHLETW  1680



>ref|XP_009404098.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=1786

 Score =   490 bits (1261),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 323/803 (40%), Positives = 441/803 (55%), Gaps = 120/803 (15%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++ SV LPP  ++FN Q  Q WI KE  E+  +A++L+ 
Sbjct  979   RDCLRFYGFGRMVACFRYASINVHSVYLPPPKVDFNYQ-HQEWISKEANEVAERAENLFR  1037

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EI S + + +E     G     +    + I+EL+D L  EK  + D+     ++   +G+
Sbjct  1038  EIHSDLCQFKETMIQNGS--MEVPEFRHHIVELQDFLQTEKAEFEDVLHKVLKKEVRKGE  1095

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYY-------------------------MESIFDN  466
               ID+LE+N+LR  L+   + WD RL +                         +E I D 
Sbjct  1096  PVIDILEVNKLRRQLIFHSYLWDQRLLFAAELDNCPKGICNSFLTREKEKHCTVEKIKDL  1155

Query  467   NFSSQHPENAVSCIN--PGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDE  640
             N + + P+    C N  P E+  + +F+ G+      E +    +S+E  G+ +      
Sbjct  1156  NLALK-PQKDSQCSNAAPVEFKTDELFEQGTHTANNPEGLFGHHDSDEL-GQKIRD----  1209

Query  641   PPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKID  805
               V  D++  +Q  +S   +   T E+ + LE+ +      R  S G       LSD  D
Sbjct  1210  --VEMDSMQEKQNQTSLYTSISAT-ESSILLESGLVG---RRTLSDGQFPVLTNLSDTFD  1263

Query  806   CAWTG------IDPSSQDM------QVHASLQEGERRVASFGQLSHVDSPTCKRLKSPAR  949
               W G       D  +QD+       V   + EG    A         S    +L   A 
Sbjct  1264  ARWIGDSGTALADVMTQDLIVPMENSVAMPISEGSEERAGADITQSFTSILLSKLGDSAE  1323

Query  950   VYSFDSAL---RIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALP  1120
              +S    +    I   I+K    SP        F    +Y ++ R        I  + L 
Sbjct  1324  DFSARIGIPFVNIYRTINKNWGNSPR-------FSDLNEYSSVFR--------IFLRELE  1368

Query  1121  REAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKE  1300
             R+                       GAR ++P  G  D VI +YD+EPTSIIS+AL S E
Sbjct  1369  RQG----------------------GARFLLPV-GLNDTVIPIYDDEPTSIISFALVSPE  1405

Query  1301  YKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMH---FGSYGSED---  1462
             Y   ++D+      G        +S ++  L     F S   D      F S+GS +   
Sbjct  1406  YHVQLSDERDRIRDG-------TDSSLSLPLYDAGNFLSQSFDETFSDPFKSFGSTEDNI  1458

Query  1463  --ASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELD  1636
                SG  G L  D  +  H R+SF DE     GKVK++VTCY+AK FDALR+ CCPSELD
Sbjct  1459  LSLSGSRGSLVLDKTM--HVRVSFTDE--GPFGKVKYTVTCYYAKCFDALRRACCPSELD  1514

Query  1637  FIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSS  1816
             FIRSLSRCK+W AQGGKSNV+FAKSLD+RFI+KQ+ KTEL+SF +FAP+YF+Y ++S ++
Sbjct  1515  FIRSLSRCKKWGAQGGKSNVFFAKSLDDRFIVKQVTKTELESFIKFAPEYFKYYSESIAT  1574

Query  1817  GSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDT  1996
             GSPT LAK++GIYQV  K+LKGGK+ +MD++VMENL + R+I+R+YDLKGS RSRYN D+
Sbjct  1575  GSPTSLAKILGIYQVTSKNLKGGKDIRMDVLVMENLLFRRNITRLYDLKGSSRSRYNPDS  1634

Query  1997  KA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEER  2173
                NKVLLD N +E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDEE+
Sbjct  1635  SGNNKVLLDQNLIEAMPTSPIFVGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEK  1694

Query  2174  KELVLGIIDYMRQYTWDKHLETW  2242
              ELVLGIID+MRQYTWDKHLETW
Sbjct  1695  HELVLGIIDFMRQYTWDKHLETW  1717



>ref|XP_010687594.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1782

 Score =   490 bits (1261),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 329/790 (42%), Positives = 448/790 (57%), Gaps = 91/790 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             +DCLR+YGCG M+ACFRY+PI + SV LPPS +EF   + + WI KE  E+  +A+ LY 
Sbjct  974   KDCLRFYGCGRMVACFRYAPIVVHSVYLPPSNIEFTCDNLE-WIRKEADEVRDRAELLYT  1032

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ ++ EK +  G   +N    GL   ++EL+ +L KEK  + +  Q   +    E
Sbjct  1033  EVCNAINEISEKLSRSGTLESNTKAFGLRKHVMELEWILKKEKEEFEESLQTALQT---E  1089

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRL------------YYMESIFDNNFSSQHPENAV  499
              Q  ID+LE+NRLR  LL   + WD RL            Y  +S+   +      E   
Sbjct  1090  RQVGIDILEINRLRRRLLIQSYVWDQRLIHTSNLDAKIAQYGSDSLILKSLEETPNEVGK  1149

Query  500   SCINPG-----EWGG-ETIFKD--GSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPK  655
             + I+ G     E GG  ++  D     + + + NV +F       GE +    D+ P+ K
Sbjct  1150  TNISTGSEIVKELGGCGSVISDVKTGTDVSQDLNVKQFNEHNSYSGEKIL---DQVPICK  1206

Query  656   DALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPL---ERAPSAGSI-----LSDKIDCA  811
             +                + L   + L  A    P+    R  SAG       LSD +D A
Sbjct  1207  EV--------------GEVLPDGINLSEAGPVPPVNTVRRVISAGQFPVTVSLSDTLDAA  1252

Query  812   WTGIDPSSQDMQVHASLQEGERRV---ASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
             W G   S        S++  E  V   +SF Q S   SP+ ++         F       
Sbjct  1253  WIGESHS-------GSVKPKENDVIDSSSFVQ-SVAASPSSEKHSDAWDETEF-------  1297

Query  983   ERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSST  1162
              R+S    P+       KS     +    ++ P  +I     ++     QKL+ +   + 
Sbjct  1298  HRVSSLALPT-------KSSDFLDNSTYWLKVPFMSIYQSLGKSSSWNTQKLDAVGDYNP  1350

Query  1163  TFTSHASILPE--GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMS  1336
              F S    L    GARL++P  G  D VI VYD+EPTSII+YAL S +Y+  ++D P M 
Sbjct  1351  VFVSSFRELERQGGARLLLPV-GVNDTVIPVYDDEPTSIIAYALVSADYQIQMSDDPDMK  1409

Query  1337  EGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDA----SGRIGFLFSDPKL  1504
             + G   + +   S  AS LS      +       FGS  SE+     SG       DP  
Sbjct  1410  KDGSEYALSLPLSHSASSLSLPSPGEAASGSMRSFGS--SEETLLSMSGSRNSFILDPLF  1467

Query  1505  ---SPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSA  1675
                + H R+SF D      GKVK++VTCY+AK+F+ALR   CPSE+DF+RSLSRCK+W A
Sbjct  1468  YTKALHARVSFSDN--GPLGKVKYTVTCYYAKRFEALRMISCPSEMDFVRSLSRCKKWGA  1525

Query  1676  QGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIY  1855
             QGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S  S SPTCLAK++GIY
Sbjct  1526  QGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESIRSSSPTCLAKILGIY  1585

Query  1856  QVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFL  2032
             QV  KH+KGG+E KMD++VMENL + R++ R+YDLKGS RSRYN+D+   NKVLLD N +
Sbjct  1586  QVTSKHIKGGREIKMDVLVMENLLFRRNVVRLYDLKGSCRSRYNADSSGGNKVLLDQNLI  1645

Query  2033  ESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQ  2212
             E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVG+DEE++ELV+GIID+MRQ
Sbjct  1646  ETMPTSPIFVGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGIDEEKRELVVGIIDFMRQ  1705

Query  2213  YTWDKHLETW  2242
             YTWDKHLETW
Sbjct  1706  YTWDKHLETW  1715



>ref|XP_009404097.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=1816

 Score =   490 bits (1261),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 323/803 (40%), Positives = 441/803 (55%), Gaps = 120/803 (15%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I++ SV LPP  ++FN Q  Q WI KE  E+  +A++L+ 
Sbjct  1009  RDCLRFYGFGRMVACFRYASINVHSVYLPPPKVDFNYQ-HQEWISKEANEVAERAENLFR  1067

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             EI S + + +E     G     +    + I+EL+D L  EK  + D+     ++   +G+
Sbjct  1068  EIHSDLCQFKETMIQNGS--MEVPEFRHHIVELQDFLQTEKAEFEDVLHKVLKKEVRKGE  1125

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYY-------------------------MESIFDN  466
               ID+LE+N+LR  L+   + WD RL +                         +E I D 
Sbjct  1126  PVIDILEVNKLRRQLIFHSYLWDQRLLFAAELDNCPKGICNSFLTREKEKHCTVEKIKDL  1185

Query  467   NFSSQHPENAVSCIN--PGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDE  640
             N + + P+    C N  P E+  + +F+ G+      E +    +S+E  G+ +      
Sbjct  1186  NLALK-PQKDSQCSNAAPVEFKTDELFEQGTHTANNPEGLFGHHDSDEL-GQKIRD----  1239

Query  641   PPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKID  805
               V  D++  +Q  +S   +   T E+ + LE+ +      R  S G       LSD  D
Sbjct  1240  --VEMDSMQEKQNQTSLYTSISAT-ESSILLESGLVG---RRTLSDGQFPVLTNLSDTFD  1293

Query  806   CAWTG------IDPSSQDM------QVHASLQEGERRVASFGQLSHVDSPTCKRLKSPAR  949
               W G       D  +QD+       V   + EG    A         S    +L   A 
Sbjct  1294  ARWIGDSGTALADVMTQDLIVPMENSVAMPISEGSEERAGADITQSFTSILLSKLGDSAE  1353

Query  950   VYSFDSAL---RIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALP  1120
              +S    +    I   I+K    SP        F    +Y ++ R        I  + L 
Sbjct  1354  DFSARIGIPFVNIYRTINKNWGNSPR-------FSDLNEYSSVFR--------IFLRELE  1398

Query  1121  REAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKE  1300
             R+                       GAR ++P  G  D VI +YD+EPTSIIS+AL S E
Sbjct  1399  RQG----------------------GARFLLPV-GLNDTVIPIYDDEPTSIISFALVSPE  1435

Query  1301  YKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMH---FGSYGSED---  1462
             Y   ++D+      G        +S ++  L     F S   D      F S+GS +   
Sbjct  1436  YHVQLSDERDRIRDG-------TDSSLSLPLYDAGNFLSQSFDETFSDPFKSFGSTEDNI  1488

Query  1463  --ASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELD  1636
                SG  G L  D  +  H R+SF DE     GKVK++VTCY+AK FDALR+ CCPSELD
Sbjct  1489  LSLSGSRGSLVLDKTM--HVRVSFTDEG--PFGKVKYTVTCYYAKCFDALRRACCPSELD  1544

Query  1637  FIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSS  1816
             FIRSLSRCK+W AQGGKSNV+FAKSLD+RFI+KQ+ KTEL+SF +FAP+YF+Y ++S ++
Sbjct  1545  FIRSLSRCKKWGAQGGKSNVFFAKSLDDRFIVKQVTKTELESFIKFAPEYFKYYSESIAT  1604

Query  1817  GSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDT  1996
             GSPT LAK++GIYQV  K+LKGGK+ +MD++VMENL + R+I+R+YDLKGS RSRYN D+
Sbjct  1605  GSPTSLAKILGIYQVTSKNLKGGKDIRMDVLVMENLLFRRNITRLYDLKGSSRSRYNPDS  1664

Query  1997  KA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEER  2173
                NKVLLD N +E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDEE+
Sbjct  1665  SGNNKVLLDQNLIEAMPTSPIFVGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGVDEEK  1724

Query  2174  KELVLGIIDYMRQYTWDKHLETW  2242
              ELVLGIID+MRQYTWDKHLETW
Sbjct  1725  HELVLGIIDFMRQYTWDKHLETW  1747



>ref|XP_010687592.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010687593.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1802

 Score =   489 bits (1260),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 329/790 (42%), Positives = 448/790 (57%), Gaps = 91/790 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             +DCLR+YGCG M+ACFRY+PI + SV LPPS +EF   + + WI KE  E+  +A+ LY 
Sbjct  994   KDCLRFYGCGRMVACFRYAPIVVHSVYLPPSNIEFTCDNLE-WIRKEADEVRDRAELLYT  1052

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ ++ EK +  G   +N    GL   ++EL+ +L KEK  + +  Q   +    E
Sbjct  1053  EVCNAINEISEKLSRSGTLESNTKAFGLRKHVMELEWILKKEKEEFEESLQTALQT---E  1109

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRL------------YYMESIFDNNFSSQHPENAV  499
              Q  ID+LE+NRLR  LL   + WD RL            Y  +S+   +      E   
Sbjct  1110  RQVGIDILEINRLRRRLLIQSYVWDQRLIHTSNLDAKIAQYGSDSLILKSLEETPNEVGK  1169

Query  500   SCINPG-----EWGG-ETIFKD--GSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPK  655
             + I+ G     E GG  ++  D     + + + NV +F       GE +    D+ P+ K
Sbjct  1170  TNISTGSEIVKELGGCGSVISDVKTGTDVSQDLNVKQFNEHNSYSGEKIL---DQVPICK  1226

Query  656   DALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPL---ERAPSAGSI-----LSDKIDCA  811
             +                + L   + L  A    P+    R  SAG       LSD +D A
Sbjct  1227  EV--------------GEVLPDGINLSEAGPVPPVNTVRRVISAGQFPVTVSLSDTLDAA  1272

Query  812   WTGIDPSSQDMQVHASLQEGERRV---ASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQ  982
             W G   S        S++  E  V   +SF Q S   SP+ ++         F       
Sbjct  1273  WIGESHS-------GSVKPKENDVIDSSSFVQ-SVAASPSSEKHSDAWDETEF-------  1317

Query  983   ERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSST  1162
              R+S    P+       KS     +    ++ P  +I     ++     QKL+ +   + 
Sbjct  1318  HRVSSLALPT-------KSSDFLDNSTYWLKVPFMSIYQSLGKSSSWNTQKLDAVGDYNP  1370

Query  1163  TFTSHASILPE--GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMS  1336
              F S    L    GARL++P  G  D VI VYD+EPTSII+YAL S +Y+  ++D P M 
Sbjct  1371  VFVSSFRELERQGGARLLLPV-GVNDTVIPVYDDEPTSIIAYALVSADYQIQMSDDPDMK  1429

Query  1337  EGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDA----SGRIGFLFSDPKL  1504
             + G   + +   S  AS LS      +       FGS  SE+     SG       DP  
Sbjct  1430  KDGSEYALSLPLSHSASSLSLPSPGEAASGSMRSFGS--SEETLLSMSGSRNSFILDPLF  1487

Query  1505  ---SPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSA  1675
                + H R+SF D      GKVK++VTCY+AK+F+ALR   CPSE+DF+RSLSRCK+W A
Sbjct  1488  YTKALHARVSFSDN--GPLGKVKYTVTCYYAKRFEALRMISCPSEMDFVRSLSRCKKWGA  1545

Query  1676  QGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIY  1855
             QGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S  S SPTCLAK++GIY
Sbjct  1546  QGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESIRSSSPTCLAKILGIY  1605

Query  1856  QVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFL  2032
             QV  KH+KGG+E KMD++VMENL + R++ R+YDLKGS RSRYN+D+   NKVLLD N +
Sbjct  1606  QVTSKHIKGGREIKMDVLVMENLLFRRNVVRLYDLKGSCRSRYNADSSGGNKVLLDQNLI  1665

Query  2033  ESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQ  2212
             E++ T PIF+G+KAKR LERAVWNDTSFLA + VMDYSLLVG+DEE++ELV+GIID+MRQ
Sbjct  1666  ETMPTSPIFVGNKAKRLLERAVWNDTSFLASIDVMDYSLLVGIDEEKRELVVGIIDFMRQ  1725

Query  2213  YTWDKHLETW  2242
             YTWDKHLETW
Sbjct  1726  YTWDKHLETW  1735



>ref|XP_009124093.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A 
isoform X2 [Brassica rapa]
Length=1719

 Score =   488 bits (1257),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 317/775 (41%), Positives = 439/775 (57%), Gaps = 108/775 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPP+ LEFN ++ Q W+ +E  E++ KA+ L+ 
Sbjct  951   RDCLRFYGFGKMVACFRYASINIFAVSLPPAKLEFNCEN-QDWLQRESKEVINKAEVLFN  1009

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K        +    +   + EL  +L  ++K Y   L Q      S+EG
Sbjct  1010  EVQEALSQISAKTMG-----SIPEKIKLSLEELAGLLDQRKKEYKESLQQML--SVSKEG  1062

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q T+D+L +N+LR  +L D +AWD  L    S+  NN+S     ++           + +
Sbjct  1063  QPTVDILLINKLRRLILFDSYAWDECLTGAASMVRNNYSEALRTSS----------SKVM  1112

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDA---LSYQQGSSSTSCNG--  703
              +D SLE   +E      +S +              +P+DA    S ++G S +  +G  
Sbjct  1113  GRDFSLEKLGDEKEKSIASSNDS-------------LPQDAEYDKSLKKGKSFSDISGKG  1159

Query  704   --------DKTLET-RLGLENAVNKSPLERA-------PSAGSILSDKIDCAWTGIDPSS  835
                     DK  E+   G EN V  S + +A        +  + LSD +D AW G   +S
Sbjct  1160  VIPEDVGSDKPSESSEGGKENVVEPSQMVKAMLSESQTQATTTDLSDTLDAAWIGEQTAS  1219

Query  836   QDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSP  1015
             ++      +     R AS       D           ++   +S L  +E+  +   PSP
Sbjct  1220  EN----NGISRPPSRAASANGTQSYD----------LKLSDSESGLTSEEQTLQVQMPSP  1265

Query  1016  SYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPE  1195
             S+  +L   ++    ++++                  A+   +  SS       +     
Sbjct  1266  SFYYSLNKNYSLNSRKHIM------------------AEDRPVYVSSYRELEWQS-----  1302

Query  1196  GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT--DKP---YMSEGGWGVSD  1360
             GARL++P  G  D+V+ VYD+EPTSII+YAL+S EY   ++  DK      S G + + D
Sbjct  1303  GARLLLPL-GINDLVLPVYDDEPTSIIAYALTSSEYNAQMSGSDKARDRLDSGGSFSLFD  1361

Query  1361  TNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDES  1540
             +     + S            +D     S   E  S  +        L  H R+SF DES
Sbjct  1362  SVNLLSLNSLSDL-------SVDMSRSLSSADEQVSQLLQSSLYLKDL--HARVSFTDES  1412

Query  1541  CNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDE  1720
                 GKVK+SVTCY+AK+F+ALRK CCPSE DFIRSL RC++W AQGGKSNV+FAK+LD+
Sbjct  1413  --PPGKVKYSVTCYYAKEFEALRKICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKTLDD  1470

Query  1721  RFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKM  1900
             RFIIKQ+ KTEL+SF +FAP YF+YLTDS  + SPT LAK++GIYQV+ KHLKGGKE KM
Sbjct  1471  RFIIKQVTKTELESFIKFAPAYFKYLTDSICTKSPTSLAKILGIYQVSSKHLKGGKEFKM  1530

Query  1901  DLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAK  2077
             D++VMENL + R+ +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAK
Sbjct  1531  DVLVMENLLFKRNFARLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAK  1590

Query  2078  RSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             R LERAVWNDTSFLA ++VMDYSLLVGVDEER ELVLG ID+MRQYTWDKHLETW
Sbjct  1591  RLLERAVWNDTSFLASIHVMDYSLLVGVDEERSELVLGTIDFMRQYTWDKHLETW  1645



>ref|XP_009123916.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A 
isoform X1 [Brassica rapa]
 ref|XP_009123970.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A 
isoform X1 [Brassica rapa]
 ref|XP_009124040.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A 
isoform X1 [Brassica rapa]
Length=1721

 Score =   488 bits (1257),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 317/775 (41%), Positives = 439/775 (57%), Gaps = 108/775 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPP+ LEFN ++ Q W+ +E  E++ KA+ L+ 
Sbjct  953   RDCLRFYGFGKMVACFRYASINIFAVSLPPAKLEFNCEN-QDWLQRESKEVINKAEVLFN  1011

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K        +    +   + EL  +L  ++K Y   L Q      S+EG
Sbjct  1012  EVQEALSQISAKTMG-----SIPEKIKLSLEELAGLLDQRKKEYKESLQQML--SVSKEG  1064

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q T+D+L +N+LR  +L D +AWD  L    S+  NN+S     ++           + +
Sbjct  1065  QPTVDILLINKLRRLILFDSYAWDECLTGAASMVRNNYSEALRTSS----------SKVM  1114

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDA---LSYQQGSSSTSCNG--  703
              +D SLE   +E      +S +              +P+DA    S ++G S +  +G  
Sbjct  1115  GRDFSLEKLGDEKEKSIASSNDS-------------LPQDAEYDKSLKKGKSFSDISGKG  1161

Query  704   --------DKTLET-RLGLENAVNKSPLERA-------PSAGSILSDKIDCAWTGIDPSS  835
                     DK  E+   G EN V  S + +A        +  + LSD +D AW G   +S
Sbjct  1162  VIPEDVGSDKPSESSEGGKENVVEPSQMVKAMLSESQTQATTTDLSDTLDAAWIGEQTAS  1221

Query  836   QDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSP  1015
             ++      +     R AS       D           ++   +S L  +E+  +   PSP
Sbjct  1222  EN----NGISRPPSRAASANGTQSYD----------LKLSDSESGLTSEEQTLQVQMPSP  1267

Query  1016  SYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPE  1195
             S+  +L   ++    ++++                  A+   +  SS       +     
Sbjct  1268  SFYYSLNKNYSLNSRKHIM------------------AEDRPVYVSSYRELEWQS-----  1304

Query  1196  GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVT--DKP---YMSEGGWGVSD  1360
             GARL++P  G  D+V+ VYD+EPTSII+YAL+S EY   ++  DK      S G + + D
Sbjct  1305  GARLLLPL-GINDLVLPVYDDEPTSIIAYALTSSEYNAQMSGSDKARDRLDSGGSFSLFD  1363

Query  1361  TNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDES  1540
             +     + S            +D     S   E  S  +        L  H R+SF DES
Sbjct  1364  SVNLLSLNSLSDL-------SVDMSRSLSSADEQVSQLLQSSLYLKDL--HARVSFTDES  1414

Query  1541  CNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDE  1720
                 GKVK+SVTCY+AK+F+ALRK CCPSE DFIRSL RC++W AQGGKSNV+FAK+LD+
Sbjct  1415  --PPGKVKYSVTCYYAKEFEALRKICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKTLDD  1472

Query  1721  RFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKM  1900
             RFIIKQ+ KTEL+SF +FAP YF+YLTDS  + SPT LAK++GIYQV+ KHLKGGKE KM
Sbjct  1473  RFIIKQVTKTELESFIKFAPAYFKYLTDSICTKSPTSLAKILGIYQVSSKHLKGGKEFKM  1532

Query  1901  DLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAK  2077
             D++VMENL + R+ +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAK
Sbjct  1533  DVLVMENLLFKRNFARLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAK  1592

Query  2078  RSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             R LERAVWNDTSFLA ++VMDYSLLVGVDEER ELVLG ID+MRQYTWDKHLETW
Sbjct  1593  RLLERAVWNDTSFLASIHVMDYSLLVGVDEERSELVLGTIDFMRQYTWDKHLETW  1647



>ref|XP_008228111.1| PREDICTED: LOW QUALITY PROTEIN: 1-phosphatidylinositol-3-phosphate 
5-kinase FAB1B [Prunus mume]
Length=1804

 Score =   489 bits (1258),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 316/777 (41%), Positives = 445/777 (57%), Gaps = 87/777 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SVR                      E++ +A+ L++
Sbjct  1018  RDCLRFYGFGKMVACFRYASIDVHSVR--------------------TDEVVERAELLFS  1057

Query  182   EISSAVQKLEEKCASVGCDWNNM---NGLHNCILELKDMLMKEKNYWNDLHQPTHEETSE  352
             E+ +A++++ EK +  G   + M      H  I+EL+ ML KEK  + +L Q T    + 
Sbjct  1058  EVLNALRQIAEKRSGSGSYTSGMVTPESRHQ-IVELEGMLQKEKVEFEELLQKTLNREAR  1116

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNN-----FSSQHPENAVSCINPG  517
             +GQ  ID+LE+NRLR  LL   + WDHRL Y  ++ DNN      +S  P+     +N G
Sbjct  1117  KGQPVIDILEINRLRRQLLFQSYMWDHRLIYAANL-DNNSLQDGLNSSVPDERKPVVNNG  1175

Query  518   EWGGETI-FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTS  694
                   +  K G   ++ +  + +   ++E    G     D        + Y++      
Sbjct  1176  NIADVNVAIKPGKCYNSCDSFLVDAMLNKEFDHGG-----DFGSTANTDMVYKERDIGQD  1230

Query  695   CNGDKTLETRLGLENAV--------NKSPLERAPSAGSI----LSDKIDCAWTGIDPSSQ  838
              N +K  +  L  E ++         ++ + R  S G      LSD +D AWTG      
Sbjct  1231  SNNEKEDQANLPGEVSICDQSEPLKPRTSMRRTLSDGQFPIMDLSDTLDTAWTG------  1284

Query  839   DMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARV-YSFDSA-LRIQERISKRLPPS  1012
               +  + +   +    +   L+  DS       SP +   + D A  +   +++  + P+
Sbjct  1285  --ENQSGIGIAKDNTCAVPVLAMADSNA-----SPVKEGLNLDHAEYQNGPKVAHSVSPA  1337

Query  1013  PSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASI  1186
                LST K      D  + ++ P  N     ++     AQKL+ L   +  + S      
Sbjct  1338  ---LST-KGSENMEDSVSWLKMPFLNFYRGFNKNFLSAAQKLDTLGEYNPVYVSSFRELE  1393

Query  1187  LPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDT-  1363
             L  GARL++P  G  D V+ VYD+EPTS+I+YAL S +Y    +D     EG    SD+ 
Sbjct  1394  LEGGARLLLPV-GVNDTVVPVYDDEPTSLIAYALVSPDYHLQTSD-----EGDASFSDSL  1447

Query  1364  --NKESPIASKLSTWQR-FGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFED  1534
                   P     S   R FGS +   +     GS ++ G     ++    + H R+SF D
Sbjct  1448  TMQSHHPDDDTASESHRSFGSTEESILSLS--GSRNSLGLDPLSYTK---ALHARVSFGD  1502

Query  1535  ESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSL  1714
             +     GKVK+SVTCY+A +F+ALR+ CCPSELDF+RSLSRCK+W AQGGKSNV+FAK+ 
Sbjct  1503  D--GPLGKVKYSVTCYYAHRFEALRRICCPSELDFVRSLSRCKKWGAQGGKSNVFFAKTS  1560

Query  1715  DERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKET  1894
             D+RFIIKQ+ KTEL+SF +FAP YF+YL++S  +GSPTCLAK++GIYQV  KHLKGGKE+
Sbjct  1561  DDRFIIKQVTKTELESFIKFAPGYFKYLSESIGTGSPTCLAKILGIYQVTSKHLKGGKES  1620

Query  1895  KMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSK  2071
             K D++VMENL +GR+++R+YDLKGS RSRYN D+  +NKVLLD N +E++ T PIF+G+K
Sbjct  1621  KTDVLVMENLLFGRNVTRLYDLKGSSRSRYNPDSSGSNKVLLDQNLIEAMPTSPIFVGNK  1680

Query  2072  AKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AKR LERAVWNDT+FLA + VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1681  AKRLLERAVWNDTAFLASIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1737



>emb|CDP03026.1| unnamed protein product [Coffea canephora]
Length=1795

 Score =   488 bits (1257),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 319/793 (40%), Positives = 428/793 (54%), Gaps = 117/793 (15%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M ACF+Y+PI++ SV LPP  LEFN    Q WI KE  E+  +A+ L+A
Sbjct  1006  RDCLRFYGFGRMAACFQYAPINVHSVYLPPPKLEFNYDF-QEWIQKEADEVCSRAELLFA  1064

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCI---LELKDMLMKEKNYWNDLHQPTHEETSE  352
             E+  ++ ++ E         NN N     +    EL+ +L KEK  + +L         +
Sbjct  1065  EVVKSLHQITENIR-----LNNGNKAPRVMERKSELEGVLQKEKKEFEELLDEVLYRKVK  1119

Query  353   EGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNF---SSQHPENAVSCINPGEW  523
              GQ  +D+L +NRLR  L+   + WD RL  M ++ DNN    S   P+     ++ G  
Sbjct  1120  AGQPAVDILAVNRLRKQLIIHSYIWDQRLIQMNNLNDNNLRGGSRSTPKMKGKTVSSGSN  1179

Query  524   GGE------------------------TIFKDGSLEHAYEENVHEFPNSEECPGEGLHSE  631
               E                          F  G   + Y  +     N  +   EG + +
Sbjct  1180  TSELAVTSKPSKGFSSCDSFLLNLKPDVTFIQGGYGNFYSPDGDHNRNDMD---EGSYCQ  1236

Query  632   HDEPPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSD  796
              D      + ++   G++S    G ++L+T            + R  S G I     LSD
Sbjct  1237  KD------NEINQPSGTNSNDEFGPESLKT------------VRRVHSDGQIPIVENLSD  1278

Query  797   KIDCAWTGIDP-----SSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSF  961
              +D AWT         ++QD+++  ++Q G     SF  LS    P              
Sbjct  1279  TLDAAWTDASSLNGTKANQDIEISGTVQGGVEYQDSFCSLSSTKGPEN------------  1326

Query  962   DSALRIQERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLN  1141
                 R   R    +P    Y S LKS  A  D                         KL+
Sbjct  1327  ----RENSRSWITMPFLNLYNSFLKSSTANED-------------------------KLD  1357

Query  1142  LLPSSSTTFTSHASILPE--GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWV  1315
              + + +  + S    L    GAR+++P  G  D V+ VYD+EPTSII+Y L S +Y + +
Sbjct  1358  KISTYNPAYISSFRDLLHQGGARVLLPV-GINDTVLPVYDDEPTSIIAYVLVSPDYHNQM  1416

Query  1316  TDKPYMSEGGWGVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSD  1495
               +P         S    ES     L +     S  L  +          SG  G    D
Sbjct  1417  LTEPTKDGLDSPSSFPFLESANLLLLPSLDEAASGSLRSLGSTDESVLSVSGSRGSSTLD  1476

Query  1496  PKL---SPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKR  1666
             P +   + H R+SF D+     GKVK+SVTCY+AKQF+ALR+ CCPSELDFIRSLSRC++
Sbjct  1477  PVVYTNALHARVSFSDD--GPLGKVKYSVTCYYAKQFEALRRSCCPSELDFIRSLSRCRK  1534

Query  1667  WSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVV  1846
             W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF  F   YF+YL++S S+GSPTCLAK++
Sbjct  1535  WGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFITFGRAYFKYLSESLSTGSPTCLAKIL  1594

Query  1847  GIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDL  2023
             GIYQV  KHLKGGKE+KMD++VMENL +GR+I R+YDLKGS RSRYN D+  +NKVLLD 
Sbjct  1595  GIYQVTSKHLKGGKESKMDVLVMENLLFGRNIVRLYDLKGSSRSRYNPDSSGSNKVLLDQ  1654

Query  2024  NFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDY  2203
             N +E++ T PIF+G KAKR LERAVWNDT+FLA + VMDYSLLVG+DEE+ ELV+GIID+
Sbjct  1655  NLIEAMPTSPIFVGPKAKRLLERAVWNDTAFLASIDVMDYSLLVGMDEEKHELVVGIIDF  1714

Query  2204  MRQYTWDKHLETW  2242
             MRQYTWDKHLETW
Sbjct  1715  MRQYTWDKHLETW  1727



>ref|XP_006296819.1| hypothetical protein CARUB_v10012801mg [Capsella rubella]
 gb|EOA29717.1| hypothetical protein CARUB_v10012801mg [Capsella rubella]
Length=1775

 Score =   487 bits (1253),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 316/772 (41%), Positives = 440/772 (57%), Gaps = 89/772 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG GSM+ACFRY+ ID+ SV LPPS+L FN ++ Q WI +E+ E++ +A+ L++
Sbjct  1000  RDCLRFYGFGSMVACFRYATIDVHSVYLPPSILSFNYEN-QDWIQREIDEVIERAELLFS  1058

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ +A+ ++ EK            G    I EL+++L +EK  + D  Q       +EGQ
Sbjct  1059  EVLNAISQIAEK------------GFRRRIGELEEVLQREKAEFEDNMQKMLYREVKEGQ  1106

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIF  541
               +D+LEL R+R  LL   + WDHRL                  + S ++  E G E   
Sbjct  1107  PLVDILELYRIRRQLLFQSYMWDHRLI-----------------SASTLHKLENGDEIRR  1149

Query  542   KDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQ-QGSSSTSCNGDKTLE  718
             +D  +E +        P   +     L S   E  +  D  S Q + +++T  N +K   
Sbjct  1150  ED--IEKSPLAKSQTLPEMNDGTNSILTS--SEVNLNPDGDSTQKEANTNTDLNLEKNDG  1205

Query  719   TRLGLENAV--------NKSPLERAPSAGSI----LSDKIDCAWTGIDPSSQDMQVHASL  862
               +   N +        NK  + R  S G I    LS  +D AW G      + Q    +
Sbjct  1206  GEVSPSNTLPDTTYPPENKLDVRRTQSDGQIVMKNLSATLDAAWIG------ERQTSVEI  1259

Query  863   QEGERRVASFGQLSHVDS--PTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLK  1036
                 + +     +S+  +  P  + LK P  +      L  Q       P SP+ LS  K
Sbjct  1260  PTNNKVLLPPSSMSNSSTFPPISEGLK-PIDL------LEQQNEFKVSYPVSPALLS--K  1310

Query  1037  SFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGARLM  1210
              +    D  + +  P  N     ++     + KL+     S  + S    + L  G RL+
Sbjct  1311  KYENSEDSVSWLSVPFLNFYRSINKNFLLSSTKLDTFGEHSPIYISSFREAELQGGPRLL  1370

Query  1211  VPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVS---DTNKESPI  1381
             +P  G  D+V+ VYD+EPTS+I+YAL S EY+   +      EG   VS   + N   P+
Sbjct  1371  LPV-GLNDIVVPVYDDEPTSMIAYALMSPEYQRQTS-----VEGESLVSYPSELNIPRPV  1424

Query  1382  ASKLSTWQRF-GSLDLDYMHFGSYGSEDASGRIGFLFSDPKL---SPHPRISFEDESCNT  1549
                +    R  GS+D   +   S  +            DP L   + H R+S+ ++   T
Sbjct  1425  DDTIFDPSRSNGSVDESILSMSSSRTSSLL-------LDPLLYTKALHARVSYGED--GT  1475

Query  1550  GGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFI  1729
              GKVK++VTCY+AK+F+ALR  C PSEL+FIRSLSRCK+W AQGGKSNV+FAK+LD+RFI
Sbjct  1476  LGKVKYTVTCYYAKRFEALRGICLPSELEFIRSLSRCKKWGAQGGKSNVFFAKTLDDRFI  1535

Query  1730  IKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLI  1909
             IKQ+ KTEL+SF +FAP YF+YL++S S+ SPTCLAK++GIYQV  K LK GKETKMD++
Sbjct  1536  IKQVTKTELESFIKFAPAYFKYLSESISTKSPTCLAKILGIYQVTTKQLKSGKETKMDVL  1595

Query  1910  VMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSL  2086
             +MENL +GR++ R+YDLKGS R+RYN D+  +NKVLLD N +E++ T PIF+G+KAKR L
Sbjct  1596  IMENLLFGRTVKRLYDLKGSSRARYNPDSSGSNKVLLDQNLIEAMPTSPIFVGNKAKRLL  1655

Query  2087  ERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             ERAVWNDT+FLA   VMDYSLLVGVDEE  ELVLGIID++RQYTWDKHLE+W
Sbjct  1656  ERAVWNDTAFLALGDVMDYSLLVGVDEENNELVLGIIDFLRQYTWDKHLESW  1707



>ref|XP_009391204.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=1507

 Score =   483 bits (1242),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 308/784 (39%), Positives = 438/784 (56%), Gaps = 105/784 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACF+Y+ I++ +V LPPS L+FN Q  Q W+ +E  ++ +    L+ 
Sbjct  724   RDCLRFYGSGEMVACFKYASINVHNVYLPPSKLDFNCQ-HQEWVQEEATKVFKTTNDLFT  782

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHN--CILELKDMLMKEKNYWNDLHQPTHEETSEE  355
              + ++++++EEK +       N   L +   I+EL+ +L KE+  + +  Q    + S +
Sbjct  783   AVYNSLRQVEEKISKTVSHDGNTEVLESRRNIIELEAILQKEQAEFEESKQKVTRKDSRK  842

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+L++N+L+  LL   + WD  L +                A S  NP E+    
Sbjct  843   GQPFIDILDVNKLQKQLLLKSYVWDKCLKFA---------------AGSLSNPHEFLMTR  887

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGL--------HSEHDEPPVPKDALSYQQ-----  676
               +D +L    + +   F  S     E L        + ++ +P   +  +  Q      
Sbjct  888   NNEDLTLR--AQRSFISFDASVSTAAESLNGTRTKDGYDQYKQPASDQQNVDQQHVKKTE  945

Query  677   --GSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGID-PSSQDMQ  847
                +S+ + +   +LE+ LG+   ++       P+    LSD +D  W G + P+  D  
Sbjct  946   LLSTSTNASDQSDSLESDLGVHKVLSDGHF---PNMAD-LSDTLDAKWRGENGPTLVDAS  1001

Query  848   VHASLQEGERRVA----SFGQLSHVDSPT--CKRLKSPARVYSFDSALRIQERISKRLPP  1009
                SL   E   A       + S +  P   C  +  P  V   + ++ I          
Sbjct  1002  KSKSLTLVEATPAISASENSEESIITDPNNLCAPMMPPRSVECAEVSILI----------  1051

Query  1010  SPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASIL  1189
                              +++  D  +++   C  AL      +   P   + F      +
Sbjct  1052  -----------------KSLFSDLYASLNKNCDSAL------IEYHPEYISLF---KEFM  1085

Query  1190  PEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNK  1369
              +G   ++P  G  D VI +YD+EPTS ISYAL   EY   ++D+P     G       +
Sbjct  1086  QQGWARLLP-TGVDDTVIPIYDDEPTSAISYALVCPEYHFQISDEPEKYRDG-------R  1137

Query  1370  ESPIA---SKLSTWQRFGSL-DLDYMHFGSYGSEDAS-----GRIGFLFSDPKLSP---H  1513
             ES I+           F S+ D+    F S+GS D S     G    L  DP  S    H
Sbjct  1138  ESSISFLTQDSGNPHLFQSVEDITLESFRSFGSFDDSNSSIYGSKSSLILDPLASSKSVH  1197

Query  1514  PRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSN  1693
              R+SF     +  GKV+++VTCY+AK FD+LR+ CCPSELDFIRSLSRCK+W AQGGKSN
Sbjct  1198  VRVSFAVNGPH--GKVRYTVTCYYAKCFDSLRRTCCPSELDFIRSLSRCKKWGAQGGKSN  1255

Query  1694  VYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKH  1873
             V+FAKSLD+RFIIKQ+ KTEL+SF +FAP+YF+YL+DS S+GSPTCLAK++GIYQVAVK+
Sbjct  1256  VFFAKSLDDRFIIKQVTKTELESFIKFAPEYFKYLSDSISTGSPTCLAKILGIYQVAVKN  1315

Query  1874  LKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTK  2050
             LKGGKE++MD++VMENL +GR++  +YDLKGS RSRYN+D    NKVLLD N +E++ T 
Sbjct  1316  LKGGKESRMDVLVMENLLFGRNVKWLYDLKGSSRSRYNADLSGNNKVLLDQNLIEAMPTS  1375

Query  2051  PIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKH  2230
             PIF+G+KAKR LERAVWNDT+FLA + VMDYSLLVGVDE + ELV+GIID+MRQYTWDKH
Sbjct  1376  PIFVGNKAKRLLERAVWNDTAFLASIDVMDYSLLVGVDENKNELVVGIIDFMRQYTWDKH  1435

Query  2231  LETW  2242
             LETW
Sbjct  1436  LETW  1439



>ref|XP_008462242.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X2 [Cucumis melo]
Length=1824

 Score =   487 bits (1253),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 318/774 (41%), Positives = 442/774 (57%), Gaps = 63/774 (8%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G MIACFRY+  D+ SV LPPS L+FN + +Q WI KE  E++ +A+ L++
Sbjct  1015  RDCLRFYGYGRMIACFRYTSTDVHSVYLPPSKLDFNYE-DQEWIRKEKDEVVNQAELLFS  1073

Query  182   EISSAVQKLEEKCASV-GCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEG  358
             E+ + ++++ EK +     +      L   I  L+ +L KEK  + +    T     ++G
Sbjct  1074  EVLNTLRQIAEKISGARTINSTRKMELRRQIAGLEAILQKEKAKFEESLHKTMIGEGKQG  1133

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNN----FSSQHPENAV--SCINPGE  520
             Q  +D+LE+N LR  LL   + WD +L    ++ + N    F ++  E  +  S   P  
Sbjct  1134  QGAVDILEINYLRRKLLIQAYVWDQQLIQAANLDNGNSAGSFIAESEERLMVDSEKLPEI  1193

Query  521   WGGETIFKD--GSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVP------KDALSYQQ  676
                  + +D   S  H   +  +E P++    G+   +   +P +        DA   ++
Sbjct  1194  STNRKLVEDLKSSDSHLAYQQCYEGPSN----GKEFVTSSAQPDIQVEEVGDSDADKGEE  1249

Query  677   GSSSTSCNG-DKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVH  853
                STS +   +TLE++  L+ A       R  +    LSD ++ AWTG + S   +   
Sbjct  1250  HLCSTSISAPSETLESKTYLQAAQADGEFSRMVN----LSDTLEAAWTGDNGSVVGITKD  1305

Query  854   ASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTL  1033
              SL      + S        +     L   +   + D   R+   IS  LP         
Sbjct  1306  NSL------ILSNSTSEDSSAIDITILNDGSEDQNVD---RVTHAISPSLPS--------  1348

Query  1034  KSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILP--EGARL  1207
             K+     D+   +    SN   + ++      QKL  L   +  F S    L    GARL
Sbjct  1349  KALDDTEDFEGYLDTASSNFYYLFNENFLASGQKLESLAKHNPVFLSSFWELEFQGGARL  1408

Query  1208  MVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIAS  1387
              +P  G  + V+ VYD+EP+SII+YAL S EY   + D+         V D     P  S
Sbjct  1409  FLPL-GISETVVPVYDDEPSSIIAYALMSPEYHSQLIDE------AEKVRDCGDSLPSLS  1461

Query  1388  KLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDPKLSP---HPRISFEDESC  1543
               +      S D  +    S G  D      SG    +  DP L P   +PRI FE+   
Sbjct  1462  SYTDSFFQSSDDFSFDTSKSLGPSDDTISSISGPRTSISLDPLLYPKSLNPRIFFEEYGP  1521

Query  1544  NTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDER  1723
             +  G VK+SVTCY+AK+F+ALR+ CC SELDF++SLSRCK+W AQGGKSNV+FAK+LD+R
Sbjct  1522  H--GGVKYSVTCYYAKRFEALRRICC-SELDFVKSLSRCKKWGAQGGKSNVFFAKTLDDR  1578

Query  1724  FIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMD  1903
             FIIKQ+ KTEL+SF +FAP+YF+YL++S  + SPTCLAK++GIYQV  KHLKGGKE+KMD
Sbjct  1579  FIIKQVTKTELESFIKFAPEYFKYLSESIGTRSPTCLAKILGIYQVTAKHLKGGKESKMD  1638

Query  1904  LIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLESLQTKPIFLGSKAKR  2080
             ++VMENL + R+++R+YDLKGS RSRYN+D T  NKVLLD N +E++ T PIF+G+KAKR
Sbjct  1639  VLVMENLLFRRNVTRLYDLKGSSRSRYNADSTGNNKVLLDQNLIEAMCTSPIFVGNKAKR  1698

Query  2081  SLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
              LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELV+GIID+MRQYTWDKHLETW
Sbjct  1699  LLERAVWNDTSFLASIGVMDYSLLVGVDEEKHELVIGIIDFMRQYTWDKHLETW  1752



>ref|XP_004973590.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
[Setaria italica]
Length=1794

 Score =   486 bits (1252),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 322/769 (42%), Positives = 440/769 (57%), Gaps = 77/769 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I + SV LPP  L+F SQ  Q W+ +E  E+   A+ L++
Sbjct  1014  RDCLRFYGFGEMVACFRYASIKVHSVYLPPPKLDFTSQ-RQEWVEQEAKEVDDSAELLFS  1072

Query  182   EISSAVQKLEEKCASVGCDWNNMN--GLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             E+ +A+ K+       G    N+    L   I EL+++L+ EK  + +  +   +    +
Sbjct  1073  EVLNALHKISGGRPITGSFDGNLKILELRRNIGELEEILLAEKADFMESLKNLLKSDMRK  1132

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+LE+N+LR  LL   + WD RL ++ +      S     +A++ +  G   G  
Sbjct  1133  GQPFIDILEVNKLRRHLLFLCYLWDQRLKFIAN------SGGKYCDALAGLRIGS--GNC  1184

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTL  715
              F D S+  +    + +     E P  G      E P+       QQ SS      D+ L
Sbjct  1185  DFNDKSVNASAAPKLEKGSKVIEVPSIG-----KEGPL-------QQSSSHPLHGEDEGL  1232

Query  716   -ETRLGLENAV-NKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGERRVAS  889
              +     EN++ N   L  A SA   + D++D   + I               G RRV S
Sbjct  1233  SQAHQSNENSLRNVEELNHATSAD--VKDRLDNEESRI---------------GVRRVVS  1275

Query  890   FGQLS-HVDSPTCKRLK-----SPARVYSFDSALRIQE------RISKRLPPSPSYLSTL  1033
              GQ     D P     K      PA   +    L   E      +   +  PS +   T+
Sbjct  1276  DGQFPVTTDIPDTLDAKWRGQNGPAPDSTLAKPLHSAEGTGVDVKSQTKAVPSHTPTFTV  1335

Query  1034  KSFHAYGDYRNMIRDP--VSNIQMICSQALP-REAQKLNLLPSSSTTFTSHASILPEGAR  1204
             +S  A  +    ++ P   SN  +  +   P R A      P     F   +     GAR
Sbjct  1336  RSGDAGEELLRWLKVPFMTSNSSLNTTSGSPLRFASLTEYTPKYVELFCELSQ--KGGAR  1393

Query  1205  LMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA  1384
               +P  G  D+VI V+D+EPTSIISYAL S  Y   ++D+         + +  K+S + 
Sbjct  1394  FFLP-TGANDIVIPVFDDEPTSIISYALVSPMYCFQLSDE--------SIKNREKDSSLP  1444

Query  1385  SKLSTWQRFGSLDLDYMHFGSY--GSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGK  1558
               +     F    L +  FGS+   +   SG  G +  D     H  +SFED      GK
Sbjct  1445  LPVYDSGNFNPFHL-FDEFGSHYDVTSSVSGGRGSVAPD---QVHLSVSFEDG--GPLGK  1498

Query  1559  VKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQ  1738
             VK++VTCY+A +F+ALR+ CCPSELDF+RS+SRCK+W AQGGKSNV+FAKSLD+RFIIKQ
Sbjct  1499  VKYNVTCYYANKFEALRRSCCPSELDFLRSISRCKKWGAQGGKSNVFFAKSLDDRFIIKQ  1558

Query  1739  MQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVME  1918
             + KTEL+SF +F  +YF+YL++S S+GSPTCLAK++GIYQV +KH+KGGKE+KMDL+VME
Sbjct  1559  VTKTELESFLKFGTEYFKYLSESISTGSPTCLAKILGIYQVTIKHVKGGKESKMDLLVME  1618

Query  1919  NLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERA  2095
             NL +GR+I+R+YDLKGS RSRYN+D+  +NKVLLD N +E++ T PIF+G+KAKR LERA
Sbjct  1619  NLLFGRNITRLYDLKGSSRSRYNADSNGSNKVLLDQNLIEAMPTSPIFVGNKAKRLLERA  1678

Query  2096  VWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             VWNDTSFLAG+ VMDYSLLVGVDEE+ ELVLGIID+MRQYTWDKHLETW
Sbjct  1679  VWNDTSFLAGIDVMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETW  1727



>ref|XP_009391203.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=1640

 Score =   484 bits (1245),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 304/777 (39%), Positives = 439/777 (56%), Gaps = 91/777 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACF+Y+ I++ +V LPPS L+FN Q  Q W+ +E  ++ +    L+ 
Sbjct  857   RDCLRFYGSGEMVACFKYASINVHNVYLPPSKLDFNCQ-HQEWVQEEATKVFKTTNDLFT  915

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHN--CILELKDMLMKEKNYWNDLHQPTHEETSEE  355
              + ++++++EEK +       N   L +   I+EL+ +L KE+  + +  Q    + S +
Sbjct  916   AVYNSLRQVEEKISKTVSHDGNTEVLESRRNIIELEAILQKEQAEFEESKQKVTRKDSRK  975

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+L++N+L+  LL   + WD  L +                A S  NP E+    
Sbjct  976   GQPFIDILDVNKLQKQLLLKSYVWDKCLKFA---------------AGSLSNPHEFLMTR  1020

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGL--------HSEHDEPPVPKDALSYQQ-----  676
               +D +L    + +   F  S     E L        + ++ +P   +  +  Q      
Sbjct  1021  NNEDLTLR--AQRSFISFDASVSTAAESLNGTRTKDGYDQYKQPASDQQNVDQQHVKKTE  1078

Query  677   --GSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV  850
                +S+ + +   +LE+ LG+   ++       P+    LSD +D  W G +  +    V
Sbjct  1079  LLSTSTNASDQSDSLESDLGVHKVLSDGHF---PNMAD-LSDTLDAKWRGENGPTL---V  1131

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
              AS  +    V +   +S  ++     +  P  +             +  +PP     + 
Sbjct  1132  DASKSKSLTLVEATPAISASENSEESIITDPNNL------------CAPMMPPRSVECAE  1179

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLM  1210
             +         +++  D  +++   C  AL      +   P   + F      + +G   +
Sbjct  1180  VSIL-----IKSLFSDLYASLNKNCDSAL------IEYHPEYISLF---KEFMQQGWARL  1225

Query  1211  VPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA--  1384
             +P  G  D VI +YD+EPTS ISYAL   EY   ++D+P     G       +ES I+  
Sbjct  1226  LP-TGVDDTVIPIYDDEPTSAISYALVCPEYHFQISDEPEKYRDG-------RESSISFL  1277

Query  1385  -SKLSTWQRFGSL-DLDYMHFGSYGSEDAS-----GRIGFLFSDPKLSP---HPRISFED  1534
                      F S+ D+    F S+GS D S     G    L  DP  S    H R+SF  
Sbjct  1278  TQDSGNPHLFQSVEDITLESFRSFGSFDDSNSSIYGSKSSLILDPLASSKSVHVRVSFAV  1337

Query  1535  ESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSL  1714
                +  GKV+++VTCY+AK FD+LR+ CCPSELDFIRSLSRCK+W AQGGKSNV+FAKSL
Sbjct  1338  NGPH--GKVRYTVTCYYAKCFDSLRRTCCPSELDFIRSLSRCKKWGAQGGKSNVFFAKSL  1395

Query  1715  DERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKET  1894
             D+RFIIKQ+ KTEL+SF +FAP+YF+YL+DS S+GSPTCLAK++GIYQVAVK+LKGGKE+
Sbjct  1396  DDRFIIKQVTKTELESFIKFAPEYFKYLSDSISTGSPTCLAKILGIYQVAVKNLKGGKES  1455

Query  1895  KMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSK  2071
             +MD++VMENL +GR++  +YDLKGS RSRYN+D    NKVLLD N +E++ T PIF+G+K
Sbjct  1456  RMDVLVMENLLFGRNVKWLYDLKGSSRSRYNADLSGNNKVLLDQNLIEAMPTSPIFVGNK  1515

Query  2072  AKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AKR LERAVWNDT+FLA + VMDYSLLVGVDE + ELV+GIID+MRQYTWDKHLETW
Sbjct  1516  AKRLLERAVWNDTAFLASIDVMDYSLLVGVDENKNELVVGIIDFMRQYTWDKHLETW  1572



>ref|XP_004141731.1| PREDICTED: 1-phosphatidylinositol 3-phosphate 5-kinase fab1-like 
[Cucumis sativus]
Length=1813

 Score =   485 bits (1249),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 315/770 (41%), Positives = 436/770 (57%), Gaps = 56/770 (7%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G MIACFRY+  D+ SV LPPS L+FN + +Q WI KE  E++ +A+ L++
Sbjct  1005  RDCLRFYGYGRMIACFRYTSTDVHSVYLPPSKLDFNYE-DQEWIQKEKDEVVNQAELLFS  1063

Query  182   EISSAVQKLEEKCASV-GCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEG  358
             E+ + ++++ EK +     +      L   I  L+ +L KEK  + +    T      +G
Sbjct  1064  EVLNTLRQIAEKISGARTINSTRKMELRRQIAGLEAILQKEKAKFEESLHKTMNGEGRQG  1123

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQH-PENAVSCINPGEWGGET  535
             Q  +D+LE+N LR  LL   + WD +L    ++ + N +     E+    +   E   E 
Sbjct  1124  QGAVDILEINYLRRKLLIQAYVWDQQLIQAANLENGNSAGSFVAESEERLVVDSEKLSEI  1183

Query  536   IFKDGSLEHAYEENVH-EFPNSEECPGEG--LHSEHDEPPVP------KDALSYQQGSSS  688
                   +E     + H  +    E P  G    +   +P +        DA   ++   S
Sbjct  1184  STNSKLVEDLKSSDSHLAYQQCNEGPSNGKEFVTNLAQPDIQVEEVGDSDADKGEEHLCS  1243

Query  689   TSC-NGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQ  865
             T+  +  +TLE +  L+ A       R  S    LSD ++ AWTG + S   +  + SL 
Sbjct  1244  TNISDPSETLEPKTYLQAAQADGEFSRMVS----LSDTLEAAWTGDNGSVVGITKNNSLI  1299

Query  866   EGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFH  1045
                   ++    S +D            V       R+   IS+ LP         K+  
Sbjct  1300  LSN---STLEDSSGIDITISNDHSEDQNVD------RVTHAISQSLPS--------KALD  1342

Query  1046  AYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILP--EGARLMVPE  1219
                D+   +    SN   + ++      QKL  L   +  F S    L    GARL +P 
Sbjct  1343  DTEDFEGYLDTASSNFYYLFNENFLASGQKLEALAKHNPVFLSSFWELEFQGGARLFLPL  1402

Query  1220  NGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLST  1399
              G  + V+ VYD+EP+SII+YAL S EY   + D+         V D     P  S   +
Sbjct  1403  -GVSETVVPVYDDEPSSIIAYALMSPEYHSQLIDE------AEKVRDGGDSLPSLSYTDS  1455

Query  1400  WQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDPKLSP---HPRISFEDESCNTGG  1555
             + +  S D  +    S G  D      SG    +  DP   P   +PRI FE+   +  G
Sbjct  1456  FFQ-SSDDFSFDTSKSLGPSDDTISSISGPRTSISLDPLSYPKSLNPRIFFEEYGPH--G  1512

Query  1556  KVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIK  1735
              VK+SVTCY+AK+F+ALR+ CC SELDF++SLSRCK+W AQGGKSNV+FAK+LD+RFIIK
Sbjct  1513  GVKYSVTCYYAKRFEALRRICC-SELDFVKSLSRCKKWGAQGGKSNVFFAKTLDDRFIIK  1571

Query  1736  QMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVM  1915
             Q+ KTEL+SF +FAP+YF+YL++S  + SPTCLAK++GIYQV  KHLKGGKE+KMD++VM
Sbjct  1572  QVTKTELESFIKFAPEYFKYLSESIGTRSPTCLAKILGIYQVTAKHLKGGKESKMDVLVM  1631

Query  1916  ENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLESLQTKPIFLGSKAKRSLER  2092
             ENL + R+++R+YDLKGS RSRYN+D T  NKVLLD N +E++ T PIF+G+KAKR LER
Sbjct  1632  ENLLFRRNVTRLYDLKGSSRSRYNADSTGNNKVLLDQNLIETMCTSPIFVGNKAKRLLER  1691

Query  2093  AVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AVWNDTSFLA + VMDYSLLVGVDEE+ ELV+GIID+MRQYTWDKHLETW
Sbjct  1692  AVWNDTSFLASIGVMDYSLLVGVDEEKHELVIGIIDFMRQYTWDKHLETW  1741



>ref|XP_006407097.1| hypothetical protein EUTSA_v10019882mg [Eutrema salsugineum]
 gb|ESQ48550.1| hypothetical protein EUTSA_v10019882mg [Eutrema salsugineum]
Length=1788

 Score =   484 bits (1247),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 309/770 (40%), Positives = 440/770 (57%), Gaps = 78/770 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+ ID+ SV LPPS+L FN  + Q WI +E  E++ +A+ L++
Sbjct  1006  RDCLRFYGFGNMVACFRYATIDVHSVYLPPSILSFN-YNNQDWIQRETDEVVERAELLFS  1064

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ +A+ ++ EK            G    I EL+++L +EK  + +  Q       +EGQ
Sbjct  1065  EVLNAISQIAEK------------GFRRRIGELEEVLQREKAEFEENMQKMLHGEVKEGQ  1112

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI--FDNNFSSQHPENAVSCINPGEWGGET  535
               +D+LEL RLR  L+   + WDHRL    ++   + +  +   E     ++  +   E 
Sbjct  1113  HLVDILELYRLRRQLIFQSYMWDHRLISASTLHKLEGSDDTSREEKEKPPLSKSQTLPEM  1172

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEG-LHSEHDEPPVPKDALSYQQGSSSTSCNGDKT  712
                  SL    E N++  PN +     G L+    E     D    Q+       +  KT
Sbjct  1173  NAGSNSLLAGSEVNLN--PNGDSAGDTGSLYKVQKEANTNSDL--NQEKEDGGEVSPSKT  1228

Query  713   L-ETRLGLENAVNKSPLERAPSAGSI----LSDKIDCAWTGIDPSSQDMQVHASLQEGER  877
             L +T   LEN ++   + R  S G I    LS  +D AW G      + Q    +    +
Sbjct  1229  LPDTSDPLENKLD---VRRTQSDGQIVMKNLSATLDAAWIG------ERQTSVEIPTNNK  1279

Query  878   RVASFGQLSHVDS-PTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYG  1054
              +     +S+  + P      +P  +    +  ++   +S  LP         +++    
Sbjct  1280  ILLPPSSMSNSSTFPPISEGLNPIDLPEQQNGFKVAYPVSPALPS--------RNYENSE  1331

Query  1055  DYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASI---------LPEGARL  1207
             D  + +  P  N     ++     +QK++       TF  H  I         L  G RL
Sbjct  1332  DSVSWLGMPFLNFYRSINKNFLLSSQKMD-------TFGEHTPIYISSFIEAELQGGPRL  1384

Query  1208  MVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIAS  1387
             ++P  G  D+V+ VYD+EPTS+I+YAL S EY+  V     +S      S+ N   P+  
Sbjct  1385  LLPV-GMNDIVVPVYDDEPTSMIAYALMSPEYQRQVEGDSLVSYP----SELNIARPVDD  1439

Query  1388  KLSTWQR-FGSLDLDYMHFGSYGSEDASGRIGFLFSDP---KLSPHPRISFEDESCNTGG  1555
              +    R  GS+D             +S R   L  DP     + H R+S+ ++   T G
Sbjct  1440  TIFDPSRSTGSVD-------ESILSMSSSRSSSLRLDPLSYTKALHARVSYGED--GTLG  1490

Query  1556  KVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIK  1735
             KVK++VTCY+AK+F+ALR  C PSEL+FIRSLSRCK+W AQGGKSNV+FAK+LD+RFIIK
Sbjct  1491  KVKYTVTCYYAKRFEALRGICIPSELEFIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIIK  1550

Query  1736  QMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVM  1915
             Q+ KTEL+SF +FAP YF+YL++S S+ SPTCLAK++GIYQV+ K LK GKETKMD+++M
Sbjct  1551  QVTKTELESFIKFAPAYFKYLSESISTKSPTCLAKILGIYQVSTKQLKSGKETKMDVLIM  1610

Query  1916  ENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLER  2092
             ENL +GR++ R+YDLKGS R+RYN D+  +N VLLD N +E++ T PIF+G+KAKR LER
Sbjct  1611  ENLLFGRTVKRLYDLKGSSRARYNPDSSGSNNVLLDQNLIEAMPTSPIFVGNKAKRLLER  1670

Query  2093  AVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AVWNDT+FLA   VMDYSLLVGVDEE+ ELVLGIID++RQYTWDKHLE+W
Sbjct  1671  AVWNDTAFLALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESW  1720



>gb|KGN45440.1| hypothetical protein Csa_7G448020 [Cucumis sativus]
Length=1823

 Score =   485 bits (1248),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 315/770 (41%), Positives = 436/770 (57%), Gaps = 56/770 (7%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G MIACFRY+  D+ SV LPPS L+FN + +Q WI KE  E++ +A+ L++
Sbjct  1015  RDCLRFYGYGRMIACFRYTSTDVHSVYLPPSKLDFNYE-DQEWIQKEKDEVVNQAELLFS  1073

Query  182   EISSAVQKLEEKCASV-GCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEG  358
             E+ + ++++ EK +     +      L   I  L+ +L KEK  + +    T      +G
Sbjct  1074  EVLNTLRQIAEKISGARTINSTRKMELRRQIAGLEAILQKEKAKFEESLHKTMNGEGRQG  1133

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQH-PENAVSCINPGEWGGET  535
             Q  +D+LE+N LR  LL   + WD +L    ++ + N +     E+    +   E   E 
Sbjct  1134  QGAVDILEINYLRRKLLIQAYVWDQQLIQAANLENGNSAGSFVAESEERLVVDSEKLSEI  1193

Query  536   IFKDGSLEHAYEENVH-EFPNSEECPGEG--LHSEHDEPPVP------KDALSYQQGSSS  688
                   +E     + H  +    E P  G    +   +P +        DA   ++   S
Sbjct  1194  STNSKLVEDLKSSDSHLAYQQCNEGPSNGKEFVTNLAQPDIQVEEVGDSDADKGEEHLCS  1253

Query  689   TSC-NGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQ  865
             T+  +  +TLE +  L+ A       R  S    LSD ++ AWTG + S   +  + SL 
Sbjct  1254  TNISDPSETLEPKTYLQAAQADGEFSRMVS----LSDTLEAAWTGDNGSVVGITKNNSLI  1309

Query  866   EGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFH  1045
                   ++    S +D            V       R+   IS+ LP         K+  
Sbjct  1310  LSN---STLEDSSGIDITISNDHSEDQNVD------RVTHAISQSLPS--------KALD  1352

Query  1046  AYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILP--EGARLMVPE  1219
                D+   +    SN   + ++      QKL  L   +  F S    L    GARL +P 
Sbjct  1353  DTEDFEGYLDTASSNFYYLFNENFLASGQKLEALAKHNPVFLSSFWELEFQGGARLFLPL  1412

Query  1220  NGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLST  1399
              G  + V+ VYD+EP+SII+YAL S EY   + D+         V D     P  S   +
Sbjct  1413  -GVSETVVPVYDDEPSSIIAYALMSPEYHSQLIDE------AEKVRDGGDSLPSLSYTDS  1465

Query  1400  WQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDPKLSP---HPRISFEDESCNTGG  1555
             + +  S D  +    S G  D      SG    +  DP   P   +PRI FE+   +  G
Sbjct  1466  FFQ-SSDDFSFDTSKSLGPSDDTISSISGPRTSISLDPLSYPKSLNPRIFFEEYGPH--G  1522

Query  1556  KVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIK  1735
              VK+SVTCY+AK+F+ALR+ CC SELDF++SLSRCK+W AQGGKSNV+FAK+LD+RFIIK
Sbjct  1523  GVKYSVTCYYAKRFEALRRICC-SELDFVKSLSRCKKWGAQGGKSNVFFAKTLDDRFIIK  1581

Query  1736  QMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVM  1915
             Q+ KTEL+SF +FAP+YF+YL++S  + SPTCLAK++GIYQV  KHLKGGKE+KMD++VM
Sbjct  1582  QVTKTELESFIKFAPEYFKYLSESIGTRSPTCLAKILGIYQVTAKHLKGGKESKMDVLVM  1641

Query  1916  ENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLESLQTKPIFLGSKAKRSLER  2092
             ENL + R+++R+YDLKGS RSRYN+D T  NKVLLD N +E++ T PIF+G+KAKR LER
Sbjct  1642  ENLLFRRNVTRLYDLKGSSRSRYNADSTGNNKVLLDQNLIETMCTSPIFVGNKAKRLLER  1701

Query  2093  AVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AVWNDTSFLA + VMDYSLLVGVDEE+ ELV+GIID+MRQYTWDKHLETW
Sbjct  1702  AVWNDTSFLASIGVMDYSLLVGVDEEKHELVIGIIDFMRQYTWDKHLETW  1751



>gb|EMS57448.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1 [Triticum urartu]
Length=1569

 Score =   481 bits (1239),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 317/767 (41%), Positives = 436/767 (57%), Gaps = 109/767 (14%)
 Frame = +2

Query  29    GSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYAEISSAVQKL  208
             GSM+A FRYSP+DILSV LPPSVL+F     Q W+++E  ++  +  + Y  I   +  +
Sbjct  839   GSMVAVFRYSPVDILSVNLPPSVLDFAYPVAQDWLIEEAGDVANRKDNFYRVIFDNLDCI  898

Query  209   EEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQTTIDVLELN  388
             E K  S   D +   GL+  +++LKD++  E   ++ L      +  +     +DVLELN
Sbjct  899   E-KTVSAQEDLSMKAGLYKHVVDLKDLIKVEWKKYDVLLGFGSIQKLQTIGEPVDVLELN  957

Query  389   RLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIFKDGSLE-HA  565
             RLR  L+ D H WD RL+ M S+   N ++     A     P ++  E++ +D   E  +
Sbjct  958   RLRRELVLDAHVWDRRLHMMHSLTKKNCTA-----ATDAQCPKKFP-ESVLEDSKAEISS  1011

Query  566   YEENVH---EFPNSEECPGEG----LHSEHDEPPVPKDALS------YQQGSSSTSCNG-  703
              +EN+    E+  S     +     L  EH +  V    L+      +Q    S S  G 
Sbjct  1012  TQENMEKSLEYSQSSSLITDSGKPLLRREHGDTTVSHSGLTNIDEVYHQSVEGSASFTGL  1071

Query  704   -----------DKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV  850
                        +  +   L LE       LE++ S+ S LSD+ID AWTG    +  +  
Sbjct  1072  HIVPHPCEVQSNGVVADELKLEKT-----LEKSESSPSNLSDRIDLAWTGSGVETL-LVA  1125

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
               +L  G                + + + +P R+ SFDS +  +  +S   P   S +S 
Sbjct  1126  PTALMNGS---------------SYQNVMAPIRIKSFDSGINFRNGLS---PVDDSNVSI  1167

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASI--LPEGAR  1204
              +++          R P         +AL R  + L      S TFT+  S+  + +G  
Sbjct  1168  RRAYSQ--------RPP---------RALERTGRGL------SPTFTNKLSLPGMVDGEG  1204

Query  1205  LMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA  1384
               +      DVVI VYD+EP+S+I++A++  EY+ ++            V + + E    
Sbjct  1205  RFLLSQSVSDVVIPVYDDEPSSMIAHAMTVPEYRSFMLP----------VLNLHNELDRP  1254

Query  1385  SKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVK  1564
             S L++  +  S    +       S+D                H  +SFEDE   +  K K
Sbjct  1255  SVLNSLDQ-NSTSRSWSDVSQMNSKDI---------------HLTVSFEDEDSCSVDKAK  1298

Query  1565  FSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQ  1744
             FSV CYFAKQFD++RKKCC  ELD+IRSLSRCKRWSAQGGKSNVYFAK+LD+RF+IKQ+ 
Sbjct  1299  FSVICYFAKQFDSIRKKCCADELDYIRSLSRCKRWSAQGGKSNVYFAKTLDDRFVIKQVT  1358

Query  1745  KTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENL  1924
             +TELDSFE++A +YF+Y+T+S SSGSP CLAKV+G+YQV  K++K GKE KM+L+VMEN+
Sbjct  1359  RTELDSFEDYATEYFKYITESVSSGSPICLAKVLGLYQVVAKNMKDGKELKMELMVMENI  1418

Query  1925  FYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVW  2101
             F+ R +SR+YDLKGS+RSRYN DT   NKVLLDLN LE+L TKPIFLGSKAKR LERAVW
Sbjct  1419  FFKRKVSRIYDLKGSLRSRYNPDTSGNNKVLLDLNLLETLHTKPIFLGSKAKRRLERAVW  1478

Query  2102  NDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             NDTSFLA V VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1479  NDTSFLASVGVMDYSLLVGIDEEKKELVMGIIDYLRQYTWDKQLETW  1525



>ref|XP_006474562.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
isoform X1 [Citrus sinensis]
 ref|XP_006474563.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
isoform X2 [Citrus sinensis]
Length=1833

 Score =   484 bits (1247),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 330/787 (42%), Positives = 440/787 (56%), Gaps = 83/787 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  +EFN  + Q WI +E  E+ R+A+ L+ 
Sbjct  1022  RDCLRFYGFGQMVACFRYASIDVNSVYLPPPKIEFNYDT-QGWIKEEANEVRRRAELLFK  1080

Query  182   EISSAVQKLEEKCASVGCDWNNMNG----LHNCILELKDMLMKEKNYWNDLHQPTHEETS  349
             ++   +Q L +K A VG +  +M      +H  I EL+ M  K++  + +  Q    +  
Sbjct  1081  DVRHTLQDLSKKIA-VGSEDGSMKTAEARVH--ISELEGMQQKDEVEFEESLQQALCKEV  1137

Query  350   EEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFD-------NNFSSQHPENAVSCI  508
             + G   ID+LE+NRLR  +L     WD RL    S+ +       N F  +  E  VS +
Sbjct  1138  KLGLPAIDILEINRLRRQILFHSCVWDQRLIRAASLVNSYLREGTNAFVPKLKEKPVSPV  1197

Query  509   ------NPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEH--------DEPP  646
                   N      +     GSL    +   H    +    G+ +H  H        D+ P
Sbjct  1198  EKPVDVNAAFKPSKGFSSCGSLPLEVKPGAH---CNRGISGD-IHEPHRVQKESGVDQDP  1253

Query  647   VPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCA  811
               K+A  +   S S     +     +L          + RA S G       LSD +D A
Sbjct  1254  SYKEADQFLSSSESVGYKPEPQESGKL----------VRRALSDGEFPKMADLSDTLDAA  1303

Query  812   WTGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERI  991
             WTG        + H +   G+    S    + VDS +  +L S A   +    L +   +
Sbjct  1304  WTG--------ENHPANVIGKESGYSLPDPTLVDSSS--KLNSVAASTAEQGGLEVVRSL  1353

Query  992   SKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFT  1171
             S          S+ K      + R M+  P S+     ++     AQKL +   + T   
Sbjct  1354  SSV--------SSTKGTENMTNSRGMVGMPFSSFYSSFNKNSSLNAQKLTVSEYNPTYVM  1405

Query  1172  SH-ASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGW  1348
             S   S    GARL +P  G  D ++ VYD+EPTS+I+Y L S +Y   +++     E   
Sbjct  1406  SLWDSERLSGARLFLPV-GVNDTIVPVYDDEPTSVIAYTLVSSDYHVQISE----FERAK  1460

Query  1349  GVSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDP---KL  1504
               +D+   S I   ++        D       S GS D      SG  G    DP     
Sbjct  1461  DAADSAAASAIFDSVNLLSVSSFDDNTSDRDKSLGSADEAVFSTSGSRGSQVLDPLSYTK  1520

Query  1505  SPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGG  1684
               H RISF D+     GKVK++VTCYFAK+FDALR+ CC SELDFIRSLSRCK+W AQGG
Sbjct  1521  DLHARISFTDDGLL--GKVKYTVTCYFAKRFDALRRMCCHSELDFIRSLSRCKKWGAQGG  1578

Query  1685  KSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVA  1864
             KSNV+FAK+LD+RFIIKQ+ KTEL+SF +F P YF+YL++S S+GSPTCLAK++GIYQVA
Sbjct  1579  KSNVFFAKTLDDRFIIKQVPKTELESFIKFGPAYFKYLSESISTGSPTCLAKILGIYQVA  1638

Query  1865  VKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESL  2041
              KH KGGKE+KMDL+VMENL + R+I+R+YDLKGS RSRYN+DT  +NKVLLD N +E++
Sbjct  1639  SKHFKGGKESKMDLLVMENLLFRRNITRLYDLKGSSRSRYNADTSGSNKVLLDQNLIEAM  1698

Query  2042  QTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTW  2221
              T PIF+GSKAKR LERAVWNDT+FLA + VMDYSLLVG+DEE+ ELVLGIID+MRQYTW
Sbjct  1699  PTSPIFVGSKAKRLLERAVWNDTAFLASIDVMDYSLLVGIDEEKHELVLGIIDFMRQYTW  1758

Query  2222  DKHLETW  2242
             DKHLETW
Sbjct  1759  DKHLETW  1765



>ref|XP_004287678.1| PREDICTED: 1-phosphatidylinositol 3-phosphate 5-kinase-like [Fragaria 
vesca subsp. vesca]
Length=1810

 Score =   484 bits (1245),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 323/788 (41%), Positives = 431/788 (55%), Gaps = 120/788 (15%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I I SV LPP  LEF   + Q W+ KE  E+  +A+ L+ 
Sbjct  1034  RDCLRFYGFGRMVACFRYASIHIHSVCLPPPKLEFYYDN-QEWLQKEAHEVGNRAELLFN  1092

Query  182   EISSAVQKLEEK--CASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEE  355
             ++ +A+ ++ EK   A        +    + I+EL+ ML KE+  + +  Q   +   + 
Sbjct  1093  DLCNALHQILEKIPAAETQDGGKKVPESTHQIVELEGMLQKEREDFEESLQKVIKGEVKS  1152

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+LE+N+LR  LL   + WD RL +  S+ ++N      E   S I         
Sbjct  1153  GQPAIDILEINKLRRQLLFHSYVWDQRLIHAASLGNHNLQ----EGLTSSIT--------  1200

Query  536   IFKDGSLEHAYEENVHEFPNSEECP----GEGLHSEHDEPPVPKDALSYQQGSSST--SC  697
                           + E P   E P    G+G  S    P + K  ++  QG  +   S 
Sbjct  1201  -------------KLKEKPIGTEKPVKITGKGFSSSTSLPEI-KSGINLIQGGDAGYFSQ  1246

Query  698   NGDKTLETRLGLE---------NAVNKS-PLERAP------------SAGSILSDKIDCA  811
              G     T +GL+         N  +KS PLE               SA   LSD +D A
Sbjct  1247  KGGVQNRTEMGLDTDHGNETSANVSDKSDPLESGKIVQTGLSEDNECSAVESLSDTLDAA  1306

Query  812   WTGIDPSSQDMQV-HASLQEGE---RRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRI  979
             WTG  P      + H+++ +     + VAS  +   VD    +  +S             
Sbjct  1307  WTGTTPRENGYSLPHSTMVKSSNVVKSVASVAENGTVDQGGVQTTRS-------------  1353

Query  980   QERISKRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMIC-SQALPREAQKLNLLPSS  1156
                +S   P   S  S   SF               N Q +C     P    +   L   
Sbjct  1354  ---VSSASPAVTSSFSKSVSF---------------NTQKLCIGDQSPVYVTRFRELERQ  1395

Query  1157  STTFTSHASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMS  1336
             +            GARL++P  G  D VI V+D+EPTS+I+Y L S  Y   + +     
Sbjct  1396  T------------GARLLLP-IGVNDTVIPVFDDEPTSVIAYTLVSPNYHLQIAEPERSK  1442

Query  1337  EGGWGVSDTNKESPI--ASKLSTWQRFG-SLDLDYMHFGSYGSEDASGRIGFLFSDPKLS  1507
             E      D+    P   ++ L +   F  ++  +Y   GS  S+D         SD  +S
Sbjct  1443  EA----LDSAISLPFFDSANLLSLNSFDEAVSENYRGLGS--SDDIISMSHSRSSDSLMS  1496

Query  1508  --PHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQG  1681
                H R+SF DE     GKVK++VTCY+A QF+ALRK CCPSELDF+RSLSRCK+W AQG
Sbjct  1497  KDTHARVSFTDE--GPLGKVKYTVTCYYASQFEALRKACCPSELDFVRSLSRCKKWGAQG  1554

Query  1682  GKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQV  1861
             GKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL+DS S+ SPTCLAK++GIYQV
Sbjct  1555  GKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSDSISTRSPTCLAKILGIYQV  1614

Query  1862  AVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLES  2038
             + K  K GKETKMD++VMENL + R++SR+YDLKGS RSRYN+DT  +NKVLLD N +E+
Sbjct  1615  STKLGKAGKETKMDVLVMENLLFRRNVSRLYDLKGSSRSRYNADTSGSNKVLLDQNLIEA  1674

Query  2039  LQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYT  2218
             + T PIF+G++AKR LERAVWNDT+FLA V VMDYSLLVGVDEE+ EL LGIID+MRQYT
Sbjct  1675  MPTSPIFVGNRAKRLLERAVWNDTAFLASVDVMDYSLLVGVDEEKHELALGIIDFMRQYT  1734

Query  2219  WDKHLETW  2242
             WDKHLETW
Sbjct  1735  WDKHLETW  1742



>ref|XP_006452907.1| hypothetical protein CICLE_v10010149mg [Citrus clementina]
 gb|ESR66147.1| hypothetical protein CICLE_v10010149mg [Citrus clementina]
Length=1807

 Score =   484 bits (1245),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 329/786 (42%), Positives = 439/786 (56%), Gaps = 81/786 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  +EFN  + Q WI +E  E+ R+A+ L+ 
Sbjct  996   RDCLRFYGFGQMVACFRYASIDVNSVYLPPPKIEFNYDT-QGWIKEEANEVRRRAELLFK  1054

Query  182   EISSAVQKLEEKCASVGCDWNNMNG----LHNCILELKDMLMKEKNYWNDLHQPTHEETS  349
             ++   +Q L +K A VG +  +M      +H  I EL+ M  K++  + +  Q    +  
Sbjct  1055  DVRHTLQDLSKKIA-VGSEDGSMKTAEARVH--ISELEGMQQKDEVEFEESLQQALCKEV  1111

Query  350   EEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFD-------NNFSSQHPENAVSCI  508
             + G   ID+LE+NRLR  +L     WD RL    S+ +       N F  +  E  VS +
Sbjct  1112  KLGLPAIDILEINRLRRQILFHSCVWDQRLIRAASLVNSYLREGTNAFVPKLKEKPVSPV  1171

Query  509   -NPGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEP------------PV  649
               P +      FK      ++     E      C   G+  +  EP            P 
Sbjct  1172  EKPVDVNA--AFKPSKGFSSFVSLPLEVKPGAHC-NRGISGDIREPHRVQKESGVDQDPS  1228

Query  650   PKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAW  814
              K+A  +   S S S   +     +L          + RA S G       LSD +D AW
Sbjct  1229  YKEADQFLSSSESVSYKPEPQESGKL----------VRRALSDGEFPKMADLSDTLDAAW  1278

Query  815   TGIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERIS  994
             TG        + H +   G+    S    + VDS +  +L S A   +    L +   +S
Sbjct  1279  TG--------ENHPANVIGKESGYSLPDPTLVDSSS--KLNSVAASTAEQGGLEVVRSLS  1328

Query  995   KRLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS  1174
                       S+ K      + R+++  P S+     ++     AQKL +   + T   S
Sbjct  1329  SV--------SSTKGTENMTNSRSLVGMPFSSFYSSFNKNSSLNAQKLTVSEYNPTYVMS  1380

Query  1175  H-ASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWG  1351
                S    GARL +P  G  D ++ VYD+EPTS+I Y L S +Y   +++     E    
Sbjct  1381  LWDSERLSGARLFLPV-GVNDTIVPVYDDEPTSVIVYTLVSSDYHVQISE----FERAKD  1435

Query  1352  VSDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDP---KLS  1507
              +D+   S I   ++        D       S GS D      SG  G    DP      
Sbjct  1436  AADSAAASAIFDSVNLLSVSSFDDTTSDRDKSLGSADEAVFSTSGSRGSQVLDPLSYTKD  1495

Query  1508  PHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGK  1687
              H RISF D+     GKVK++VTCYFAK+FDALR+ CC SELDFIRSLSRCK+W AQGGK
Sbjct  1496  LHARISFTDDGLL--GKVKYTVTCYFAKRFDALRRMCCHSELDFIRSLSRCKKWGAQGGK  1553

Query  1688  SNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAV  1867
             SNV+FAK+LD+RFIIKQ+ KTEL+SF +F P YF+YL++S S+GSPTCLAK++GIYQVA 
Sbjct  1554  SNVFFAKTLDDRFIIKQVTKTELESFIKFGPAYFKYLSESISTGSPTCLAKILGIYQVAS  1613

Query  1868  KHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQ  2044
             KH KGGKE+KMDL+VMENL + R+I+R+YDLKGS RSRYN+DT  +NKVLLD N +E++ 
Sbjct  1614  KHFKGGKESKMDLLVMENLLFRRNITRLYDLKGSSRSRYNADTSGSNKVLLDQNLIEAMP  1673

Query  2045  TKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWD  2224
             T PIF+GSKAKR LERAVWNDT+FLA + VMDYSLLVG+DEE+ ELVLGIID+MRQYTWD
Sbjct  1674  TSPIFVGSKAKRLLERAVWNDTAFLASIDVMDYSLLVGIDEEKHELVLGIIDFMRQYTWD  1733

Query  2225  KHLETW  2242
             KHLETW
Sbjct  1734  KHLETW  1739



>gb|KDO73752.1| hypothetical protein CISIN_1g000222mg [Citrus sinensis]
Length=1832

 Score =   484 bits (1245),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 329/785 (42%), Positives = 439/785 (56%), Gaps = 79/785 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  +EFN  + Q WI +E  E+ R+A+ L+ 
Sbjct  1021  RDCLRFYGFGQMVACFRYASIDVNSVYLPPPKIEFNYDT-QGWIKEEANEVRRRAELLFK  1079

Query  182   EISSAVQKLEEKCASVGCDWNNMNG----LHNCILELKDMLMKEKNYWNDLHQPTHEETS  349
             ++   +Q L +K A VG +  +M      +H  I EL+ M  K++  + +  Q    +  
Sbjct  1080  DVRHTLQDLSKKIA-VGSEDGSMKTAEARVH--ISELEGMQQKDEVEFEESLQQALCKEV  1136

Query  350   EEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFD-------NNFSSQHPENAVSCI  508
             + G   ID+LE+NRLR  +L     WD RL    S+ +       N F  +  E  VS +
Sbjct  1137  KLGLPAIDILEINRLRRQILFHSCVWDQRLIRAASLVNSYLREGTNAFVPKLKEKPVSPV  1196

Query  509   -NPGEWGGETIFKDGSLEHAYEENVHEFPNSEECP---GEGLHSEH--------DEPPVP  652
               P +      FK      ++     E      C       +H  H        D+ P  
Sbjct  1197  EKPVDVNA--AFKPSKGFSSFVSLPLEVKPGAHCNRGISGDIHEPHRVQKESGVDQDPSY  1254

Query  653   KDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAWT  817
             K+A  +   S S S   +     +L          + RA S G       LSD +D AWT
Sbjct  1255  KEADQFLSSSESVSYKPEPQESGKL----------VRRALSDGEFPKMADLSDTLDAAWT  1304

Query  818   GIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISK  997
             G        + H +   G+    S    + VDS +  +L S A   +    L +   +S 
Sbjct  1305  G--------ENHPANVIGKESGYSLPDPTLVDSSS--KLNSVAASTAEQGGLEVVRSLSS  1354

Query  998   RLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSH  1177
                      S+ K      + R+++  P S+     ++     AQKL +   + T   S 
Sbjct  1355  V--------SSTKGTENMTNSRSLVGMPFSSFYSSFNKNSSLNAQKLTVSEYNPTYVMSL  1406

Query  1178  -ASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGV  1354
               S    GARL +P  G  D ++ VYD+EPTS+I Y L S +Y   +++     E     
Sbjct  1407  WDSERLSGARLFLPV-GVNDTIVPVYDDEPTSVIVYTLVSSDYHVQISE----FERAKDA  1461

Query  1355  SDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDP---KLSP  1510
             +D+   S I   ++        D       S GS D      SG  G    DP       
Sbjct  1462  ADSAAASAIFDSVNLLSVSSFDDTTSDRDKSLGSADEAVFSTSGSRGSQVLDPLSYTKDL  1521

Query  1511  HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKS  1690
             H RISF D+     GKVK++VTCYFAK+FDALR+ CC SELDFIRSLSRCK+W AQGGKS
Sbjct  1522  HARISFTDDGLL--GKVKYTVTCYFAKRFDALRRMCCHSELDFIRSLSRCKKWGAQGGKS  1579

Query  1691  NVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVK  1870
             NV+FAK+LD+RFIIKQ+ KTEL+SF +F P YF+YL++S S+GSPTCLAK++GIYQVA K
Sbjct  1580  NVFFAKTLDDRFIIKQVPKTELESFIKFGPAYFKYLSESISTGSPTCLAKILGIYQVASK  1639

Query  1871  HLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQT  2047
             H KGGKE+KMDL+VMENL + R+I+R+YDLKGS RSRYN+DT  +NKVLLD N +E++ T
Sbjct  1640  HFKGGKESKMDLLVMENLLFRRNITRLYDLKGSSRSRYNADTSGSNKVLLDQNLIEAMPT  1699

Query  2048  KPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDK  2227
              PIF+GSKAKR LERAVWNDT+FLA + VMDYSLLVG+DEE+ ELVLGIID+MRQYTWDK
Sbjct  1700  SPIFVGSKAKRLLERAVWNDTAFLASIDVMDYSLLVGIDEEKHELVLGIIDFMRQYTWDK  1759

Query  2228  HLETW  2242
             HLETW
Sbjct  1760  HLETW  1764



>ref|XP_008800515.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
[Phoenix dactylifera]
Length=1837

 Score =   484 bits (1245),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 316/799 (40%), Positives = 438/799 (55%), Gaps = 113/799 (14%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  L+FN +  Q WI KE  E+   A+ L+ 
Sbjct  1032  RDCLRFYGFGKMVACFRYASIDVHSVYLPPQKLDFNYE-HQEWIQKEANEVSDGAELLFN  1090

Query  182   EISSAVQKLEEKCASVGCDWNNMNG------LHNCILELKDMLMKEKNYWNDLHQPTHEE  343
             EI +A+ ++ E+         ++NG      +   I+EL+ +L KEK  +        ++
Sbjct  1091  EILNALHQIAER--------KSINGSMKAPEIRPQIVELEGILQKEKAEFEGYLHRVLKK  1142

Query  344   TSEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYM-------------------ESIFDN  466
              + +GQ  ID+LE+N+L+  L+   + WD RL +                    E + D 
Sbjct  1143  EARKGQPVIDILEVNKLKRQLIFYSYLWDQRLIFAAGSDSCPDEVLQSFVTRDKERLTDT  1202

Query  467   NFSSQHPENAVSCIN--PGEWGGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDE  640
             N   + P+   + ++  PG++         +    ++E++++            +S H  
Sbjct  1203  NLGLK-PQKGFNRLDTFPGDFRDNEFLNGSTYAINHQEDINDH--------HVHYSGHQR  1253

Query  641   PPVPKDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-LSDKIDCAWT  817
               +  D+   +Q  +  S +   + ++ L     + +  L        + LSD  D  WT
Sbjct  1254  RCIELDSFQGKQIKTHRSTSTSASKQSVLLETGLIGRRTLSDGQFPVLVNLSDTFDAKWT  1313

Query  818   GIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARV-YSFDSALRIQERIS  994
             G    +     HASL +      SF   +          +S A V  SF SAL  +   S
Sbjct  1314  G---ENGPFLFHASLLDSSN---SFEAAAAASVSKDSEERSGAEVTQSFASALLTKLGDS  1367

Query  995   K-------RLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPS  1153
                     R+P    +L+  + F     YRN+   P                 + N L  
Sbjct  1368  AEDFSIWIRMP----FLNFYRPF-----YRNLGSTP-----------------RFNSLNE  1401

Query  1154  SSTTFTSHASIL--PEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKP  1327
                 +      L    GAR ++P  G  D VI +YD+EPT+IISYAL S EY   ++D+ 
Sbjct  1402  YKPVYVPLFRELECQGGARFLLPV-GVNDTVIPIYDDEPTTIISYALVSPEYHIQISDER  1460

Query  1328  YMSEGGWGVS---------DTNKESPIASKLS-TWQRFGSLDLDYMHFGSYGSEDASGRI  1477
               +  G   S         D +         S  ++ FGS+D   +          SG  
Sbjct  1461  ERTRDGVETSLLLATHESGDFHLSRSFDETTSEPYKSFGSIDDSILSL--------SGSR  1512

Query  1478  GFLFSDP---KLSPHPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRS  1648
             G +  DP       H ++SF DE     GKVK++VTCY+AK FDALR+ CCPSE DFIRS
Sbjct  1513  GSVVLDPLTYTKEMHVKVSFADE--GPLGKVKYTVTCYYAKCFDALRRTCCPSEFDFIRS  1570

Query  1649  LSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPT  1828
             LSRCK+W AQGGKSNV+FAKSLD+RFIIKQ+ KTEL+SF +FAP YF+YL++S  + SPT
Sbjct  1571  LSRCKKWGAQGGKSNVFFAKSLDDRFIIKQVTKTELESFIKFAPGYFKYLSESTGTRSPT  1630

Query  1829  CLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-N  2005
             CLAK++GIYQV  ++LKGGKE +MD++VMENL +GR+++R+YDLKGS RSRYN D+   N
Sbjct  1631  CLAKILGIYQVTSRNLKGGKELRMDVLVMENLLFGRNLTRLYDLKGSSRSRYNPDSSGNN  1690

Query  2006  KVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELV  2185
             KVLLD N +ES+ T PIF+G+KAKR LERAVWNDTSFLA V VMDYSLLVG+DEE+ ELV
Sbjct  1691  KVLLDQNLIESMPTSPIFVGNKAKRLLERAVWNDTSFLASVDVMDYSLLVGIDEEKHELV  1750

Query  2186  LGIIDYMRQYTWDKHLETW  2242
             LGIID+MRQYTWDKHLETW
Sbjct  1751  LGIIDFMRQYTWDKHLETW  1769



>ref|XP_009391198.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009391199.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=1817

 Score =   483 bits (1244),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 304/777 (39%), Positives = 439/777 (56%), Gaps = 91/777 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACF+Y+ I++ +V LPPS L+FN Q  Q W+ +E  ++ +    L+ 
Sbjct  1034  RDCLRFYGSGEMVACFKYASINVHNVYLPPSKLDFNCQ-HQEWVQEEATKVFKTTNDLFT  1092

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHN--CILELKDMLMKEKNYWNDLHQPTHEETSEE  355
              + ++++++EEK +       N   L +   I+EL+ +L KE+  + +  Q    + S +
Sbjct  1093  AVYNSLRQVEEKISKTVSHDGNTEVLESRRNIIELEAILQKEQAEFEESKQKVTRKDSRK  1152

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+L++N+L+  LL   + WD  L +                A S  NP E+    
Sbjct  1153  GQPFIDILDVNKLQKQLLLKSYVWDKCLKFA---------------AGSLSNPHEFLMTR  1197

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGL--------HSEHDEPPVPKDALSYQQ-----  676
               +D +L    + +   F  S     E L        + ++ +P   +  +  Q      
Sbjct  1198  NNEDLTLR--AQRSFISFDASVSTAAESLNGTRTKDGYDQYKQPASDQQNVDQQHVKKTE  1255

Query  677   --GSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV  850
                +S+ + +   +LE+ LG+   ++       P+    LSD +D  W G +  +    V
Sbjct  1256  LLSTSTNASDQSDSLESDLGVHKVLSDGHF---PNMAD-LSDTLDAKWRGENGPTL---V  1308

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
              AS  +    V +   +S  ++     +  P  +             +  +PP     + 
Sbjct  1309  DASKSKSLTLVEATPAISASENSEESIITDPNNL------------CAPMMPPRSVECAE  1356

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLM  1210
             +         +++  D  +++   C  AL      +   P   + F      + +G   +
Sbjct  1357  VSIL-----IKSLFSDLYASLNKNCDSAL------IEYHPEYISLF---KEFMQQGWARL  1402

Query  1211  VPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA--  1384
             +P  G  D VI +YD+EPTS ISYAL   EY   ++D+P     G       +ES I+  
Sbjct  1403  LP-TGVDDTVIPIYDDEPTSAISYALVCPEYHFQISDEPEKYRDG-------RESSISFL  1454

Query  1385  -SKLSTWQRFGSL-DLDYMHFGSYGSEDAS-----GRIGFLFSDPKLSP---HPRISFED  1534
                      F S+ D+    F S+GS D S     G    L  DP  S    H R+SF  
Sbjct  1455  TQDSGNPHLFQSVEDITLESFRSFGSFDDSNSSIYGSKSSLILDPLASSKSVHVRVSFAV  1514

Query  1535  ESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSL  1714
                +  GKV+++VTCY+AK FD+LR+ CCPSELDFIRSLSRCK+W AQGGKSNV+FAKSL
Sbjct  1515  NGPH--GKVRYTVTCYYAKCFDSLRRTCCPSELDFIRSLSRCKKWGAQGGKSNVFFAKSL  1572

Query  1715  DERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKET  1894
             D+RFIIKQ+ KTEL+SF +FAP+YF+YL+DS S+GSPTCLAK++GIYQVAVK+LKGGKE+
Sbjct  1573  DDRFIIKQVTKTELESFIKFAPEYFKYLSDSISTGSPTCLAKILGIYQVAVKNLKGGKES  1632

Query  1895  KMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSK  2071
             +MD++VMENL +GR++  +YDLKGS RSRYN+D    NKVLLD N +E++ T PIF+G+K
Sbjct  1633  RMDVLVMENLLFGRNVKWLYDLKGSSRSRYNADLSGNNKVLLDQNLIEAMPTSPIFVGNK  1692

Query  2072  AKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AKR LERAVWNDT+FLA + VMDYSLLVGVDE + ELV+GIID+MRQYTWDKHLETW
Sbjct  1693  AKRLLERAVWNDTAFLASIDVMDYSLLVGVDENKNELVVGIIDFMRQYTWDKHLETW  1749



>gb|KDO73753.1| hypothetical protein CISIN_1g000222mg [Citrus sinensis]
 gb|KDO73754.1| hypothetical protein CISIN_1g000222mg [Citrus sinensis]
 gb|KDO73755.1| hypothetical protein CISIN_1g000222mg [Citrus sinensis]
Length=1833

 Score =   483 bits (1244),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 329/785 (42%), Positives = 439/785 (56%), Gaps = 79/785 (10%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ ID+ SV LPP  +EFN  + Q WI +E  E+ R+A+ L+ 
Sbjct  1022  RDCLRFYGFGQMVACFRYASIDVNSVYLPPPKIEFNYDT-QGWIKEEANEVRRRAELLFK  1080

Query  182   EISSAVQKLEEKCASVGCDWNNMNG----LHNCILELKDMLMKEKNYWNDLHQPTHEETS  349
             ++   +Q L +K A VG +  +M      +H  I EL+ M  K++  + +  Q    +  
Sbjct  1081  DVRHTLQDLSKKIA-VGSEDGSMKTAEARVH--ISELEGMQQKDEVEFEESLQQALCKEV  1137

Query  350   EEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFD-------NNFSSQHPENAVSCI  508
             + G   ID+LE+NRLR  +L     WD RL    S+ +       N F  +  E  VS +
Sbjct  1138  KLGLPAIDILEINRLRRQILFHSCVWDQRLIRAASLVNSYLREGTNAFVPKLKEKPVSPV  1197

Query  509   -NPGEWGGETIFKDGSLEHAYEENVHEFPNSEECP---GEGLHSEH--------DEPPVP  652
               P +      FK      ++     E      C       +H  H        D+ P  
Sbjct  1198  EKPVDVNA--AFKPSKGFSSFVSLPLEVKPGAHCNRGISGDIHEPHRVQKESGVDQDPSY  1255

Query  653   KDALSYQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSI-----LSDKIDCAWT  817
             K+A  +   S S S   +     +L          + RA S G       LSD +D AWT
Sbjct  1256  KEADQFLSSSESVSYKPEPQESGKL----------VRRALSDGEFPKMADLSDTLDAAWT  1305

Query  818   GIDPSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISK  997
             G        + H +   G+    S    + VDS +  +L S A   +    L +   +S 
Sbjct  1306  G--------ENHPANVIGKESGYSLPDPTLVDSSS--KLNSVAASTAEQGGLEVVRSLSS  1355

Query  998   RLPPSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSH  1177
                      S+ K      + R+++  P S+     ++     AQKL +   + T   S 
Sbjct  1356  V--------SSTKGTENMTNSRSLVGMPFSSFYSSFNKNSSLNAQKLTVSEYNPTYVMSL  1407

Query  1178  -ASILPEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGV  1354
               S    GARL +P  G  D ++ VYD+EPTS+I Y L S +Y   +++     E     
Sbjct  1408  WDSERLSGARLFLPV-GVNDTIVPVYDDEPTSVIVYTLVSSDYHVQISE----FERAKDA  1462

Query  1355  SDTNKESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDP---KLSP  1510
             +D+   S I   ++        D       S GS D      SG  G    DP       
Sbjct  1463  ADSAAASAIFDSVNLLSVSSFDDTTSDRDKSLGSADEAVFSTSGSRGSQVLDPLSYTKDL  1522

Query  1511  HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKS  1690
             H RISF D+     GKVK++VTCYFAK+FDALR+ CC SELDFIRSLSRCK+W AQGGKS
Sbjct  1523  HARISFTDDGLL--GKVKYTVTCYFAKRFDALRRMCCHSELDFIRSLSRCKKWGAQGGKS  1580

Query  1691  NVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVK  1870
             NV+FAK+LD+RFIIKQ+ KTEL+SF +F P YF+YL++S S+GSPTCLAK++GIYQVA K
Sbjct  1581  NVFFAKTLDDRFIIKQVPKTELESFIKFGPAYFKYLSESISTGSPTCLAKILGIYQVASK  1640

Query  1871  HLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQT  2047
             H KGGKE+KMDL+VMENL + R+I+R+YDLKGS RSRYN+DT  +NKVLLD N +E++ T
Sbjct  1641  HFKGGKESKMDLLVMENLLFRRNITRLYDLKGSSRSRYNADTSGSNKVLLDQNLIEAMPT  1700

Query  2048  KPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDK  2227
              PIF+GSKAKR LERAVWNDT+FLA + VMDYSLLVG+DEE+ ELVLGIID+MRQYTWDK
Sbjct  1701  SPIFVGSKAKRLLERAVWNDTAFLASIDVMDYSLLVGIDEEKHELVLGIIDFMRQYTWDK  1760

Query  2228  HLETW  2242
             HLETW
Sbjct  1761  HLETW  1765



>ref|XP_009391201.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009391202.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=1815

 Score =   483 bits (1243),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 304/777 (39%), Positives = 439/777 (56%), Gaps = 91/777 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACF+Y+ I++ +V LPPS L+FN Q  Q W+ +E  ++ +    L+ 
Sbjct  1032  RDCLRFYGSGEMVACFKYASINVHNVYLPPSKLDFNCQ-HQEWVQEEATKVFKTTNDLFT  1090

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHN--CILELKDMLMKEKNYWNDLHQPTHEETSEE  355
              + ++++++EEK +       N   L +   I+EL+ +L KE+  + +  Q    + S +
Sbjct  1091  AVYNSLRQVEEKISKTVSHDGNTEVLESRRNIIELEAILQKEQAEFEESKQKVTRKDSRK  1150

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGET  535
             GQ  ID+L++N+L+  LL   + WD  L +                A S  NP E+    
Sbjct  1151  GQPFIDILDVNKLQKQLLLKSYVWDKCLKFA---------------AGSLSNPHEFLMTR  1195

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGL--------HSEHDEPPVPKDALSYQQ-----  676
               +D +L    + +   F  S     E L        + ++ +P   +  +  Q      
Sbjct  1196  NNEDLTLR--AQRSFISFDASVSTAAESLNGTRTKDGYDQYKQPASDQQNVDQQHVKKTE  1253

Query  677   --GSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV  850
                +S+ + +   +LE+ LG+   ++       P+    LSD +D  W G +  +    V
Sbjct  1254  LLSTSTNASDQSDSLESDLGVHKVLSDGHF---PNMAD-LSDTLDAKWRGENGPTL---V  1306

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
              AS  +    V +   +S  ++     +  P  +             +  +PP     + 
Sbjct  1307  DASKSKSLTLVEATPAISASENSEESIITDPNNL------------CAPMMPPRSVECAE  1354

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLM  1210
             +         +++  D  +++   C  AL      +   P   + F      + +G   +
Sbjct  1355  VSIL-----IKSLFSDLYASLNKNCDSAL------IEYHPEYISLF---KEFMQQGWARL  1400

Query  1211  VPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA--  1384
             +P  G  D VI +YD+EPTS ISYAL   EY   ++D+P     G       +ES I+  
Sbjct  1401  LP-TGVDDTVIPIYDDEPTSAISYALVCPEYHFQISDEPEKYRDG-------RESSISFL  1452

Query  1385  -SKLSTWQRFGSL-DLDYMHFGSYGSEDAS-----GRIGFLFSDPKLSP---HPRISFED  1534
                      F S+ D+    F S+GS D S     G    L  DP  S    H R+SF  
Sbjct  1453  TQDSGNPHLFQSVEDITLESFRSFGSFDDSNSSIYGSKSSLILDPLASSKSVHVRVSFAV  1512

Query  1535  ESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSL  1714
                +  GKV+++VTCY+AK FD+LR+ CCPSELDFIRSLSRCK+W AQGGKSNV+FAKSL
Sbjct  1513  NGPH--GKVRYTVTCYYAKCFDSLRRTCCPSELDFIRSLSRCKKWGAQGGKSNVFFAKSL  1570

Query  1715  DERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKET  1894
             D+RFIIKQ+ KTEL+SF +FAP+YF+YL+DS S+GSPTCLAK++GIYQVAVK+LKGGKE+
Sbjct  1571  DDRFIIKQVTKTELESFIKFAPEYFKYLSDSISTGSPTCLAKILGIYQVAVKNLKGGKES  1630

Query  1895  KMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSK  2071
             +MD++VMENL +GR++  +YDLKGS RSRYN+D    NKVLLD N +E++ T PIF+G+K
Sbjct  1631  RMDVLVMENLLFGRNVKWLYDLKGSSRSRYNADLSGNNKVLLDQNLIEAMPTSPIFVGNK  1690

Query  2072  AKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             AKR LERAVWNDT+FLA + VMDYSLLVGVDE + ELV+GIID+MRQYTWDKHLETW
Sbjct  1691  AKRLLERAVWNDTAFLASIDVMDYSLLVGVDENKNELVVGIIDFMRQYTWDKHLETW  1747



>ref|XP_009359681.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
isoform X2 [Pyrus x bretschneideri]
Length=1815

 Score =   483 bits (1243),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 321/787 (41%), Positives = 442/787 (56%), Gaps = 94/787 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACF Y+ I + SV LPP  LEF++ + Q WI KE  E+  +A+ L+ 
Sbjct  1018  RDCLRFYGFGRMVACFSYASIHVHSVYLPPQKLEFHNDN-QEWIQKEADEVGHRAELLFT  1076

Query  182   EISSAV-QKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEK-NYWNDLHQPTHEETSEE  355
             E+ +A+ Q LE++  S   D        + I+EL++ML KE+ ++   L +  H+E  + 
Sbjct  1077  ELRNALNQILEKRPISGTADGGKKAPESSQIVELEEMLQKEREDFEESLQKMMHKEV-KF  1135

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI----FDNNFSSQHPENAVSCINPGEW  523
             GQ  ID+LE+NRLR  LL   + WD RL    S+    F    SS  P+     I+    
Sbjct  1136  GQPAIDILEINRLRRQLLFHSYIWDQRLIQAASLSKKSFQEGLSSSLPKLKEKPIS----  1191

Query  524   GGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNG  703
                      S E   + N++  P      G+GL S        K  +S  QG       G
Sbjct  1192  ---------STEKLVDTNINSMP------GKGLSSSDSSLRETKPDVSIYQG-------G  1229

Query  704   DKTLETRLGLENAVNKSPLERAPS---AGSILSDKIDCAWTGIDPSSQDMQVHASLQEGE  874
             D    ++ G E   NK+ + + P+        +   D +    DP      V  +L EG 
Sbjct  1230  DVGSFSQPGGEQ--NKNEMVQDPNHSNEAKNFTSSSDNSIDKSDPLESGTNVRRTLSEGN  1287

Query  875   RRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSY----------L  1024
                         +SP    L       + D+A   +   +  +P    Y           
Sbjct  1288  ------------ESPVVANLSD-----TLDAAWTGESHPTSTIPKENEYSLPDSTLVNSA  1330

Query  1025  STLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKL---NLLPSSSTTFTS-----HA  1180
             + L+   +  D +N   D         + +L  ++ K+   N   +S           + 
Sbjct  1331  TVLRKVESNSDLQNCAVDQAGVKATAPTHSLSSKSLKVFDKNYSSNSQKIIIGEYNPVNV  1390

Query  1181  SILPE-----GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGG  1345
             S+  E     GARL++P  G  D VI V+D+EPTS+I+YAL S +Y   +++    SE  
Sbjct  1391  SMFRELERQSGARLLLPI-GVNDSVIPVFDDEPTSVIAYALVSSDYHLQISE----SERP  1445

Query  1346  WGVSDTNKESPI---ASKLSTWQRFGSLDLDYMHFGSY--GSEDASGRIGFLFSDPKLSP  1510
                 D++   P+   A+ LS      SL   Y + GS   G    S        D  LS 
Sbjct  1446  RDALDSSVSLPLFDSANLLSLSSFDESLSETYRNLGSSDEGMLSVSQSRSSQALDSLLSK  1505

Query  1511  --HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGG  1684
               H R+SF D   +  GKVK++VTCY+A +F+ALR+ CCPSE+DF+RSLSRCK+W AQGG
Sbjct  1506  DVHARVSFTDGGPH--GKVKYTVTCYYATRFEALRRTCCPSEIDFVRSLSRCKKWGAQGG  1563

Query  1685  KSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVA  1864
             KSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S SS SPTCLAK++GIYQV+
Sbjct  1564  KSNVFFAKTLDDRFIIKQVTKTELESFIKFAPSYFKYLSESISSKSPTCLAKILGIYQVS  1623

Query  1865  VKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESL  2041
              KH K GKE+KMD++VMENL + R+++R+YDLKGS RSRYN DT  +NKVLLD N +E++
Sbjct  1624  SKHGKAGKESKMDVLVMENLLFRRNVTRLYDLKGSSRSRYNPDTSGSNKVLLDQNLIEAM  1683

Query  2042  QTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTW  2221
              T PIF+G+KAKR LERAVWNDT+FLA + VMDYSLLVG+DEE+ ELVLGIID+MRQYTW
Sbjct  1684  PTSPIFVGNKAKRLLERAVWNDTAFLASIDVMDYSLLVGMDEEKDELVLGIIDFMRQYTW  1743

Query  2222  DKHLETW  2242
             DKHLETW
Sbjct  1744  DKHLETW  1750



>gb|EMT29808.1| 1-phosphatidylinositol-3-phosphate 5-kinase FAB1 [Aegilops tauschii]
Length=1499

 Score =   478 bits (1230),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 316/767 (41%), Positives = 437/767 (57%), Gaps = 109/767 (14%)
 Frame = +2

Query  29    GSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYAEISSAVQKL  208
             GSM+A FRYSP+DILSV LPPSVL+F     Q W+++E  ++  +  + Y  I   +  +
Sbjct  769   GSMVAVFRYSPVDILSVNLPPSVLDFAYPVAQDWLIEEAGDVANRKDNFYRVIFDNLDCI  828

Query  209   EEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQTTIDVLELN  388
             E K  S   D +   GL+  +++LKD++  E   ++ L      +  +     +DVLELN
Sbjct  829   E-KTVSAQEDVSMKAGLYKHVVDLKDLIKVEWKKYDVLSGFGSIQKLQTIGEPVDVLELN  887

Query  389   RLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETIFKDGSLE-HA  565
             RLR  L+ D H WD RL+ M S+   N ++     A     P ++  E++ +D   E  +
Sbjct  888   RLRRELVLDAHVWDRRLHMMHSLTKKNCTA-----ATDAQCPKKFP-ESVLEDSKAEISS  941

Query  566   YEENVH---EFPNSEECPGEG----LHSEHDEPPVPKDALS-----YQQ---GSSSTS--  694
              +EN+    E+  S     +     L  EH    V    L+     Y Q   GS+S++  
Sbjct  942   TQENMEKSLEYSQSSSFITDSGKPLLRREHGGTTVSHSGLTNIDEVYHQSVEGSASSAGL  1001

Query  695   --------CNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQV  850
                        +  +   L LE       LE++ S+ S LSD+ID AWTG    +  +  
Sbjct  1002  HIVPHPCEVQSNGVVADELKLEKT-----LEKSESSPSNLSDRIDLAWTGSGVETL-LVA  1055

Query  851   HASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLST  1030
               +L  G                + + + +P R+ SFDS +  +  +S   P   S +S 
Sbjct  1056  PTALMNGS---------------SYQNVMAPIRIKSFDSGINFRNGLS---PVDDSNVSI  1097

Query  1031  LKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASI--LPEGAR  1204
              +++          R P         +AL R  + L      S  FT+  S+  + +G  
Sbjct  1098  RRAYSQ--------RPP---------RALERTGRGL------SPIFTNKLSLPGMVDGEG  1134

Query  1205  LMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIA  1384
               +      DVV+ VYD+EP+S+I++A++  EY+ ++            V + + E    
Sbjct  1135  RFLLSQSVSDVVVPVYDDEPSSMIAHAMTVPEYRSFMLP----------VLNLHNELDRP  1184

Query  1385  SKLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVK  1564
             S L++  +  S    +       S+D                H  +SFEDE   +  K K
Sbjct  1185  SVLNSLDQ-NSTSRSWSDVSQMNSKDI---------------HLTVSFEDEDSCSVDKAK  1228

Query  1565  FSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQ  1744
             FSV CYFAKQFD++RKKCC  ELD+IRSLSRCKRWSAQGGKSNVYFAK+LD+RF+IKQ+ 
Sbjct  1229  FSVICYFAKQFDSIRKKCCADELDYIRSLSRCKRWSAQGGKSNVYFAKTLDDRFVIKQVT  1288

Query  1745  KTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENL  1924
             +TELDSFE++A +YF+Y+T+S SSGSP CLAKV+G+YQV  K++K GKE KM+L+VMEN+
Sbjct  1289  RTELDSFEDYATEYFKYITESVSSGSPICLAKVLGLYQVVAKNMKDGKELKMELMVMENI  1348

Query  1925  FYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTKPIFLGSKAKRSLERAVW  2101
             F+ R +SR+YDLKGS+RSRYN DT   NKVLLDLN LE+L TKPIFLGSKAKR LERAVW
Sbjct  1349  FFKRKVSRIYDLKGSLRSRYNPDTSGNNKVLLDLNLLETLHTKPIFLGSKAKRRLERAVW  1408

Query  2102  NDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             NDTSFLA V VMDYSLLVG+DEE+KELV+GIIDY+RQYTWDK LETW
Sbjct  1409  NDTSFLASVGVMDYSLLVGIDEEKKELVMGIIDYLRQYTWDKQLETW  1455



>ref|XP_006412375.1| hypothetical protein EUTSA_v10024198mg [Eutrema salsugineum]
 gb|ESQ53828.1| hypothetical protein EUTSA_v10024198mg [Eutrema salsugineum]
Length=1756

 Score =   482 bits (1240),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 308/762 (40%), Positives = 431/762 (57%), Gaps = 69/762 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACFRY+ I+I +V LPP+ LEFN ++ Q W+ KE  E++ KA  L+ 
Sbjct  976   RDCLRFYGFGRMVACFRYASINIFAVFLPPAKLEFNYEN-QEWLQKESKEVIIKADVLFN  1034

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDML-MKEKNYWNDLHQPTHEETSEEG  358
             E+  A+ ++  K        +  N +   + EL  +L  ++K Y   L Q       ++G
Sbjct  1035  EVQEALSQISAKTVDANSKDSTPNKIKLSLEELAGLLEQRKKEYKESLQQML--SMFKDG  1092

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q  ID+L +N+LR  +L D +AWD  L    S+  NN+S +   N+       + G E +
Sbjct  1093  QPAIDILLINKLRRLILFDSYAWDECLAGAASMVRNNYS-EALRNSAPKFMGQKLGDEKV  1151

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEG--LHSEHDEPPVPKDALS-----YQQGSSSTSC  697
                 +   +  +++ +   S++   +G  L   + +  +P++  S     Y+    S+  
Sbjct  1152  SSRSTHVASSNDSLPQDAESDKSLNQGKLLADVNGKGAIPEEVGSDMPPDYRMELESSEG  1211

Query  698   NGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQEGER  877
               +  +E      + V ++ L  + S  + LSD +D AW G   +S++         G  
Sbjct  1212  GKENFVEP-----SQVVRTVLTESQSQAADLSDTLDAAWIGEQTASEN---------GIS  1257

Query  878   RVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYGD  1057
             R AS    ++    +   L       +F      +E   +   PSPS+  +L   ++   
Sbjct  1258  RPASRAASANGTQTSDLWLSDSESGLTFKGGATNEEHTIQIQMPSPSFYYSLNKNYSLNS  1317

Query  1058  YRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPEGARLMVPENGQKDV  1237
              ++           I ++  P        L   S            GARL++P  G  ++
Sbjct  1318  RKH-----------IMAEDRPYYVSSYRELEWRS------------GARLLLPL-GINEL  1353

Query  1238  VIAVYDNEPTSIISYALSSKEYK------DWVTDKPYMSEGGWGVSDTNKESPIASKLST  1399
             V+ VYD+EPTSII+YAL+S EY       D   D+   S G + + D+     + S    
Sbjct  1354  VLPVYDDEPTSIIAYALTSSEYNAQMSGSDKARDR-LDSGGSFSLFDSVNLLSLNSLSDL  1412

Query  1400  WQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVTC  1579
                     +D     S   E  S  +        L  H R+SF DE     GKVK+SVTC
Sbjct  1413  -------SVDMSRSLSSADEQVSQLLHSYLYLKDL--HARVSFTDE--GPPGKVKYSVTC  1461

Query  1580  YFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTELD  1759
             Y+AK+F+ALRK CCPSE DFIRSL RC++W AQGGKSNV+FAK+LD+RFIIKQ+ KTEL+
Sbjct  1462  YYAKEFEALRKICCPSETDFIRSLGRCRKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELE  1521

Query  1760  SFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGRS  1939
             SF +F P YF+YLTDS  S SPT LAK++GIYQV+ KHLKGGKE KMD++VMENL + R+
Sbjct  1522  SFIKFGPAYFKYLTDSICSKSPTSLAKILGIYQVSSKHLKGGKEFKMDVLVMENLLFKRN  1581

Query  1940  ISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTSF  2116
              +R+YDLKGS R+RYN DT  +N VLLD N +E++ T PIF+GSKAKR LERAVWNDTSF
Sbjct  1582  FARLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRLLERAVWNDTSF  1641

Query  2117  LAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LA ++VMDYSLLVGVDEER ELVLG ID+MRQYTWDKHLETW
Sbjct  1642  LASIHVMDYSLLVGVDEERNELVLGTIDFMRQYTWDKHLETW  1683



>ref|XP_009359680.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
isoform X1 [Pyrus x bretschneideri]
Length=1822

 Score =   482 bits (1241),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 321/787 (41%), Positives = 442/787 (56%), Gaps = 94/787 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACF Y+ I + SV LPP  LEF++ + Q WI KE  E+  +A+ L+ 
Sbjct  1025  RDCLRFYGFGRMVACFSYASIHVHSVYLPPQKLEFHNDN-QEWIQKEADEVGHRAELLFT  1083

Query  182   EISSAV-QKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEK-NYWNDLHQPTHEETSEE  355
             E+ +A+ Q LE++  S   D        + I+EL++ML KE+ ++   L +  H+E  + 
Sbjct  1084  ELRNALNQILEKRPISGTADGGKKAPESSQIVELEEMLQKEREDFEESLQKMMHKEV-KF  1142

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI----FDNNFSSQHPENAVSCINPGEW  523
             GQ  ID+LE+NRLR  LL   + WD RL    S+    F    SS  P+     I+    
Sbjct  1143  GQPAIDILEINRLRRQLLFHSYIWDQRLIQAASLSKKSFQEGLSSSLPKLKEKPIS----  1198

Query  524   GGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNG  703
                      S E   + N++  P      G+GL S        K  +S  QG       G
Sbjct  1199  ---------STEKLVDTNINSMP------GKGLSSSDSSLRETKPDVSIYQG-------G  1236

Query  704   DKTLETRLGLENAVNKSPLERAPS---AGSILSDKIDCAWTGIDPSSQDMQVHASLQEGE  874
             D    ++ G E   NK+ + + P+        +   D +    DP      V  +L EG 
Sbjct  1237  DVGSFSQPGGEQ--NKNEMVQDPNHSNEAKNFTSSSDNSIDKSDPLESGTNVRRTLSEGN  1294

Query  875   RRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSY----------L  1024
                         +SP    L       + D+A   +   +  +P    Y           
Sbjct  1295  ------------ESPVVANLSD-----TLDAAWTGESHPTSTIPKENEYSLPDSTLVNSA  1337

Query  1025  STLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKL---NLLPSSSTTFTS-----HA  1180
             + L+   +  D +N   D         + +L  ++ K+   N   +S           + 
Sbjct  1338  TVLRKVESNSDLQNCAVDQAGVKATAPTHSLSSKSLKVFDKNYSSNSQKIIIGEYNPVNV  1397

Query  1181  SILPE-----GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGG  1345
             S+  E     GARL++P  G  D VI V+D+EPTS+I+YAL S +Y   +++    SE  
Sbjct  1398  SMFRELERQSGARLLLP-IGVNDSVIPVFDDEPTSVIAYALVSSDYHLQISE----SERP  1452

Query  1346  WGVSDTNKESPI---ASKLSTWQRFGSLDLDYMHFGSY--GSEDASGRIGFLFSDPKLSP  1510
                 D++   P+   A+ LS      SL   Y + GS   G    S        D  LS 
Sbjct  1453  RDALDSSVSLPLFDSANLLSLSSFDESLSETYRNLGSSDEGMLSVSQSRSSQALDSLLSK  1512

Query  1511  --HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGG  1684
               H R+SF D   +  GKVK++VTCY+A +F+ALR+ CCPSE+DF+RSLSRCK+W AQGG
Sbjct  1513  DVHARVSFTDGGPH--GKVKYTVTCYYATRFEALRRTCCPSEIDFVRSLSRCKKWGAQGG  1570

Query  1685  KSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVA  1864
             KSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S SS SPTCLAK++GIYQV+
Sbjct  1571  KSNVFFAKTLDDRFIIKQVTKTELESFIKFAPSYFKYLSESISSKSPTCLAKILGIYQVS  1630

Query  1865  VKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESL  2041
              KH K GKE+KMD++VMENL + R+++R+YDLKGS RSRYN DT  +NKVLLD N +E++
Sbjct  1631  SKHGKAGKESKMDVLVMENLLFRRNVTRLYDLKGSSRSRYNPDTSGSNKVLLDQNLIEAM  1690

Query  2042  QTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTW  2221
              T PIF+G+KAKR LERAVWNDT+FLA + VMDYSLLVG+DEE+ ELVLGIID+MRQYTW
Sbjct  1691  PTSPIFVGNKAKRLLERAVWNDTAFLASIDVMDYSLLVGMDEEKDELVLGIIDFMRQYTW  1750

Query  2222  DKHLETW  2242
             DKHLETW
Sbjct  1751  DKHLETW  1757



>ref|XP_008337796.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
[Malus domestica]
 ref|XP_008337797.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
[Malus domestica]
 ref|XP_008337798.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
[Malus domestica]
 ref|XP_008337799.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like 
[Malus domestica]
Length=1815

 Score =   482 bits (1241),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 320/790 (41%), Positives = 439/790 (56%), Gaps = 100/790 (13%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G M+ACF Y+ I + SV LPP  LEF++ + Q WI KE  E+  +A+ L+ 
Sbjct  1018  RDCLRFYGFGRMVACFSYASIHVHSVYLPPQKLEFHNDN-QEWIQKEAEEVGHRAELLFT  1076

Query  182   EISSAVQK-LEEKCASVGCDWNNMNGLHNCILELKDMLMKEK-NYWNDLHQPTHEETSEE  355
             E+ +A+   LE++  S   D        + I+EL++ML KE+ ++   L +  H+E  + 
Sbjct  1077  ELRNALNHILEKRPISGTADGGKKAPESSQIVELEEMLQKEREDFEESLRKTMHKEV-KF  1135

Query  356   GQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESI----FDNNFSSQHPENAVSCINPGEW  523
             GQ  ID+LE+NRLR  LL   + WD  L    S+    F    SS  P+     I+    
Sbjct  1136  GQPAIDILEINRLRRQLLFHSYIWDQHLIQAASLSKKSFQEGLSSSLPKLKEKPIS----  1191

Query  524   GGETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNG  703
                      S+E     N++  P      G+GL S        K  +S  QG       G
Sbjct  1192  ---------SMEKLVNTNINSMP------GKGLSSSDSSLRETKPDVSIYQG-------G  1229

Query  704   DKTLETRLGLENAVNKSPLERAPS---AGSILSDKIDCAWTGIDPSSQDMQVHASLQEGE  874
             D    ++ G E   NK+ + + P+        +   D +    DP      V  +L EG 
Sbjct  1230  DVGSFSQPGGEQ--NKNEMVQDPNHSNEAKNFTPSSDNSIDKSDPLESGTSVRRTLSEGN  1287

Query  875   RRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSY----------L  1024
                         +SP    L       + D+A   +   +  +P    Y           
Sbjct  1288  ------------ESPVVANLSD-----TLDAAWTGESHPTSTIPKENGYSLPDSTFVNSA  1330

Query  1025  STLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASILPE---  1195
             + L+   +  D +N   D         + +L  ++ K+      + +F S   I+ E   
Sbjct  1331  TVLRKVESNSDLQNCAVDQAGVQATAPTHSLSSKSLKVF---DKNYSFNSQKIIIGEYNP  1387

Query  1196  -------------GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMS  1336
                           ARL++P  G  D VI V+D+EPTS+I+YAL S +Y   +++    S
Sbjct  1388  VNVPMFRELERQSRARLLLP-IGVNDTVIPVFDDEPTSVIAYALVSSDYHLQISE----S  1442

Query  1337  EGGWGVSDTNKESPI---ASKLSTWQRFGSLDLDYMHFGSY--GSEDASGRIGFLFSDPK  1501
             E      D++   P+   A+ LS      SL   Y + GS   G    S        D  
Sbjct  1443  ERPRDALDSSVSLPLFDSANLLSLSSFDESLSETYRNLGSSDEGMLSVSRSRSSQALDSL  1502

Query  1502  LSP--HPRISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSA  1675
             LS   H R+SF D    T GKVK++VTCY+A +F+ALR+ CCPSE+DF+RSLSRCK+W A
Sbjct  1503  LSKDIHARVSFTDG--GTLGKVKYTVTCYYATRFEALRRTCCPSEIDFVRSLSRCKKWGA  1560

Query  1676  QGGKSNVYFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIY  1855
             QGGKSNV+FAK+LD+RFIIKQ+ KTEL+SF +FAP YF+YL++S S+ SPTCLAK++GIY
Sbjct  1561  QGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPSYFKYLSESISTRSPTCLAKILGIY  1620

Query  1856  QVAVKHLKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFL  2032
             QV+ KH K GKE+KMD++VMENL + R+++R+YDLKGS RSRYN DT  +NKVLLD N +
Sbjct  1621  QVSSKHGKAGKESKMDVLVMENLLFRRNVTRLYDLKGSSRSRYNPDTSGSNKVLLDQNLI  1680

Query  2033  ESLQTKPIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQ  2212
             E++ T PIF+GSKAKR LERAVWNDT+FLA + VMDYSLLVGVDEE+ ELVLGIID+MRQ
Sbjct  1681  EAMPTSPIFVGSKAKRLLERAVWNDTAFLASIDVMDYSLLVGVDEEKDELVLGIIDFMRQ  1740

Query  2213  YTWDKHLETW  2242
             YTWDKHLETW
Sbjct  1741  YTWDKHLETW  1750



>ref|XP_008462241.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Cucumis melo]
Length=1832

 Score =   482 bits (1241),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 320/783 (41%), Positives = 444/783 (57%), Gaps = 73/783 (9%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G MIACFRY+  D+ SV LPPS L+FN + +Q WI KE  E++ +A+ L++
Sbjct  1015  RDCLRFYGYGRMIACFRYTSTDVHSVYLPPSKLDFNYE-DQEWIRKEKDEVVNQAELLFS  1073

Query  182   EISSAVQKLEEKCASV-GCDWNNMNGLHNCILELKDMLMKEKNYWN---------DLHQP  331
             E+ + ++++ EK +     +      L   I  L+ +L KEK  +           LH+ 
Sbjct  1074  EVLNTLRQIAEKISGARTINSTRKMELRRQIAGLEAILQKEKAKFELVLMRVIKESLHKT  1133

Query  332   THEETSEEGQTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNN----FSSQHPENAV  499
                E  ++GQ  +D+LE+N LR  LL   + WD +L    ++ + N    F ++  E  +
Sbjct  1134  MIGE-GKQGQGAVDILEINYLRRKLLIQAYVWDQQLIQAANLDNGNSAGSFIAESEERLM  1192

Query  500   --SCINPGEWGGETIFKD--GSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVP-----  652
               S   P       + +D   S  H   +  +E P++    G+   +   +P +      
Sbjct  1193  VDSEKLPEISTNRKLVEDLKSSDSHLAYQQCYEGPSN----GKEFVTSSAQPDIQVEEVG  1248

Query  653   -KDALSYQQGSSSTSCNG-DKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGID  826
               DA   ++   STS +   +TLE++  L+ A       R  +    LSD ++ AWTG +
Sbjct  1249  DSDADKGEEHLCSTSISAPSETLESKTYLQAAQADGEFSRMVN----LSDTLEAAWTGDN  1304

Query  827   PSSQDMQVHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLP  1006
              S   +    SL      + S        +     L   +   + D   R+   IS  LP
Sbjct  1305  GSVVGITKDNSL------ILSNSTSEDSSAIDITILNDGSEDQNVD---RVTHAISPSLP  1355

Query  1007  PSPSYLSTLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTSHASI  1186
                      K+     D+   +    SN   + ++      QKL  L   +  F S    
Sbjct  1356  S--------KALDDTEDFEGYLDTASSNFYYLFNENFLASGQKLESLAKHNPVFLSSFWE  1407

Query  1187  L--PEGARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSD  1360
             L    GARL +P  G  + V+ VYD+EP+SII+YAL S EY   + D+         V D
Sbjct  1408  LEFQGGARLFLPL-GISETVVPVYDDEPSSIIAYALMSPEYHSQLIDE------AEKVRD  1460

Query  1361  TNKESPIASKLSTWQRFGSLDLDYMHFGSYGSED-----ASGRIGFLFSDPKLSP---HP  1516
                  P  S  +      S D  +    S G  D      SG    +  DP L P   +P
Sbjct  1461  CGDSLPSLSSYTDSFFQSSDDFSFDTSKSLGPSDDTISSISGPRTSISLDPLLYPKSLNP  1520

Query  1517  RISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNV  1696
             RI FE+   +  G VK+SVTCY+AK+F+ALR+ CC SELDF++SLSRCK+W AQGGKSNV
Sbjct  1521  RIFFEEYGPH--GGVKYSVTCYYAKRFEALRRICC-SELDFVKSLSRCKKWGAQGGKSNV  1577

Query  1697  YFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHL  1876
             +FAK+LD+RFIIKQ+ KTEL+SF +FAP+YF+YL++S  + SPTCLAK++GIYQV  KHL
Sbjct  1578  FFAKTLDDRFIIKQVTKTELESFIKFAPEYFKYLSESIGTRSPTCLAKILGIYQVTAKHL  1637

Query  1877  KGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLESLQTKP  2053
             KGGKE+KMD++VMENL + R+++R+YDLKGS RSRYN+D T  NKVLLD N +E++ T P
Sbjct  1638  KGGKESKMDVLVMENLLFRRNVTRLYDLKGSSRSRYNADSTGNNKVLLDQNLIEAMCTSP  1697

Query  2054  IFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHL  2233
             IF+G+KAKR LERAVWNDTSFLA + VMDYSLLVGVDEE+ ELV+GIID+MRQYTWDKHL
Sbjct  1698  IFVGNKAKRLLERAVWNDTSFLASIGVMDYSLLVGVDEEKHELVIGIIDFMRQYTWDKHL  1757

Query  2234  ETW  2242
             ETW
Sbjct  1758  ETW  1760



>ref|XP_009135374.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
[Brassica rapa]
Length=1767

 Score =   481 bits (1238),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 312/764 (41%), Positives = 441/764 (58%), Gaps = 86/764 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+ ID+ SV LPPSVL FN  + Q WI +E  E++ +A+ L++
Sbjct  1005  RDCLRFYGFGNMVACFRYATIDVNSVYLPPSVLSFNYDN-QDWIQRETDEVVERAELLFS  1063

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWND-LHQPTHEETSEEG  358
             E+ +A+ ++  K            G    I EL+++L +EK  + D + +   +   +EG
Sbjct  1064  EVLNAISQIAAK------------GFRRRIGELEELLQREKAEFEDNIQKMMLQREVKEG  1111

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPENAVSCINPGEWGGETI  538
             Q  +D+LEL RLR  L+   + WDHRL    S+     S ++ +  ++            
Sbjct  1112  QPQVDILELYRLRRQLIFQSYMWDHRLINASSLSKIESSDKNEKVPLA------------  1159

Query  539   FKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTLE  718
              K  +L    E NV            G +S    P V ++      G S+      K  +
Sbjct  1160  -KSQTLP---EMNV------------GTNSLLAGPEVDQNP----DGGSTDDTKVQKEAD  1199

Query  719   TRLGL----ENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQE---GER  877
             T L L    E+    SP +  P +   L  K+D   T  D       + A+L     GER
Sbjct  1200  THLDLNPEKEDGGEVSPSKTLPDSSEPLESKLDVRRTQSDGEIVMKNLSATLDAAWIGER  1259

Query  878   RVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISK---RLPPSPSYLSTLKSFHA  1048
             + +  G++     PT  ++  P    S    + + E+ ++     P SP+  S  K + +
Sbjct  1260  QTS--GEI-----PTNTKILLPPSNSSTFPPIDLSEQQNEFKVAYPVSPALPS--KDYES  1310

Query  1049  YGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGARLMVPEN  1222
               D  + +  P  N     ++     +QKL+     S  + S    + L  G RL++P  
Sbjct  1311  SDDSVSWLGVPFLNFYRSINKNFLLSSQKLDTFGEHSPVYISSFREAELQGGPRLLLPV-  1369

Query  1223  GQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVSDTNKESPIASKLSTW  1402
             G  D+V+ VYD+EPTS+I+YAL+S EY+  ++      EG   VS T       S+L+  
Sbjct  1370  GINDIVVPVYDDEPTSMIAYALTSPEYQRQIS-----LEGESLVSYT-------SELNIP  1417

Query  1403  QRFGSLDLDYMHFGSYGSEDASGRIGFLFSDP---KLSPHPRISFEDESCNTGGKVKFSV  1573
             +       D     S   E           DP     + H R+S+ ++   T GKVK++V
Sbjct  1418  RPVDDTIFDPSRSTSSVDESILSMSSSRSLDPLSYTKALHARVSYGED--GTLGKVKYTV  1475

Query  1574  TCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTE  1753
             TCY+AK+F+ALR  C PSEL++IRSLSRCK+W AQGGKSNV+FAK+LD+RFIIKQ+ KTE
Sbjct  1476  TCYYAKRFEALRGICIPSELEYIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTE  1535

Query  1754  LDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYG  1933
             L+SF +FAP YF+YL++S S+ SPTCLAK++GIYQVA K LK GKETKMD+++MENL  G
Sbjct  1536  LESFIKFAPAYFKYLSESISTKSPTCLAKILGIYQVATKQLKSGKETKMDVLIMENLLSG  1595

Query  1934  RSISRVYDLKGSVRSRYNSD-TKANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDT  2110
             R++ R+YDLKGS R+RYN D + +NKVLLD N +E++ T PIF+G+KAKR LERAVWNDT
Sbjct  1596  RTVKRLYDLKGSSRARYNPDASGSNKVLLDQNLIEAMPTSPIFVGNKAKRLLERAVWNDT  1655

Query  2111  SFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             +FLA   VMDYSLLVGVDEE+ ELVLGIID++RQYTWDKHLE+W
Sbjct  1656  AFLALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESW  1699



>gb|EPS70417.1| hypothetical protein M569_04338, partial [Genlisea aurea]
Length=1718

 Score =   480 bits (1235),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 313/784 (40%), Positives = 442/784 (56%), Gaps = 88/784 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+ ID+ SV LPP  L+FN ++ Q WI+ +V E+ R+AK L++
Sbjct  926   RDCLRFYGYGNMVACFRYASIDVFSVFLPPLQLDFNYEN-QEWIVNQVNEVTRRAKLLFS  984

Query  182   EISSAVQKLEEKCASVGCDWN-NMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEG  358
             E+ +++  +E+   S   D   N++  +N +  L  +L  EK+ +    Q    +  + G
Sbjct  985   EVLNSLLLMEKSSGSEPFDSGMNLSESNNQVALLDALLQDEKSKFEISLQKIVNKDEKNG  1044

Query  359   QTTIDVLELNRLRHSLLTDLHAWDHRLYYMESIFDNNFSSQHPE----NAVSCINP----  514
             Q  +D+LELN+L+  L+   + WDHRL    +  D N     P+     A++  NP    
Sbjct  1045  QHAVDILELNKLQQQLVLQSYIWDHRLRCAANK-DANVEYDDPDFTNSEAITSTNPVKTS  1103

Query  515   --------GEWG-GETIFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALS  667
                       W     +F  G+++ A + +    P   +   +  H   ++ P+   AL 
Sbjct  1104  ERLMTAASDSWDINFELFDSGAIDSA-KRSPDTVPTVSDIYLDDRH--RNQSPLVLTALK  1160

Query  668   YQQGSSSTSCNGDKTLETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQ  847
                  S    +G   ++ R  L     +SP+         LSD +D  WTG  PS     
Sbjct  1161  KANSVSDPLVSG---VKVRRALSEG--QSPI--------CLSDTLDAVWTGQSPSGLATP  1207

Query  848   VHASLQEGERRVASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLS  1027
             V+ S  E      S  +    DS   + + +P    S  S   I  +       S S+L 
Sbjct  1208  VNNSSMEANTPEVSSSRWEVEDSIAREDVTTPKVSLSPPS---IFTKRCDNFEESVSWLG  1264

Query  1028  TLKSFHAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLL----PSSSTTFTSHASILPE  1195
              +     Y  Y+N++                  +QKL+ +    P+  ++F +      E
Sbjct  1265  -MPFLSFYRSYKNLLGG----------------SQKLDTIKEYDPAYISSFRNSED---E  1304

Query  1196  GARLMVPENGQKDVVIAVYDNEPTSIISYALSSKEY-----------KDWVTDKPYMSEG  1342
             G    +   G  D VI VY++EPTS+ISYAL S +Y           K +V+ +   SE 
Sbjct  1305  GGGCFLLPIGVNDAVIPVYEDEPTSVISYALMSPDYASQACHELEKSKSFVSMQSLDSEN  1364

Query  1343  GWGVSDTNKESPIASKL--STWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHP  1516
                   +++  P + +   S  +R        +   S    D+     FL+     + HP
Sbjct  1365  FQSFYSSDETVPESCRSVDSIEERMMPPSSSSILSQSSLPSDS-----FLYLK---TLHP  1416

Query  1517  RISFEDESCNTGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNV  1696
             R+SF  +     GKV+++VTCY+AK F ALR+ CCPSE+DF+RSLSRCK+W AQGGKSNV
Sbjct  1417  RVSFTVD--GAAGKVRYTVTCYYAKCFKALRETCCPSEVDFVRSLSRCKKWGAQGGKSNV  1474

Query  1697  YFAKSLDERFIIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVK-H  1873
             +FAK+LDERFI KQ+ KTEL+SF +FAP YF+YLT+S +S SPTCLAK++GIYQVA +  
Sbjct  1475  FFAKTLDERFIAKQLSKTELESFIKFAPYYFKYLTESIASNSPTCLAKILGIYQVASRQQ  1534

Query  1874  LKGGKETKMDLIVMENLFYGRSISRVYDLKGSVRSRYNSDTKA-NKVLLDLNFLESLQTK  2050
             +KGGKETKMDL+VMENL + R+++R+YDLKGS RSRYN D+   N+VLLD N +E++ T 
Sbjct  1535  VKGGKETKMDLLVMENLLFRRNLTRLYDLKGSSRSRYNPDSSGRNQVLLDQNLIEAMPTS  1594

Query  2051  PIFLGSKAKRSLERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKH  2230
             PIF+GSKAKR LERA+WNDT+FLA V VMDYSLLVGVDEER ELVLGIID+MRQYTWDKH
Sbjct  1595  PIFIGSKAKRRLERAIWNDTAFLASVDVMDYSLLVGVDEERHELVLGIIDFMRQYTWDKH  1654

Query  2231  LETW  2242
             LETW
Sbjct  1655  LETW  1658



>gb|KFK38794.1| hypothetical protein AALP_AA3G161200 [Arabis alpina]
Length=1776

 Score =   477 bits (1227),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 307/763 (40%), Positives = 440/763 (58%), Gaps = 63/763 (8%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+ ID+ SV LPPS+L FN    Q WI +E  +++ +A+ L++
Sbjct  993   RDCLRFYGFGNMVACFRYATIDVHSVYLPPSILSFNYDY-QEWIQRETDKVVERAELLFS  1051

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ +A+ ++ EK            G      EL+++L +EK  + +  Q       +EGQ
Sbjct  1052  EVLNAISQIAEK------------GFRRRTGELEEVLQREKAEFEENMQKMLHREVKEGQ  1099

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI--FDNNFSSQHPENAVSCINPGEWGGET  535
               +D+LEL R+R  L+   + WDHRL    ++   +++  ++  EN    +   +   E 
Sbjct  1100  PLVDILELYRIRRQLIFQSYMWDHRLISASTLHKLESSDDTKREENEKPPLAKSQTLPEM  1159

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGSSSTSCNGDKTL  715
                  SL    + N+     S    G  L+    E     D    ++     S +  KTL
Sbjct  1160  NAGTNSLLAGSDVNLILDGASTGDTG-SLNKVQKEADTNSDLNQKKEDGGEVSLS--KTL  1216

Query  716   -ETRLGLENAVNKSPLERAPSAGSI----LSDKIDCAWTGIDPSSQDMQVHASLQEGERR  880
              +T   LEN ++   + R  S G I    LS  +D AW G      + Q    +    + 
Sbjct  1217  PDTCDPLENKLD---VRRTQSDGQIVMKNLSATLDAAWIG------ERQTSVEIPTNNKI  1267

Query  881   VASFGQLSHVDS--PTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYG  1054
             +     +S   +  P  + LK P  +    +  ++   +S  LP         K++    
Sbjct  1268  LLPPSSMSQSSTFPPIAEGLK-PIDLPEQHNEFKVGYPVSPALPS--------KNYENSE  1318

Query  1055  DYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGARLMVPENGQ  1228
             D  + +  P  N     ++     +QKL+     S  + S    + L  G RL++P  G 
Sbjct  1319  DSVSWLGMPFLNFYRSINKNFLLSSQKLDTFGEHSPIYISSFREAELQGGPRLLLPV-GM  1377

Query  1229  KDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGV---SDTNKESPIASKLST  1399
              DVV+ VYD+EPTS+I+YAL S EY+  +T      EG   V   S+ N   P+   +  
Sbjct  1378  NDVVVPVYDDEPTSMIAYALMSPEYQRQIT-----VEGESLVSYPSELNIPRPVDDTIFD  1432

Query  1400  WQR-FGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSPHPRISFEDESCNTGGKVKFSVT  1576
               R  GS+D   +   S  S      + +       + H R+S+ ++   T GKVK++VT
Sbjct  1433  PSRGTGSVDESILSMSSSRSSSRLDPLSY-----TKALHARVSYGED--GTLGKVKYTVT  1485

Query  1577  CYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQMQKTEL  1756
             CY+AK+F+ALR  C PSEL+FIRSLSRCK+W AQGGKSNV+FAK+LD+RFI+KQ+ KTEL
Sbjct  1486  CYYAKRFEALRGICLPSELEFIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIVKQVTKTEL  1545

Query  1757  DSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMENLFYGR  1936
             +SF +FAP YF+YL++S S+ SPTCLAK++GIYQV  K LK GKETKMD+++MENL +GR
Sbjct  1546  ESFIKFAPDYFKYLSESISTKSPTCLAKILGIYQVTTKQLKSGKETKMDVLIMENLLFGR  1605

Query  1937  SISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAVWNDTS  2113
             ++ R+YDLKGS R+RYN D+  +NKVLLD N +E++ T PIF+G+KAKR LERAVWNDT+
Sbjct  1606  NVKRLYDLKGSSRARYNPDSSGSNKVLLDQNLIEAMPTCPIFVGNKAKRLLERAVWNDTA  1665

Query  2114  FLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             FLA   VMDYSLLVGVDEE+ ELVLGIID++RQYTWDKHLE+W
Sbjct  1666  FLALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESW  1708



>emb|CDY33237.1| BnaC01g37100D [Brassica napus]
Length=1735

 Score =   476 bits (1226),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 309/773 (40%), Positives = 439/773 (57%), Gaps = 92/773 (12%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+ ID+ SV LPPSVL FN  + Q WI +E+ ++  +A+ L++
Sbjct  961   RDCLRFYGFGNMVACFRYATIDVHSVYLPPSVLSFNYDN-QDWIQREIDKVAERAELLFS  1019

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ +A+ ++  K            G +  I EL+++L +EK  + +  Q   +   +EGQ
Sbjct  1020  EVLNAISQIAVK------------GSNRRIGELEELLQREKAEFEENMQSMLQREVKEGQ  1067

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI--FDNNFSSQHPENAVSCINPGEWGGET  535
               +++LEL RLR  L+   + WDHRL    ++   +++  ++  EN    +   +   E 
Sbjct  1068  PRVEILELYRLRRQLIFQSYMWDHRLINASNLQKLESSDDTKREENEKPPLATSQTLPEM  1127

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEGLHSEHDEPPVPKDALSYQQGS-SSTSCNGDKT  712
                  SL    E +                      P P    +   GS +      D T
Sbjct  1128  NAGTNSLLAGSEVD----------------------PNPDGGSTGDTGSLNKVQKEADTT  1165

Query  713   LETRLGLENAVNKSPLERAPSAGSILSDKIDCAWTGIDPSSQDMQVHASLQE---GERRV  883
             L+     E+    SP    P     + +K+D   T  D       + A+L     GER+ 
Sbjct  1166  LDLIQEKEDMGEVSPSNTLPDTSDPVENKLDVRRTQSDGHLVMKNLSATLDAAWIGERQT  1225

Query  884   ASFGQLSHVDSPTCKRLKSPARVYSFDSALRI-----QERISK--RLPPSPSYLSTLKSF  1042
             +        + PT  ++  P    S    L+      Q++ SK    P SP+  S  KS+
Sbjct  1226  SE-------EIPTNNKILLPPSSMSISEGLKPIDLSEQQKESKVAAYPVSPALPS--KSY  1276

Query  1043  HAYGDYRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGARLMVP  1216
                 D  + +  P  +     ++     +QKL+        + S    + L  G RL++P
Sbjct  1277  ENSEDSVSWLGMPFLSFYRSINKNFLLSSQKLDTFGEHRPLYISSFREAELQGGPRLLLP  1336

Query  1217  ENGQKDVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVS---DTNKESPIAS  1387
               G  DVV+ VYD+EPTS+I+YAL + EY+  ++      EG   VS   + N   P+  
Sbjct  1337  V-GMNDVVVPVYDDEPTSMIAYALMTPEYQRQIS-----VEGESLVSFPSELNIPRPVDD  1390

Query  1388  KLSTWQRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSP-------HPRISFEDESCN  1546
              +    R            S  S D S  I  + S  +L P       + R+S+ ++   
Sbjct  1391  TIFDPSR------------SNSSVDES--ILSMSSSLRLDPLSYTKAFNARVSYGED--G  1434

Query  1547  TGGKVKFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERF  1726
             T GKVK++VTCY+AK+F+ALR  C PSEL+FIRSLSRCK+W AQGGKSNV+FAK+LD+RF
Sbjct  1435  TLGKVKYTVTCYYAKRFEALRGICLPSELEFIRSLSRCKKWGAQGGKSNVFFAKTLDDRF  1494

Query  1727  IIKQMQKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDL  1906
             IIKQ+ KTEL+SF +FAP YF+YL++S S+ SPTCLAK++GIYQVA K LK GKETKMD+
Sbjct  1495  IIKQVTKTELESFIKFAPAYFKYLSESISTKSPTCLAKILGIYQVATKQLKSGKETKMDV  1554

Query  1907  IVMENLFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRS  2083
             ++MENL +GR++ R+YDLKGS R+RYN D+  +NKVLLD N +E++ T PIF+G+KAKR 
Sbjct  1555  LIMENLLFGRTVKRLYDLKGSSRARYNPDSSGSNKVLLDQNLIEAMPTSPIFVGNKAKRL  1614

Query  2084  LERAVWNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             LERAVWNDT+FLA   VMDYSLLVGVDEE+ ELVLGIID++RQYTWDKHLE+W
Sbjct  1615  LERAVWNDTAFLALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESW  1667



>ref|XP_009117010.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Brassica rapa]
 ref|XP_009117018.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B 
isoform X1 [Brassica rapa]
Length=1771

 Score =   476 bits (1226),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 309/768 (40%), Positives = 445/768 (58%), Gaps = 83/768 (11%)
 Frame = +2

Query  2     RDCLRYYGCGSMIACFRYSPIDILSVRLPPSVLEFNSQSEQAWIMKEVAELLRKAKSLYA  181
             RDCLR+YG G+M+ACFRY+ ID+ SV LPPSVL FN  + Q WI +E+ ++  +A+ L++
Sbjct  998   RDCLRFYGFGNMVACFRYATIDVHSVYLPPSVLSFNYDN-QDWIQREIDKVAERAELLFS  1056

Query  182   EISSAVQKLEEKCASVGCDWNNMNGLHNCILELKDMLMKEKNYWNDLHQPTHEETSEEGQ  361
             E+ +A+ ++  K            G    I +L+++L +EK  + +  Q   +   +EGQ
Sbjct  1057  EVLNAISQIAVK------------GSRRRIGQLEELLQREKAEFEENMQRMLQGEVKEGQ  1104

Query  362   TTIDVLELNRLRHSLLTDLHAWDHRLYYMESI--FDNNFSSQHPENAVSCINPGEWGGET  535
               +D+LEL RLR  L+   + WDHRL    ++   +++  ++  EN    +   +   E 
Sbjct  1105  PLVDILELYRLRRQLIFQSYMWDHRLINASNLQKLESSDDTKREENEKPPLAKSQTLPEM  1164

Query  536   IFKDGSLEHAYEENVHEFPNSEECPGEG-LHSEHDEPPVPKDALSYQQGSSSTSCNGDKT  712
                  +L    E+N +  P+S      G L+    E     D +  ++     S + +  
Sbjct  1165  NAGTNTLLAGSEDNPN--PDSGSTGDTGSLNKVQKEADGNLDLIQEKEDEGEVSPS-NTL  1221

Query  713   LETRLGLENAVNKSPLERAPSAGSI----LSDKIDCAWTGIDPSSQDMQVHASLQEGERR  880
              +T   +EN ++   + R  S G +    LS  +D AW G   +S+D+  +  +      
Sbjct  1222  PDTSDPVENKLD---VRRTQSDGHLVMKNLSATLDAAWIGERQTSEDIPANNKILLPPSS  1278

Query  881   VASFGQLSHVDSPTCKRLKSPARVYSFDSALRIQERISKRLPPSPSYLSTLKSFHAYG-D  1057
             ++    L  +D P  +  K     Y    AL           PS +Y ++  S    G  
Sbjct  1279  MSISEGLKPIDLP--EHQKESKVAYPVSPAL-----------PSKNYENSEDSVSWLGMP  1325

Query  1058  YRNMIRDPVSNIQMICSQALPREAQKLNLLPSSSTTFTS--HASILPEGARLMVPENGQK  1231
             + +  R    N  +         +QKL+     S  + S    + L  G RL++P  G  
Sbjct  1326  FLSFYRSINKNFLL--------SSQKLDTFGEHSPVYISSFREAELQGGPRLLLPV-GIN  1376

Query  1232  DVVIAVYDNEPTSIISYALSSKEYKDWVTDKPYMSEGGWGVS---DTNKESPIASKLSTW  1402
             DVV+ VYD+EPTS+I+YAL + EY+  ++      EG   VS   + N   P+   +   
Sbjct  1377  DVVVPVYDDEPTSMIAYALMTPEYQRQIS-----VEGESLVSFPSELNIPRPVDDTIFDP  1431

Query  1403  QRFGSLDLDYMHFGSYGSEDASGRIGFLFSDPKLSP-------HPRISFEDESCNTGGKV  1561
              R            S  S D S  I  + S  +L P       + R+S+ ++   T GKV
Sbjct  1432  SR------------SNSSVDES--ILSMSSSLRLDPLSYTKAFNARVSYGED--GTLGKV  1475

Query  1562  KFSVTCYFAKQFDALRKKCCPSELDFIRSLSRCKRWSAQGGKSNVYFAKSLDERFIIKQM  1741
             K++VTCY+AK+F+ALR  C PSEL+FIRSLSRCK+W AQGGKSNV+FAK+LD+RFIIKQ+
Sbjct  1476  KYTVTCYYAKRFEALRGICLPSELEFIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIIKQV  1535

Query  1742  QKTELDSFEEFAPKYFEYLTDSHSSGSPTCLAKVVGIYQVAVKHLKGGKETKMDLIVMEN  1921
              KTEL+SF +FAP YF+YL++S S+ SPTCLAK++GIYQVA K LK GKETKMD+++MEN
Sbjct  1536  TKTELESFIKFAPAYFKYLSESISTKSPTCLAKILGIYQVATKQLKSGKETKMDVLIMEN  1595

Query  1922  LFYGRSISRVYDLKGSVRSRYNSDTK-ANKVLLDLNFLESLQTKPIFLGSKAKRSLERAV  2098
             L +GR++ R+YDLKGS R+RYN D+  +NKVLLD N +E++ T PIF+G+KAKR LERAV
Sbjct  1596  LLFGRTVKRLYDLKGSSRARYNPDSSGSNKVLLDQNLIEAMPTSPIFVGNKAKRLLERAV  1655

Query  2099  WNDTSFLAGVYVMDYSLLVGVDEERKELVLGIIDYMRQYTWDKHLETW  2242
             WNDT+FLA   VMDYSLLVGVDEE+ ELVLGIID++RQYTWDKHLE+W
Sbjct  1656  WNDTAFLALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESW  1703



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6877861654060