BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16952_g1_i1 len=1520 path=[1498:0-531 2030:532-569 2068:570-998
2497:999-1519]

Length=1520
                                                                      Score     E

ref|NP_001233950.1|  plastid-dividing ring protein                      574   0.0      
ref|NP_001275153.1|  plastid-dividing ring protein                      570   0.0      
ref|XP_009591422.1|  PREDICTED: cell division protein FtsZ homolo...    568   0.0      
ref|XP_002276623.1|  PREDICTED: cell division protein FtsZ homolo...    560   0.0      Vitis vinifera
emb|CAB89287.1|  chloroplast FtsZ-like protein                          559   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009765068.1|  PREDICTED: cell division protein FtsZ homolo...    558   0.0      
ref|XP_007211741.1|  hypothetical protein PRUPE_ppa006258mg             550   0.0      
ref|XP_008227026.1|  PREDICTED: cell division protein FtsZ homolo...    546   0.0      
ref|XP_008366436.1|  PREDICTED: cell division protein FtsZ homolo...    545   0.0      
gb|AFC37491.1|  FtsZ1 protein                                           544   0.0      
ref|XP_009334175.1|  PREDICTED: cell division protein FtsZ homolo...    544   0.0      
gb|KDP39208.1|  hypothetical protein JCGZ_00965                         543   0.0      
ref|XP_011097821.1|  PREDICTED: cell division protein FtsZ homolo...    542   0.0      
ref|XP_002531210.1|  Cell division protein ftsZ, putative               541   0.0      Ricinus communis
ref|XP_009343640.1|  PREDICTED: cell division protein FtsZ homolo...    540   0.0      
ref|XP_011047540.1|  PREDICTED: cell division protein FtsZ homolo...    538   0.0      
ref|XP_009361066.1|  PREDICTED: cell division protein FtsZ homolo...    538   0.0      
ref|XP_006452476.1|  hypothetical protein CICLE_v10008445mg             537   0.0      
ref|XP_002300342.2|  cell division family protein                       536   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008364389.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    537   0.0      
ref|XP_002866084.1|  ftsz1-1                                            535   0.0      
ref|XP_004294407.1|  PREDICTED: cell division protein FtsZ homolo...    534   0.0      
emb|CDY20776.1|  BnaA02g09160D                                          535   0.0      
ref|NP_200339.1|  cell division protein ftsZ-like protein 1             535   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK27127.1|  hypothetical protein AALP_AA8G338300                    534   0.0      
ref|XP_008366435.1|  PREDICTED: cell division protein FtsZ homolo...    534   0.0      
ref|XP_009334174.1|  PREDICTED: cell division protein FtsZ homolo...    533   0.0      
ref|XP_006401472.1|  hypothetical protein EUTSA_v10013612mg             533   0.0      
ref|XP_010270112.1|  PREDICTED: cell division protein FtsZ homolo...    535   0.0      
ref|XP_003551732.1|  PREDICTED: cell division protein FtsZ homolo...    532   0.0      
gb|ACG70179.1|  chloroplast FtsZ1-1                                     532   0.0      Brassica oleracea var. botrytis [cauliflower]
ref|XP_008449114.1|  PREDICTED: cell division protein FtsZ homolo...    531   0.0      
emb|CDY17316.1|  BnaA10g09500D                                          531   0.0      
gb|AAA82068.1|  cpFtsZ                                                  531   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY19897.1|  BnaC09g31630D                                          530   0.0      
ref|XP_009127013.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    530   0.0      
ref|XP_010063064.1|  PREDICTED: cell division protein FtsZ homolo...    530   0.0      
gb|KHN30883.1|  Cell division protein FtsZ like 1, chloroplastic        529   0.0      
ref|XP_009343639.1|  PREDICTED: cell division protein FtsZ homolo...    530   0.0      
ref|XP_007020676.1|  Bacterial cytokinesis Z-ring protein FTSZ 1-...    530   0.0      
ref|XP_006586107.1|  PREDICTED: cell division protein FtsZ homolo...    527   0.0      
ref|XP_004149587.1|  PREDICTED: cell division protein FtsZ homolo...    527   0.0      
ref|XP_010675824.1|  PREDICTED: cell division protein FtsZ homolo...    526   0.0      
ref|XP_009120048.1|  PREDICTED: cell division protein FtsZ homolo...    526   0.0      
ref|XP_006344879.1|  PREDICTED: cell division protein FtsZ homolo...    526   1e-180   
ref|XP_004166970.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    526   1e-180   
ref|XP_006280511.1|  hypothetical protein CARUB_v10026448mg             526   1e-180   
emb|CBI26709.3|  unnamed protein product                                523   2e-180   
gb|AAF81220.1|  FtsZ1                                                   522   2e-179   Tagetes erecta [big marigold]
gb|KHM99513.1|  Cell division protein FtsZ like 1, chloroplastic        522   4e-179   
ref|XP_010449352.1|  PREDICTED: cell division protein FtsZ homolo...    521   1e-178   
ref|XP_007146538.1|  hypothetical protein PHAVU_006G049100g             521   1e-178   
ref|XP_010443150.1|  PREDICTED: cell division protein FtsZ homolo...    521   2e-178   
ref|XP_010099992.1|  Cell division protein FtsZ-1-like protein          520   2e-178   
ref|XP_010482963.1|  PREDICTED: cell division protein FtsZ homolo...    520   3e-178   
ref|XP_009765135.1|  PREDICTED: cell division protein FtsZ homolo...    519   3e-178   
ref|XP_009625657.1|  PREDICTED: cell division protein FtsZ homolo...    519   4e-178   
ref|XP_004500118.1|  PREDICTED: cell division protein FtsZ homolo...    519   5e-178   
ref|XP_010536696.1|  PREDICTED: cell division protein FtsZ homolo...    519   7e-178   
gb|EPS68972.1|  plastid-dividing ring protein                           515   2e-177   
gb|EYU27393.1|  hypothetical protein MIMGU_mgv1a007772mg                514   1e-176   
gb|AAF23770.1|AF205858_1  FtsZ-like protein 2                           514   5e-176   Nicotiana tabacum [American tobacco]
emb|CAA75603.1|  FtsZ protein                                           514   5e-176   Pisum sativum [garden pea]
emb|CAB89286.1|  chloroplast FtsZ-like protein                          513   1e-175   Nicotiana tabacum [American tobacco]
ref|XP_007020677.1|  Bacterial cytokinesis Z-ring protein FTSZ 1-...    512   1e-175   
gb|AFK39538.1|  unknown                                                 512   3e-175   
ref|XP_003600215.1|  Cell division protein FtsZ                         511   7e-175   
ref|XP_004491442.1|  PREDICTED: cell division protein FtsZ homolo...    510   1e-174   
emb|CAI44667.1|  plastid division protein                               511   1e-174   Medicago truncatula
gb|KHN43855.1|  Cell division protein FtsZ like 1, chloroplastic        509   3e-174   
ref|XP_003519603.1|  PREDICTED: cell division protein FtsZ homolo...    508   7e-174   
ref|XP_003544739.1|  PREDICTED: cell division protein FtsZ homolo...    507   2e-173   
gb|KHN23882.1|  Cell division protein FtsZ like 1, chloroplastic        507   2e-173   
gb|EYU33680.1|  hypothetical protein MIMGU_mgv1a008311mg                505   3e-173   
ref|XP_010913967.1|  PREDICTED: cell division protein FtsZ homolo...    506   5e-173   
ref|XP_003617666.1|  FtsZ protein                                       505   1e-172   
dbj|BAG97403.1|  unnamed protein product                                500   6e-171   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011095476.1|  PREDICTED: cell division protein FtsZ homolo...    499   3e-170   
ref|XP_006839100.1|  hypothetical protein AMTR_s00090p00136440          498   5e-170   
ref|XP_009407904.1|  PREDICTED: cell division protein FtsZ homolo...    498   7e-170   
ref|XP_008798743.1|  PREDICTED: cell division protein FtsZ homolo...    498   7e-170   
ref|NP_001149695.1|  LOC100283321                                       496   3e-169   Zea mays [maize]
gb|ACF85277.1|  unknown                                                 496   4e-169   Zea mays [maize]
ref|NP_001054176.1|  Os04g0665400                                       496   5e-169   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960200.1|  PREDICTED: cell division protein FtsZ homolo...    496   5e-169   
ref|XP_002448714.1|  hypothetical protein SORBIDRAFT_06g031950          495   6e-169   Sorghum bicolor [broomcorn]
ref|XP_006652974.1|  PREDICTED: cell division protein FtsZ homolo...    495   8e-169   
ref|XP_010928878.1|  PREDICTED: cell division protein FtsZ homolo...    494   1e-168   
gb|AEV40936.1|  putative tubulin/FtsZ domain-containing protein         493   6e-168   
gb|KHG27532.1|  Cell division FtsZ, chloroplastic -like protein         490   6e-167   
ref|XP_004251908.1|  PREDICTED: cell division protein FtsZ homolo...    489   2e-166   
dbj|BAJ85582.1|  predicted protein                                      488   6e-166   
ref|XP_003580765.1|  PREDICTED: cell division protein FtsZ homolo...    485   9e-165   
ref|XP_008782917.1|  PREDICTED: cell division protein FtsZ homolo...    482   2e-163   
ref|XP_010313930.1|  PREDICTED: cell division protein FtsZ homolo...    482   2e-163   
gb|KHG00460.1|  Cell division FtsZ, chloroplastic -like protein         479   8e-163   
ref|XP_008668017.1|  PREDICTED: LOC100283321 isoform X1                 455   5e-154   
gb|EMT28400.1|  Cell division protein ftsZ-like protein, chloropl...    460   6e-154   
gb|ACN40898.1|  unknown                                                 455   2e-152   Picea sitchensis
gb|ABK24653.1|  unknown                                                 454   4e-152   Picea sitchensis
ref|XP_010249043.1|  PREDICTED: cell division protein FtsZ homolo...    440   5e-147   
ref|XP_011097822.1|  PREDICTED: cell division protein FtsZ homolo...    435   4e-146   
dbj|BAC57986.1|  ftsZ1                                                  437   2e-145   Marchantia polymorpha
ref|XP_002984848.1|  hypothetical protein SELMODRAFT_156840             424   1e-141   
ref|XP_002985903.1|  hypothetical protein SELMODRAFT_123081             423   2e-141   
gb|AEV40986.1|  putative tubulin/FtsZ domain-containing protein         402   1e-133   
ref|XP_005647947.1|  cell division protein FtsZ                         393   2e-129   
ref|XP_001769058.1|  ftsZ1-2 plastid division protein                   396   2e-129   
dbj|BAD12165.1|  plastid division protein FtsZ                          394   8e-129   Nannochloris bacillaris
ref|XP_001780238.1|  ftsZ1-1 plastid division protein                   393   2e-128   
gb|KFM23856.1|  Cell division protein FtsZ-like protein 1, chloro...    390   5e-128   
gb|EMS66227.1|  Cell division protein ftsZ-like protein 1, chloro...    385   2e-126   
emb|CDP13770.1|  unnamed protein product                                376   3e-124   
gb|KDD77168.1|  tubulin/FtsZ GTPase                                     384   7e-124   
ref|XP_002501749.1|  predicted protein                                  365   1e-118   Micromonas commoda
gb|EEC78198.1|  hypothetical protein OsI_17816                          366   2e-118   Oryza sativa Indica Group [Indian rice]
ref|XP_007515227.1|  cell division protein FtsZ                         363   2e-117   
ref|XP_001702420.1|  plastid division protein                           357   6e-114   Chlamydomonas reinhardtii
ref|XP_002955661.1|  plastid division protein FtsZ1                     356   2e-113   
dbj|BAB91150.1|  FtsZ                                                   355   2e-113   Chlamydomonas reinhardtii
ref|XP_003080788.1|  ftsZ1 (ISS)                                        351   1e-112   
emb|CEG01485.1|  Cell division protein FtsZ, C-terminal                 352   2e-112   
dbj|BAM11094.1|  chloroplast division protein                           343   1e-111   
ref|XP_001419359.1|  predicted protein                                  345   2e-111   Ostreococcus lucimarinus CCE9901
ref|XP_006846633.1|  hypothetical protein AMTR_s00156p00058400          336   3e-107   
gb|AEL23173.1|  cell division protein                                   333   2e-106   
gb|AEL23175.1|  cell division protein                                   333   2e-106   
gb|AEL23168.1|  cell division protein                                   332   3e-106   
gb|AEL23169.1|  cell division protein                                   332   4e-106   
gb|AFP55289.1|  FtsZ                                                    332   8e-106   
ref|WP_009785798.1|  cell division protein FtsZ                         333   2e-105   
ref|WP_008050554.1|  cell division protein FtsZ                         333   3e-105   
ref|WP_006625893.1|  cell division protein FtsZ                         333   3e-105   
ref|WP_006669768.1|  cell division protein FtsZ                         333   3e-105   
ref|WP_023065873.1|  cell division protein FtsZ                         333   3e-105   
gb|AEL23167.1|  cell division protein                                   330   5e-105   
gb|AFP55293.1|  FtsZ                                                    332   5e-105   
gb|AEL23170.1|  cell division protein                                   329   5e-105   
ref|WP_006620261.1|  cell division protein FtsZ                         332   5e-105   
ref|WP_014276905.1|  cell division protein FtsZ                         332   6e-105   
ref|WP_009633359.1|  cell division protein FtsZ                         330   2e-104   
ref|XP_003058549.1|  predicted protein                                  328   3e-104   
gb|AFP55292.1|  FtsZ                                                    330   7e-104   
ref|WP_015167500.1|  cell division protein FtsZ                         327   3e-103   
ref|WP_012630079.1|  cell division protein FtsZ                         328   5e-103   
ref|WP_035156917.1|  cell division protein FtsZ                         326   1e-102   
ref|WP_006106232.1|  cell division protein FtsZ                         323   3e-102   
ref|WP_015147980.1|  cell division protein FtsZ                         324   6e-102   
ref|WP_011244037.1|  cell division protein FtsZ                         323   7e-102   
ref|WP_015186821.1|  cell division protein FtsZ                         324   8e-102   
dbj|BAE20183.1|  FtsZ protein                                           323   1e-101   Microcystis aeruginosa
ref|WP_015201234.1|  cell division protein FtsZ                         323   2e-101   
gb|AIE75824.1|  Cell division protein FtsZ                              323   2e-101   
ref|WP_012161432.1|  cell division protein FtsZ                         321   2e-101   
ref|WP_002781797.1|  Cell division protein ftsZ                         322   2e-101   
ref|WP_015180997.1|  cell division protein FtsZ                         323   3e-101   
ref|WP_002801422.1|  cell division protein FtsZ                         322   3e-101   
ref|WP_015164337.1|  cell division protein FtsZ                         323   3e-101   
ref|WP_002742535.1|  cell division protein FtsZ                         322   4e-101   
ref|WP_008206746.1|  cell division protein FtsZ                         322   4e-101   
ref|WP_038027290.1|  cell division protein FtsZ                         320   4e-101   
ref|WP_039778672.1|  cell division protein FtsZ                         320   4e-101   
ref|WP_004161871.1|  cell division protein FtsZ                         322   5e-101   
ref|WP_037222028.1|  cell division protein FtsZ                         322   5e-101   
ref|WP_002778450.1|  cell division protein FtsZ                         322   5e-101   
ref|WP_002738456.1|  cell division protein FtsZ                         322   5e-101   
ref|WP_002765213.1|  cell division protein FtsZ                         322   6e-101   
ref|WP_015221984.1|  cell division protein FtsZ                         322   6e-101   
ref|WP_007355195.1|  MULTISPECIES: cell division protein FtsZ           322   7e-101   
ref|WP_026099047.1|  cell division protein FtsZ                         321   9e-101   
ref|WP_002789310.1|  cell division protein FtsZ                         321   1e-100   
ref|WP_006457598.1|  cell division protein FtsZ                         321   1e-100   
ref|WP_002756934.1|  cell division protein FtsZ                         321   1e-100   
dbj|GAL92496.1|  cell division protein FtsZ                             321   1e-100   
ref|WP_012265734.1|  cell division protein FtsZ                         321   1e-100   
ref|WP_017303420.1|  hypothetical protein                               319   1e-100   
ref|WP_039716790.1|  cell division protein FtsZ                         320   2e-100   
ref|WP_015225997.1|  cell division protein FtsZ                         320   2e-100   
ref|WP_019499271.1|  hypothetical protein                               320   2e-100   
ref|WP_015117120.1|  cell division protein FtsZ                         321   2e-100   
ref|WP_017712109.1|  cell division protein FtsZ                         318   3e-100   
ref|WP_015154609.1|  cell division protein FtsZ                         320   3e-100   
ref|WP_008186504.1|  cell division protein FtsZ                         320   4e-100   
ref|WP_010468588.1|  cell division protein FtsZ                         320   6e-100   
ref|WP_015142504.1|  cell division protein FtsZ                         319   6e-100   
ref|WP_035996963.1|  cell division protein FtsZ                         319   7e-100   
ref|WP_011613145.1|  cell division protein FtsZ                         319   8e-100   
ref|WP_015229558.1|  cell division protein FtsZ                         317   9e-100   
ref|WP_011433691.1|  cell division protein FtsZ                         317   1e-99    
ref|WP_015956956.1|  cell division protein FtsZ                         318   1e-99    
ref|WP_009557129.1|  cell division protein FtsZ                         318   1e-99    
ref|WP_013322397.1|  cell division protein FtsZ                         318   2e-99    
ref|WP_024125914.1|  cell division tubulin protein FtsZ                 317   2e-99    
ref|WP_006632966.1|  cell division protein FtsZ                         317   3e-99    
ref|WP_015785230.1|  MULTISPECIES: cell division protein FtsZ           317   3e-99    
ref|WP_027841036.1|  cell division protein FtsZ                         317   3e-99    
ref|WP_008274607.1|  cell division protein FtsZ                         317   3e-99    
ref|WP_008226369.1|  Cell division protein FtsZ                         317   4e-99    
ref|WP_015179039.1|  cell division protein FtsZ                         318   4e-99    
ref|WP_009544135.1|  MULTISPECIES: cell division protein FtsZ           317   6e-99    
gb|KEI67555.1|  FtsZ                                                    317   8e-99    
ref|WP_015219491.1|  cell division protein FtsZ                         316   1e-98    
ref|WP_015263178.1|  cell division protein FtsZ                         313   1e-98    
ref|WP_009628587.1|  cell division protein FtsZ                         316   1e-98    
ref|WP_011429031.1|  cell division protein FtsZ                         314   1e-98    
ref|WP_010872126.1|  cell division protein FtsZ                         316   1e-98    
ref|WP_026788004.1|  MULTISPECIES: cell division protein FtsZ           316   1e-98    
ref|WP_018212641.1|  cell division protein FtsZ                         313   1e-98    
ref|WP_017287543.1|  cell division protein FtsZ                         316   1e-98    
ref|WP_005811376.1|  cell division protein FtsZ                         313   1e-98    
ref|WP_008232986.1|  Cell division protein FtsZ                         316   2e-98    
dbj|BAP17020.1|  cell division protein                                  313   2e-98    
ref|WP_014795201.1|  MULTISPECIES: cell division protein FtsZ           311   7e-98    
ref|WP_011058214.1|  cell division protein FtsZ                         313   7e-98    
ref|WP_039725564.1|  cell division protein FtsZ                         312   7e-98    
ref|WP_017745628.1|  cell division protein FtsZ                         314   8e-98    
ref|WP_031291206.1|  cell division protein FtsZ                         313   1e-97    
ref|WP_035826132.1|  cell division protein FtsZ                         313   1e-97    
gb|ESA39048.1|  cell division protein                                   312   1e-97    
ref|WP_017296057.1|  hypothetical protein                               313   1e-97    
ref|WP_006278715.1|  cell division protein FtsZ                         313   1e-97    
ref|WP_013191011.1|  cell division protein FtsZ                         313   1e-97    
gb|EHJ13165.1|  cell division protein                                   311   2e-97    
gb|AHJ27769.1|  Cell division protein FtsZ                              311   2e-97    
ref|WP_009342894.1|  cell division protein FtsZ                         313   2e-97    
ref|WP_018753246.1|  cell division protein FtsZ                         311   2e-97    
ref|WP_011140302.1|  cell division protein FtsZ                         312   2e-97    
ref|WP_021834441.1|  Cell division protein FtsZ                         312   3e-97    
ref|WP_006516669.1|  cell division protein FtsZ                         312   3e-97    
ref|WP_015173791.1|  cell division protein FtsZ                         312   3e-97    
ref|WP_007305196.1|  cell division protein FtsZ                         312   3e-97    
ref|WP_015212387.1|  cell division protein FtsZ                         312   3e-97    
ref|WP_036646713.1|  cell division protein FtsZ                         310   4e-97    
ref|WP_015194198.1|  cell division protein FtsZ                         311   4e-97    
ref|WP_015209597.1|  cell division protein FtsZ                         312   5e-97    
ref|WP_015125672.1|  cell division protein FtsZ                         310   5e-97    
gb|KIE11505.1|  cell division protein FtsZ                              311   5e-97    
gb|AHV98374.1|  cell division protein FtsZ                              310   6e-97    
dbj|GAK39701.1|  cell division protein FtsZ                             310   6e-97    
ref|WP_038074722.1|  cell division protein FtsZ                         312   6e-97    
ref|WP_023171980.1|  cell division protein FtsZ                         311   6e-97    
ref|WP_006197392.1|  cell division protein FtsZ                         311   7e-97    
ref|WP_015139802.1|  cell division protein FtsZ                         311   8e-97    
ref|WP_025692149.1|  cell division protein FtsZ                         309   8e-97    
ref|WP_016949004.1|  cell division protein FtsZ                         311   8e-97    
gb|AIQ13897.1|  cell division protein FtsZ                              309   8e-97    
ref|WP_025699186.1|  cell division protein FtsZ                         309   9e-97    
ref|WP_039204701.1|  cell division protein FtsZ                         311   9e-97    
ref|WP_036598772.1|  cell division protein FtsZ                         309   9e-97    
gb|AAA85526.1|  FtsZ                                                    309   1e-96    Nostoc sp. PCC 7120
ref|WP_027404710.1|  cell division protein FtsZ                         311   1e-96    
ref|WP_015081472.1|  cell division protein FtsZ                         311   1e-96    
ref|WP_013917748.1|  cell division protein FtsZ                         309   1e-96    
ref|WP_019909324.1|  cell division protein FtsZ                         309   1e-96    
ref|WP_026101371.1|  cell division protein FtsZ                         311   1e-96    
ref|WP_007505648.1|  cell division protein FtsZ                         309   1e-96    
ref|WP_015115266.1|  cell division protein FtsZ                         312   1e-96    
gb|ACU24263.1|  unknown                                                 306   1e-96    Glycine max [soybeans]
ref|WP_034935803.1|  cell division protein FtsZ                         309   1e-96    
ref|WP_015157768.1|  cell division protein FtsZ                         310   1e-96    
ref|WP_012411109.1|  cell division protein FtsZ                         311   2e-96    
ref|WP_015255167.1|  cell division protein FtsZ                         308   2e-96    
ref|WP_026093497.1|  cell division protein FtsZ                         311   2e-96    
ref|WP_038697626.1|  cell division protein FtsZ                         308   2e-96    
gb|AHF07711.1|  cell division protein FtsZ                              308   2e-96    
ref|WP_008307838.1|  cell division protein FtsZ                         308   3e-96    
ref|WP_017656104.1|  cell division protein FtsZ                         310   3e-96    
ref|WP_010997999.1|  cell division protein FtsZ                         310   3e-96    
ref|WP_011318639.1|  cell division protein FtsZ                         310   3e-96    
ref|WP_038330945.1|  cell division protein FtsZ                         310   3e-96    
ref|WP_015127955.1|  cell division protein FtsZ                         310   3e-96    
ref|WP_027091068.1|  cell division protein FtsZ                         308   3e-96    
ref|WP_036683633.1|  cell division protein FtsZ                         308   3e-96    
ref|WP_028090307.1|  cell division protein FtsZ                         310   4e-96    
ref|WP_028082852.1|  cell division protein FtsZ                         310   4e-96    
ref|WP_026087296.1|  cell division protein FtsZ                         309   4e-96    
gb|AIQ48718.1|  cell division protein FtsZ                              307   4e-96    
ref|WP_029682012.1|  cell division protein FtsZ                         309   4e-96    
ref|WP_017299096.1|  cell division protein FtsZ                         308   4e-96    
gb|AIQ31689.1|  cell division protein FtsZ                              307   4e-96    
gb|ELR98955.1|  cell division protein FtsZ                              309   5e-96    
ref|WP_028549289.1|  cell division protein FtsZ                         308   5e-96    
ref|WP_014255359.1|  cell division protein FtsZ [                       307   5e-96    
ref|WP_039304277.1|  cell division protein FtsZ                         307   5e-96    
ref|WP_025707238.1|  cell division protein FtsZ                         307   6e-96    
ref|WP_039748803.1|  cell division protein FtsZ                         309   6e-96    
ref|WP_013311084.1|  MULTISPECIES: cell division protein FtsZ           307   6e-96    
ref|WP_011877059.1|  cell division protein FtsZ                         306   6e-96    
ref|WP_036657855.1|  cell division protein FtsZ                         307   6e-96    
ref|WP_012305666.1|  cell division protein FtsZ                         308   7e-96    
ref|WP_039837031.1|  cell division protein FtsZ                         307   7e-96    
ref|WP_027414502.1|  cell division protein FtsZ                         307   7e-96    
ref|WP_035989948.1|  cell division protein FtsZ                         307   7e-96    
ref|WP_023989443.1|  cell division protein FtsZ                         307   7e-96    
ref|WP_023438005.1|  cell division protein FtsZ                         307   7e-96    
ref|WP_025715634.1|  cell division protein FtsZ                         307   8e-96    
ref|WP_014282434.1|  cell division protein FtsZ                         307   8e-96    
ref|WP_030006808.1|  cell division protein FtsZ                         308   8e-96    
ref|WP_026674366.1|  cell division protein FtsZ                         307   8e-96    
ref|WP_025684642.1|  cell division protein FtsZ                         307   9e-96    
ref|WP_013822263.1|  cell division protein FtsZ                         306   9e-96    
ref|WP_029636425.1|  cell division protein FtsZ [                       308   9e-96    
ref|WP_006511475.1|  cell division protein FtsZ                         308   1e-95    
ref|WP_010345423.1|  cell division protein FtsZ                         306   1e-95    
ref|WP_008412322.1|  Cell division protein FtsZ                         305   1e-95    
gb|EES72495.1|  cell division protein FtsZ                              306   1e-95    
ref|WP_011099362.1|  cell division protein FtsZ                         306   1e-95    
ref|WP_010304168.1|  cell division protein FtsZ                         306   1e-95    
ref|WP_036645617.1|  cell division protein FtsZ                         306   1e-95    
ref|WP_019688024.1|  cell division protein FtsZ                         306   1e-95    
ref|WP_013372084.1|  MULTISPECIES: cell division protein FtsZ           306   1e-95    
gb|AIQ37250.1|  cell division protein FtsZ                              306   1e-95    
ref|WP_036621409.1|  cell division protein FtsZ                         306   1e-95    
ref|WP_036624324.1|  cell division protein FtsZ                         306   1e-95    
ref|WP_028537941.1|  cell division protein FtsZ                         306   2e-95    
ref|WP_015010309.1|  cell division protein FtsZ                         306   2e-95    
ref|WP_026733488.1|  cell division protein FtsZ                         308   2e-95    
ref|WP_027623331.1|  cell division protein FtsZ                         306   2e-95    
ref|WP_028307443.1|  cell division protein FtsZ                         305   2e-95    
ref|WP_007431185.1|  cell division protein FtsZ                         306   2e-95    
ref|WP_003517903.1|  cell division protein FtsZ                         306   2e-95    
ref|WP_036724269.1|  cell division protein FtsZ                         306   2e-95    
ref|WP_036690196.1|  cell division protein FtsZ                         306   2e-95    
gb|EOS57895.1|  cell division protein ftsZ                              306   2e-95    
ref|WP_025701508.1|  cell division protein FtsZ                         306   2e-95    
ref|WP_031413479.1|  cell division protein FtsZ                         306   2e-95    
ref|WP_011837832.1|  cell division protein FtsZ                         306   2e-95    
ref|WP_038595356.1|  cell division protein FtsZ                         305   2e-95    
ref|WP_018886787.1|  MULTISPECIES: cell division protein FtsZ           305   3e-95    
ref|WP_009456805.1|  MULTISPECIES: cell division protein FtsZ           307   3e-95    
ref|WP_017687306.1|  MULTISPECIES: cell division protein FtsZ           305   3e-95    
ref|WP_013075835.1|  cell division protein FtsZ                         305   3e-95    
ref|WP_014904587.1|  MULTISPECIES: cell division protein FtsZ           305   3e-95    
ref|WP_024628412.1|  MULTISPECIES: cell division protein FtsZ           305   3e-95    
gb|AIQ60212.1|  cell division protein FtsZ                              305   3e-95    
ref|WP_026085701.1|  cell division protein FtsZ                         307   3e-95    
ref|WP_011564468.1|  cell division protein FtsZ                         305   4e-95    
ref|WP_006286419.1|  GTPase                                             305   4e-95    
ref|WP_014828619.1|  cell division protein FtsZ                         304   4e-95    
ref|WP_013843289.1|  cell division protein FtsZ                         304   4e-95    
ref|WP_006209084.1|  MULTISPECIES: cell division protein FtsZ           305   4e-95    
ref|WP_018921335.1|  cell division protein FtsZ                         305   4e-95    
ref|WP_015132799.1|  cell division protein FtsZ                         306   5e-95    
ref|WP_006675639.1|  cell division protein FtsZ                         305   5e-95    
ref|WP_003540049.1|  MULTISPECIES: cell division protein FtsZ           304   5e-95    
ref|WP_026082307.1|  cell division protein FtsZ                         306   5e-95    
ref|WP_007129473.1|  MULTISPECIES: cell division protein FtsZ           305   6e-95    
ref|WP_018671853.1|  cell division protein FtsZ                         305   6e-95    
gb|AIQ54176.1|  cell division protein FtsZ                              305   6e-95    
ref|WP_025027694.1|  cell division protein FtsZ                         305   6e-95    
ref|WP_035146028.1|  cell division protein FtsZ                         305   7e-95    
ref|WP_028611218.1|  cell division protein FtsZ                         304   7e-95    
ref|WP_012283121.1|  cell division protein FtsZ                         304   7e-95    
ref|WP_017310208.1|  cell division protein FtsZ                         306   1e-94    
ref|WP_003336701.1|  cell division protein FtsZ                         304   1e-94    
ref|WP_016860511.1|  cell division protein FtsZ                         306   1e-94    
ref|WP_019533079.1|  cell division protein FtsZ                         304   1e-94    
ref|WP_015199344.1|  cell division protein FtsZ                         306   1e-94    
ref|WP_009589569.1|  MULTISPECIES: cell division protein FtsZ           304   1e-94    
ref|WP_026721750.1|  cell division protein FtsZ                         305   1e-94    
ref|WP_026799689.1|  cell division protein FtsZ                         304   1e-94    
ref|WP_036946165.1|  cell division protein FtsZ                         304   2e-94    
ref|WP_007786513.1|  cell division protein FtsZ                         303   2e-94    
ref|WP_027356094.1|  cell division protein FtsZ                         302   2e-94    
ref|WP_036832149.1|  cell division protein FtsZ                         303   2e-94    
dbj|BAD99307.1|  plastid division protein FtsZ                          306   2e-94    
ref|WP_011618675.1|  cell division protein FtsZ                         303   2e-94    
ref|WP_017811789.1|  cell division protein FtsZ                         303   2e-94    
ref|WP_006909620.1|  cell division protein FtsZ                         304   2e-94    
ref|WP_018085527.1|  cell division protein FtsZ                         302   2e-94    
ref|WP_036778481.1|  cell division protein FtsZ                         303   3e-94    
ref|WP_019005181.1|  cell division protein FtsZ                         303   3e-94    
ref|WP_010243136.1|  cell division protein FtsZ                         302   3e-94    
ref|WP_026485538.1|  cell division protein FtsZ                         302   4e-94    
ref|WP_036819968.1|  cell division protein FtsZ                         303   4e-94    
ref|WP_015845455.1|  cell division protein FtsZ                         302   4e-94    
ref|WP_027717340.1|  cell division protein FtsZ                         301   5e-94    
ref|WP_011392369.1|  cell division protein FtsZ                         301   5e-94    
ref|WP_018932762.1|  cell division protein FtsZ                         302   5e-94    
ref|WP_015756665.1|  cell division protein FtsZ                         301   5e-94    
ref|WP_007100416.1|  cell division protein FtsZ                         303   5e-94    
ref|WP_003333420.1|  cell division protein FtsZ                         302   5e-94    
gb|KEF38623.1|  cell division protein FtsZ                              302   6e-94    
ref|WP_017471805.1|  cell division protein FtsZ                         302   6e-94    
ref|WP_019226188.1|  cell division protein FtsZ                         301   6e-94    
ref|WP_027963109.1|  cell division protein FtsZ                         302   6e-94    
ref|WP_018975671.1|  cell division protein FtsZ                         302   7e-94    
ref|WP_009620973.1|  cell division protein FtsZ                         301   7e-94    
ref|WP_012344963.1|  cell division protein FtsZ                         301   7e-94    
ref|WP_012995467.1|  cell division protein FtsZ                         301   7e-94    
ref|WP_034145549.1|  cell division protein FtsZ                         301   7e-94    
ref|WP_026570445.1|  MULTISPECIES: cell division protein FtsZ           302   8e-94    
ref|WP_003386373.1|  cell division protein FtsZ                         301   8e-94    
ref|WP_003867934.1|  MULTISPECIES: cell division protein FtsZ           301   8e-94    
ref|WP_026675956.1|  cell division protein FtsZ                         302   8e-94    
ref|WP_035429136.1|  cell division protein FtsZ                         302   8e-94    
dbj|BAQ14204.1|  putative cell division protein FtsZ                    301   8e-94    
ref|WP_014521294.1|  cell division protein FtsZ                         301   8e-94    
ref|WP_004441551.1|  cell division protein FtsZ                         301   8e-94    
ref|WP_035307485.1|  cell division protein FtsZ                         301   8e-94    
ref|WP_014063046.1|  cell division protein FtsZ                         301   9e-94    
ref|WP_020059246.1|  cell division protein FtsZ                         301   1e-93    
ref|WP_009671787.1|  MULTISPECIES: cell division protein FtsZ           301   1e-93    
ref|WP_011887102.1|  cell division protein FtsZ                         301   1e-93    
ref|WP_003199787.1|  MULTISPECIES: cell division protein FtsZ           302   1e-93    
ref|WP_015359817.1|  MULTISPECIES: cell division protein FtsZ           301   1e-93    
ref|WP_006170207.1|  cell division protein FtsZ                         301   1e-93    
dbj|GAK04047.1|  cell division protein FtsZ                             301   1e-93    
dbj|GAK14519.1|  cell division protein FtsZ                             301   1e-93    
ref|WP_016116029.1|  cell division protein ftsZ                         301   1e-93    
ref|WP_017151182.1|  cell division protein FtsZ                         301   1e-93    
ref|WP_017186040.1|  cell division protein FtsZ                         301   1e-93    
ref|WP_035340445.1|  cell division protein FtsZ                         301   1e-93    
ref|WP_000888992.1|  cell division protein FtsZ                         301   1e-93    
ref|WP_020615575.1|  cell division protein FtsZ                         301   1e-93    
ref|WP_037289880.1|  cell division protein FtsZ                         301   1e-93    
ref|WP_026590251.1|  cell division protein FtsZ                         301   1e-93    
ref|WP_015045315.1|  MULTISPECIES: cell division protein FtsZ           300   1e-93    
ref|WP_012033008.1|  cell division protein FtsZ                         300   2e-93    
ref|WP_020491925.1|  cell division protein FtsZ                         300   2e-93    
ref|WP_019636227.1|  cell division protein FtsZ                         301   2e-93    
ref|WP_034614828.1|  cell division protein FtsZ                         300   2e-93    
ref|WP_008878677.1|  MULTISPECIES: cell division protein FtsZ           301   2e-93    
ref|WP_017727216.1|  cell division protein FtsZ                         301   2e-93    
ref|WP_003494426.1|  cell division protein FtsZ                         300   2e-93    
gb|EZP77955.1|  cell division protein FtsZ                              301   2e-93    
ref|WP_029626421.1|  cell division protein FtsZ                         301   2e-93    
ref|WP_030035749.1|  cell division protein FtsZ                         300   2e-93    
ref|WP_003484662.1|  cell division protein FtsZ                         300   2e-93    
ref|WP_027448202.1|  cell division protein FtsZ                         301   2e-93    
ref|WP_008589762.1|  cell division protein FtsZ                         301   2e-93    
ref|WP_026097750.1|  cell division protein FtsZ                         302   3e-93    
ref|WP_015043536.1|  cell division protein FtsZ                         299   3e-93    
ref|WP_012094996.1|  cell division protein FtsZ                         300   3e-93    
ref|WP_018132753.1|  cell division protein FtsZ                         300   3e-93    
ref|WP_033011308.1|  cell division protein FtsZ                         300   3e-93    
ref|WP_025747359.1|  cell division protein FtsZ                         300   3e-93    
ref|WP_028558081.1|  cell division protein FtsZ                         300   3e-93    
ref|WP_024094493.1|  cell division protein FtsZ                         300   3e-93    
ref|WP_028544979.1|  cell division protein FtsZ                         300   3e-93    
ref|WP_029270648.1|  cell division protein FtsZ                         300   4e-93    
ref|XP_002966083.1|  hypothetical protein SELMODRAFT_84291              300   4e-93    
ref|WP_036654768.1|  cell division protein FtsZ                         300   4e-93    
ref|WP_017434709.1|  cell division protein FtsZ                         300   4e-93    
ref|WP_038681737.1|  cell division protein FtsZ                         299   4e-93    
ref|WP_019420636.1|  cell division protein FtsZ                         300   5e-93    
ref|WP_022792698.1|  cell division protein FtsZ                         300   5e-93    
ref|WP_022628243.1|  cell division protein FtsZ                         300   5e-93    
ref|WP_027954116.1|  cell division protein FtsZ                         300   5e-93    
ref|WP_020959252.1|  cell division protein FtsZ                         300   5e-93    
ref|WP_004402383.1|  MULTISPECIES: cell division protein FtsZ           299   6e-93    
ref|WP_027638192.1|  cell division protein FtsZ                         299   6e-93    
ref|WP_015863363.1|  cell division protein FtsZ                         300   6e-93    
ref|WP_003395073.1|  cell division protein FtsZ                         299   6e-93    
ref|WP_021882365.1|  Cell division protein FtsZ                         299   6e-93    
ref|WP_011025862.1|  cell division protein FtsZ                         299   6e-93    
ref|WP_006570252.1|  cell division protein FtsZ                         299   7e-93    
ref|WP_003871212.1|  cell division protein FtsZ                         299   7e-93    
ref|WP_002165146.1|  cell division protein FtsZ                         300   7e-93    
ref|WP_010898709.1|  cell division protein FtsZ                         300   7e-93    
emb|CDN46091.1|  Cell division protein FtsZ                             299   7e-93    
ref|WP_012959479.1|  cell division protein FtsZ                         299   7e-93    
ref|WP_003463144.1|  cell division protein FtsZ                         299   7e-93    
ref|WP_000888978.1|  cell division protein FtsZ                         300   8e-93    
ref|WP_000888976.1|  cell division protein FtsZ                         300   8e-93    
ref|WP_006036353.1|  cell division protein FtsZ                         299   8e-93    
ref|WP_032077718.1|  cell division protein FtsZ                         299   8e-93    
ref|WP_025147788.1|  cell division protein FtsZ                         299   8e-93    
gb|AIS52701.1|  cell division protein FtsZ                              298   8e-93    
ref|WP_000888985.1|  cell division protein FtsZ                         299   8e-93    
ref|WP_000888977.1|  MULTISPECIES: cell division protein FtsZ           299   8e-93    
ref|WP_016106026.1|  cell division protein ftsZ                         299   9e-93    
ref|WP_000888989.1|  cell division protein FtsZ                         299   9e-93    
ref|WP_002160704.1|  cell division protein FtsZ                         299   9e-93    
ref|WP_015739527.1|  cell division protein FtsZ                         298   9e-93    
ref|WP_025968224.1|  cell division protein FtsZ                         299   9e-93    
ref|WP_036806879.1|  cell division protein FtsZ                         300   9e-93    
ref|WP_012063991.1|  cell division protein FtsZ                         298   9e-93    
ref|WP_000888982.1|  cell division protein FtsZ                         299   9e-93    
ref|WP_000888988.1|  cell division protein FtsZ                         299   9e-93    
ref|WP_000888984.1|  MULTISPECIES: cell division protein FtsZ           299   1e-92    
ref|WP_002066873.1|  cell division protein FtsZ                         299   1e-92    
ref|WP_027408218.1|  cell division protein FtsZ                         299   1e-92    
ref|WP_000888983.1|  cell division protein FtsZ                         299   1e-92    
ref|WP_000888979.1|  cell division protein FtsZ                         299   1e-92    
ref|WP_035505505.1|  MULTISPECIES: cell division protein FtsZ           299   1e-92    
ref|WP_036573236.1|  cell division protein FtsZ                         299   1e-92    
ref|WP_000888986.1|  MULTISPECIES: cell division protein FtsZ           299   1e-92    
ref|WP_025894894.1|  MULTISPECIES: cell division protein FtsZ           298   1e-92    
ref|WP_038559969.1|  cell division protein FtsZ                         299   1e-92    
ref|WP_007202462.1|  cell division protein FtsZ                         299   1e-92    
ref|WP_007098501.1|  cell division protein FtsZ                         299   1e-92    
ref|WP_000888987.1|  MULTISPECIES: cell division protein FtsZ           299   1e-92    
ref|WP_025964440.1|  cell division protein FtsZ                         298   1e-92    
ref|WP_016135259.1|  cell division protein ftsZ                         299   1e-92    
ref|WP_000888981.1|  cell division protein FtsZ                         299   1e-92    
ref|WP_013237895.1|  MULTISPECIES: cell division protein FtsZ           298   1e-92    
ref|WP_002121892.1|  cell division protein FtsZ                         299   1e-92    
ref|WP_002014730.1|  MULTISPECIES: cell division protein FtsZ           299   1e-92    
dbj|GAK07430.1|  cell division protein FtsZ                             299   1e-92    



>ref|NP_001233950.1| plastid-dividing ring protein [Solanum lycopersicum]
 gb|ADB57040.1| plastid-dividing ring protein [Solanum lycopersicum]
Length=419

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/404 (87%), Positives = 372/404 (92%), Gaps = 6/404 (1%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVR  1252
             MA+LG +NPAE++++  SS A       R  SSFIP+QC  +G   RRKS    +RFS+ 
Sbjct  1     MAILGLSNPAELASSPSSSLA----FSHRLHSSFIPKQCFFTGV--RRKSFCRPQRFSIS  54

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
              SF PMDSAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQ+L+QSAA+ P+QIGE
Sbjct  55    SSFTPMDSAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQALVQSAAENPLQIGE  114

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
             LLTRGLGTGGNPLLGEQAAEESKEAIAN+LKGSDMVFITAGMGGGTGSGAAPVVAQI+KE
Sbjct  115   LLTRGLGTGGNPLLGEQAAEESKEAIANSLKGSDMVFITAGMGGGTGSGAAPVVAQIAKE  174

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
             AGYLTVGVVTYPFSFEGRKRS+QALEAIEKLQ+NVDTLIVIPNDRLLDIADEQTPLQDAF
Sbjct  175   AGYLTVGVVTYPFSFEGRKRSVQALEAIEKLQRNVDTLIVIPNDRLLDIADEQTPLQDAF  234

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
             LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ
Sbjct  235   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  294

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN
Sbjct  295   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  354

Query  351   GEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAGSLV  220
             GEIHVTIIATGFTQSFQ+TLL+DPRGAK  +KGAG +EN  S V
Sbjct  355   GEIHVTIIATGFTQSFQKTLLSDPRGAKLIEKGAGIKENMASPV  398



>ref|NP_001275153.1| plastid-dividing ring protein [Solanum tuberosum]
 gb|AAT11924.1| plastid-dividing ring protein [Solanum tuberosum]
Length=419

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/404 (86%), Positives = 373/404 (92%), Gaps = 6/404 (1%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVR  1252
             MA+LG +NPAE++++  SS   L F   R  +SFIP+QC  +G   RRKS    +RFS+ 
Sbjct  1     MAILGLSNPAELASSPSSS---LTFSH-RLHTSFIPKQCFFTGV--RRKSFCRPQRFSIS  54

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
              SF PMDSAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQ+L+QSAA+ P+QIGE
Sbjct  55    SSFTPMDSAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQALVQSAAENPLQIGE  114

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
             LLTRGLGTGGNPLLGEQAAEESKEAIAN+LKGSDMVFITAGMGGGTGSGAAPVVAQI+KE
Sbjct  115   LLTRGLGTGGNPLLGEQAAEESKEAIANSLKGSDMVFITAGMGGGTGSGAAPVVAQIAKE  174

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
             AGYLTVGVVTYPFSFEGRKRS+QALEAIEKLQ+NVDTLIVIPNDRLLDIADEQTPLQDAF
Sbjct  175   AGYLTVGVVTYPFSFEGRKRSVQALEAIEKLQRNVDTLIVIPNDRLLDIADEQTPLQDAF  234

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
             LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSK+RAEEAAEQ
Sbjct  235   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKDRAEEAAEQ  294

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN
Sbjct  295   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  354

Query  351   GEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAGSLV  220
             GEIHVTIIATGFTQSFQ+TLL+DPRGAK  +KG+G +E+  S V
Sbjct  355   GEIHVTIIATGFTQSFQKTLLSDPRGAKLLEKGSGIKESMASPV  398



>ref|XP_009591422.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Nicotiana tomentosiformis]
 emb|CAB41987.1| FtsZ-like protein [Nicotiana tabacum]
Length=419

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/402 (87%), Positives = 372/402 (93%), Gaps = 7/402 (2%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVRCS  1246
             MLG +NPAE++A+SPSS++   +H     SSFIP+QC  +   +RRKSL   +RFS+  S
Sbjct  4     MLGLSNPAEIAASSPSSTSFAFYH-----SSFIPKQCCFT--KARRKSLCKPQRFSISSS  56

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
             F P DSAKIKV+GVGGGGNNAVNRMIGSGLQGVDFYAINTDAQ+LLQSAA+ P+QIGELL
Sbjct  57    FTPFDSAKIKVIGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQALLQSAAENPLQIGELL  116

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLGTGGNPLLGEQAAEESKEAIAN+LKGSDMVFITAGMGGGTGSGAAPVVAQI+KEAG
Sbjct  117   TRGLGTGGNPLLGEQAAEESKEAIANSLKGSDMVFITAGMGGGTGSGAAPVVAQIAKEAG  176

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
             YLTVGVVTYPFSFEGRKRS+QALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL
Sbjct  177   YLTVGVVTYPFSFEGRKRSVQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  236

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT
Sbjct  237   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  296

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
             LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE
Sbjct  297   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  356

Query  345   IHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAGSLV  220
             IHVTIIATGFTQSFQ+TLL+DPRGAK  DKG   QE+  S V
Sbjct  357   IHVTIIATGFTQSFQKTLLSDPRGAKLADKGPVIQESMASPV  398



>ref|XP_002276623.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Vitis vinifera]
Length=422

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/401 (86%), Positives = 365/401 (91%), Gaps = 4/401 (1%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVR  1252
             MA L   NP E  ++S SS ++ GF  K A SS  P +C+SS   + R SL+ +RRF V 
Sbjct  1     MATLQLTNPNEFISSSSSSIST-GFSHK-ALSSAAPGKCLSS--KNTRGSLWKRRRFGVC  56

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
             CSF PM+SAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTD+Q+LL SAA  P+QIGE
Sbjct  57    CSFAPMESAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDSQALLHSAASNPLQIGE  116

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
             LLTRGLGTGGNPLLGEQAAEESKEAIANALKGSD+VFITAGMGGGTGSGAAPVVAQISKE
Sbjct  117   LLTRGLGTGGNPLLGEQAAEESKEAIANALKGSDLVFITAGMGGGTGSGAAPVVAQISKE  176

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
             AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF
Sbjct  177   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  236

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
             LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ
Sbjct  237   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  296

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RYN
Sbjct  297   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYN  356

Query  351   GEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             GEIHVTIIATGF+QSFQ+ LLTDP+ AK  D+ AG QEN G
Sbjct  357   GEIHVTIIATGFSQSFQKILLTDPKAAKLVDRVAGGQENKG  397



>emb|CAB89287.1| chloroplast FtsZ-like protein [Nicotiana tabacum]
Length=413

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/402 (86%), Positives = 367/402 (91%), Gaps = 10/402 (2%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVRCS  1246
             M   +NPAE++A+SPS      F+     SSFIP+QC  +   +RRKSL   +RFS+  S
Sbjct  1     MATISNPAEIAASSPS----FAFYH----SSFIPKQCCFT--KARRKSLCKPQRFSISSS  50

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
             F P DSAKIKV+GVGGGGNNAVNRMIGSGLQGVDFYAINTDAQ+LLQSAA+ P+QIGELL
Sbjct  51    FTPFDSAKIKVIGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQALLQSAAENPLQIGELL  110

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLGTGGNPLLGEQAAEESKEAIAN+LKGSDMVFITAGMGGGTGSGAAPVVAQI+KEAG
Sbjct  111   TRGLGTGGNPLLGEQAAEESKEAIANSLKGSDMVFITAGMGGGTGSGAAPVVAQIAKEAG  170

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
             YLTVGVVTYPFSFEGRKRS+QALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL
Sbjct  171   YLTVGVVTYPFSFEGRKRSVQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  230

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT
Sbjct  231   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  290

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
             LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE
Sbjct  291   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  350

Query  345   IHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAGSLV  220
             IHVTIIATGFTQSFQ+TLL+DPRGAK  DKG   QE+  S V
Sbjct  351   IHVTIIATGFTQSFQKTLLSDPRGAKLADKGPVIQESMASPV  392



>ref|XP_009765068.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=413

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/402 (86%), Positives = 367/402 (91%), Gaps = 10/402 (2%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVRCS  1246
             M   +NPAE++A+SPS      F+     SSFIP+QC  +   +RRKSL   +RFS+  S
Sbjct  1     MATISNPAEIAASSPS----FAFYH----SSFIPKQCCFT--KARRKSLCKPQRFSISSS  50

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
             F P DSAKIKV+GVGGGGNNAVNRMIGSGLQGVDFYAINTDAQ+LLQSAA+ P+QIGELL
Sbjct  51    FTPFDSAKIKVIGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQALLQSAAENPLQIGELL  110

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLGTGGNPLLGEQAAEESKEAIAN+LKGSDMVFITAGMGGGTGSGAAPVVAQI+KEAG
Sbjct  111   TRGLGTGGNPLLGEQAAEESKEAIANSLKGSDMVFITAGMGGGTGSGAAPVVAQIAKEAG  170

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
             YLTVGVVTYPFSFEGRKRS+QALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL
Sbjct  171   YLTVGVVTYPFSFEGRKRSVQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  230

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT
Sbjct  231   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  290

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
             LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE
Sbjct  291   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  350

Query  345   IHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAGSLV  220
             IH+TIIATGFTQSFQ+TLL+DPRGAK  DKG   QE+  S V
Sbjct  351   IHLTIIATGFTQSFQKTLLSDPRGAKLADKGPVIQESMASPV  392



>ref|XP_007211741.1| hypothetical protein PRUPE_ppa006258mg [Prunus persica]
 gb|EMJ12940.1| hypothetical protein PRUPE_ppa006258mg [Prunus persica]
Length=420

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/400 (84%), Positives = 362/400 (91%), Gaps = 6/400 (2%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSV-RC  1249
             M  + NP E+ + + S+  +  FH  +A  SF  R CIS   +S+R+S   +R F V  C
Sbjct  1     MATWTNPNELISTTSSTIPT-AFHHHKAVPSF--RTCIS--LSSKRRSALKRRCFGVVSC  55

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             SF PM+SAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTDAQ+LLQSAA+ P+QIGEL
Sbjct  56    SFAPMESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDAQALLQSAAEYPLQIGEL  115

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLGTGGNPLLGEQAAEESKEAI+NALKGSD+VFITAGMGGGTGSGAAPVVAQISKEA
Sbjct  116   LTRGLGTGGNPLLGEQAAEESKEAISNALKGSDLVFITAGMGGGTGSGAAPVVAQISKEA  175

Query  888   GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  709
             GYLTVGVVTYPFSFEGRKRSLQA EAI+KLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL
Sbjct  176   GYLTVGVVTYPFSFEGRKRSLQAFEAIDKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  235

Query  708   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  529
             LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLGVGVSSSKNRAEEAAEQA
Sbjct  236   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGVGVSSSKNRAEEAAEQA  295

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNG  349
             TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP+ANIIFGAVVD+RYNG
Sbjct  296   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPAANIIFGAVVDDRYNG  355

Query  348   EIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             EIHVTIIATGF+QSFQ+TLLTDP+ AK  DK AG QE+ G
Sbjct  356   EIHVTIIATGFSQSFQKTLLTDPKAAKLLDKVAGGQESRG  395



>ref|XP_008227026.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Prunus mume]
Length=419

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/400 (84%), Positives = 360/400 (90%), Gaps = 7/400 (2%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSV-RC  1249
             M  + NP E+ + + S+  +  FH  +A  SF  R CI     SR++S   +R F V  C
Sbjct  1     MATWTNPNELISTTSSTIPT-AFHHHKAVPSF--RTCIP---LSRKRSALKRRCFGVVSC  54

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             SF PM+SAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTDAQ+LLQSAA+ P+QIGEL
Sbjct  55    SFAPMESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDAQALLQSAAEYPLQIGEL  114

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLGTGGNPLLGEQAAEESKEAI+NALKGSD+VFITAGMGGGTGSGAAPVVAQISKEA
Sbjct  115   LTRGLGTGGNPLLGEQAAEESKEAISNALKGSDLVFITAGMGGGTGSGAAPVVAQISKEA  174

Query  888   GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  709
             GYLTVGVVTYPFSFEGRKRSLQA EAI+KLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL
Sbjct  175   GYLTVGVVTYPFSFEGRKRSLQAFEAIDKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  234

Query  708   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  529
             LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLGVGVSSSKNRAEEAAEQA
Sbjct  235   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGVGVSSSKNRAEEAAEQA  294

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNG  349
             TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP+ANIIFGAVVD+RYNG
Sbjct  295   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPAANIIFGAVVDDRYNG  354

Query  348   EIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             EIHVTIIATGF+QSFQ+TLLTDP+ AK  DK AG QE+ G
Sbjct  355   EIHVTIIATGFSQSFQKTLLTDPKAAKLLDKVAGGQESRG  394



>ref|XP_008366436.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X2 [Malus domestica]
Length=424

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/400 (84%), Positives = 357/400 (89%), Gaps = 6/400 (2%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSV-RC  1249
             M  + NP E+   + SS  +   H K  PS    R CI    +S+R+S + + RF V  C
Sbjct  5     MAAWXNPNELIXTTSSSIPAAFHHHKPLPSL---RTCIP--LSSKRRSAWKRHRFGVVSC  59

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             SF PM+SAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTD+Q+LLQSAA+ P+QIGEL
Sbjct  60    SFAPMESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDSQALLQSAAEYPLQIGEL  119

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLGTGGNPLLGEQAAEESKEAI+NALKGSD+VFITAGMGGGTGSGAAPVVAQISKEA
Sbjct  120   LTRGLGTGGNPLLGEQAAEESKEAISNALKGSDLVFITAGMGGGTGSGAAPVVAQISKEA  179

Query  888   GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  709
             G LTVGVVTYPFSFEGRKRSLQA EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL
Sbjct  180   GCLTVGVVTYPFSFEGRKRSLQAFEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  239

Query  708   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  529
             LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA
Sbjct  240   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  299

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNG  349
             TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY G
Sbjct  300   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYTG  359

Query  348   EIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             EIHVTIIATGF+QSFQ+TLLTDP+ A+  DK AG QE+ G
Sbjct  360   EIHVTIIATGFSQSFQKTLLTDPKAARLLDKVAGGQESRG  399



>gb|AFC37491.1| FtsZ1 protein [Manihot esculenta]
Length=415

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/357 (92%), Positives = 341/357 (96%), Gaps = 3/357 (1%)
 Frame = -3

Query  1290  RKSLFHQRRF---SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDA  1120
             R S++ + R    SV CSF P++SAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTD+
Sbjct  34    RSSVWKRYRSGSGSVSCSFAPVESAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDS  93

Query  1119  QSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgg  940
             Q+LLQSAAQ P+QIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSD+VFITAGMGG
Sbjct  94    QALLQSAAQNPLQIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSDLVFITAGMGG  153

Query  939   gtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPND  760
             GTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPND
Sbjct  154   GTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPND  213

Query  759   RLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLG  580
             RLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLG
Sbjct  214   RLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLG  273

Query  579   VGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLAD  400
             VGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLAD
Sbjct  274   VGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLAD  333

Query  399   PSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             PSANIIFGAVVD+RYNGEIHVTIIATGF+QSFQ+TLLTDPR AK  DK +GSQE  G
Sbjct  334   PSANIIFGAVVDDRYNGEIHVTIIATGFSQSFQKTLLTDPRAAKLVDKMSGSQEGKG  390



>ref|XP_009334175.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=421

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/400 (84%), Positives = 358/400 (90%), Gaps = 5/400 (1%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSV-RC  1249
             M  + NP E+ + + SS  +  FH    P   + R CI     S+R+S + + RF V  C
Sbjct  1     MAAWTNPNELISTTSSSIPA-AFHHHNKPLPSL-RTCIP--LNSKRRSAWERHRFGVVSC  56

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             SF PM+SAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTD+Q+LLQSAA+ P+QIGEL
Sbjct  57    SFAPMESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDSQALLQSAAEYPLQIGEL  116

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLGTGGNPLLGEQAAEESKEAI+NALKGSD+VFITAGMGGGTGSGAAPVVAQISKEA
Sbjct  117   LTRGLGTGGNPLLGEQAAEESKEAISNALKGSDLVFITAGMGGGTGSGAAPVVAQISKEA  176

Query  888   GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  709
             GYLTVGVVTYPFSFEGRKRSLQA EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL
Sbjct  177   GYLTVGVVTYPFSFEGRKRSLQAFEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  236

Query  708   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  529
             LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA
Sbjct  237   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  296

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNG  349
             TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY G
Sbjct  297   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYTG  356

Query  348   EIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             EIHVTIIATGF++SFQ+TLLTDP+ A+  DK AG QE+ G
Sbjct  357   EIHVTIIATGFSESFQKTLLTDPKAARLLDKVAGGQESRG  396



>gb|KDP39208.1| hypothetical protein JCGZ_00965 [Jatropha curcas]
Length=415

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/357 (91%), Positives = 340/357 (95%), Gaps = 3/357 (1%)
 Frame = -3

Query  1290  RKSLFHQRRF---SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDA  1120
             R S++ + R    +V CSF PM+SAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDA
Sbjct  34    RGSMWKRHRCGSGNVSCSFAPMESAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDA  93

Query  1119  QSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgg  940
             Q+L+QSAAQ P+QIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSD+VFITAGMGG
Sbjct  94    QALVQSAAQNPLQIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSDLVFITAGMGG  153

Query  939   gtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPND  760
             GTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPND
Sbjct  154   GTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPND  213

Query  759   RLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLG  580
             RLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLG
Sbjct  214   RLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLG  273

Query  579   VGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLAD  400
             VGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLAD
Sbjct  274   VGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLAD  333

Query  399   PSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             PSANIIFGAVVD+RYNGEIHVTIIATGF+QSFQ+TLLTDP+ A   DK AG+QE  G
Sbjct  334   PSANIIFGAVVDDRYNGEIHVTIIATGFSQSFQKTLLTDPKAATLLDKMAGNQEGKG  390



>ref|XP_011097821.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
isoform X1 [Sesamum indicum]
Length=424

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/350 (93%), Positives = 335/350 (96%), Gaps = 0/350 (0%)
 Frame = -3

Query  1269  RRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQT  1090
              R  V+CSFIPMDSAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTDAQ+LLQSAA+ 
Sbjct  54    HRSGVQCSFIPMDSAKIKVVGVGGGGNNAVNRMIGSGLSGVDFYAINTDAQALLQSAAEN  113

Query  1089  PIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVV  910
             PIQIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSDMVFITAGMGGGTGSGAAPVV
Sbjct  114   PIQIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSDMVFITAGMGGGTGSGAAPVV  173

Query  909   AQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQT  730
             AQI+KE+GYLTVGVVTYPFSFEGRKRS+QALEAIEKLQKNVDTLIVIPNDRLLDIADEQT
Sbjct  174   AQIAKESGYLTVGVVTYPFSFEGRKRSMQALEAIEKLQKNVDTLIVIPNDRLLDIADEQT  233

Query  729   PLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRA  550
              LQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVS+SKNRA
Sbjct  234   ALQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSASKNRA  293

Query  549   EEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAV  370
             EEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAV
Sbjct  294   EEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAV  353

Query  369   VDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAGSLV  220
             VDERYNGEIHVTIIATGFTQSFQ+TLLTDPRGAK  DK  GS +   S V
Sbjct  354   VDERYNGEIHVTIIATGFTQSFQKTLLTDPRGAKLADKPTGSPDGMKSPV  403



>ref|XP_002531210.1| Cell division protein ftsZ, putative [Ricinus communis]
 gb|EEF31187.1| Cell division protein ftsZ, putative [Ricinus communis]
Length=412

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/363 (90%), Positives = 343/363 (94%), Gaps = 4/363 (1%)
 Frame = -3

Query  1302  YASRRKSLFHQRRFS----VRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYA  1135
             Y + R ++F + R S    + CSF P++SAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYA
Sbjct  26    YRTGRTNVFRRHRSSSPCAISCSFAPIESAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYA  85

Query  1134  INTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFIt  955
             INTD+Q+LLQSAAQ P+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKGSD+VFIT
Sbjct  86    INTDSQALLQSAAQNPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFIT  145

Query  954   agmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLI  775
             AGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLI
Sbjct  146   AGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLI  205

Query  774   VIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSG  595
             VIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSG
Sbjct  206   VIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSG  265

Query  594   TAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVV  415
             TAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVV
Sbjct  266   TAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVV  325

Query  414   TSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             TSLADPSANIIFGAVVD+RYNGEIHVTIIATGF+QSFQ+ LLTDP+ AK  DK  GSQE+
Sbjct  326   TSLADPSANIIFGAVVDDRYNGEIHVTIIATGFSQSFQKILLTDPKAAKLLDKMTGSQES  385

Query  234   AGS  226
              G+
Sbjct  386   KGA  388



>ref|XP_009343640.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=421

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/400 (83%), Positives = 357/400 (89%), Gaps = 5/400 (1%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSV-RC  1249
             M  + NP E+ + + SS  +  FH    P   + R CI     S+R+S + + RF V  C
Sbjct  1     MAAWTNPNELISTTSSSIPA-AFHHHNKPLPSL-RTCIP--LNSKRRSAWKRHRFGVVSC  56

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             SF PM+SAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTD+Q+LLQSAA+ P+QIGEL
Sbjct  57    SFAPMESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDSQALLQSAAEYPLQIGEL  116

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLGTGGNPLLGEQAAEESKEAI+NALKGSD+VFITAGMGGGTGSGAAPVVAQISKEA
Sbjct  117   LTRGLGTGGNPLLGEQAAEESKEAISNALKGSDLVFITAGMGGGTGSGAAPVVAQISKEA  176

Query  888   GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  709
             GYLTVGVVTYPFSFEGRKRSLQA EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL
Sbjct  177   GYLTVGVVTYPFSFEGRKRSLQAFEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  236

Query  708   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  529
             LADDVL QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA
Sbjct  237   LADDVLCQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  296

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNG  349
             TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY G
Sbjct  297   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYTG  356

Query  348   EIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             EIHVTIIATGF++SFQ+TLLTDP+ A+  DK AG QE+ G
Sbjct  357   EIHVTIIATGFSESFQKTLLTDPKAARLLDKVAGGQESRG  396



>ref|XP_011047540.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Populus euphratica]
Length=410

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/356 (90%), Positives = 340/356 (96%), Gaps = 0/356 (0%)
 Frame = -3

Query  1296  SRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQ  1117
             S+R+ L   +  SV CSF PM+SAKIKVVGVGGGGNNAVNRMIGS LQG+DFYAINTDAQ
Sbjct  30    SQRRRLSSSKHGSVSCSFAPMESAKIKVVGVGGGGNNAVNRMIGSDLQGIDFYAINTDAQ  89

Query  1116  SLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmggg  937
             +L+QSAAQ P+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKGSD+VFITAGMGGG
Sbjct  90    ALVQSAAQNPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFITAGMGGG  149

Query  936   tgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDR  757
             TGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDR
Sbjct  150   TGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDR  209

Query  756   LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV  577
             LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLG+
Sbjct  210   LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGI  269

Query  576   GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP  397
             GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP
Sbjct  270   GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP  329

Query  396   SANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             SANIIFGAVVD+RYNGEIHVTIIATGF+QSFQ++LLTDP+ AK  D+ AGSQE  G
Sbjct  330   SANIIFGAVVDDRYNGEIHVTIIATGFSQSFQKSLLTDPKAAKLVDRMAGSQEAKG  385



>ref|XP_009361066.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=420

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/402 (82%), Positives = 359/402 (89%), Gaps = 10/402 (2%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPS--SFIPRQCISSGYASRRKSLFHQRRFSV-  1255
             M  + +P ++ + + SS A+   H K  PS  ++IP        + +R S   + RF V 
Sbjct  1     MAAWTSPNDLISTTSSSIAAAFHHHKALPSLGTYIP-------LSGKRSSPRKRSRFGVV  53

Query  1254  RCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIg  1075
              CSF+P +SAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTDAQ+LLQSAA+ P+QIG
Sbjct  54    SCSFVPTESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDAQALLQSAAEYPLQIG  113

Query  1074  elltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISK  895
             ELLTRGLGTGGNPLLGEQAAEESKEAI+NALKGSD+VF+TAGMGGGTGSGAAP+VAQISK
Sbjct  114   ELLTRGLGTGGNPLLGEQAAEESKEAISNALKGSDLVFVTAGMGGGTGSGAAPIVAQISK  173

Query  894   EAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDA  715
             EAGYLTVGVVTYPFSFEGRKRSLQA EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDA
Sbjct  174   EAGYLTVGVVTYPFSFEGRKRSLQAFEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDA  233

Query  714   FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAE  535
             FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLGVGVSSSKNRAEEAAE
Sbjct  234   FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGVGVSSSKNRAEEAAE  293

Query  534   QATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERY  355
             QATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY
Sbjct  294   QATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRY  353

Query  354   NGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             NGE+HVTIIATGF+QSFQ+TLLTDP+ AK  DK AG QE+ G
Sbjct  354   NGELHVTIIATGFSQSFQKTLLTDPKAAKLLDKVAGGQESRG  395



>ref|XP_006452476.1| hypothetical protein CICLE_v10008445mg [Citrus clementina]
 ref|XP_006474983.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR65716.1| hypothetical protein CICLE_v10008445mg [Citrus clementina]
 gb|KDO62154.1| hypothetical protein CISIN_1g014946mg [Citrus sinensis]
Length=415

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/402 (82%), Positives = 360/402 (90%), Gaps = 12/402 (3%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQ-RRFSV  1255
             MA L   NP E+ ++S S + SL ++  R+    + R+ +       RKS + + R  ++
Sbjct  1     MATLQVTNPNELISSSTSFANSLHYNNSRS----LSRKTM-------RKSAWKRCRSGNI  49

Query  1254  RCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIg  1075
              CSF PM++AKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTD+Q+LLQSAA+ P+QIG
Sbjct  50    SCSFAPMETAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDSQALLQSAAENPLQIG  109

Query  1074  elltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISK  895
             +LLTRGLGTGGNPLLGEQAAEESKE IANALKGSD+VFITAGMGGGTGSGAAPVVAQI+K
Sbjct  110   DLLTRGLGTGGNPLLGEQAAEESKEVIANALKGSDLVFITAGMGGGTGSGAAPVVAQIAK  169

Query  894   EAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDA  715
             EAGYLTVGVVTYPFSFEGRKRS QALEAIE+LQKNVDTLIVIPNDRLLDI DEQT LQDA
Sbjct  170   EAGYLTVGVVTYPFSFEGRKRSSQALEAIERLQKNVDTLIVIPNDRLLDITDEQTALQDA  229

Query  714   FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAE  535
             FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAE
Sbjct  230   FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAE  289

Query  534   QATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERY  355
             QATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY
Sbjct  290   QATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRY  349

Query  354   NGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             NGEIHVTIIATGF+QSFQ+TLLT+P+ AK  DK AGSQE+ G
Sbjct  350   NGEIHVTIIATGFSQSFQKTLLTNPKAAKVLDKAAGSQESRG  391



>ref|XP_002300342.2| cell division family protein [Populus trichocarpa]
 gb|EEE85147.2| cell division family protein [Populus trichocarpa]
Length=410

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/356 (90%), Positives = 340/356 (96%), Gaps = 0/356 (0%)
 Frame = -3

Query  1296  SRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQ  1117
             S+++ L   +  SV CSF PM+SAKIKVVGVGGGGNNAVNRMIGS LQG+DFYAINTDAQ
Sbjct  30    SQKRRLSSSKHGSVSCSFAPMESAKIKVVGVGGGGNNAVNRMIGSDLQGIDFYAINTDAQ  89

Query  1116  SLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmggg  937
             +L+QSAAQ P+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKGSD+VFITAGMGGG
Sbjct  90    ALVQSAAQNPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFITAGMGGG  149

Query  936   tgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDR  757
             TGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDR
Sbjct  150   TGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDR  209

Query  756   LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV  577
             LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLG+
Sbjct  210   LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGI  269

Query  576   GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP  397
             GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP
Sbjct  270   GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP  329

Query  396   SANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             SANIIFGAVVD+RYNGEIHVTIIATGF+QSFQ++LLTDP+ AK  D+ +GSQE  G
Sbjct  330   SANIIFGAVVDDRYNGEIHVTIIATGFSQSFQKSLLTDPKAAKLVDRMSGSQEAKG  385



>ref|XP_008364389.1| PREDICTED: LOW QUALITY PROTEIN: cell division protein FtsZ homolog 
1, chloroplastic-like [Malus domestica]
 ref|XP_008355316.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Malus domestica]
Length=421

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/400 (83%), Positives = 356/400 (89%), Gaps = 6/400 (2%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSV-RC  1249
             M  + NP ++ + + SS A+   H K  PS      CI    + +R S   + RF V  C
Sbjct  2     MASWTNPNDLISTTSSSIAAAFHHHKALPSL---GTCIP--LSGKRSSPXKRYRFGVVSC  56

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             SF P +SAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTDAQ+LLQSAA+ P+QIGEL
Sbjct  57    SFAPTESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDAQALLQSAAEYPLQIGEL  116

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLGTGGNPLLGEQAAEESKEAI+NALKGSD+VF+TAGMGGGTGSGAAP+VAQISKEA
Sbjct  117   LTRGLGTGGNPLLGEQAAEESKEAISNALKGSDLVFVTAGMGGGTGSGAAPIVAQISKEA  176

Query  888   GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  709
             GYLTVGVVTYPFSFEGRKRSLQA EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL
Sbjct  177   GYLTVGVVTYPFSFEGRKRSLQAFEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  236

Query  708   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  529
             LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLGVGVSSSKNRAEEAAEQA
Sbjct  237   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGVGVSSSKNRAEEAAEQA  296

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNG  349
             TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RYNG
Sbjct  297   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYNG  356

Query  348   EIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             E+HVTIIATGF+QSFQ+TLLTDP+ AK  DK AG QE+ G
Sbjct  357   ELHVTIIATGFSQSFQKTLLTDPKAAKLLDKVAGGQESRG  396



>ref|XP_002866084.1| ftsz1-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42343.1| ftsz1-1 [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/361 (89%), Positives = 338/361 (94%), Gaps = 2/361 (1%)
 Frame = -3

Query  1305  GYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINT  1126
             G++ RR      +   +RCSF PM+SA+IKVVGVGGGGNNAVNRMI SGLQ VDFYAINT
Sbjct  48    GFSKRRSDSTRSKSMRLRCSFSPMESARIKVVGVGGGGNNAVNRMISSGLQSVDFYAINT  107

Query  1125  DAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagm  946
             D+Q+LLQS+A+ P+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKGSD+VFITAGM
Sbjct  108   DSQALLQSSAENPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFITAGM  167

Query  945   gggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  766
             GGGTGSGAAPVVAQISK+AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP
Sbjct  168   GGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  227

Query  765   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  586
             NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM
Sbjct  228   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  287

Query  585   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL  406
             LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL
Sbjct  288   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL  347

Query  405   ADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDK--GAGSQENA  232
             ADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLLTDPR AK  DK   +G QEN 
Sbjct  348   ADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLTDPRAAKLLDKMGSSGQQENK  407

Query  231   G  229
             G
Sbjct  408   G  408



>ref|XP_004294407.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=411

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/401 (82%), Positives = 349/401 (87%), Gaps = 11/401 (3%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVR  1252
             MA   +ANP ++ + S S      FH     +  IP            K+    +R  V 
Sbjct  1     MATTTWANPNDLISTSSSIPT--AFHHNTLRTCTIPLPT---------KTRTALKRHRVS  49

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
             CSF PM+SAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTDAQ+LLQSAA+ P+QIGE
Sbjct  50    CSFAPMESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDAQALLQSAAENPLQIGE  109

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
             LLTRGLGTGGNPLLGEQAAEESKEAIA ALKGSD+VFITAGMGGGTGSGAAPVVAQIS+E
Sbjct  110   LLTRGLGTGGNPLLGEQAAEESKEAIAGALKGSDLVFITAGMGGGTGSGAAPVVAQISRE  169

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
             AGYLTVGVVTYPFSFEGRKRS+QALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF
Sbjct  170   AGYLTVGVVTYPFSFEGRKRSVQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  229

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
             LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ
Sbjct  230   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  289

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY 
Sbjct  290   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYT  349

Query  351   GEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             GEIHVTIIATGF+QSFQ+TLLTDP+ A+  DK A  QE  G
Sbjct  350   GEIHVTIIATGFSQSFQKTLLTDPKAARLVDKVAAGQETRG  390



>emb|CDY20776.1| BnaA02g09160D [Brassica napus]
Length=425

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/371 (87%), Positives = 342/371 (92%), Gaps = 9/371 (2%)
 Frame = -3

Query  1314  ISSGYASRRKSLFHQRR-------FSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGL  1156
             + S +AS R S F +RR         +RCSF PM++AKIKVVGVGGGGNNAVNRMI SGL
Sbjct  30    LHSSFASTRISGFTKRRSDSKSKSLRLRCSFSPMETAKIKVVGVGGGGNNAVNRMISSGL  89

Query  1155  QGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKG  976
             Q VDFYAINTD+Q+LLQS+AQTP+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKG
Sbjct  90    QSVDFYAINTDSQALLQSSAQTPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKG  149

Query  975   SDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ  796
             SD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ
Sbjct  150   SDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ  209

Query  795   KNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVK  616
             KNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVK
Sbjct  210   KNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVK  269

Query  615   AVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEV  436
             AVMKDSGTAMLGVGVS  KNRA+EAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEV
Sbjct  270   AVMKDSGTAMLGVGVSCGKNRAQEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEV  329

Query  435   NRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDK  256
             NRVSQVVTSLADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLL+DPR AK  DK
Sbjct  330   NRVSQVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLSDPRAAKLVDK  389

Query  255   --GAGSQENAG  229
                +G QEN G
Sbjct  390   MGSSGQQENEG  400



>ref|NP_200339.1| cell division protein ftsZ-like protein 1 [Arabidopsis thaliana]
 sp|Q42545.2|FTSZ1_ARATH RecName: Full=Cell division protein FtsZ homolog 1, chloroplastic; 
Short=AtFtsZ1; Short=AtFtsZ1-1; Short=Chloroplast FtsZ; 
Short=CpFtsZ; AltName: Full=Protein ACCUMULATION AND REPLICATION 
OF CHLOROPLASTS 10; AltName: Full=Protein PLASTID MOVEMENT 
IMPAIRED4; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08597.1| cell division protein FtsZ chloroplast homolog precursor [Arabidopsis 
thaliana]
 gb|AAK59497.1| putative cell division protein FtsZ chloroplast homolog precursor 
[Arabidopsis thaliana]
 gb|AAM44944.1| putative cell division protein FtsZ chloroplast homolog precursor 
[Arabidopsis thaliana]
 gb|AED96609.1| cell division protein ftsZ-like protein 1 [Arabidopsis thaliana]
Length=433

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/361 (88%), Positives = 338/361 (94%), Gaps = 2/361 (1%)
 Frame = -3

Query  1305  GYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINT  1126
             G++ RR      +   +RCSF PM+SA+IKV+GVGGGGNNAVNRMI SGLQ VDFYAINT
Sbjct  48    GFSKRRSDSTRSKSMRLRCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINT  107

Query  1125  DAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagm  946
             D+Q+LLQS+A+ P+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKGSD+VFITAGM
Sbjct  108   DSQALLQSSAENPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFITAGM  167

Query  945   gggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  766
             GGGTGSGAAPVVAQISK+AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP
Sbjct  168   GGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  227

Query  765   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  586
             NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM
Sbjct  228   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  287

Query  585   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL  406
             LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL
Sbjct  288   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL  347

Query  405   ADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDK--GAGSQENA  232
             ADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLLTDPR AK  DK   +G QEN 
Sbjct  348   ADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLTDPRAAKLLDKMGSSGQQENK  407

Query  231   G  229
             G
Sbjct  408   G  408



>gb|KFK27127.1| hypothetical protein AALP_AA8G338300 [Arabis alpina]
Length=425

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/369 (88%), Positives = 339/369 (92%), Gaps = 6/369 (2%)
 Frame = -3

Query  1317  CISSGYASRRKSLFHQRR----FSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQG  1150
             C SS    +    F +RR      +RCSF PM+SA+IKV+GVGGGGNNAVNRMI SGLQ 
Sbjct  33    CASSTRLCKLGLGFSKRRSDSGMRLRCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQS  92

Query  1149  VDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSD  970
             VDFYAINTD+Q+LLQS+A+ P+QIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSD
Sbjct  93    VDFYAINTDSQALLQSSAENPLQIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSD  152

Query  969   MVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKN  790
             +VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKN
Sbjct  153   LVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKN  212

Query  789   VDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAV  610
             VDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAV
Sbjct  213   VDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAV  272

Query  609   MKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNR  430
             MKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNR
Sbjct  273   MKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNR  332

Query  429   VSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDK--  256
             VSQVVTSLADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLLTDPR AK  DK  
Sbjct  333   VSQVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLTDPRAAKLLDKMG  392

Query  255   GAGSQENAG  229
               G QEN G
Sbjct  393   STGQQENKG  401



>ref|XP_008366435.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X1 [Malus domestica]
Length=440

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/416 (81%), Positives = 357/416 (86%), Gaps = 22/416 (5%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSV-RC  1249
             M  + NP E+   + SS  +   H K  PS    R CI    +S+R+S + + RF V  C
Sbjct  5     MAAWXNPNELIXTTSSSIPAAFHHHKPLPSL---RTCIP--LSSKRRSAWKRHRFGVVSC  59

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             SF PM+SAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTD+Q+LLQSAA+ P+QIGEL
Sbjct  60    SFAPMESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDSQALLQSAAEYPLQIGEL  119

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLGTGGNPLLGEQAAEESKEAI+NALKGSD+VFITAGMGGGTGSGAAPVVAQISKEA
Sbjct  120   LTRGLGTGGNPLLGEQAAEESKEAISNALKGSDLVFITAGMGGGTGSGAAPVVAQISKEA  179

Query  888   GYLTVGVVTYPFSFEGRKRSLQ----------------ALEAIEKLQKNVDTLIVIPNDR  757
             G LTVGVVTYPFSFEGRKRSLQ                A EAIEKLQKNVDTLIVIPNDR
Sbjct  180   GCLTVGVVTYPFSFEGRKRSLQSVDWGVIXHAFIGFFQAFEAIEKLQKNVDTLIVIPNDR  239

Query  756   LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV  577
             LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV
Sbjct  240   LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV  299

Query  576   GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP  397
             GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP
Sbjct  300   GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP  359

Query  396   SANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             SANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLLTDP+ A+  DK AG QE+ G
Sbjct  360   SANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLTDPKAARLLDKVAGGQESRG  415



>ref|XP_009334174.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=437

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/416 (80%), Positives = 359/416 (86%), Gaps = 21/416 (5%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSV-RC  1249
             M  + NP E+ + + SS  +  FH    P   + R CI     S+R+S + + RF V  C
Sbjct  1     MAAWTNPNELISTTSSSIPA-AFHHHNKPLPSL-RTCIP--LNSKRRSAWERHRFGVVSC  56

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             SF PM+SAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTD+Q+LLQSAA+ P+QIGEL
Sbjct  57    SFAPMESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDSQALLQSAAEYPLQIGEL  116

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLGTGGNPLLGEQAAEESKEAI+NALKGSD+VFITAGMGGGTGSGAAPVVAQISKEA
Sbjct  117   LTRGLGTGGNPLLGEQAAEESKEAISNALKGSDLVFITAGMGGGTGSGAAPVVAQISKEA  176

Query  888   GYLTVGVVTYPFSFEGRKRSLQAL----------------EAIEKLQKNVDTLIVIPNDR  757
             GYLTVGVVTYPFSFEGRKRSLQ+L                EAIEKLQKNVDTLIVIPNDR
Sbjct  177   GYLTVGVVTYPFSFEGRKRSLQSLDWGVILHAFIGFFQAFEAIEKLQKNVDTLIVIPNDR  236

Query  756   LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV  577
             LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV
Sbjct  237   LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV  296

Query  576   GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP  397
             GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP
Sbjct  297   GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP  356

Query  396   SANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             SANIIFGAVVD+RY GEIHVTIIATGF++SFQ+TLLTDP+ A+  DK AG QE+ G
Sbjct  357   SANIIFGAVVDDRYTGEIHVTIIATGFSESFQKTLLTDPKAARLLDKVAGGQESRG  412



>ref|XP_006401472.1| hypothetical protein EUTSA_v10013612mg [Eutrema salsugineum]
 gb|ESQ42925.1| hypothetical protein EUTSA_v10013612mg [Eutrema salsugineum]
Length=430

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/361 (89%), Positives = 339/361 (94%), Gaps = 2/361 (1%)
 Frame = -3

Query  1305  GYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINT  1126
             G  S+R+S    +   +RCSF PM+SA+IKVVGVGGGGNNAVNRMI SGLQ VDFYAINT
Sbjct  46    GGFSKRRSDSRSKPMRLRCSFSPMESARIKVVGVGGGGNNAVNRMISSGLQSVDFYAINT  105

Query  1125  DAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagm  946
             D+Q+LLQS+A+ P+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKGSD+VFITAGM
Sbjct  106   DSQALLQSSAENPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFITAGM  165

Query  945   gggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  766
             GGGTGSGAAPVVAQISK+AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP
Sbjct  166   GGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  225

Query  765   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  586
             NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM
Sbjct  226   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  285

Query  585   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL  406
             LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL
Sbjct  286   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL  345

Query  405   ADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDK--GAGSQENA  232
             ADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLLTDPR AK  DK   +G QEN 
Sbjct  346   ADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLTDPRAAKLLDKMGSSGQQENK  405

Query  231   G  229
             G
Sbjct  406   G  406



>ref|XP_010270112.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Nelumbo nucifera]
Length=503

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/408 (82%), Positives = 361/408 (88%), Gaps = 18/408 (4%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSS-----FIPRQCISSGYASRRKSLFHQR  1267
             MA L   +P +++++S  S   +GF QK+  ++     F PR        +RR+  +   
Sbjct  83    MATLHLTSPTQLASSSSIS---VGFLQKKLFNNGFHIGFSPR--------ARRRRSWSPS  131

Query  1266  RFSVRCS--FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQ  1093
              F V CS  F  MDSAKIKVVGVGGGGNNAVNRMIGSGLQGV+FYAINTDAQ+LLQSAA+
Sbjct  132   DFGVCCSSAFSSMDSAKIKVVGVGGGGNNAVNRMIGSGLQGVEFYAINTDAQALLQSAAK  191

Query  1092  TPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPV  913
              P+QIGELLTRGLGTGGNPLLGEQAAEESKE IA+ALKGSD+VFITAGMGGGTGSGAAPV
Sbjct  192   NPLQIGELLTRGLGTGGNPLLGEQAAEESKETIASALKGSDLVFITAGMGGGTGSGAAPV  251

Query  912   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ  733
             VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ+NVDTLIVIPNDRLLDIADEQ
Sbjct  252   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQRNVDTLIVIPNDRLLDIADEQ  311

Query  732   TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNR  553
             TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNR
Sbjct  312   TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNR  371

Query  552   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  373
             AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA
Sbjct  372   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  431

Query  372   VVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             VVD+RYNGEIHVTIIATGF+QSFQ+TLLTDP+ AK  +K A SQE+ G
Sbjct  432   VVDDRYNGEIHVTIIATGFSQSFQKTLLTDPKAAKLVEKAASSQESKG  479



>ref|XP_003551732.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Glycine max]
Length=417

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/402 (82%), Positives = 351/402 (87%), Gaps = 15/402 (4%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRR-FS-  1258
             MAML   NP  +             +     SSF+ R C+S    SRR +   QRR F+ 
Sbjct  1     MAMLPLTNPTPIR------------YNALPSSSFVQRNCVSLNPRSRRCAFEPQRRRFAS  48

Query  1257  -VRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
                CSF  +DSAKIKVVGVGGGGNNAVNRMIG GL GV+FYAINTDAQ+LL SAA+ PI+
Sbjct  49    VTCCSFSTVDSAKIKVVGVGGGGNNAVNRMIGCGLHGVEFYAINTDAQALLHSAAENPIK  108

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IGELLTRGLGTGGNPLLGEQAAEESKEAIANAL+GSD+VF+TAGMGGGTGSGAAPVVA+I
Sbjct  109   IGELLTRGLGTGGNPLLGEQAAEESKEAIANALQGSDLVFVTAGMGGGTGSGAAPVVARI  168

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLD+ADEQTPLQ
Sbjct  169   AKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDMADEQTPLQ  228

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             DAF LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA
Sbjct  229   DAFRLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  288

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             AEQATLAPLIGSSIQSATGVVYNITGG+DITLQEVNRVSQVVTSLADPSANIIFGAVVD+
Sbjct  289   AEQATLAPLIGSSIQSATGVVYNITGGRDITLQEVNRVSQVVTSLADPSANIIFGAVVDD  348

Query  360   RYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             RYNGEIHVTIIATGF+QSFQ+TLLTDPR AK  D+  G QE+
Sbjct  349   RYNGEIHVTIIATGFSQSFQKTLLTDPRAAKLLDRELGGQES  390



>gb|ACG70179.1| chloroplast FtsZ1-1 [Brassica oleracea var. botrytis]
 emb|CDY06595.1| BnaC02g13190D [Brassica napus]
Length=425

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/371 (87%), Positives = 340/371 (92%), Gaps = 9/371 (2%)
 Frame = -3

Query  1314  ISSGYASRRKSLFHQRR-------FSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGL  1156
             + S +AS R S F +RR         +RCSF PM++AKIKVVGVGGGGNNAVNRMI SGL
Sbjct  30    LHSSFASTRISGFPKRRSDSKSKSLRLRCSFSPMETAKIKVVGVGGGGNNAVNRMISSGL  89

Query  1155  QGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKG  976
             Q VDFYAINTD+Q+LLQS+AQTP+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKG
Sbjct  90    QSVDFYAINTDSQALLQSSAQTPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKG  149

Query  975   SDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ  796
             SD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRS QALEAIEKLQ
Sbjct  150   SDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSFQALEAIEKLQ  209

Query  795   KNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVK  616
             KNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVK
Sbjct  210   KNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVK  269

Query  615   AVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEV  436
             AVMKDSGTAMLGVGVS  KNRA+EAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEV
Sbjct  270   AVMKDSGTAMLGVGVSCGKNRAQEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEV  329

Query  435   NRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDK  256
             NRVSQVVTSLADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLLTDPR AK  DK
Sbjct  330   NRVSQVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLTDPRAAKLVDK  389

Query  255   --GAGSQENAG  229
                 G QEN G
Sbjct  390   MGSTGQQENKG  400



>ref|XP_008449114.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Cucumis melo]
Length=425

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/382 (87%), Positives = 349/382 (91%), Gaps = 11/382 (3%)
 Frame = -3

Query  1359  FHQKRA--PSSFIPRQCISSGYASRRKSLFHQRRFS---VRCSFIPMDSAKIKvvgvggg  1195
             FH K +  PS+F P  C SS   ++RK  F  RR     V CSF PM+SAKIKVVGVGGG
Sbjct  21    FHHKTSFFPSNF-PWTCSSSN--AKRK--FPSRRHHLAVVGCSFSPMESAKIKVVGVGGG  75

Query  1194  gnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAA  1015
             GNNAVNRMIGSGL+GVDFYAINTD+Q+LLQSAA+ P+QIGELLTRGLGTGGNPLLGEQAA
Sbjct  76    GNNAVNRMIGSGLKGVDFYAINTDSQALLQSAAENPLQIGELLTRGLGTGGNPLLGEQAA  135

Query  1014  EESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRK  835
             EESKEAIA ALKGSD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVT+PFSFEGRK
Sbjct  136   EESKEAIAGALKGSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTFPFSFEGRK  195

Query  834   RSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIIT  655
             RSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIIT
Sbjct  196   RSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIIT  255

Query  654   IPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVY  475
             IPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVY
Sbjct  256   IPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVY  315

Query  474   NITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRT  295
             NITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY+GEIHVTIIATGF+QSFQ+T
Sbjct  316   NITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYSGEIHVTIIATGFSQSFQKT  375

Query  294   LLTDPRGAKAGDK-GAGSQENA  232
             LL DPR +K  DK   G QE +
Sbjct  376   LLADPRASKLIDKVSGGGQEKS  397



>emb|CDY17316.1| BnaA10g09500D [Brassica napus]
Length=411

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/366 (88%), Positives = 341/366 (93%), Gaps = 8/366 (2%)
 Frame = -3

Query  1314  ISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYA  1135
             IS G++ +R      ++  +RCSF PM+SA+IKVVGVGGGGNNAVNRMI SGLQ VDFYA
Sbjct  30    ISGGFSKQRS-----KQTRLRCSFSPMESARIKVVGVGGGGNNAVNRMISSGLQSVDFYA  84

Query  1134  INTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFIt  955
             INTD+Q+LLQS+AQ P+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKGSD+VFIT
Sbjct  85    INTDSQALLQSSAQNPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFIT  144

Query  954   agmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLI  775
             AGMGGGTGSGAAPVVAQISK+AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLI
Sbjct  145   AGMGGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLI  204

Query  774   VIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSG  595
             VIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSG
Sbjct  205   VIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSG  264

Query  594   TAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVV  415
             TAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVV
Sbjct  265   TAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVV  324

Query  414   TSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGS---  244
             TSLADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLL+DPR AK  DK   S   
Sbjct  325   TSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLSDPRAAKLLDKTGSSGQQ  384

Query  243   QENAGS  226
             QEN GS
Sbjct  385   QENKGS  390



>gb|AAA82068.1| cpFtsZ [Arabidopsis thaliana]
Length=433

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/361 (88%), Positives = 337/361 (93%), Gaps = 2/361 (1%)
 Frame = -3

Query  1305  GYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINT  1126
             G++ RR      +   +RCSF PM+SA+IKV+GVGGGGNNAVNRMI SGLQ VDFYAINT
Sbjct  48    GFSKRRSDSTRSKSMRLRCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINT  107

Query  1125  DAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagm  946
             D+Q+LLQ +A+ P+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKGSD+VFITAGM
Sbjct  108   DSQALLQFSAENPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFITAGM  167

Query  945   gggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  766
             GGGTGSGAAPVVAQISK+AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP
Sbjct  168   GGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  227

Query  765   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  586
             NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM
Sbjct  228   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  287

Query  585   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL  406
             LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL
Sbjct  288   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL  347

Query  405   ADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDK--GAGSQENA  232
             ADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLLTDPR AK  DK   +G QEN 
Sbjct  348   ADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLTDPRAAKLLDKMGSSGQQENK  407

Query  231   G  229
             G
Sbjct  408   G  408



>emb|CDY19897.1| BnaC09g31630D [Brassica napus]
Length=411

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/384 (85%), Positives = 347/384 (90%), Gaps = 8/384 (2%)
 Frame = -3

Query  1359  FHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFS---VRCSFIPMDSAKIKvvgvggggn  1189
              ++ R  SSF+      S ++SR    F +RR     +RCSF PM+SA+IKVVGVGGGGN
Sbjct  9     LNELRVSSSFVATS--HSLHSSRINGGFSKRRSKPTRLRCSFSPMESARIKVVGVGGGGN  66

Query  1188  navNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEE  1009
             NAVNRMI SGLQ VDFYAINTD+Q+LLQS+AQ P+QIGELLTRGLGTGGNPLLGEQAAEE
Sbjct  67    NAVNRMISSGLQSVDFYAINTDSQALLQSSAQNPLQIGELLTRGLGTGGNPLLGEQAAEE  126

Query  1008  SKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRS  829
             SK+AIANALKGSD+VFITAGMGGGTGSGAAPVVAQISK+AGYLTVGVVTYPFSFEGRKRS
Sbjct  127   SKDAIANALKGSDLVFITAGMGGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRS  186

Query  828   LQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIP  649
             LQALEAIEKLQ NVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIP
Sbjct  187   LQALEAIEKLQMNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIP  246

Query  648   GLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNI  469
             GLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNI
Sbjct  247   GLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNI  306

Query  468   TGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLL  289
             TGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLL
Sbjct  307   TGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLL  366

Query  288   TDPRGAKAGDKGAGS---QENAGS  226
             +DPR AK  DK   S   QEN GS
Sbjct  367   SDPRAAKLLDKTGSSGQQQENKGS  390



>ref|XP_009127013.1| PREDICTED: LOW QUALITY PROTEIN: cell division protein FtsZ homolog 
1, chloroplastic-like [Brassica rapa]
Length=427

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/371 (87%), Positives = 340/371 (92%), Gaps = 9/371 (2%)
 Frame = -3

Query  1314  ISSGYASRRKSLFHQRR-------FSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGL  1156
             + S + S R S F +RR         +RCSF PM++AKIKVVGVGGGGNNAVNRMI SGL
Sbjct  32    LHSSFTSTRISGFTKRRSDSKSKSLRLRCSFSPMETAKIKVVGVGGGGNNAVNRMISSGL  91

Query  1155  QGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKG  976
             Q VDFYAINTD+Q+LLQS+AQTP+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKG
Sbjct  92    QSVDFYAINTDSQALLQSSAQTPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKG  151

Query  975   SDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ  796
             SD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ
Sbjct  152   SDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ  211

Query  795   KNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVK  616
             KNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVK
Sbjct  212   KNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVK  271

Query  615   AVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEV  436
             AVMKDSGTAMLGVGVS  KNRA+EAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEV
Sbjct  272   AVMKDSGTAMLGVGVSCGKNRAQEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEV  331

Query  435   NRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDK  256
             NRVSQVVT LADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLL+DPR AK  DK
Sbjct  332   NRVSQVVTRLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLSDPRAAKLVDK  391

Query  255   --GAGSQENAG  229
                +G QEN G
Sbjct  392   MGSSGQQENKG  402



>ref|XP_010063064.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW70253.1| hypothetical protein EUGRSUZ_F03510 [Eucalyptus grandis]
Length=421

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/360 (89%), Positives = 338/360 (94%), Gaps = 6/360 (2%)
 Frame = -3

Query  1293  RRKSLFHQRRFS-----VRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAIN  1129
             +R S + + R +       CSF+PM+SAKIKVVGVGGGGNNAVNRMIGSGLQ VDFYAIN
Sbjct  38    KRGSPWRRNRATSSGGGASCSFVPMESAKIKVVGVGGGGNNAVNRMIGSGLQSVDFYAIN  97

Query  1128  TDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItag  949
             TD+Q+LLQSAA+ P+QIGELLTRGLGTGGNP LGEQAAEESKEAIANALKGSD+VFITAG
Sbjct  98    TDSQALLQSAAEYPLQIGELLTRGLGTGGNPTLGEQAAEESKEAIANALKGSDLVFITAG  157

Query  948   mgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVI  769
             MGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVI
Sbjct  158   MGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVI  217

Query  768   PNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTA  589
             PNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTA
Sbjct  218   PNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTA  277

Query  588   MLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTS  409
             MLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATG+VYNITGGKDITLQEVNRVSQVVTS
Sbjct  278   MLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGIVYNITGGKDITLQEVNRVSQVVTS  337

Query  408   LADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             LADPSANIIFGAVVD+RYNGEIHVTIIATGF+QSFQ+TLLTDP+ +K  DK A + EN G
Sbjct  338   LADPSANIIFGAVVDDRYNGEIHVTIIATGFSQSFQKTLLTDPKASKLIDKVA-APENKG  396



>gb|KHN30883.1| Cell division protein FtsZ like 1, chloroplastic [Glycine soja]
Length=419

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/404 (81%), Positives = 351/404 (87%), Gaps = 17/404 (4%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRR-FS-  1258
             MAML   NP  +             H     SSF+ R C+S    SRR +   QRR F+ 
Sbjct  1     MAMLPLTNPTPIR------------HNALPSSSFVQRNCVSLNPRSRRCAFEPQRRRFAS  48

Query  1257  -VRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
                CSF  +DSAKIKVVGVGGGGNNAVNRMIG GL GV+FYAINTDAQ+LL SAA+ PI+
Sbjct  49    VTCCSFSTVDSAKIKVVGVGGGGNNAVNRMIGCGLHGVEFYAINTDAQALLHSAAENPIK  108

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IGELLTRGLGTGGNPLLGEQAAEESKEAIANAL+GSD+VF+TAGMGGGTGSGAAPVVA+I
Sbjct  109   IGELLTRGLGTGGNPLLGEQAAEESKEAIANALQGSDLVFVTAGMGGGTGSGAAPVVARI  168

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQA--LEAIEKLQKNVDTLIVIPNDRLLDIADEQTP  727
             +KEAGYLTVGVVTYPFSFEGRKRSLQA  LEAIEKLQKNVDTLIVIPNDRLLD+ADEQTP
Sbjct  169   AKEAGYLTVGVVTYPFSFEGRKRSLQAGALEAIEKLQKNVDTLIVIPNDRLLDMADEQTP  228

Query  726   LQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAE  547
             LQDAF LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAE
Sbjct  229   LQDAFRLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAE  288

Query  546   EAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVV  367
             EAAEQATLAPLIGSSIQSATGVVYNITGG+DITLQEVNRVSQVVTSLADPSANIIFGAVV
Sbjct  289   EAAEQATLAPLIGSSIQSATGVVYNITGGRDITLQEVNRVSQVVTSLADPSANIIFGAVV  348

Query  366   DERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             D+RYNGEIHVTIIATGF+QSFQ+TLLTDPR AK  D+  G QE+
Sbjct  349   DDRYNGEIHVTIIATGFSQSFQKTLLTDPRAAKLLDRELGGQES  392



>ref|XP_009343639.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=437

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/416 (80%), Positives = 358/416 (86%), Gaps = 21/416 (5%)
 Frame = -3

Query  1425  MLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSV-RC  1249
             M  + NP E+ + + SS  +  FH    P   + R CI     S+R+S + + RF V  C
Sbjct  1     MAAWTNPNELISTTSSSIPA-AFHHHNKPLPSL-RTCIP--LNSKRRSAWKRHRFGVVSC  56

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             SF PM+SAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTD+Q+LLQSAA+ P+QIGEL
Sbjct  57    SFAPMESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDSQALLQSAAEYPLQIGEL  116

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLGTGGNPLLGEQAAEESKEAI+NALKGSD+VFITAGMGGGTGSGAAPVVAQISKEA
Sbjct  117   LTRGLGTGGNPLLGEQAAEESKEAISNALKGSDLVFITAGMGGGTGSGAAPVVAQISKEA  176

Query  888   GYLTVGVVTYPFSFEGRKRSLQAL----------------EAIEKLQKNVDTLIVIPNDR  757
             GYLTVGVVTYPFSFEGRKRSLQ+L                EAIEKLQKNVDTLIVIPNDR
Sbjct  177   GYLTVGVVTYPFSFEGRKRSLQSLDWGVILHAFIGFFQAFEAIEKLQKNVDTLIVIPNDR  236

Query  756   LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV  577
             LLDIADEQTPLQDAFLLADDVL QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV
Sbjct  237   LLDIADEQTPLQDAFLLADDVLCQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV  296

Query  576   GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP  397
             GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP
Sbjct  297   GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP  356

Query  396   SANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             SANIIFGAVVD+RY GEIHVTIIATGF++SFQ+TLLTDP+ A+  DK AG QE+ G
Sbjct  357   SANIIFGAVVDDRYTGEIHVTIIATGFSESFQKTLLTDPKAARLLDKVAGGQESRG  412



>ref|XP_007020676.1| Bacterial cytokinesis Z-ring protein FTSZ 1-1 isoform 1 [Theobroma 
cacao]
 gb|EOY12201.1| Bacterial cytokinesis Z-ring protein FTSZ 1-1 isoform 1 [Theobroma 
cacao]
Length=470

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/365 (87%), Positives = 340/365 (93%), Gaps = 0/365 (0%)
 Frame = -3

Query  1323  RQCISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVD  1144
             R   SS    +R  L   R   + CSF PM++AKIKVVGVGGGGNNAVNRMIGSGLQGVD
Sbjct  82    RPSFSSKKPLKRGCLRRHRFGGISCSFAPMETAKIKVVGVGGGGNNAVNRMIGSGLQGVD  141

Query  1143  FYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMV  964
             FYAINTD+Q+LLQSAA+ P+QIGELLTRGLGTGGNPLLGEQAAEES++AI+NALKGSD+V
Sbjct  142   FYAINTDSQALLQSAAENPLQIGELLTRGLGTGGNPLLGEQAAEESRDAISNALKGSDLV  201

Query  963   FItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVD  784
             FITAGMGGGTGSGAAPVVAQI+KEAGYLTVGVVTYPFSFEGRKR++QAL+AIEKLQKNVD
Sbjct  202   FITAGMGGGTGSGAAPVVAQIAKEAGYLTVGVVTYPFSFEGRKRTMQALDAIEKLQKNVD  261

Query  783   TLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK  604
             TLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK
Sbjct  262   TLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK  321

Query  603   DSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVS  424
             DSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVS
Sbjct  322   DSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVS  381

Query  423   QVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGS  244
             QVVTSLADP+ANIIFGAVVD+RYNGEIHVTIIATGF+QSFQ+TLLTDP+ AK  DK A  
Sbjct  382   QVVTSLADPTANIIFGAVVDDRYNGEIHVTIIATGFSQSFQKTLLTDPKAAKQIDKLAAG  441

Query  243   QENAG  229
             QE+ G
Sbjct  442   QESKG  446



>ref|XP_006586107.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Glycine max]
Length=417

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/402 (81%), Positives = 350/402 (87%), Gaps = 15/402 (4%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRR-KSLFHQRRFS-  1258
             MAML   NP  +             H   + SSF+ R+C+S     R   S   +RRF+ 
Sbjct  1     MAMLPLTNPTPIR------------HNALSSSSFVQRKCVSLIPRIRTCDSEPQRRRFAS  48

Query  1257  -VRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
                CSF  +DSAKIKVVGVGGGGNNAVNRMIG GL GV+FYAINTDAQ+LL S+A+ PI+
Sbjct  49    VTCCSFSTLDSAKIKVVGVGGGGNNAVNRMIGCGLHGVEFYAINTDAQALLHSSAENPIK  108

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IGELLTRGLGTGGNPLLGEQAAEESKEAIANAL+GSD+VF+TAGMGGGTGSGAAPVVA+I
Sbjct  109   IGELLTRGLGTGGNPLLGEQAAEESKEAIANALQGSDLVFVTAGMGGGTGSGAAPVVARI  168

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLD+ADEQTPLQ
Sbjct  169   AKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDMADEQTPLQ  228

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             DAF LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA
Sbjct  229   DAFRLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  288

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+
Sbjct  289   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDD  348

Query  360   RYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             RYNGEIHVTIIATGF+QSFQ+ LLTDPR AK  D+  G QE+
Sbjct  349   RYNGEIHVTIIATGFSQSFQKILLTDPRAAKLLDREPGGQES  390



>ref|XP_004149587.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN56071.1| hypothetical protein Csa_3G064200 [Cucumis sativus]
Length=421

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/380 (86%), Positives = 343/380 (90%), Gaps = 10/380 (3%)
 Frame = -3

Query  1359  FHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFS---VRCSFIPMDSAKIKvvgvggggn  1189
             FH K   + F P    S   A R+   F  RR     V CSF PM+SAKIKVVGVGGGGN
Sbjct  21    FHHK---TPFFPSNFPSPSIAKRK---FPSRRHHLAVVGCSFSPMESAKIKVVGVGGGGN  74

Query  1188  navNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEE  1009
             NAVNRMIGSGL+GVDFYAINTD+Q+LLQSAA+ P+QIGELLTRGLGTGGNPLLGEQAAEE
Sbjct  75    NAVNRMIGSGLKGVDFYAINTDSQALLQSAAENPLQIGELLTRGLGTGGNPLLGEQAAEE  134

Query  1008  SKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRS  829
             SKEAIA ALKGSD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVT+PFSFEGRKRS
Sbjct  135   SKEAIAGALKGSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTFPFSFEGRKRS  194

Query  828   LQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIP  649
             LQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIP
Sbjct  195   LQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIP  254

Query  648   GLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNI  469
             GLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNI
Sbjct  255   GLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNI  314

Query  468   TGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLL  289
             TGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY+GEIHVTIIATGF+QSFQ+TLL
Sbjct  315   TGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYSGEIHVTIIATGFSQSFQKTLL  374

Query  288   TDPRGAKAGDK-GAGSQENA  232
              DPR +K  DK   G QE +
Sbjct  375   ADPRASKLIDKVSGGGQEKS  394



>ref|XP_010675824.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=421

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/404 (81%), Positives = 353/404 (87%), Gaps = 6/404 (1%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVR  1252
             MA  G  N  E+  + P S+    FH K++  +F P+       + RR++  +   FS  
Sbjct  1     MATFGLTNANELVYSPPISTP---FHSKKS-FNFFPKTLNFPKTSRRRRNGKNYAAFSTY  56

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
             CSF PM++AKIKVVGVGGGGNNAVNRMIGSGLQGVDFY INTDAQ+LLQSAA+ PIQIGE
Sbjct  57    CSFSPMETAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYTINTDAQALLQSAAEHPIQIGE  116

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
             LLTRGLGTGGNP LGEQAA ESKEAIA AL GSD+VFITAGMGGGTGSGAAPV+AQISK+
Sbjct  117   LLTRGLGTGGNPSLGEQAAHESKEAIATALAGSDLVFITAGMGGGTGSGAAPVIAQISKD  176

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
             AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ NVDTLIVIPNDRLLDIADEQTPLQDAF
Sbjct  177   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQNNVDTLIVIPNDRLLDIADEQTPLQDAF  236

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
              LADDVLRQGVQGISDIITIPGLVNVDFADVKA+MKDSGTAMLGVGVSSSKNRAEEAAEQ
Sbjct  237   QLADDVLRQGVQGISDIITIPGLVNVDFADVKAIMKDSGTAMLGVGVSSSKNRAEEAAEQ  296

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RYN
Sbjct  297   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYN  356

Query  351   GEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAGSLV  220
             GE+HVTIIATGF+QSFQ+ LLTDP+ A+  DK   +QEN GS V
Sbjct  357   GELHVTIIATGFSQSFQKVLLTDPKAARLLDK--VTQENKGSTV  398



>ref|XP_009120048.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Brassica rapa]
Length=411

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/366 (87%), Positives = 339/366 (93%), Gaps = 8/366 (2%)
 Frame = -3

Query  1314  ISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYA  1135
             I+ G++ +R      +   +RCSF PM+SA+IKVVGVGGGGNNAVNRMI SGLQ VDFYA
Sbjct  30    INGGFSKQRP-----KPTRLRCSFSPMESARIKVVGVGGGGNNAVNRMISSGLQSVDFYA  84

Query  1134  INTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFIt  955
             INTD+Q+LLQS+A  P+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKGSD+VFIT
Sbjct  85    INTDSQALLQSSAHNPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFIT  144

Query  954   agmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLI  775
             AGMGGGTGSGAAPVVAQISK+AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLI
Sbjct  145   AGMGGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLI  204

Query  774   VIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSG  595
             VIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSG
Sbjct  205   VIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSG  264

Query  594   TAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVV  415
             TAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVV
Sbjct  265   TAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVV  324

Query  414   TSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGS---  244
             TSLADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLL+DPR AK  DK   S   
Sbjct  325   TSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLSDPRAAKLLDKTGSSGQQ  384

Query  243   QENAGS  226
             QEN GS
Sbjct  385   QENKGS  390



>ref|XP_006344879.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Solanum tuberosum]
Length=419

 Score =   526 bits (1355),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 327/399 (82%), Positives = 356/399 (89%), Gaps = 6/399 (2%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVR  1252
             MA+LG +N  ++ ++S +S   L F+ K  PSSF+P Q       +RRK L+ ++ FS+ 
Sbjct  1     MAVLGLSNRGDILSSSSNS---LEFYHK-IPSSFVPTQWFPP--RTRRKILYKRQHFSIS  54

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
              S  P +SAKIKV+GVGGGGNNAVNRMIGSGLQGVDFYAINTD Q+L QS A+ PIQIGE
Sbjct  55    SSLSPKNSAKIKVIGVGGGGNNAVNRMIGSGLQGVDFYAINTDTQALSQSTAENPIQIGE  114

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
             LLTRGLGTGGNPLLGEQAAEESKE IANALKGSDMVFITAGMGGGTGSGAAPVVAQI+KE
Sbjct  115   LLTRGLGTGGNPLLGEQAAEESKEGIANALKGSDMVFITAGMGGGTGSGAAPVVAQIAKE  174

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
             AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVI NDRLLDIADEQTPLQ+AF
Sbjct  175   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIHNDRLLDIADEQTPLQNAF  234

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
             LLADDVL QGVQGISDIITIPGLVNVDFADVKA+MK+SGTAMLGVG SSS+NRAEEAAEQ
Sbjct  235   LLADDVLCQGVQGISDIITIPGLVNVDFADVKAIMKNSGTAMLGVGASSSRNRAEEAAEQ  294

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             ATLAPLIGSSIQSATG+VYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDER+N
Sbjct  295   ATLAPLIGSSIQSATGIVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERFN  354

Query  351   GEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             GEIHVTIIATGFT+SFQ TLLT+PRGAK  D   G+ E+
Sbjct  355   GEIHVTIIATGFTESFQNTLLTNPRGAKLVDNSKGTTES  393



>ref|XP_004166970.1| PREDICTED: LOW QUALITY PROTEIN: cell division protein FtsZ homolog 
1, chloroplastic-like [Cucumis sativus]
Length=421

 Score =   526 bits (1355),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 326/380 (86%), Positives = 342/380 (90%), Gaps = 10/380 (3%)
 Frame = -3

Query  1359  FHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFS---VRCSFIPMDSAKIKvvgvggggn  1189
             FH K   + F P    S   A R+   F  RR     V CSF PM+SAKIKVVGVGGGGN
Sbjct  21    FHHK---TPFFPSNFPSPSIAKRK---FPSRRHHLAVVGCSFSPMESAKIKVVGVGGGGN  74

Query  1188  navNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEE  1009
             NAVNRMIGSGL+GVDFYAINTD+Q+LLQSAA+ P+QIGELLTRGLGTGGNPLLGEQAAEE
Sbjct  75    NAVNRMIGSGLKGVDFYAINTDSQALLQSAAENPLQIGELLTRGLGTGGNPLLGEQAAEE  134

Query  1008  SKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRS  829
             SKEAIA ALKGSD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVT+PFSFEGRKRS
Sbjct  135   SKEAIAGALKGSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTFPFSFEGRKRS  194

Query  828   LQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIP  649
             LQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIP
Sbjct  195   LQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIP  254

Query  648   GLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNI  469
             GLVNVDFADVKAVMKDSGTAMLGVGVSSSKNR EEAAEQATLAPLIGSSIQSATGVVYNI
Sbjct  255   GLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRTEEAAEQATLAPLIGSSIQSATGVVYNI  314

Query  468   TGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLL  289
             TGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY+GEIHVTIIATGF+QSFQ+TLL
Sbjct  315   TGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYSGEIHVTIIATGFSQSFQKTLL  374

Query  288   TDPRGAKAGDK-GAGSQENA  232
              DPR +K  DK   G QE +
Sbjct  375   ADPRASKLIDKVSGGGQEKS  394



>ref|XP_006280511.1| hypothetical protein CARUB_v10026448mg [Capsella rubella]
 gb|EOA13409.1| hypothetical protein CARUB_v10026448mg [Capsella rubella]
Length=430

 Score =   526 bits (1355),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 317/372 (85%), Positives = 338/372 (91%), Gaps = 9/372 (2%)
 Frame = -3

Query  1317  CISS-------GYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSG  1159
             C+S+       G + RR      +    RCSF PM+SA+IKV+GVGGGGNNAVNRMI SG
Sbjct  36    CVSTRITKFGGGVSKRRSDSARSKSMGWRCSFSPMESARIKVIGVGGGGNNAVNRMISSG  95

Query  1158  LQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALK  979
             LQ VDFYAINTD+Q+LLQS+A+ P+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALK
Sbjct  96    LQSVDFYAINTDSQALLQSSAENPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALK  155

Query  978   GSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKL  799
             GSD+VFITAGMGGGTGSGAAPVVAQISK+AGYLTVGVVTYPFSFEGRKRSLQALEAIEKL
Sbjct  156   GSDLVFITAGMGGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKL  215

Query  798   QKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADV  619
             QKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADV
Sbjct  216   QKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADV  275

Query  618   KAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQE  439
             KAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKD+TL E
Sbjct  276   KAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDLTLLE  335

Query  438   VNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGD  259
             VNRVS+VVTSLADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLL DPR AK  D
Sbjct  336   VNRVSEVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLADPRAAKLLD  395

Query  258   K--GAGSQENAG  229
             K   +G QEN G
Sbjct  396   KMGSSGQQENKG  407



>emb|CBI26709.3| unnamed protein product [Vitis vinifera]
Length=361

 Score =   523 bits (1347),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 316/336 (94%), Positives = 326/336 (97%), Gaps = 0/336 (0%)
 Frame = -3

Query  1236  MDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrg  1057
             M+SAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTD+Q+LL SAA  P+QIGELLTRG
Sbjct  1     MESAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDSQALLHSAASNPLQIGELLTRG  60

Query  1056  lgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLT  877
             LGTGGNPLLGEQAAEESKEAIANALKGSD+VFITAGMGGGTGSGAAPVVAQISKEAGYLT
Sbjct  61    LGTGGNPLLGEQAAEESKEAIANALKGSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLT  120

Query  876   VGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADD  697
             VGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADD
Sbjct  121   VGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADD  180

Query  696   VLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAP  517
             VLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAP
Sbjct  181   VLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAP  240

Query  516   LIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHV  337
             LIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RYNGEIHV
Sbjct  241   LIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYNGEIHV  300

Query  336   TIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             TIIATGF+QSFQ+ LLTDP+ AK  D+ AG QEN G
Sbjct  301   TIIATGFSQSFQKILLTDPKAAKLVDRVAGGQENKG  336



>gb|AAF81220.1| FtsZ1 [Tagetes erecta]
Length=410

 Score =   522 bits (1345),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 313/340 (92%), Positives = 325/340 (96%), Gaps = 0/340 (0%)
 Frame = -3

Query  1275  HQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAA  1096
               RR +V CSF  +DSAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTD+Q+LLQS A
Sbjct  42    RHRRSAVCCSFASLDSAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDSQALLQSVA  101

Query  1095  QTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAP  916
               PIQIGELLTRGLGTGGNPLLGEQAAEESKEAI NALKGSD+VFITAGMGGGTGSGAAP
Sbjct  102   HNPIQIGELLTRGLGTGGNPLLGEQAAEESKEAIGNALKGSDLVFITAGMGGGTGSGAAP  161

Query  915   VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADE  736
             VVAQI+KEAGYLTVGVVTYPFSFEGRKRS+QALEAIEKLQKNVDTLIVIPNDRLLDIADE
Sbjct  162   VVAQIAKEAGYLTVGVVTYPFSFEGRKRSVQALEAIEKLQKNVDTLIVIPNDRLLDIADE  221

Query  735   QTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKN  556
              TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKN
Sbjct  222   NTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKN  281

Query  555   RAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFG  376
             RAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFG
Sbjct  282   RAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFG  341

Query  375   AVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDK  256
             AVVDERYNGEIHVTI+ATGF QSFQ++LL DP+GAK  D+
Sbjct  342   AVVDERYNGEIHVTIVATGFAQSFQKSLLADPKGAKLVDR  381



>gb|KHM99513.1| Cell division protein FtsZ like 1, chloroplastic [Glycine soja]
Length=419

 Score =   522 bits (1344),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 326/404 (81%), Positives = 350/404 (87%), Gaps = 17/404 (4%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRR-KSLFHQRRFS-  1258
             MAML   NP  +             H   + SSF+ R+C+S     R   S   +RRF+ 
Sbjct  1     MAMLPLTNPTPIR------------HNALSSSSFVQRKCVSLIPRIRTCDSEPQRRRFAS  48

Query  1257  -VRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
                CSF  +DSAKIKVVGVGGGGNNAVNRMIG GL GV+FYAINTDAQ+LL S+A+ PI+
Sbjct  49    VTCCSFSTLDSAKIKVVGVGGGGNNAVNRMIGCGLHGVEFYAINTDAQALLHSSAENPIK  108

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IGELLTRGLGTGGNPLLGEQAAEESKEAIANAL+GSD+VF+TAGMGGGTGSGAAPVVA+I
Sbjct  109   IGELLTRGLGTGGNPLLGEQAAEESKEAIANALQGSDLVFVTAGMGGGTGSGAAPVVARI  168

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQA--LEAIEKLQKNVDTLIVIPNDRLLDIADEQTP  727
             +KEAGYLTVGVVTYPFSFEGRKRSLQA  LEAIEKLQKNVDTLIVIPNDRLLD+ADEQTP
Sbjct  169   AKEAGYLTVGVVTYPFSFEGRKRSLQAGALEAIEKLQKNVDTLIVIPNDRLLDMADEQTP  228

Query  726   LQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAE  547
             LQDAF LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAE
Sbjct  229   LQDAFRLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAE  288

Query  546   EAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVV  367
             EAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVV
Sbjct  289   EAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVV  348

Query  366   DERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             D+RYNGEIHVTIIATGF+QSFQ+ LLTDPR AK  D+  G QE+
Sbjct  349   DDRYNGEIHVTIIATGFSQSFQKILLTDPRAAKLLDREPGGQES  392



>ref|XP_010449352.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Camelina sativa]
Length=427

 Score =   521 bits (1342),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 315/361 (87%), Positives = 337/361 (93%), Gaps = 5/361 (1%)
 Frame = -3

Query  1305  GYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINT  1126
             G  S+R+S+  +    +RCSF PM+SA+IKV+GVGGGGNNAVNRMI SGLQ VDFYAINT
Sbjct  47    GGCSKRRSISTR---GLRCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINT  103

Query  1125  DAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagm  946
             D+Q+L+QS+A  P+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKGSD+VFITAGM
Sbjct  104   DSQALIQSSADNPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFITAGM  163

Query  945   gggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  766
             GGGTGSGAAPVVAQISK+AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP
Sbjct  164   GGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  223

Query  765   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  586
             NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM
Sbjct  224   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  283

Query  585   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL  406
             LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKD+TL EVNRVS+VVTSL
Sbjct  284   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDLTLLEVNRVSEVVTSL  343

Query  405   ADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDK--GAGSQENA  232
             ADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLL DPR AK  DK   +G QEN 
Sbjct  344   ADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLADPRAAKLLDKMGSSGQQENK  403

Query  231   G  229
             G
Sbjct  404   G  404



>ref|XP_007146538.1| hypothetical protein PHAVU_006G049100g [Phaseolus vulgaris]
 gb|ESW18532.1| hypothetical protein PHAVU_006G049100g [Phaseolus vulgaris]
Length=418

 Score =   521 bits (1341),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 328/400 (82%), Positives = 356/400 (89%), Gaps = 9/400 (2%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVR  1252
             MAML   NP+ V   + SSS+S    +   P + IPR C+   +AS R+ L      SVR
Sbjct  1     MAMLPLTNPSSVRHNALSSSSSSFALRNCVPLNPIPRTCV---FASPRRPLA-----SVR  52

Query  1251  C-SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIg  1075
             C SF  ++SAKIKVVGVGGGGNNAVNRMIG GL  V+FYAINTDAQ+LL+SAA+ PI+IG
Sbjct  53    CCSFSALESAKIKVVGVGGGGNNAVNRMIGCGLHDVEFYAINTDAQALLKSAAENPIKIG  112

Query  1074  elltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISK  895
             ELLTRGLGTGGNPLLGEQAAEESKEAIA+AL+GSD+VF+TAGMGGGTGSGAAPVVA+I+K
Sbjct  113   ELLTRGLGTGGNPLLGEQAAEESKEAIASALQGSDLVFVTAGMGGGTGSGAAPVVARIAK  172

Query  894   EAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDA  715
             EAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLD+ADEQTPLQDA
Sbjct  173   EAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDMADEQTPLQDA  232

Query  714   FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAE  535
             F LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAE
Sbjct  233   FRLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAE  292

Query  534   QATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERY  355
             QATLAPLIGSSIQ+ATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY
Sbjct  293   QATLAPLIGSSIQAATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRY  352

Query  354   NGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             NGEIHVTIIATGF+QSFQ+TLLTDPR AK  D+    QE+
Sbjct  353   NGEIHVTIIATGFSQSFQKTLLTDPRAAKLLDRVPEGQES  392



>ref|XP_010443150.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Camelina sativa]
Length=426

 Score =   521 bits (1341),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 318/383 (83%), Positives = 342/383 (89%), Gaps = 6/383 (2%)
 Frame = -3

Query  1359  FHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFS----VRCSFIPMDSAKIKvvgvgggg  1192
             F  K    S +     +S   S+    F +RR      ++CSF PM+SA+IKV+GVGGGG
Sbjct  21    FLAKSISHSLLTSCVCASTRISKFGGGFSKRRSGSTRGLKCSFSPMESARIKVIGVGGGG  80

Query  1191  nnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAE  1012
             NNAVNRMI SGLQ VDFYAINTD+Q+L+QS+A+ P+QIGELLTRGLGTGGNPLLGEQAAE
Sbjct  81    NNAVNRMISSGLQSVDFYAINTDSQALIQSSAENPLQIGELLTRGLGTGGNPLLGEQAAE  140

Query  1011  ESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKR  832
             ESK+AIANALKGSD+VFITAGMGGGTGSGAAPVVAQISK+AGYLTVGVVTYPFSFEGRKR
Sbjct  141   ESKDAIANALKGSDLVFITAGMGGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKR  200

Query  831   SLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITI  652
             SLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITI
Sbjct  201   SLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITI  260

Query  651   PGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYN  472
             PGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYN
Sbjct  261   PGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYN  320

Query  471   ITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTL  292
             ITGGKD+TL EVNRVS+VVTSLADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TL
Sbjct  321   ITGGKDLTLLEVNRVSEVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTL  380

Query  291   LTDPRGAKAGDK--GAGSQENAG  229
             L DPR AK  DK   +G QEN G
Sbjct  381   LADPRAAKLLDKMGSSGQQENKG  403



>ref|XP_010099992.1| Cell division protein FtsZ-1-like protein [Morus notabilis]
 gb|EXB81097.1| Cell division protein FtsZ-1-like protein [Morus notabilis]
Length=423

 Score =   520 bits (1339),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 316/354 (89%), Positives = 331/354 (94%), Gaps = 5/354 (1%)
 Frame = -3

Query  1275  HQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAA  1096
             H+    V CSF PM++AKIKVVGVGGGG+NAVNRMIGSGLQGVDFYAINTDAQ+L+ SAA
Sbjct  49    HRFDAVVSCSFQPMETAKIKVVGVGGGGSNAVNRMIGSGLQGVDFYAINTDAQALVHSAA  108

Query  1095  QTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAP  916
             + P+QIGELLTRGLGTGGNPLLGEQAAEESK+ IANALKGSD+VFITAGMGGGTGSGAAP
Sbjct  109   ENPLQIGELLTRGLGTGGNPLLGEQAAEESKDTIANALKGSDLVFITAGMGGGTGSGAAP  168

Query  915   VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQA-----LEAIEKLQKNVDTLIVIPNDRLL  751
             VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQA     LEAIEKLQKNVDTLIVIPNDRLL
Sbjct  169   VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAGVIVALEAIEKLQKNVDTLIVIPNDRLL  228

Query  750   DIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGV  571
             DI DEQT LQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGV
Sbjct  229   DITDEQTALQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGV  288

Query  570   SSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSA  391
             SSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSA
Sbjct  289   SSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSA  348

Query  390   NIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             NIIFGAVVD+RYNGEIHVTIIATGF+QSFQ+TLLTDPR AK  +K  G QE+ G
Sbjct  349   NIIFGAVVDDRYNGEIHVTIIATGFSQSFQKTLLTDPRAAKLVEKITGGQESKG  402



>ref|XP_010482963.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Camelina sativa]
Length=426

 Score =   520 bits (1339),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 314/356 (88%), Positives = 334/356 (94%), Gaps = 6/356 (2%)
 Frame = -3

Query  1278  FHQRRFS----VRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSL  1111
             F +RR      +RCSF PM+SA+IKV+GVGGGGNNAVNRMI SGLQ VDFYAINTD+Q+L
Sbjct  48    FPKRRSGSTKGLRCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINTDSQAL  107

Query  1110  LQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtg  931
             +QS+A+ P+QIGELLTRGLGTGGNPLLGEQAAEESK+AIANALKGSD+VFITAGMGGGTG
Sbjct  108   IQSSAENPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFITAGMGGGTG  167

Query  930   sgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLL  751
             SGAAPVVAQISK+AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLL
Sbjct  168   SGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLL  227

Query  750   DIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGV  571
             DIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGV
Sbjct  228   DIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGV  287

Query  570   SSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSA  391
             SSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKD+TL EVNRVS+VVTSLADPSA
Sbjct  288   SSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDLTLLEVNRVSEVVTSLADPSA  347

Query  390   NIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDK--GAGSQENAG  229
             NIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLL DPR AK  DK   +G QEN G
Sbjct  348   NIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLADPRAAKLLDKMGSSGQQENKG  403



>ref|XP_009765135.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=412

 Score =   519 bits (1337),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 327/398 (82%), Positives = 349/398 (88%), Gaps = 13/398 (3%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVR  1252
             MAMLG ++   +   S SS++   +H  R        QC S     +R+    +RRFS+ 
Sbjct  1     MAMLGLSSNTGIDILSSSSNSLSFYHSTRFT------QCFSPKSLCKRQ----RRRFSI-  49

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
             CS   + SAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYA+NTDAQ+LLQS  + PIQIGE
Sbjct  50    CS--SLSSAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAVNTDAQALLQSTVENPIQIGE  107

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
             LLTRGLGTGGNPLLGEQAAEESKE IANALKGSDMVFITAGMGGGTGSGAAPVVAQI+KE
Sbjct  108   LLTRGLGTGGNPLLGEQAAEESKEHIANALKGSDMVFITAGMGGGTGSGAAPVVAQIAKE  167

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
             AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ+AF
Sbjct  168   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQNAF  227

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
             LLADDVL QGVQGISDIITIPGLVNVDFADVKA+MKDSGTAMLGVGVSSS+NRAEEAAEQ
Sbjct  228   LLADDVLCQGVQGISDIITIPGLVNVDFADVKAIMKDSGTAMLGVGVSSSRNRAEEAAEQ  287

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             ATLAPLIGSSIQSATGVVYNITGGKDITLQEVN+VSQVVTSLADPSANIIFGAVVDERYN
Sbjct  288   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNKVSQVVTSLADPSANIIFGAVVDERYN  347

Query  351   GEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQE  238
             GEI VT+IATGF QSFQ +LLTDPRGAK  DK  G+ E
Sbjct  348   GEIQVTLIATGFAQSFQNSLLTDPRGAKLVDKSKGTTE  385



>ref|XP_009625657.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=412

 Score =   519 bits (1336),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 327/398 (82%), Positives = 349/398 (88%), Gaps = 13/398 (3%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVR  1252
             MAM+G +    +   S SS++   +H  R    F P+        S RK    ++RFS+ 
Sbjct  1     MAMIGLSLNTGIDILSSSSNSLSFYHSTRLIQCFSPK--------SLRKR--QRQRFSI-  49

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
             CS   + SAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYA+NTDAQ+LLQS  + PIQIGE
Sbjct  50    CS--SLSSAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAVNTDAQALLQSTVENPIQIGE  107

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
             LLTRGLGTGGNPLLGEQAAEESKE IANALKGSDMVFITAGMGGGTGSGAAPVVAQI+KE
Sbjct  108   LLTRGLGTGGNPLLGEQAAEESKEHIANALKGSDMVFITAGMGGGTGSGAAPVVAQIAKE  167

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
             AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ+AF
Sbjct  168   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQNAF  227

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
             LLADDVL QGVQGISDIITIPGLVNVDFADVKA+MKDSGTAMLGVGVSSS+NRAEEAAEQ
Sbjct  228   LLADDVLCQGVQGISDIITIPGLVNVDFADVKAIMKDSGTAMLGVGVSSSRNRAEEAAEQ  287

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             ATLAPLIGSSIQSATGVVYNITGGKDITLQEVN+VSQVVTSLADPSANIIFGAVVDERYN
Sbjct  288   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNKVSQVVTSLADPSANIIFGAVVDERYN  347

Query  351   GEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQE  238
             GEIHVT+IATGF QSFQ +LLTDPRGAK  DK  G+ E
Sbjct  348   GEIHVTLIATGFAQSFQNSLLTDPRGAKLVDKSKGTTE  385



>ref|XP_004500118.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Cicer arietinum]
Length=425

 Score =   519 bits (1337),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 318/368 (86%), Positives = 336/368 (91%), Gaps = 2/368 (1%)
 Frame = -3

Query  1332  FIPRQCIS-SGYASRRKSLFHQRRFS-VRCSFIPMDSAKIKvvgvggggnnavNRMIGSG  1159
             F  R CIS +   +   +   +RRF  V CSF  +D+AKIKVVGVGGGGNNAVNRMIG G
Sbjct  31    FAVRNCISLNPILTTSNTESPRRRFRPVNCSFSSIDNAKIKVVGVGGGGNNAVNRMIGCG  90

Query  1158  LQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALK  979
             LQGVDFYAINTDAQ+LL S+A+ PI+IGELLTRGLGTGGNPLLGEQAA ESKE IANAL 
Sbjct  91    LQGVDFYAINTDAQALLHSSAENPIKIGELLTRGLGTGGNPLLGEQAAMESKETIANALH  150

Query  978   GSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKL  799
             GSD+VF+TAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKL
Sbjct  151   GSDLVFVTAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKL  210

Query  798   QKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADV  619
             QKNVDTLIVIPNDRLLDIADEQTPLQDAF LADDVLRQGVQGISDIITIPGLVNVDFADV
Sbjct  211   QKNVDTLIVIPNDRLLDIADEQTPLQDAFRLADDVLRQGVQGISDIITIPGLVNVDFADV  270

Query  618   KAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQE  439
             KAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATG+VYNITGGKDITLQE
Sbjct  271   KAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGIVYNITGGKDITLQE  330

Query  438   VNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGD  259
             VNRVSQVVTSLADPSANIIFGAVVD+RYNGEIHVTIIATGF+QSFQ+ LLTDPR AK  D
Sbjct  331   VNRVSQVVTSLADPSANIIFGAVVDDRYNGEIHVTIIATGFSQSFQKMLLTDPRAAKLLD  390

Query  258   KGAGSQEN  235
             +  G QE+
Sbjct  391   RLPGGQES  398



>ref|XP_010536696.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Tarenaya hassleriana]
Length=425

 Score =   519 bits (1336),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 312/343 (91%), Positives = 329/343 (96%), Gaps = 2/343 (1%)
 Frame = -3

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
             CSF PM+SA+IKVVGVGGGGNNAVNRMI SGLQGVDFYAINTD+Q+LLQSAA  P+QIGE
Sbjct  61    CSFAPMESARIKVVGVGGGGNNAVNRMISSGLQGVDFYAINTDSQALLQSAADNPLQIGE  120

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
             LLTRGLGTGGNPLLGEQAAEESK+AIANALKGSD+VFITAGMGGGTGSGAAPVVAQI+KE
Sbjct  121   LLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFITAGMGGGTGSGAAPVVAQIAKE  180

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
             +GYLTVGVVTYPFSFEGRKRS+QALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF
Sbjct  181   SGYLTVGVVTYPFSFEGRKRSVQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  240

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
             LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ
Sbjct  241   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  300

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY 
Sbjct  301   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYT  360

Query  351   GEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAGSL  223
             GE+HVTIIATGF+QSFQ+TLLTDPR AK    G+  Q+N G +
Sbjct  361   GELHVTIIATGFSQSFQKTLLTDPRAAKL--LGSSGQDNKGGI  401



>gb|EPS68972.1| plastid-dividing ring protein, partial [Genlisea aurea]
Length=361

 Score =   515 bits (1327),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 308/325 (95%), Positives = 321/325 (99%), Gaps = 0/325 (0%)
 Frame = -3

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             SF PM++A+IKVVGVGGGGNNAVNRMIGSGL+GVDFYAINTDAQ+LLQSAA+ PIQIGEL
Sbjct  1     SFTPMETARIKVVGVGGGGNNAVNRMIGSGLKGVDFYAINTDAQALLQSAAENPIQIGEL  60

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLGTGGNPLLGEQAAEES+EAIAN+L GSDMVFITAGMGGGTGSGAAPVVAQI+KEA
Sbjct  61    LTRGLGTGGNPLLGEQAAEESREAIANSLSGSDMVFITAGMGGGTGSGAAPVVAQIAKEA  120

Query  888   GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  709
             GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL
Sbjct  121   GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  180

Query  708   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  529
             LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA
Sbjct  181   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  240

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNG  349
             TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERY+G
Sbjct  241   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYHG  300

Query  348   EIHVTIIATGFTQSFQRTLLTDPRG  274
             EIHVTIIATGFTQSFQ+++L DPRG
Sbjct  301   EIHVTIIATGFTQSFQKSVLMDPRG  325



>gb|EYU27393.1| hypothetical protein MIMGU_mgv1a007772mg [Erythranthe guttata]
Length=395

 Score =   514 bits (1325),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 309/342 (90%), Positives = 329/342 (96%), Gaps = 2/342 (1%)
 Frame = -3

Query  1296  SRRKSLFHQRRFS--VRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTD  1123
             SRRKS  + +R S  V CS  PMDSAKIKVVGVGGGGNNAVNRMIGSGL+GVDFYAINTD
Sbjct  26    SRRKSFCNFKRHSSGVYCSLTPMDSAKIKVVGVGGGGNNAVNRMIGSGLRGVDFYAINTD  85

Query  1122  AQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmg  943
             AQ+LLQS+A+ PIQIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSDMVFITAGMG
Sbjct  86    AQALLQSSAENPIQIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSDMVFITAGMG  145

Query  942   ggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPN  763
             GGTGSGAAPVV+QI+K+AGYLTVGVVTYPFSFEGRKRS+QALEAIEKLQK+VDTLIV+PN
Sbjct  146   GGTGSGAAPVVSQIAKDAGYLTVGVVTYPFSFEGRKRSVQALEAIEKLQKHVDTLIVVPN  205

Query  762   DRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAML  583
             DRLLDIADE TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADV+AVMK+SGTAML
Sbjct  206   DRLLDIADENTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVQAVMKNSGTAML  265

Query  582   GVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLA  403
             GVGVSSSKNRA EAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVN+VSQ+VTSLA
Sbjct  266   GVGVSSSKNRAVEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNKVSQIVTSLA  325

Query  402   DPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPR  277
             DPSANIIFGAVVDER+NGEIHVTIIATGFT+SFQ+ LLTDP+
Sbjct  326   DPSANIIFGAVVDERFNGEIHVTIIATGFTESFQKALLTDPK  367



>gb|AAF23770.1|AF205858_1 FtsZ-like protein 2 [Nicotiana tabacum]
Length=413

 Score =   514 bits (1323),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 316/361 (88%), Positives = 332/361 (92%), Gaps = 7/361 (2%)
 Frame = -3

Query  1320  QCISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDF  1141
             QC S     +R+    +RRFS+ CS   + SAKIKVVGVGGGGNNAVNRMIGSGLQGVDF
Sbjct  33    QCFSPKSLCKRQ----RRRFSI-CS--SLSSAKIKVVGVGGGGNNAVNRMIGSGLQGVDF  85

Query  1140  YAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVF  961
             YA+NTDAQ+LLQS  + PIQIGELLTRGLGTGGNPLLGEQAAEESKE IANALKGSDMVF
Sbjct  86    YAVNTDAQALLQSTVENPIQIGELLTRGLGTGGNPLLGEQAAEESKEHIANALKGSDMVF  145

Query  960   ItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDT  781
             ITAGMGGGTGSGAAPVVAQI+KEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDT
Sbjct  146   ITAGMGGGTGSGAAPVVAQIAKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDT  205

Query  780   LIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKD  601
             LIVIPNDRLLDIADEQTPLQ+AFLLADDVL QGVQGISDIITIPGLVNVDFADVKA+MKD
Sbjct  206   LIVIPNDRLLDIADEQTPLQNAFLLADDVLCQGVQGISDIITIPGLVNVDFADVKAIMKD  265

Query  600   SGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQ  421
             SGTAMLGVGVSSS+NRAEEAAEQATLAPLIGSSIQSATG VYNITGGKDITLQEVN+VSQ
Sbjct  266   SGTAMLGVGVSSSRNRAEEAAEQATLAPLIGSSIQSATGDVYNITGGKDITLQEVNKVSQ  325

Query  420   VVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQ  241
             VVTSLADPSANIIFGAVVDERYNGEI VT+IATGF QSFQ +LLTDPRGAK  DK  G+ 
Sbjct  326   VVTSLADPSANIIFGAVVDERYNGEIQVTLIATGFAQSFQNSLLTDPRGAKLVDKSKGTT  385

Query  240   E  238
             E
Sbjct  386   E  386



>emb|CAA75603.1| FtsZ protein [Pisum sativum]
Length=423

 Score =   514 bits (1324),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 317/346 (92%), Positives = 329/346 (95%), Gaps = 1/346 (0%)
 Frame = -3

Query  1269  RRF-SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQ  1093
             RRF SVRCS   +D+AKIKVVG+GGGGNNAVNRMIGSGLQGVDFYAINTDAQ+LL SAA+
Sbjct  50    RRFGSVRCSLAYVDNAKIKVVGIGGGGNNAVNRMIGSGLQGVDFYAINTDAQALLHSAAE  109

Query  1092  TPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPV  913
              PI+IGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSD+VFITAGMGGGTGSGAAPV
Sbjct  110   NPIKIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSDLVFITAGMGGGTGSGAAPV  169

Query  912   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ  733
             VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ
Sbjct  170   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ  229

Query  732   TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNR  553
              PLQDAF LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSS KNR
Sbjct  230   MPLQDAFRLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSGKNR  289

Query  552   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  373
             AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA
Sbjct  290   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  349

Query  372   VVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             VVD+RY GEIHVTIIATGF+QSFQ+ LLTDPR AK  DK A  +E+
Sbjct  350   VVDDRYTGEIHVTIIATGFSQSFQKKLLTDPRAAKLLDKVAEGKES  395



>emb|CAB89286.1| chloroplast FtsZ-like protein [Nicotiana tabacum]
Length=408

 Score =   513 bits (1321),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 316/361 (88%), Positives = 332/361 (92%), Gaps = 7/361 (2%)
 Frame = -3

Query  1320  QCISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDF  1141
             QC S     +R+    +RRFS+ CS   + SAKIKVVGVGGGGNNAVNRMIGSGLQGVDF
Sbjct  28    QCFSPKSLCKRQ----RRRFSI-CS--SLSSAKIKVVGVGGGGNNAVNRMIGSGLQGVDF  80

Query  1140  YAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVF  961
             YA+NTDAQ+LLQS  + PIQIGELLTRGLGTGGNPLLGEQAAEESKE IANALKGSDMVF
Sbjct  81    YAVNTDAQALLQSTVENPIQIGELLTRGLGTGGNPLLGEQAAEESKEHIANALKGSDMVF  140

Query  960   ItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDT  781
             ITAGMGGGTGSGAAPVVAQI+KEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDT
Sbjct  141   ITAGMGGGTGSGAAPVVAQIAKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDT  200

Query  780   LIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKD  601
             LIVIPNDRLLDIADEQTPLQ+AFLLADDVL QGVQGISDIITIPGLVNVDFADVKA+MKD
Sbjct  201   LIVIPNDRLLDIADEQTPLQNAFLLADDVLCQGVQGISDIITIPGLVNVDFADVKAIMKD  260

Query  600   SGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQ  421
             SGTAMLGVGVSSS+NRAEEAAEQATLAPLIG SIQSATGVVYNITGGKDITLQEVN+VSQ
Sbjct  261   SGTAMLGVGVSSSRNRAEEAAEQATLAPLIGLSIQSATGVVYNITGGKDITLQEVNKVSQ  320

Query  420   VVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQ  241
             VVTSLADPSANIIFGAVVDERYNGEI VT+IATGF QSFQ +LLTDPRGAK  DK  G+ 
Sbjct  321   VVTSLADPSANIIFGAVVDERYNGEIQVTLIATGFAQSFQNSLLTDPRGAKLVDKSKGTT  380

Query  240   E  238
             E
Sbjct  381   E  381



>ref|XP_007020677.1| Bacterial cytokinesis Z-ring protein FTSZ 1-1 isoform 2 [Theobroma 
cacao]
 gb|EOY12202.1| Bacterial cytokinesis Z-ring protein FTSZ 1-1 isoform 2 [Theobroma 
cacao]
Length=407

 Score =   512 bits (1319),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 312/365 (85%), Positives = 334/365 (92%), Gaps = 6/365 (2%)
 Frame = -3

Query  1323  RQCISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVD  1144
             R   SS    +R  L   R   + CSF PM++AKIKVVGVGGGGNNAVNRMIGSGLQGVD
Sbjct  25    RPSFSSKKPLKRGCLRRHRFGGISCSFAPMETAKIKVVGVGGGGNNAVNRMIGSGLQGVD  84

Query  1143  FYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMV  964
             FYAINTD+Q+LLQSAA+ P+QIGELLTRGLGTGGNPLLGEQAAEES++AI+NALKGSD+V
Sbjct  85    FYAINTDSQALLQSAAENPLQIGELLTRGLGTGGNPLLGEQAAEESRDAISNALKGSDLV  144

Query  963   FItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVD  784
             FITAGMGGGTGSGAAPVVAQI+KEAGYLTVGVVTYPFSFEGRKR++QAL+AIEKLQKNVD
Sbjct  145   FITAGMGGGTGSGAAPVVAQIAKEAGYLTVGVVTYPFSFEGRKRTMQALDAIEKLQKNVD  204

Query  783   TLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK  604
             TLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK
Sbjct  205   TLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK  264

Query  603   DSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVS  424
             DSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQE     
Sbjct  265   DSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQE-----  319

Query  423   QVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGS  244
              VVTSLADP+ANIIFGAVVD+RYNGEIHVTIIATGF+QSFQ+TLLTDP+ AK  DK A  
Sbjct  320   -VVTSLADPTANIIFGAVVDDRYNGEIHVTIIATGFSQSFQKTLLTDPKAAKQIDKLAAG  378

Query  243   QENAG  229
             QE+ G
Sbjct  379   QESKG  383



>gb|AFK39538.1| unknown [Lotus japonicus]
Length=416

 Score =   512 bits (1318),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 314/346 (91%), Positives = 330/346 (95%), Gaps = 1/346 (0%)
 Frame = -3

Query  1269  RRF-SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQ  1093
             RRF SVRCSF  +++AKIKVVG+GGGGNNAVNRMIGSGLQGVDFYAINTDAQ+L+ S A+
Sbjct  49    RRFRSVRCSFASVENAKIKVVGIGGGGNNAVNRMIGSGLQGVDFYAINTDAQALVHSVAE  108

Query  1092  TPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPV  913
              PI+IGELLTRGLGTGGNPLLGEQAAEES+EAIA+ALKGSD+VFITAGMGGGTGSGAAPV
Sbjct  109   NPIKIGELLTRGLGTGGNPLLGEQAAEESREAIADALKGSDLVFITAGMGGGTGSGAAPV  168

Query  912   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ  733
             VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ
Sbjct  169   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ  228

Query  732   TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNR  553
              PLQDAF LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSS KNR
Sbjct  229   MPLQDAFRLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSGKNR  288

Query  552   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  373
             AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSA+IIFGA
Sbjct  289   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSADIIFGA  348

Query  372   VVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             VVD+RY GEIHVTIIATGF+QSFQ+ LLTDPR AK  DK A SQE+
Sbjct  349   VVDDRYTGEIHVTIIATGFSQSFQKKLLTDPRAAKLLDKVAESQES  394



>ref|XP_003600215.1| Cell division protein FtsZ [Medicago truncatula]
 gb|AES70466.1| cell division FtsZ-like protein [Medicago truncatula]
Length=413

 Score =   511 bits (1315),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 312/363 (86%), Positives = 334/363 (92%), Gaps = 4/363 (1%)
 Frame = -3

Query  1323  RQCISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVD  1144
             R CIS    + RK+L H+ +  V CSF  +D+AKIKVVGVGGGGNNAVNRMIG GLQGVD
Sbjct  28    RNCIS---LNPRKTLRHRLK-PVSCSFESIDNAKIKVVGVGGGGNNAVNRMIGCGLQGVD  83

Query  1143  FYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMV  964
             FYAINTDAQ+LL SAA+ PI+IGELLTRGLGTGGNPLLGEQAAEESKE IANAL GSD+V
Sbjct  84    FYAINTDAQALLHSAAENPIKIGELLTRGLGTGGNPLLGEQAAEESKETIANALHGSDLV  143

Query  963   FItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVD  784
             F+TAGMGGGTGSGAAPVVA+ISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIE+LQ+NVD
Sbjct  144   FVTAGMGGGTGSGAAPVVARISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIERLQQNVD  203

Query  783   TLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK  604
             TLIVIPNDRLLDIAD+QTPL DAF LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK
Sbjct  204   TLIVIPNDRLLDIADDQTPLTDAFRLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK  263

Query  603   DSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVS  424
             DSGTAMLGVGVSS KNRAEEAAEQATLAPLIGSSIQSATG+VYNITGGKDITLQEVNRVS
Sbjct  264   DSGTAMLGVGVSSGKNRAEEAAEQATLAPLIGSSIQSATGIVYNITGGKDITLQEVNRVS  323

Query  423   QVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGS  244
             QVVTSLADPSANIIFGAVVDERY+GEIHVT+IATGF+QSFQ+ LLTDPR AK  D+    
Sbjct  324   QVVTSLADPSANIIFGAVVDERYSGEIHVTLIATGFSQSFQKMLLTDPRAAKLLDRLPMG  383

Query  243   QEN  235
             QE+
Sbjct  384   QES  386



>ref|XP_004491442.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Cicer arietinum]
Length=413

 Score =   510 bits (1314),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 314/348 (90%), Positives = 329/348 (95%), Gaps = 0/348 (0%)
 Frame = -3

Query  1278  FHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSA  1099
             F +R  SV+CS   +D+AKIKVVG+GGGGNNAVNRMIGSGLQGVDFYAINTDAQ+LL SA
Sbjct  38    FSRRFGSVKCSLAYVDNAKIKVVGIGGGGNNAVNRMIGSGLQGVDFYAINTDAQALLHSA  97

Query  1098  AQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaA  919
             A+ PI+IGELLTRGLGTGGNPLLGEQAAEESKEAIA+ALKGSD+VFITAGMGGGTGSGAA
Sbjct  98    AENPIKIGELLTRGLGTGGNPLLGEQAAEESKEAIADALKGSDLVFITAGMGGGTGSGAA  157

Query  918   PVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIAD  739
             PVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIAD
Sbjct  158   PVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIAD  217

Query  738   EQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSK  559
             EQ PLQDAF LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSS K
Sbjct  218   EQMPLQDAFRLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSGK  277

Query  558   NRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIF  379
             NRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIF
Sbjct  278   NRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIF  337

Query  378   GAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             GAVVD+RY GEIHVTIIATGF+QSFQ+ LLTDPR AK  DK A  +E+
Sbjct  338   GAVVDDRYTGEIHVTIIATGFSQSFQKKLLTDPRAAKLLDKVAEGKES  385



>emb|CAI44667.1| plastid division protein [Medicago truncatula]
 gb|AET00625.2| cell division FtsZ-like protein [Medicago truncatula]
Length=418

 Score =   511 bits (1315),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 314/346 (91%), Positives = 329/346 (95%), Gaps = 1/346 (0%)
 Frame = -3

Query  1269  RRF-SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQ  1093
             RRF SV+CS   +D+AKIKVVG+GGGGNNAVNRMIGSGLQGVDFYAINTDAQ+LL SAA+
Sbjct  45    RRFGSVKCSLAYVDNAKIKVVGIGGGGNNAVNRMIGSGLQGVDFYAINTDAQALLHSAAE  104

Query  1092  TPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPV  913
              PI+IGELLTRGLGTGGNPLLGEQAAEESKEAIA+ALKGSD+VFITAGMGGGTGSGAAPV
Sbjct  105   NPIKIGELLTRGLGTGGNPLLGEQAAEESKEAIADALKGSDLVFITAGMGGGTGSGAAPV  164

Query  912   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ  733
             VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ+NVDTLIVIPNDRLLDIADEQ
Sbjct  165   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQRNVDTLIVIPNDRLLDIADEQ  224

Query  732   TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNR  553
              PLQDAF LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSS KNR
Sbjct  225   MPLQDAFRLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSGKNR  284

Query  552   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  373
             AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA
Sbjct  285   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  344

Query  372   VVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             VVD+RY GEIHVTIIATGF+QSFQ+ LLTDPR AK  DK A  +E+
Sbjct  345   VVDDRYTGEIHVTIIATGFSQSFQKKLLTDPRAAKLLDKVAEGKES  390



>gb|KHN43855.1| Cell division protein FtsZ like 1, chloroplastic [Glycine soja]
Length=418

 Score =   509 bits (1312),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 320/378 (85%), Positives = 341/378 (90%), Gaps = 10/378 (3%)
 Frame = -3

Query  1359  FHQKRAPSS--FIPRQCISSGYASRRKSLFHQRRF-SVRCSFIPMDSAKIKvvgvggggn  1189
             FH     +S    PR   ++  A RR S    RRF SVRCS+  +D+AKIKVVG+GGGGN
Sbjct  24    FHHNALTTSVSLNPR---TTKIAPRRLS----RRFGSVRCSYAYVDNAKIKVVGIGGGGN  76

Query  1188  navNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEE  1009
             NAVNRMIGSGLQGVDFYAINTDAQ+LL SAA+ PI+IGE+LTRGLGTGGNPLLGEQAAEE
Sbjct  77    NAVNRMIGSGLQGVDFYAINTDAQALLNSAAENPIKIGEVLTRGLGTGGNPLLGEQAAEE  136

Query  1008  SKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRS  829
             S++AIA+ALKGSD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRS
Sbjct  137   SRDAIADALKGSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRS  196

Query  828   LQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIP  649
             LQA EAIE+LQKNVDTLIVIPNDRLLDIADEQ PLQDAF LADDVLRQGVQGISDIIT+P
Sbjct  197   LQAFEAIERLQKNVDTLIVIPNDRLLDIADEQMPLQDAFRLADDVLRQGVQGISDIITVP  256

Query  648   GLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNI  469
             GLVNVDFADVKAVMKDSGTAMLGVGVSS KNRAEEAAEQATLAPLIGSSIQSATGVVYNI
Sbjct  257   GLVNVDFADVKAVMKDSGTAMLGVGVSSGKNRAEEAAEQATLAPLIGSSIQSATGVVYNI  316

Query  468   TGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLL  289
             TGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+ LL
Sbjct  317   TGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKKLL  376

Query  288   TDPRGAKAGDKGAGSQEN  235
             TDPR AK  DK A  QE+
Sbjct  377   TDPRAAKLLDKVAEGQES  394



>ref|XP_003519603.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Glycine max]
Length=418

 Score =   508 bits (1309),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 311/346 (90%), Positives = 329/346 (95%), Gaps = 1/346 (0%)
 Frame = -3

Query  1269  RRF-SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQ  1093
             RRF SVRCS+  +D+AKIKVVG+GGGGNNAVNRMIGSGLQGVDFYAINTDAQ+LL SAA+
Sbjct  49    RRFGSVRCSYAYVDNAKIKVVGIGGGGNNAVNRMIGSGLQGVDFYAINTDAQALLNSAAE  108

Query  1092  TPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPV  913
              PI+IGE+LTRGLGTGGNPLLGEQAAEES++AIA+ALKGSD+VFITAGMGGGTGSGAAPV
Sbjct  109   NPIKIGEVLTRGLGTGGNPLLGEQAAEESRDAIADALKGSDLVFITAGMGGGTGSGAAPV  168

Query  912   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ  733
             VAQISKEAGYLTVGVVTYPFSFEGRKRSLQA EAIE+LQKNVDTLIVIPNDRLLDIADEQ
Sbjct  169   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQAFEAIERLQKNVDTLIVIPNDRLLDIADEQ  228

Query  732   TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNR  553
              PLQDAF LADDVLRQGVQGISDIIT+PGLVNVDFADVKAVMKDSGTAMLGVGVSS KNR
Sbjct  229   MPLQDAFRLADDVLRQGVQGISDIITVPGLVNVDFADVKAVMKDSGTAMLGVGVSSGKNR  288

Query  552   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  373
             AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA
Sbjct  289   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  348

Query  372   VVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             VVD+RY GEIHVTIIATGF+QSFQ+ LLTDPR AK  DK A  QE+
Sbjct  349   VVDDRYTGEIHVTIIATGFSQSFQKKLLTDPRAAKLLDKVAEGQES  394



>ref|XP_003544739.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Glycine max]
Length=418

 Score =   507 bits (1306),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 317/368 (86%), Positives = 338/368 (92%), Gaps = 8/368 (2%)
 Frame = -3

Query  1335  SFIPRQCISSGYASRRKSLFHQRRF-SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSG  1159
             SF PR   ++  A +R S    RRF SVRCS+  +D+AKIKVVG+GGGGNNAVNRMIGSG
Sbjct  34    SFKPR---TTKIAPQRLS----RRFGSVRCSYAYVDNAKIKVVGIGGGGNNAVNRMIGSG  86

Query  1158  LQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALK  979
             LQGVDFYAINTDAQ+LL SAA+ PI+IGE+LTRGLGTGGNPLLGEQAAEES++AIA+ALK
Sbjct  87    LQGVDFYAINTDAQALLNSAAENPIKIGEVLTRGLGTGGNPLLGEQAAEESRDAIADALK  146

Query  978   GSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKL  799
             GSD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKR LQA EAIE+L
Sbjct  147   GSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRCLQAFEAIERL  206

Query  798   QKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADV  619
             QKNVDTLIVIPNDRLLDIADEQ PLQDAF LADDVLRQGVQGISDIIT+PGLVNVDFADV
Sbjct  207   QKNVDTLIVIPNDRLLDIADEQMPLQDAFRLADDVLRQGVQGISDIITVPGLVNVDFADV  266

Query  618   KAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQE  439
             KAVMKDSGTAMLGVGVSS KNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQE
Sbjct  267   KAVMKDSGTAMLGVGVSSGKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQE  326

Query  438   VNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGD  259
             VNRVSQVVTSLADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+ LLTDPR AK  D
Sbjct  327   VNRVSQVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKKLLTDPRAAKLLD  386

Query  258   KGAGSQEN  235
             K A  QE+
Sbjct  387   KVAEGQES  394



>gb|KHN23882.1| Cell division protein FtsZ like 1, chloroplastic [Glycine soja]
Length=418

 Score =   507 bits (1306),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 317/368 (86%), Positives = 338/368 (92%), Gaps = 8/368 (2%)
 Frame = -3

Query  1335  SFIPRQCISSGYASRRKSLFHQRRF-SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSG  1159
             SF PR   ++  A +R S    RRF SVRCS+  +D+AKIKVVG+GGGGNNAVNRMIGSG
Sbjct  34    SFKPR---TTKIAPQRLS----RRFGSVRCSYAYVDNAKIKVVGIGGGGNNAVNRMIGSG  86

Query  1158  LQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALK  979
             LQGVDFYAINTDAQ+LL SAA+ PI+IGE+LTRGLGTGGNPLLGEQAAEES++AIA+ALK
Sbjct  87    LQGVDFYAINTDAQALLNSAAENPIKIGEVLTRGLGTGGNPLLGEQAAEESRDAIADALK  146

Query  978   GSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKL  799
             GSD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKR LQA EAIE+L
Sbjct  147   GSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRCLQAFEAIERL  206

Query  798   QKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADV  619
             QKNVDTLIVIPNDRLLDIADEQ PLQDAF LADDVLRQGVQGISDIIT+PGLVNVDFADV
Sbjct  207   QKNVDTLIVIPNDRLLDIADEQMPLQDAFRLADDVLRQGVQGISDIITVPGLVNVDFADV  266

Query  618   KAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQE  439
             KAVMKDSGTAMLGVGVSS KNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQE
Sbjct  267   KAVMKDSGTAMLGVGVSSGKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQE  326

Query  438   VNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGD  259
             VNRVSQVVTSLADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+ LLTDPR AK  D
Sbjct  327   VNRVSQVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKKLLTDPRAAKLLD  386

Query  258   KGAGSQEN  235
             K A  QE+
Sbjct  387   KVAEGQES  394



>gb|EYU33680.1| hypothetical protein MIMGU_mgv1a008311mg [Erythranthe guttata]
Length=378

 Score =   505 bits (1301),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 306/335 (91%), Positives = 318/335 (95%), Gaps = 3/335 (1%)
 Frame = -3

Query  1293  RRKSLFHQRRF---SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTD  1123
             RRKS  + +R     V CSFIPMD+A+IKV+GVGGGGNNAVNRMIGSGLQGVDFYA+NTD
Sbjct  42    RRKSFGNDKRRRSGGVYCSFIPMDTARIKVIGVGGGGNNAVNRMIGSGLQGVDFYAVNTD  101

Query  1122  AQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmg  943
             AQ+LLQS A+ PIQIGELLTRGLGTGGNPLLGEQAAEESKE+IANALKGSDMVFITAGMG
Sbjct  102   AQALLQSVAENPIQIGELLTRGLGTGGNPLLGEQAAEESKESIANALKGSDMVFITAGMG  161

Query  942   ggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPN  763
             GGTGSGAAP+VAQI+KEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPN
Sbjct  162   GGTGSGAAPIVAQIAKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPN  221

Query  762   DRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAML  583
             DRLLDIADE TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAML
Sbjct  222   DRLLDIADEHTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAML  281

Query  582   GVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLA  403
             GVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLA
Sbjct  282   GVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLA  341

Query  402   DPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQR  298
             DPSANII GAVVDERYNGEIHVTIIATG    F+R
Sbjct  342   DPSANIISGAVVDERYNGEIHVTIIATGLHSRFRR  376



>ref|XP_010913967.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Elaeis guineensis]
Length=411

 Score =   506 bits (1303),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 314/375 (84%), Positives = 339/375 (90%), Gaps = 13/375 (3%)
 Frame = -3

Query  1344  APSSFIPRQCISSGYASRRKSLFHQRRFSVRCS---FIPMDSAKIKvvgvggggnnavNR  1174
             APS   PR   + G   RR++   +   +VRCS   F P+DSA+IKVVGVGGGGNNAVNR
Sbjct  24    APS---PRGLSAVG---RRRASLWRGGSTVRCSYSSFAPVDSARIKVVGVGGGGNNAVNR  77

Query  1173  MIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAI  994
             MIGSGLQGV+FYAINTDAQ+LL S A+ P+QIGELLTRGLGTGGNPLLGEQAAEESKE I
Sbjct  78    MIGSGLQGVEFYAINTDAQALLHSQAKNPLQIGELLTRGLGTGGNPLLGEQAAEESKEVI  137

Query  993   ANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALE  814
             ANALK SD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALE
Sbjct  138   ANALKDSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALE  197

Query  813   AIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNV  634
             AIEKLQK+VDTLI+IPNDRLLD+ DE TPLQDAFLLADDVLRQGVQGISDIITIPGLVNV
Sbjct  198   AIEKLQKSVDTLIIIPNDRLLDVVDEHTPLQDAFLLADDVLRQGVQGISDIITIPGLVNV  257

Query  633   DFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKD  454
             DFADVKAVMK+SGTAMLGVGVSSSKNRA+EAAEQATLAPLIGSSI+SATGVVYNITGGKD
Sbjct  258   DFADVKAVMKNSGTAMLGVGVSSSKNRAQEAAEQATLAPLIGSSIESATGVVYNITGGKD  317

Query  453   ITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRG  274
             ITLQEVNRVSQVVTSLADPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLLT+P+ 
Sbjct  318   ITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLTNPKA  377

Query  273   AKAGDKGAGSQENAG  229
             AK  D    ++EN G
Sbjct  378   AKIVD----ARENKG  388



>ref|XP_003617666.1| FtsZ protein [Medicago truncatula]
Length=420

 Score =   505 bits (1301),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 314/348 (90%), Positives = 329/348 (95%), Gaps = 3/348 (1%)
 Frame = -3

Query  1269  RRF-SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQ  1093
             RRF SV+CS   +D+AKIKVVG+GGGGNNAVNRMIGSGLQGVDFYAINTDAQ+LL SAA+
Sbjct  45    RRFGSVKCSLAYVDNAKIKVVGIGGGGNNAVNRMIGSGLQGVDFYAINTDAQALLHSAAE  104

Query  1092  TPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPV  913
              PI+IGELLTRGLGTGGNPLLGEQAAEESKEAIA+ALKGSD+VFITAGMGGGTGSGAAPV
Sbjct  105   NPIKIGELLTRGLGTGGNPLLGEQAAEESKEAIADALKGSDLVFITAGMGGGTGSGAAPV  164

Query  912   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQA--LEAIEKLQKNVDTLIVIPNDRLLDIAD  739
             VAQISKEAGYLTVGVVTYPFSFEGRKRSLQA  LEAIEKLQ+NVDTLIVIPNDRLLDIAD
Sbjct  165   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQAGALEAIEKLQRNVDTLIVIPNDRLLDIAD  224

Query  738   EQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSK  559
             EQ PLQDAF LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSS K
Sbjct  225   EQMPLQDAFRLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSGK  284

Query  558   NRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIF  379
             NRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIF
Sbjct  285   NRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIF  344

Query  378   GAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             GAVVD+RY GEIHVTIIATGF+QSFQ+ LLTDPR AK  DK A  +E+
Sbjct  345   GAVVDDRYTGEIHVTIIATGFSQSFQKKLLTDPRAAKLLDKVAEGKES  392



>dbj|BAG97403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61856.1| hypothetical protein OsJ_16530 [Oryza sativa Japonica Group]
Length=402

 Score =   500 bits (1288),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 294/336 (88%), Positives = 321/336 (96%), Gaps = 0/336 (0%)
 Frame = -3

Query  1275  HQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAA  1096
              +R  SVRCSF P+++A+IKVVGVGGGGNNAVNRMIGSGLQG++FYAINTD+Q+LL S A
Sbjct  32    RRRHASVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALLNSQA  91

Query  1095  QTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAP  916
             Q P+QIGE LTRGLGTGGNP LGEQAAEESKEAIANALK SD+VFITAGMGGGTGSGAAP
Sbjct  92    QYPLQIGEQLTRGLGTGGNPNLGEQAAEESKEAIANALKDSDLVFITAGMGGGTGSGAAP  151

Query  915   VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADE  736
             VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEA+EKL+++VDTLIVIPNDRLLD+ DE
Sbjct  152   VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEALEKLERSVDTLIVIPNDRLLDVVDE  211

Query  735   QTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKN  556
              TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLGVGVSSSKN
Sbjct  212   NTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGVGVSSSKN  271

Query  555   RAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFG  376
             RA+EAAEQATLAPLIGSSI++ATGVVYNITGGKDITLQEVN+VSQ+VTSLADPSANIIFG
Sbjct  272   RAQEAAEQATLAPLIGSSIEAATGVVYNITGGKDITLQEVNKVSQIVTSLADPSANIIFG  331

Query  375   AVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             AVVD+RY GEIHVTIIATGF QSFQ++LL DP+GA+
Sbjct  332   AVVDDRYTGEIHVTIIATGFPQSFQKSLLADPKGAR  367



>ref|XP_011095476.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Sesamum indicum]
Length=408

 Score =   499 bits (1284),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 300/345 (87%), Positives = 322/345 (93%), Gaps = 0/345 (0%)
 Frame = -3

Query  1278  FHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSA  1099
             F +RR  V CS+IP  S KIKVVGVGGGGNNAVNRMIGSGLQG+DFYAINTDAQ+LLQS 
Sbjct  44    FKRRRGGVYCSYIPTGSTKIKVVGVGGGGNNAVNRMIGSGLQGMDFYAINTDAQTLLQSL  103

Query  1098  AQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaA  919
             A+ PIQIGE+LTRGLGTGG+PLLGEQAAEESKEAIANALKGSDMVFITAGMGGGTGSGAA
Sbjct  104   AKNPIQIGEVLTRGLGTGGSPLLGEQAAEESKEAIANALKGSDMVFITAGMGGGTGSGAA  163

Query  918   PVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIAD  739
             PVVAQ++K+AGYLTVGVVTYPFSFEG KRS+QALEAIEKLQKNVD LI+IPNDRLLDIAD
Sbjct  164   PVVAQVAKDAGYLTVGVVTYPFSFEGGKRSVQALEAIEKLQKNVDALIIIPNDRLLDIAD  223

Query  738   EQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSK  559
             E T L++AFLLADDVLRQGVQGISDII IPGLVNVDFADV+AV+KDSGTA+LGVG SSSK
Sbjct  224   EHTSLRNAFLLADDVLRQGVQGISDIINIPGLVNVDFADVRAVIKDSGTAILGVGTSSSK  283

Query  558   NRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIF  379
             NRAEEAAEQATLAPLIGSSIQSAT VVYNITGGKDITLQEVNRVSQVVTSLADPSANIIF
Sbjct  284   NRAEEAAEQATLAPLIGSSIQSATAVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIF  343

Query  378   GAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGS  244
             GAVVDE++NGEIHVT+IATGFTQS Q+T LTDP GAK  DK  G+
Sbjct  344   GAVVDEQFNGEIHVTLIATGFTQSTQKTFLTDPMGAKLADKITGN  388



>ref|XP_006839100.1| hypothetical protein AMTR_s00090p00136440 [Amborella trichopoda]
 gb|ERN01669.1| hypothetical protein AMTR_s00090p00136440 [Amborella trichopoda]
Length=409

 Score =   498 bits (1283),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 306/345 (89%), Positives = 324/345 (94%), Gaps = 5/345 (1%)
 Frame = -3

Query  1257  VRC-SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             V C SF PM+SAKIKVVGVGGGGNNAVNRMIGSGLQGV+FYAINTD+Q+L+ SAAQ P+Q
Sbjct  49    VSCLSFAPMESAKIKVVGVGGGGNNAVNRMIGSGLQGVEFYAINTDSQALVNSAAQNPLQ  108

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IGELLTRGLG GGNPLLGEQAAEESKEAIANALK SD+VFITAGMGGGTGSGAAPVVAQI
Sbjct  109   IGELLTRGLGIGGNPLLGEQAAEESKEAIANALKDSDLVFITAGMGGGTGSGAAPVVAQI  168

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             SK+AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQK VDTLIVIPNDRLL++ DEQTPLQ
Sbjct  169   SKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKCVDTLIVIPNDRLLEVVDEQTPLQ  228

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             DAFL ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA
Sbjct  229   DAFLFADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  288

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             AEQATLAPLIGSSI+SATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD+
Sbjct  289   AEQATLAPLIGSSIESATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDD  348

Query  360   RYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAGS  226
             RY GEIHVTIIATGF+Q+FQ+ LLTDP+ A+       SQE+ GS
Sbjct  349   RYTGEIHVTIIATGFSQTFQKILLTDPKAARI----LQSQESKGS  389



>ref|XP_009407904.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=416

 Score =   498 bits (1283),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 298/338 (88%), Positives = 323/338 (96%), Gaps = 3/338 (1%)
 Frame = -3

Query  1260  SVRCSF---IPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQT  1090
             +VRCSF   +P++SA+IKVVGVGGGGNNAVNRMIGSGLQGV+FYAINTD+Q+LL S AQ 
Sbjct  52    AVRCSFSPFVPVESARIKVVGVGGGGNNAVNRMIGSGLQGVEFYAINTDSQALLHSQAQN  111

Query  1089  PIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVV  910
             P+QIGE+LTRGLGTGGNPLLGEQAAEESKE IA+ALK SD+VFITAGMGGGTGSGAAPVV
Sbjct  112   PLQIGEVLTRGLGTGGNPLLGEQAAEESKETIASALKDSDLVFITAGMGGGTGSGAAPVV  171

Query  909   AQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQT  730
             AQIS++AGYLTVGVVTYPFSFEGRKRS+QALEAIEKLQK+VDTLIVIPNDRLLDI DE T
Sbjct  172   AQISRDAGYLTVGVVTYPFSFEGRKRSVQALEAIEKLQKSVDTLIVIPNDRLLDIVDEHT  231

Query  729   PLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRA  550
             PLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLGVGVSSSKNRA
Sbjct  232   PLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGVGVSSSKNRA  291

Query  549   EEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAV  370
             +EAAEQATLAPLIGSSI+SA G+VYNITGGKDITLQEVN+VSQVVTSLADPSANIIFGAV
Sbjct  292   QEAAEQATLAPLIGSSIESAMGIVYNITGGKDITLQEVNKVSQVVTSLADPSANIIFGAV  351

Query  369   VDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDK  256
             VD+RY+GEIHVTIIATGF+QSFQ+TLLTDPR AK  D 
Sbjct  352   VDDRYSGEIHVTIIATGFSQSFQKTLLTDPRSAKVADN  389



>ref|XP_008798743.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Phoenix dactylifera]
Length=411

 Score =   498 bits (1282),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 306/358 (85%), Positives = 331/358 (92%), Gaps = 7/358 (2%)
 Frame = -3

Query  1293  RRKSLFHQRRFSVRCS---FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTD  1123
             RR++   +   +VRCS   F P+DSA+IKVVGVGGGGNNAVNRMIGSGLQGV+FYAINTD
Sbjct  35    RRRAFRWRGGSTVRCSYSSFAPVDSARIKVVGVGGGGNNAVNRMIGSGLQGVEFYAINTD  94

Query  1122  AQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmg  943
             +Q+LL S A+ P+QIGELLTRGLGTGGNPLLGEQAAEESKEAIANALK SD+VFITAGMG
Sbjct  95    SQALLLSQAKNPLQIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKDSDLVFITAGMG  154

Query  942   ggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPN  763
             GGTGSGAAPVVAQ+SKEAGYLTVGVVTYPFSFEGRKRS QALEAIEKLQK+VDTLI+IPN
Sbjct  155   GGTGSGAAPVVAQVSKEAGYLTVGVVTYPFSFEGRKRSSQALEAIEKLQKSVDTLIIIPN  214

Query  762   DRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAML  583
             DRLLD+ DE TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAML
Sbjct  215   DRLLDVVDEHTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAML  274

Query  582   GVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLA  403
             GVGVSSSKNRA+EAAEQATLAPLIGSSI+SATGVVYNITGGKDITLQEVNRVSQVVTSLA
Sbjct  275   GVGVSSSKNRAQEAAEQATLAPLIGSSIESATGVVYNITGGKDITLQEVNRVSQVVTSLA  334

Query  402   DPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             DPSANIIFGAVVD+RY GEIHVTIIATGF+QSFQ+TLLT+P  AK  D    ++EN G
Sbjct  335   DPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLTNPDPAKFVD----ARENKG  388



>ref|NP_001149695.1| LOC100283321 [Zea mays]
 gb|ACG36412.1| cell division protein ftsZ [Zea mays]
Length=405

 Score =   496 bits (1277),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 296/360 (82%), Positives = 329/360 (91%), Gaps = 4/360 (1%)
 Frame = -3

Query  1347  RAPSSFIPRQCISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMI  1168
             R P S   R    SG+   R+S    RR +VRCSF P+++A+IKVVGVGGGGNNAVNRMI
Sbjct  16    RLPGSGHLRAPPRSGWRDHRRS----RRATVRCSFAPVETARIKVVGVGGGGNNAVNRMI  71

Query  1167  GSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIAN  988
             GSGLQG++FYAINTD+Q+L+ S AQ P+QIGE LTRGLGTGGNP LGEQAAEES+E IA 
Sbjct  72    GSGLQGIEFYAINTDSQALINSQAQYPLQIGEQLTRGLGTGGNPNLGEQAAEESRETIAT  131

Query  987   ALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAI  808
             AL+ SD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRS+QALEA+
Sbjct  132   ALRDSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSVQALEAL  191

Query  807   EKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDF  628
             EKL+K+VDTLIVIPND+LLD+ADE  PLQDAFLLADDVLRQGVQGISDIITIPGLVNVDF
Sbjct  192   EKLEKSVDTLIVIPNDKLLDVADENMPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDF  251

Query  627   ADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDIT  448
             ADVKAVMK+SGTAMLGVGVSSSKNRA+EAAEQATLAPLIGSSI++ATGVVYNITGGKDIT
Sbjct  252   ADVKAVMKNSGTAMLGVGVSSSKNRAQEAAEQATLAPLIGSSIEAATGVVYNITGGKDIT  311

Query  447   LQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             LQEVN+VSQ+VTSLADPSANIIFGAVVD+RY GEIHVTIIATGF QSFQ++LL DP+GA+
Sbjct  312   LQEVNKVSQIVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFPQSFQKSLLADPKGAR  371



>gb|ACF85277.1| unknown [Zea mays]
 tpg|DAA35501.1| TPA: cell division protein ftsZ [Zea mays]
Length=405

 Score =   496 bits (1277),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 295/360 (82%), Positives = 328/360 (91%), Gaps = 4/360 (1%)
 Frame = -3

Query  1347  RAPSSFIPRQCISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMI  1168
             R P S   R    SG+   R+S    RR +VRCSF P+++A+IKVVGVGGGGNNAVNRMI
Sbjct  16    RLPGSGHLRAPPRSGWRDHRRS----RRATVRCSFAPVETARIKVVGVGGGGNNAVNRMI  71

Query  1167  GSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIAN  988
             GSGLQG++FYAINTD+Q+L+ S AQ P+QIGE LTRGLG GGNP LGEQAAEES+E IA 
Sbjct  72    GSGLQGIEFYAINTDSQALINSQAQYPLQIGEQLTRGLGAGGNPNLGEQAAEESRETIAT  131

Query  987   ALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAI  808
             AL+ SD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRS+QALEA+
Sbjct  132   ALRDSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSVQALEAL  191

Query  807   EKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDF  628
             EKL+K+VDTLIVIPND+LLD+ADE  PLQDAFLLADDVLRQGVQGISDIITIPGLVNVDF
Sbjct  192   EKLEKSVDTLIVIPNDKLLDVADENMPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDF  251

Query  627   ADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDIT  448
             ADVKAVMK+SGTAMLGVGVSSSKNRA+EAAEQATLAPLIGSSI++ATGVVYNITGGKDIT
Sbjct  252   ADVKAVMKNSGTAMLGVGVSSSKNRAQEAAEQATLAPLIGSSIEAATGVVYNITGGKDIT  311

Query  447   LQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             LQEVN+VSQ+VTSLADPSANIIFGAVVD+RY GEIHVTIIATGF QSFQ++LL DP+GA+
Sbjct  312   LQEVNKVSQIVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFPQSFQKSLLADPKGAR  371



>ref|NP_001054176.1| Os04g0665400 [Oryza sativa Japonica Group]
 gb|AAK64282.1|AF383876_1 plastid division protein FtsZ [Oryza sativa]
 emb|CAE03583.1| OSJNBa0087O24.6 [Oryza sativa Japonica Group]
 dbj|BAF16090.1| Os04g0665400 [Oryza sativa Japonica Group]
 emb|CAH65978.1| H1005F08.7 [Oryza sativa Indica Group]
Length=404

 Score =   496 bits (1276),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 294/338 (87%), Positives = 321/338 (95%), Gaps = 2/338 (1%)
 Frame = -3

Query  1275  HQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAA  1096
              +R  SVRCSF P+++A+IKVVGVGGGGNNAVNRMIGSGLQG++FYAINTD+Q+LL S A
Sbjct  32    RRRHASVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALLNSQA  91

Query  1095  QTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAP  916
             Q P+QIGE LTRGLGTGGNP LGEQAAEESKEAIANALK SD+VFITAGMGGGTGSGAAP
Sbjct  92    QYPLQIGEQLTRGLGTGGNPNLGEQAAEESKEAIANALKDSDLVFITAGMGGGTGSGAAP  151

Query  915   VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQA--LEAIEKLQKNVDTLIVIPNDRLLDIA  742
             VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQA  LEA+EKL+++VDTLIVIPNDRLLD+ 
Sbjct  152   VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQASALEALEKLERSVDTLIVIPNDRLLDVV  211

Query  741   DEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSS  562
             DE TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLGVGVSSS
Sbjct  212   DENTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGVGVSSS  271

Query  561   KNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANII  382
             KNRA+EAAEQATLAPLIGSSI++ATGVVYNITGGKDITLQEVN+VSQ+VTSLADPSANII
Sbjct  272   KNRAQEAAEQATLAPLIGSSIEAATGVVYNITGGKDITLQEVNKVSQIVTSLADPSANII  331

Query  381   FGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             FGAVVD+RY GEIHVTIIATGF QSFQ++LL DP+GA+
Sbjct  332   FGAVVDDRYTGEIHVTIIATGFPQSFQKSLLADPKGAR  369



>ref|XP_004960200.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Setaria italica]
Length=406

 Score =   496 bits (1276),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 298/360 (83%), Positives = 330/360 (92%), Gaps = 12/360 (3%)
 Frame = -3

Query  1347  RAPSSFIPRQCISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMI  1168
             RAP    PR    SG+   R+     RR +VRCSF P+++A+IKVVGVGGGGNNAVNRMI
Sbjct  24    RAP----PR----SGWREHRQP----RRATVRCSFAPVETARIKVVGVGGGGNNAVNRMI  71

Query  1167  GSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIAN  988
             GSGLQG++FYAINTD+Q+L+ S AQ P+QIGE LTRGLGTGGNP LGEQAAEES+EAIA 
Sbjct  72    GSGLQGIEFYAINTDSQALITSQAQYPLQIGEQLTRGLGTGGNPNLGEQAAEESREAIAT  131

Query  987   ALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAI  808
             AL+ SD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEA+
Sbjct  132   ALRDSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAL  191

Query  807   EKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDF  628
             EKL+K+VDTLIVIPND+LLD+ADE  PLQDAFLLADDVLRQGVQGISDIITIPGLVNVDF
Sbjct  192   EKLEKSVDTLIVIPNDKLLDVADENMPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDF  251

Query  627   ADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDIT  448
             ADVKAVMK+SGTAMLGVGVSSSKNRA+EAAEQATLAPLIGSSI++ATGVVYNITGGKDIT
Sbjct  252   ADVKAVMKNSGTAMLGVGVSSSKNRAQEAAEQATLAPLIGSSIEAATGVVYNITGGKDIT  311

Query  447   LQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             LQEVN+VSQ+VTSLADPSANIIFGAVVD+RY GEIHVTIIATGF QSFQ++LL DP+GA+
Sbjct  312   LQEVNKVSQIVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFPQSFQKSLLADPKGAR  371



>ref|XP_002448714.1| hypothetical protein SORBIDRAFT_06g031950 [Sorghum bicolor]
 gb|EES13042.1| hypothetical protein SORBIDRAFT_06g031950 [Sorghum bicolor]
Length=405

 Score =   495 bits (1275),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 300/375 (80%), Positives = 334/375 (89%), Gaps = 8/375 (2%)
 Frame = -3

Query  1347  RAPSSFIPRQCISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMI  1168
             R P     R    SG+   R+     RR  VRCSF P+++A+IKVVGVGGGGNNAVNRMI
Sbjct  16    RLPGPGHLRALPRSGWRDHRRP----RRAIVRCSFAPVETARIKVVGVGGGGNNAVNRMI  71

Query  1167  GSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIAN  988
             GSGLQG++FYAINTD+Q+L+ S AQ P+QIGE LTRGLGTGGNP LGEQAAEES+EAIA 
Sbjct  72    GSGLQGIEFYAINTDSQALINSQAQYPLQIGEQLTRGLGTGGNPNLGEQAAEESREAIAT  131

Query  987   ALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAI  808
             AL+ SD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEA+
Sbjct  132   ALRDSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAL  191

Query  807   EKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDF  628
             EKL+K+VDTLIVIPND+LLD+ADE  PLQDAFLLADDVLRQGVQGISDIITIPGLVNVDF
Sbjct  192   EKLEKSVDTLIVIPNDKLLDVADENMPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDF  251

Query  627   ADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDIT  448
             ADVKAVMK+SGTAMLGVGVSSSKNRA+EAAEQATLAPLIGSSI++ATGVVYNITGGKDIT
Sbjct  252   ADVKAVMKNSGTAMLGVGVSSSKNRAQEAAEQATLAPLIGSSIEAATGVVYNITGGKDIT  311

Query  447   LQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             LQEVN+VSQ+VTSLADPSANIIFGAVVD+RY GEIHVTIIATGF QSFQ++LL DP+GA+
Sbjct  312   LQEVNKVSQIVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFPQSFQKSLLADPKGAR  371

Query  267   AGDKGAGSQENAGSL  223
               +    S+E A +L
Sbjct  372   IVE----SKEKAATL  382



>ref|XP_006652974.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Oryza brachyantha]
Length=405

 Score =   495 bits (1274),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 292/331 (88%), Positives = 319/331 (96%), Gaps = 0/331 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             SVRCSF P+++A+IKVVGVGGGGNNAVNRMIGSGLQG++FYAINTD+Q+LL S AQ P+Q
Sbjct  40    SVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALLNSQAQYPLQ  99

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IGE LTRGLGTGGNP LGEQAAEESKEAIANALK SD+VFITAGMGGGTGSGAAPVVAQI
Sbjct  100   IGEQLTRGLGTGGNPNLGEQAAEESKEAIANALKDSDLVFITAGMGGGTGSGAAPVVAQI  159

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             SKEAGYLTVGVVTYPFSFEGRKRSLQALEA+EKL+++VDTLIVIPNDRLLD+ D+ TPLQ
Sbjct  160   SKEAGYLTVGVVTYPFSFEGRKRSLQALEALEKLERSVDTLIVIPNDRLLDVVDDNTPLQ  219

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLGVGVSSSKNRA+EA
Sbjct  220   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGVGVSSSKNRAQEA  279

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             AEQATLAPLIGSSI++ATGVVYNITGGKDITLQEVN+VSQ+VTSLADPSANIIFGAVVD+
Sbjct  280   AEQATLAPLIGSSIEAATGVVYNITGGKDITLQEVNKVSQIVTSLADPSANIIFGAVVDD  339

Query  360   RYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             RY GEIHVTIIATGF QSFQ++LL DP+GA+
Sbjct  340   RYTGEIHVTIIATGFPQSFQKSLLADPKGAR  370



>ref|XP_010928878.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=410

 Score =   494 bits (1273),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 303/359 (84%), Positives = 330/359 (92%), Gaps = 7/359 (2%)
 Frame = -3

Query  1326  PRQCISSGYASRRKSLFHQRRFS-VRCS--FIPMDSAKIKvvgvggggnnavNRMIGSGL  1156
             PR+   +G    R+ + H+R  S ++CS   + +D+A+I+VVGVGGGGNNAVNRMIGSGL
Sbjct  27    PRELAPAG----RRRVSHRREGSALQCSNSSVSVDAARIRVVGVGGGGNNAVNRMIGSGL  82

Query  1155  QGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKG  976
             QGV+FYAINTDAQ+LL S A+ P+QIGELLTRGLGTGGNPLLGEQAAEESKE IANALK 
Sbjct  83    QGVEFYAINTDAQALLHSQAKNPLQIGELLTRGLGTGGNPLLGEQAAEESKEGIANALKD  142

Query  975   SDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ  796
             SD+VFITAGMGGGTGSGA PVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ
Sbjct  143   SDLVFITAGMGGGTGSGATPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQ  202

Query  795   KNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVK  616
             K+VDTLIVIPNDRLLD+A+E TPLQDAFLLADD+LRQGVQGISDIITIPGLVNVDFADVK
Sbjct  203   KSVDTLIVIPNDRLLDVANEHTPLQDAFLLADDILRQGVQGISDIITIPGLVNVDFADVK  262

Query  615   AVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEV  436
             AVMK+SGTAMLGVGVSSSKNRA+EAAEQATLAPLIGSSI+SATGVVYNITGG DITLQEV
Sbjct  263   AVMKNSGTAMLGVGVSSSKNRAQEAAEQATLAPLIGSSIESATGVVYNITGGNDITLQEV  322

Query  435   NRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGD  259
             NRVSQVVTSLADPSANIIFGAVVD+RY GEIHVTIIATGF QSFQ+TLLTDP+ AK  D
Sbjct  323   NRVSQVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFPQSFQKTLLTDPKAAKNVD  381



>gb|AEV40936.1| putative tubulin/FtsZ domain-containing protein [Oryza punctata]
Length=407

 Score =   493 bits (1269),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 293/333 (88%), Positives = 319/333 (96%), Gaps = 2/333 (1%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             SVRCSF P+++A+IKVVGVGGGGNNAVNRMIGSGLQG++FYAINTD+Q+LL S AQ P+Q
Sbjct  40    SVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALLNSQAQYPLQ  99

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IGE LTRGLGTGGNP LGEQAAEESKEAIANALK SD+VFITAGMGGGTGSGAAPVVAQI
Sbjct  100   IGEQLTRGLGTGGNPNLGEQAAEESKEAIANALKDSDLVFITAGMGGGTGSGAAPVVAQI  159

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQA--LEAIEKLQKNVDTLIVIPNDRLLDIADEQTP  727
             SKEAGYLTVGVVTYPFSFEGRKRSLQA  LEA+EKL+++VDTLIVIPNDRLLD+ DE TP
Sbjct  160   SKEAGYLTVGVVTYPFSFEGRKRSLQASALEALEKLERSVDTLIVIPNDRLLDVVDENTP  219

Query  726   LQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAE  547
             LQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLGVGVSSSKNRA+
Sbjct  220   LQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGVGVSSSKNRAQ  279

Query  546   EAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVV  367
             EAAEQATLAPLIGSSI++ATGVVYNITGGKDITLQEVN+VSQ+VTSLADPSANIIFGAVV
Sbjct  280   EAAEQATLAPLIGSSIEAATGVVYNITGGKDITLQEVNKVSQIVTSLADPSANIIFGAVV  339

Query  366   DERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             D+RY GEIHVTIIATGF QSFQ++LL DP+GA+
Sbjct  340   DDRYTGEIHVTIIATGFPQSFQKSLLADPKGAR  372



>gb|KHG27532.1| Cell division FtsZ, chloroplastic -like protein [Gossypium arboreum]
Length=399

 Score =   490 bits (1261),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 305/352 (87%), Positives = 321/352 (91%), Gaps = 16/352 (5%)
 Frame = -3

Query  1281  LFHQRRFS-VRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQ  1105
             L  + RF  + CSF PM++AKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTD+Q+LLQ
Sbjct  39    LRTRHRFGGIACSFAPMETAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDSQALLQ  98

Query  1104  SAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsg  925
             SAA+ P+QIGELLTRGLGTGGNPLLGEQAAEES++AIANALKGSD+VFITAGMGGGTGSG
Sbjct  99    SAAENPLQIGELLTRGLGTGGNPLLGEQAAEESRDAIANALKGSDLVFITAGMGGGTGSG  158

Query  924   aAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDI  745
             AAPVVAQI+KEAGYLTVGV               ALEAIEKLQKNVDTLIVIPNDRLL I
Sbjct  159   AAPVVAQIAKEAGYLTVGV---------------ALEAIEKLQKNVDTLIVIPNDRLLGI  203

Query  744   ADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSS  565
             ADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSS
Sbjct  204   ADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSS  263

Query  564   SKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANI  385
             SKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANI
Sbjct  264   SKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANI  323

Query  384   IFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             IFGAVVD+RYNGEIHVTIIATGF+QSFQ+TLLTDP+ AK  DK AG QE  G
Sbjct  324   IFGAVVDDRYNGEIHVTIIATGFSQSFQKTLLTDPKAAKQNDKVAGGQERKG  375



>ref|XP_004251908.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X2 [Solanum lycopersicum]
Length=419

 Score =   489 bits (1260),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 317/399 (79%), Positives = 347/399 (87%), Gaps = 6/399 (2%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVR  1252
             MA+LG +N  ++ ++S +S   L F+ K   SS +P Q       +RRK L+ + RFS+ 
Sbjct  1     MAVLGLSNRGDILSSSSNS---LEFYHKIHSSS-VPTQWFPP--RTRRKILYKRHRFSIS  54

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
              S    +SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY++NTD Q+L QS A+ PIQIGE
Sbjct  55    SSLSSKNSAKIKVIGVGGGGNNAVNRMIDSGLQGVDFYSMNTDTQALSQSTAENPIQIGE  114

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
             LLTRGLGTGGNPLLGEQAAEESKE IANALKGSDMVFITAGMGGGTGSGAAPVVAQI+KE
Sbjct  115   LLTRGLGTGGNPLLGEQAAEESKEGIANALKGSDMVFITAGMGGGTGSGAAPVVAQIAKE  174

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
             AGYLTVGVVTYPFSFEGRKRSLQALEAI+KLQKNVDTLIVI NDRLLDIADEQTPLQ+AF
Sbjct  175   AGYLTVGVVTYPFSFEGRKRSLQALEAIKKLQKNVDTLIVIHNDRLLDIADEQTPLQNAF  234

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
             LLADDVL QGVQGISDIITIPGLVNVDFADVKA+MK+SGTAMLGVG SSS+NRAEEAAEQ
Sbjct  235   LLADDVLCQGVQGISDIITIPGLVNVDFADVKAIMKNSGTAMLGVGASSSRNRAEEAAEQ  294

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             ATLAPLI SSIQSATG+VYNITGGKDITLQEVNRVSQVVTSLADPSANIIFG VVDER+N
Sbjct  295   ATLAPLIESSIQSATGIVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGVVVDERFN  354

Query  351   GEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             G IHVTIIATGFTQ FQ TLL +PRGAK  D   G+ E+
Sbjct  355   GGIHVTIIATGFTQPFQNTLLNNPRGAKLVDNSKGTTES  393



>dbj|BAJ85582.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=403

 Score =   488 bits (1255),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 298/371 (80%), Positives = 333/371 (90%), Gaps = 9/371 (2%)
 Frame = -3

Query  1326  PRQCISSGYASRRKSLFHQRRFSVRCSFI--PMDSAKIKvvgvggggnnavNRMIGSGLQ  1153
             PR+  S G    R      R  +V+CSF   P+++A+IKVVGVGGGGNNAVNRMIGSGLQ
Sbjct  19    PRRPHSGGC---RNQTRRPRHAAVQCSFAFAPVETARIKVVGVGGGGNNAVNRMIGSGLQ  75

Query  1152  GVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGS  973
             G++FYAINTD+Q+L+ S AQ P+QIGE LTRGLGTGGNP LGEQAAEESKE IANAL+ S
Sbjct  76    GIEFYAINTDSQALVNSQAQHPLQIGEQLTRGLGTGGNPNLGEQAAEESKEVIANALRDS  135

Query  972   DMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQK  793
             D+VFITAGMGGGTGSGAAPVVAQI+KEAGYLTVGVVT+PFSFEGRKRSLQALEA+EKL++
Sbjct  136   DLVFITAGMGGGTGSGAAPVVAQIAKEAGYLTVGVVTHPFSFEGRKRSLQALEALEKLER  195

Query  792   NVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKA  613
             +VDTLIVIPNDRLLDIADE  PLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKA
Sbjct  196   SVDTLIVIPNDRLLDIADENMPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKA  255

Query  612   VMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVN  433
             VMK+SGTAMLGVGVSSSKNRA+EAAEQATLAPLIGSSI++ATGVVYNITGGKDITLQEVN
Sbjct  256   VMKNSGTAMLGVGVSSSKNRAQEAAEQATLAPLIGSSIEAATGVVYNITGGKDITLQEVN  315

Query  432   RVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKG  253
             +VSQ+VTSLADPSANII GAVVD+RYNGEIHVTIIATGF QSFQ++LL DP+GA+  +  
Sbjct  316   KVSQIVTSLADPSANIILGAVVDDRYNGEIHVTIIATGFPQSFQKSLLADPKGARILE--  373

Query  252   AGSQENAGSLV  220
               ++E A SLV
Sbjct  374   --AKEKAASLV  382



>ref|XP_003580765.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Brachypodium distachyon]
Length=405

 Score =   485 bits (1248),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 288/332 (87%), Positives = 317/332 (95%), Gaps = 2/332 (1%)
 Frame = -3

Query  1257  VRCSFI--PMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPI  1084
             VRCSF   P+++A+IKVVGVGGGGNNAVNRMIGSGLQG++FYAINTD+Q+L+ S AQ P+
Sbjct  43    VRCSFAFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALVNSQAQHPL  102

Query  1083  QIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQ  904
             QIGE LTRGLGTGGNP LGEQAAEESKE IANAL+ SD+VFITAGMGGGTGSGAAPVVAQ
Sbjct  103   QIGEQLTRGLGTGGNPNLGEQAAEESKEVIANALRDSDLVFITAGMGGGTGSGAAPVVAQ  162

Query  903   ISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPL  724
             I+KEAGYLTVGVVTYPFSFEGRKRSLQALEA+EKL+++VDTLIVIPNDRLLD+ADE  PL
Sbjct  163   IAKEAGYLTVGVVTYPFSFEGRKRSLQALEALEKLERSVDTLIVIPNDRLLDVADENMPL  222

Query  723   QDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEE  544
             QDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLGVGVSSSKNRA+E
Sbjct  223   QDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGVGVSSSKNRAQE  282

Query  543   AAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVD  364
             AAEQATLAPLIGSSI++ATGVVYNITGGKDITLQEVN+VSQ+VTSLADPSANIIFGAVVD
Sbjct  283   AAEQATLAPLIGSSIEAATGVVYNITGGKDITLQEVNKVSQIVTSLADPSANIIFGAVVD  342

Query  363   ERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             +RY GEIHVTIIATGF QSFQ++LL DP+GA+
Sbjct  343   DRYTGEIHVTIIATGFPQSFQKSLLADPKGAR  374



>ref|XP_008782917.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Phoenix dactylifera]
Length=411

 Score =   482 bits (1240),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 301/360 (84%), Positives = 327/360 (91%), Gaps = 7/360 (2%)
 Frame = -3

Query  1299  ASRRKSLFHQRRFSVRCSFIPMDS---AKIKvvgvggggnnavNRMIGSGLQGVDFYAIN  1129
             A RR++   +R  +++CS+    S   A+IKVVGVGGGGNNAVNRMIGSGL+GV+FYAIN
Sbjct  33    ADRRRASHWRRGLTLQCSYSSSASVDSARIKVVGVGGGGNNAVNRMIGSGLEGVEFYAIN  92

Query  1128  TDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItag  949
             TDAQ+LL S A+ P+QIGELLTRGLGTGGNPLLGEQAAEESKEAIANALK S++VF+TAG
Sbjct  93    TDAQALLHSQAKNPLQIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKDSELVFVTAG  152

Query  948   mgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVI  769
             MGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL+AIEKLQK+VDTLIVI
Sbjct  153   MGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALKAIEKLQKSVDTLIVI  212

Query  768   PNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTA  589
             PNDRLLD+ DE TPLQDAFLLADDVLRQGVQGISDII IPGLVNVDFADVKAVMK+SGTA
Sbjct  213   PNDRLLDVVDEHTPLQDAFLLADDVLRQGVQGISDIILIPGLVNVDFADVKAVMKNSGTA  272

Query  588   MLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTS  409
             MLG+GVSSSKNRA EAAEQA  APLIGSSI+SATGVVYNITGGKDITLQEVNRVSQVVTS
Sbjct  273   MLGLGVSSSKNRALEAAEQAIFAPLIGSSIESATGVVYNITGGKDITLQEVNRVSQVVTS  332

Query  408   LADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             LADPSANIIFGAVVD+RY GEIHVTIIATGF QSFQ+TLLTDP+ AKA D     +EN G
Sbjct  333   LADPSANIIFGAVVDDRYTGEIHVTIIATGFPQSFQKTLLTDPKVAKAVD----VRENKG  388



>ref|XP_010313930.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
Length=429

 Score =   482 bits (1241),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 312/409 (76%), Positives = 342/409 (84%), Gaps = 16/409 (4%)
 Frame = -3

Query  1431  MAMLGFANPAEVsaaspsssaSLGFHQKRAPSSFIPRQCISSGYASRRKSLFHQRRFSVR  1252
             MA+LG +N  ++ ++S +S   L F+ K   SS +P Q       +RRK L+ + RFS+ 
Sbjct  1     MAVLGLSNRGDILSSSSNS---LEFYHKIHSSS-VPTQWFPP--RTRRKILYKRHRFSIS  54

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
              S    +SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY++NTD Q+L QS A+ PIQIGE
Sbjct  55    SSLSSKNSAKIKVIGVGGGGNNAVNRMIDSGLQGVDFYSMNTDTQALSQSTAENPIQIGE  114

Query  1071  lltrglgtggnp----------llgEQAAEESKEAIANALKGSDMVFItagmgggtgsga  922
             LLTRGLG               LLGEQAAEESKE IANALKGSDMVFITAGMGGGTGSGA
Sbjct  115   LLTRGLGLHLLVFLDAGTGGNPLLGEQAAEESKEGIANALKGSDMVFITAGMGGGTGSGA  174

Query  921   APVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIA  742
             APVVAQI+KEAGYLTVGVVTYPFSFEGRKRSLQALEAI+KLQKNVDTLIVI NDRLLDIA
Sbjct  175   APVVAQIAKEAGYLTVGVVTYPFSFEGRKRSLQALEAIKKLQKNVDTLIVIHNDRLLDIA  234

Query  741   DEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSS  562
             DEQTPLQ+AFLLADDVL QGVQGISDIITIPGLVNVDFADVKA+MK+SGTAMLGVG SSS
Sbjct  235   DEQTPLQNAFLLADDVLCQGVQGISDIITIPGLVNVDFADVKAIMKNSGTAMLGVGASSS  294

Query  561   KNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANII  382
             +NRAEEAAEQATLAPLI SSIQSATG+VYNITGGKDITLQEVNRVSQVVTSLADPSANII
Sbjct  295   RNRAEEAAEQATLAPLIESSIQSATGIVYNITGGKDITLQEVNRVSQVVTSLADPSANII  354

Query  381   FGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQEN  235
             FG VVDER+NG IHVTIIATGFTQ FQ TLL +PRGAK  D   G+ E+
Sbjct  355   FGVVVDERFNGGIHVTIIATGFTQPFQNTLLNNPRGAKLVDNSKGTTES  403



>gb|KHG00460.1| Cell division FtsZ, chloroplastic -like protein [Gossypium arboreum]
Length=400

 Score =   479 bits (1234),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 300/356 (84%), Positives = 318/356 (89%), Gaps = 16/356 (4%)
 Frame = -3

Query  1293  RRKSLFHQRRFS-VRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQ  1117
             +R S     RF  + CSF  M++AKIKVVGVGGGGNNAVNRMIGS LQGVDFYA+NTD+Q
Sbjct  36    KRSSFCTYHRFGRISCSFASMETAKIKVVGVGGGGNNAVNRMIGSSLQGVDFYAVNTDSQ  95

Query  1116  SLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmggg  937
             +LLQS+A+ P+QIGELLTRGLGTGGNPLLGEQAAEES +AIANALKGSD+VFITAGMGGG
Sbjct  96    ALLQSSAENPLQIGELLTRGLGTGGNPLLGEQAAEESADAIANALKGSDLVFITAGMGGG  155

Query  936   tgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDR  757
             TGSGAAPVVAQI+KEAGYLTVGV               ALEAIEKLQKNVDTLIVIPNDR
Sbjct  156   TGSGAAPVVAQIAKEAGYLTVGV---------------ALEAIEKLQKNVDTLIVIPNDR  200

Query  756   LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV  577
             LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV
Sbjct  201   LLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGV  260

Query  576   GVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP  397
             GVSSSKNRA EAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP
Sbjct  261   GVSSSKNRAVEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADP  320

Query  396   SANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKAGDKGAGSQENAG  229
             SANIIFGAVVD+RYNGEIHVTIIATGF+QSFQ+TLLTDP+ AK  DK    QE+ G
Sbjct  321   SANIIFGAVVDDRYNGEIHVTIIATGFSQSFQKTLLTDPKAAKQIDKATMGQESKG  376



>ref|XP_008668017.1| PREDICTED: LOC100283321 isoform X1 [Zea mays]
Length=344

 Score =   455 bits (1170),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 258/302 (85%), Positives = 285/302 (94%), Gaps = 1/302 (0%)
 Frame = -3

Query  1170  IGSGLQ-GVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAI  994
             I +GL  G++FYAINTD+Q+L+ S AQ P+QIGE LTRGLG GGNP LGEQAAEES+E I
Sbjct  9     ISTGLWMGIEFYAINTDSQALINSQAQYPLQIGEQLTRGLGAGGNPNLGEQAAEESRETI  68

Query  993   ANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALE  814
             A AL+ SD+VFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRS+QALE
Sbjct  69    ATALRDSDLVFITAGMGGGTGSGAAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSVQALE  128

Query  813   AIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNV  634
             A+EKL+K+VDTLIVIPND+LLD+ADE  PLQDAFLLADDVLRQGVQGISDIITIPGLVNV
Sbjct  129   ALEKLEKSVDTLIVIPNDKLLDVADENMPLQDAFLLADDVLRQGVQGISDIITIPGLVNV  188

Query  633   DFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKD  454
             DFADVKAVMK+SGTAMLGVGVSSSKNRA+EAAEQATLAPLIGSSI++ATGVVYNITGGKD
Sbjct  189   DFADVKAVMKNSGTAMLGVGVSSSKNRAQEAAEQATLAPLIGSSIEAATGVVYNITGGKD  248

Query  453   ITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRG  274
             ITLQEVN+VSQ+VTSLADPSANIIFGAVVD+RY GEIHVTIIATGF QSFQ++LL DP+G
Sbjct  249   ITLQEVNKVSQIVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFPQSFQKSLLADPKG  308

Query  273   AK  268
             A+
Sbjct  309   AR  310



>gb|EMT28400.1| Cell division protein ftsZ-like protein, chloroplastic [Aegilops 
tauschii]
Length=477

 Score =   460 bits (1183),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 260/295 (88%), Positives = 284/295 (96%), Gaps = 0/295 (0%)
 Frame = -3

Query  1152  GVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGS  973
             G++FYAINTD+Q+L+ S AQ P+QIGE LTRGLGTGGNP LGEQAAEESKE IANAL+ S
Sbjct  142   GIEFYAINTDSQALVNSQAQHPLQIGEQLTRGLGTGGNPNLGEQAAEESKEVIANALRDS  201

Query  972   DMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQK  793
             D+VFITAGMGGGTGSGAAPVVAQI+KEAGYLTVGVVTYPFSFEGRKRSLQALEA+EKL++
Sbjct  202   DLVFITAGMGGGTGSGAAPVVAQIAKEAGYLTVGVVTYPFSFEGRKRSLQALEALEKLER  261

Query  792   NVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKA  613
             +VDTLIVIPNDRLLDIADE  PLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKA
Sbjct  262   SVDTLIVIPNDRLLDIADENMPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKA  321

Query  612   VMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVN  433
             VMK+SGTAMLGVGVSSSKNRA+EAAEQATLAPLIGSSI++ATGVVYNITGGKDITLQEVN
Sbjct  322   VMKNSGTAMLGVGVSSSKNRAQEAAEQATLAPLIGSSIEAATGVVYNITGGKDITLQEVN  381

Query  432   RVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             +VSQ+VTSLADPSANIIFGAVVD+RYNGEIHVTIIATGF QSFQ++LL DP+GA+
Sbjct  382   KVSQIVTSLADPSANIIFGAVVDDRYNGEIHVTIIATGFPQSFQKSLLADPKGAR  436



>gb|ACN40898.1| unknown [Picea sitchensis]
Length=439

 Score =   455 bits (1170),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 276/336 (82%), Positives = 307/336 (91%), Gaps = 3/336 (1%)
 Frame = -3

Query  1266  RFSVRCSFIP---MDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAA  1096
             R   R S+ P   M+SA+IKVVG+GGGGNNAVNRMI +GL GV+FYAINTDAQ+LLQSA 
Sbjct  74    RRVCRSSYSPFRQMESARIKVVGIGGGGNNAVNRMIAAGLHGVEFYAINTDAQALLQSAT  133

Query  1095  QTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAP  916
             + P+QIGE LTRGLGTGGNP LGEQAAEESKEAI  +LK SD+VFITAGMGGGTGSGAAP
Sbjct  134   ENPVQIGEQLTRGLGTGGNPELGEQAAEESKEAIVESLKESDLVFITAGMGGGTGSGAAP  193

Query  915   VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADE  736
             VVA++SKEAG LTVGVVTYPFSFEGR+RS+QALEAIE+LQK VDTLIVIPNDRLLD+ +E
Sbjct  194   VVARLSKEAGNLTVGVVTYPFSFEGRRRSVQALEAIERLQKCVDTLIVIPNDRLLDVVEE  253

Query  735   QTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKN  556
             QTPL++AFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVM +SGTAMLGVGVSS KN
Sbjct  254   QTPLEEAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMSNSGTAMLGVGVSSGKN  313

Query  555   RAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFG  376
             RAEEAA+QAT APLI  SI+ ATGVVYNITGGKD+TLQEVN+VSQVVTSLADPSANIIFG
Sbjct  314   RAEEAAQQATSAPLIERSIERATGVVYNITGGKDLTLQEVNKVSQVVTSLADPSANIIFG  373

Query  375   AVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             AVVD+RY GEIHVTIIATGF+Q+FQ+ L+TDP+ AK
Sbjct  374   AVVDDRYAGEIHVTIIATGFSQTFQKALVTDPKVAK  409



>gb|ABK24653.1| unknown [Picea sitchensis]
Length=439

 Score =   454 bits (1167),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 276/336 (82%), Positives = 306/336 (91%), Gaps = 3/336 (1%)
 Frame = -3

Query  1266  RFSVRCSFIP---MDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAA  1096
             R   R S+ P   M+SA+IKVVG+GGGGNNAVNRMI +GL GV+FYAINTDAQ+LLQSAA
Sbjct  74    RRVCRSSYSPFRQMESARIKVVGIGGGGNNAVNRMIAAGLHGVEFYAINTDAQALLQSAA  133

Query  1095  QTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAP  916
             + P+QIGE LTRGLGTGGNP LGEQAAEESKEAI   LK SD+VFITAGMGGGTGSGAAP
Sbjct  134   ENPVQIGEQLTRGLGTGGNPELGEQAAEESKEAIVECLKESDLVFITAGMGGGTGSGAAP  193

Query  915   VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADE  736
             VVA++SKEA  LTVGVVTYPFSFEGR+RS+QALEAIE+LQK VDTLIVIPNDRLLD+ +E
Sbjct  194   VVARLSKEADNLTVGVVTYPFSFEGRRRSVQALEAIERLQKCVDTLIVIPNDRLLDVVEE  253

Query  735   QTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKN  556
             QTPL++AFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVM +SGTAMLGVGVSS KN
Sbjct  254   QTPLEEAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMSNSGTAMLGVGVSSGKN  313

Query  555   RAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFG  376
             RAEEAA+QAT APLI  SI+ ATGVVYNITGGKD+TLQEVN+VSQVVTSLADPSANIIFG
Sbjct  314   RAEEAAQQATSAPLIERSIERATGVVYNITGGKDLTLQEVNKVSQVVTSLADPSANIIFG  373

Query  375   AVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             AVVD+RY GEIHVTIIATGF+Q+FQ+ L+TDP+ AK
Sbjct  374   AVVDDRYAGEIHVTIIATGFSQTFQKALVTDPKVAK  409



>ref|XP_010249043.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Nelumbo nucifera]
Length=431

 Score =   440 bits (1132),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 270/350 (77%), Positives = 307/350 (88%), Gaps = 5/350 (1%)
 Frame = -3

Query  1311  SSGYASRRKSLFHQRRFSVRCSF-IPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYA  1135
             S  Y  R  SL      +  CSF  P++SA+IKV+GVGGGGNNAVNRMI SGLQGV+FYA
Sbjct  54    SKTYKCRYLSLNK----ACYCSFSAPINSARIKVIGVGGGGNNAVNRMIESGLQGVEFYA  109

Query  1134  INTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFIt  955
             INTDAQ+LLQS+ +  +QIGE LT GLGTGGNP LGEQAAEESK+AI   L  SD+VFI 
Sbjct  110   INTDAQALLQSSTKRQVQIGEKLTCGLGTGGNPELGEQAAEESKDAICKVLADSDLVFIA  169

Query  954   agmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLI  775
             AGMGGGTGSGAAPVVA++SKEAG+LTVGVVTYPFSFEGR+R++QALEAI KLQ +VDTLI
Sbjct  170   AGMGGGTGSGAAPVVARLSKEAGFLTVGVVTYPFSFEGRRRAVQALEAIGKLQDSVDTLI  229

Query  774   VIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSG  595
             VIPNDRLLD+A  QTPLQ+AFLLADDVL +GVQGISDIITIPGLVNVDFADVKA+MKDSG
Sbjct  230   VIPNDRLLDVATAQTPLQEAFLLADDVLCEGVQGISDIITIPGLVNVDFADVKAIMKDSG  289

Query  594   TAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVV  415
             TAMLGVGVSS KNRAEEAA QAT APLI  SI+ ATGVVYNITGGKD+TLQEVNRVSQ+V
Sbjct  290   TAMLGVGVSSGKNRAEEAALQATSAPLIERSIERATGVVYNITGGKDLTLQEVNRVSQIV  349

Query  414   TSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAKA  265
             TSLADPSANIIFGAV+D+RY+GE+HVTIIATGF+Q+FQ+TLL +P+ + +
Sbjct  350   TSLADPSANIIFGAVIDDRYSGEVHVTIIATGFSQTFQKTLLMEPKSSTS  399



>ref|XP_011097822.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
isoform X2 [Sesamum indicum]
Length=338

 Score =   435 bits (1118),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 270/283 (95%), Positives = 277/283 (98%), Gaps = 0/283 (0%)
 Frame = -3

Query  1269  RRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQT  1090
              R  V+CSFIPMDSAKIKVVGVGGGGNNAVNRMIGSGL GVDFYAINTDAQ+LLQSAA+ 
Sbjct  54    HRSGVQCSFIPMDSAKIKVVGVGGGGNNAVNRMIGSGLSGVDFYAINTDAQALLQSAAEN  113

Query  1089  PIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVV  910
             PIQIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSDMVFITAGMGGGTGSGAAPVV
Sbjct  114   PIQIGELLTRGLGTGGNPLLGEQAAEESKEAIANALKGSDMVFITAGMGGGTGSGAAPVV  173

Query  909   AQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQT  730
             AQI+KE+GYLTVGVVTYPFSFEGRKRS+QALEAIEKLQKNVDTLIVIPNDRLLDIADEQT
Sbjct  174   AQIAKESGYLTVGVVTYPFSFEGRKRSMQALEAIEKLQKNVDTLIVIPNDRLLDIADEQT  233

Query  729   PLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRA  550
              LQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVS+SKNRA
Sbjct  234   ALQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSASKNRA  293

Query  549   EEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQ  421
             EEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQ
Sbjct  294   EEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQ  336



>dbj|BAC57986.1| ftsZ1 [Marchantia polymorpha]
 dbj|BAC57993.1| ftsZ1 [Marchantia polymorpha]
Length=446

 Score =   437 bits (1123),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 269/357 (75%), Positives = 310/357 (87%), Gaps = 4/357 (1%)
 Frame = -3

Query  1338  SSFIPRQCISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSG  1159
             S  +   C  + +   +KS    R F+   S IPMDSA+IKV+GVGGGGNNA+NRMIGSG
Sbjct  60    SGTLQHDCKRAEWQRAKKSAKGTRIFA---SMIPMDSARIKVIGVGGGGNNAINRMIGSG  116

Query  1158  LQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALK  979
             LQGV+F+AINTDAQ+LLQSAA   +QIGE LTRGLGTGGNP LGE+AAEES EAIA A+ 
Sbjct  117   LQGVEFWAINTDAQALLQSAATHRVQIGETLTRGLGTGGNPELGEKAAEESLEAIAEAVS  176

Query  978   GSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKL  799
              +D+VFITAGMGGGTGSGAAPVVA+++KE G LTVGVVTYPF+FEGR+R+ Q LEAIE+L
Sbjct  177   DADLVFITAGMGGGTGSGAAPVVARLAKEGGQLTVGVVTYPFTFEGRRRAQQGLEAIEQL  236

Query  798   QKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADV  619
             +KNVDTLIVIPNDRLLD+  E TPLQ+AFLLADDVLRQGVQGISDIITIPGLVNVDFADV
Sbjct  237   RKNVDTLIVIPNDRLLDVVQEATPLQEAFLLADDVLRQGVQGISDIITIPGLVNVDFADV  296

Query  618   KAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQE  439
             KAVM +SGTAMLGVG+S+ KNRAEEAA+QAT APLI  SI+ ATGVVYNITGGKD+TLQE
Sbjct  297   KAVMSNSGTAMLGVGMSTGKNRAEEAAQQATSAPLIERSIERATGVVYNITGGKDLTLQE  356

Query  438   VNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             VNRVSQVVT LADP+ANIIFGAVVDE+Y G +HVTIIATGF+Q+FQ+TL+ DP+ A+
Sbjct  357   VNRVSQVVTGLADPAANIIFGAVVDEKYTGAVHVTIIATGFSQTFQKTLI-DPKVAR  412



>ref|XP_002984848.1| hypothetical protein SELMODRAFT_156840 [Selaginella moellendorffii]
 gb|EFJ14098.1| hypothetical protein SELMODRAFT_156840 [Selaginella moellendorffii]
Length=355

 Score =   424 bits (1090),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 258/324 (80%), Positives = 295/324 (91%), Gaps = 1/324 (0%)
 Frame = -3

Query  1236  MDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrg  1057
             MDSA+IKVVG+GGGGNNAVNRMIGSGLQGVDF+AINTDAQ+L+QS+A   +QIGE LTRG
Sbjct  1     MDSARIKVVGIGGGGNNAVNRMIGSGLQGVDFWAINTDAQALVQSSASNRLQIGEELTRG  60

Query  1056  lgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLT  877
             LGTGG P LGE+AAEESK+ I  A+  SD+VFITAGMGGGTGSGAAPVVA++SKE G LT
Sbjct  61    LGTGGKPSLGEEAAEESKDDIKVAVADSDLVFITAGMGGGTGSGAAPVVARLSKEKGQLT  120

Query  876   VGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADD  697
             VGVVTYPF+FEGR+RS QAL+AIE+L+ NVDTLIVIPNDRLLD+  E TPLQ+AFLLADD
Sbjct  121   VGVVTYPFTFEGRRRSQQALDAIERLRSNVDTLIVIPNDRLLDLVQEHTPLQEAFLLADD  180

Query  696   VLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAP  517
             VLRQGVQGISDIITIPGLVNVDFADVKA+M +SGTAMLGVG +S KNRAEEAA+QAT AP
Sbjct  181   VLRQGVQGISDIITIPGLVNVDFADVKAIMANSGTAMLGVGTASGKNRAEEAAQQATSAP  240

Query  516   LIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHV  337
             LI  SI+ ATGVVYNITGG+D+TLQEVNRVSQVVT LADP+ANIIFGAVVDERY+G++HV
Sbjct  241   LIERSIERATGVVYNITGGRDLTLQEVNRVSQVVTGLADPAANIIFGAVVDERYDGQVHV  300

Query  336   TIIATGFTQSFQRTLLTDPRGAKA  265
             TIIATGF+Q+FQ+TL+ DP+ + A
Sbjct  301   TIIATGFSQTFQKTLV-DPKASVA  323



>ref|XP_002985903.1| hypothetical protein SELMODRAFT_123081 [Selaginella moellendorffii]
 gb|EFJ13080.1| hypothetical protein SELMODRAFT_123081 [Selaginella moellendorffii]
Length=355

 Score =   423 bits (1088),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 257/324 (79%), Positives = 295/324 (91%), Gaps = 1/324 (0%)
 Frame = -3

Query  1236  MDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrg  1057
             MDSA+IKVVG+GGGGNNAVNRMIGSGLQGVDF+AINTDAQ+L+QS+A   +QIGE LTRG
Sbjct  1     MDSARIKVVGIGGGGNNAVNRMIGSGLQGVDFWAINTDAQALVQSSASNRLQIGEELTRG  60

Query  1056  lgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLT  877
             LGTGG P LGE+AAEESK+ +  A+  SD+VFITAGMGGGTGSGAAPVVA++SKE G LT
Sbjct  61    LGTGGKPSLGEEAAEESKDDLKVAVADSDLVFITAGMGGGTGSGAAPVVARLSKEKGQLT  120

Query  876   VGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADD  697
             VGVVTYPF+FEGR+RS QAL+AIE+L+ NVDTLIVIPNDRLLD+  E TPLQ+AFLLADD
Sbjct  121   VGVVTYPFTFEGRRRSQQALDAIERLRSNVDTLIVIPNDRLLDLVQEHTPLQEAFLLADD  180

Query  696   VLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAP  517
             VLRQGVQGISDIITIPGLVNVDFADVKA+M +SGTAMLGVG +S KNRAEEAA+QAT AP
Sbjct  181   VLRQGVQGISDIITIPGLVNVDFADVKAIMTNSGTAMLGVGTASGKNRAEEAAQQATSAP  240

Query  516   LIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHV  337
             LI  SI+ ATGVVYNITGG+D+TLQEVNRVSQVVT LADP+ANIIFGAVVDERY+G++HV
Sbjct  241   LIERSIERATGVVYNITGGRDLTLQEVNRVSQVVTGLADPAANIIFGAVVDERYDGQVHV  300

Query  336   TIIATGFTQSFQRTLLTDPRGAKA  265
             TIIATGF+Q+FQ+TL+ DP+ + A
Sbjct  301   TIIATGFSQTFQKTLV-DPKASVA  323



>gb|AEV40986.1| putative tubulin/FtsZ domain-containing protein [Oryza minuta]
Length=334

 Score =   402 bits (1034),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 255/289 (88%), Positives = 275/289 (95%), Gaps = 3/289 (1%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             SVRCSF P+++A+IKVVGVGGGGNNAVNRMIGSGLQG++FYAINTD+Q+LL S AQ P+Q
Sbjct  40    SVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALLNSQAQYPLQ  99

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IGE LTRGLGTGGNP LGEQAAEESKEAIANALK SD+VFITAGMGGGTGSGAAPVVAQI
Sbjct  100   IGEQLTRGLGTGGNPNLGEQAAEESKEAIANALKDSDLVFITAGMGGGTGSGAAPVVAQI  159

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQA--LEAIEKLQKNVDTLIVIPNDRLLDIADEQTP  727
             SKEAGYLTVGVVTYPFSFEGRKRSLQA  LEA+EKL+++VDTLIVIPNDRLLD+ DE TP
Sbjct  160   SKEAGYLTVGVVTYPFSFEGRKRSLQASALEALEKLERSVDTLIVIPNDRLLDVVDENTP  219

Query  726   LQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAE  547
             LQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTAMLGVGVSSSKNRA+
Sbjct  220   LQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTAMLGVGVSSSKNRAQ  279

Query  546   EAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQV-VTSLA  403
             EAAEQATLAPLIGSSI++A GVVYNITGGKDITLQEVN+VSQV VT LA
Sbjct  280   EAAEQATLAPLIGSSIEAAMGVVYNITGGKDITLQEVNKVSQVRVTFLA  328



>ref|XP_005647947.1| cell division protein FtsZ [Coccomyxa subellipsoidea C-169]
 gb|EIE23403.1| cell division protein FtsZ [Coccomyxa subellipsoidea C-169]
Length=373

 Score =   393 bits (1010),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 241/328 (73%), Positives = 282/328 (86%), Gaps = 0/328 (0%)
 Frame = -3

Query  1272  QRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQ  1093
             +R+++V  S      A+IKV+GVGGGGNNA+NRMIGSGLQGV+F+A NTDAQ+L  S A 
Sbjct  2     ERKYNVSFSAHSGGDARIKVIGVGGGGNNAINRMIGSGLQGVEFWAANTDAQALDNSDAL  61

Query  1092  TPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPV  913
               IQ+G  LTRGLGTGGNP LGEQAAEES   +  A+  +DMVFITAGMGGGTG+GAAPV
Sbjct  62    NKIQMGAQLTRGLGTGGNPSLGEQAAEESAVDLQTAVGNADMVFITAGMGGGTGTGAAPV  121

Query  912   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ  733
             VA++SKE G LTVGVVTYPF+FEGR+R  QA + IE L++NVDTLIVIPNDRLLD+  E 
Sbjct  122   VARVSKEMGVLTVGVVTYPFTFEGRRRGTQASDGIEALRRNVDTLIVIPNDRLLDVVGES  181

Query  732   TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNR  553
             TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKA+M +SGTAMLGVGV++ KNR
Sbjct  182   TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAIMCNSGTAMLGVGVATGKNR  241

Query  552   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  373
             AEEAA  AT APLI  SI+ ATG+VYNITGGKD+TLQEVNRVS+VVTSLADPSAN+IFGA
Sbjct  242   AEEAALAATSAPLIERSIERATGIVYNITGGKDLTLQEVNRVSEVVTSLADPSANVIFGA  301

Query  372   VVDERYNGEIHVTIIATGFTQSFQRTLL  289
             V++++Y GE+HVTIIATGF+Q+++  LL
Sbjct  302   VIEDQYEGEVHVTIIATGFSQTYEENLL  329



>ref|XP_001769058.1| ftsZ1-2 plastid division protein [Physcomitrella patens]
 gb|EDQ66136.1| ftsZ1-3 plastid division protein [Physcomitrella patens]
Length=443

 Score =   396 bits (1017),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 230/304 (76%), Positives = 268/304 (88%), Gaps = 1/304 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMIGSG+QGVDF+AINTD Q+L +S AQ  +QIGE LTRGLGTGG P LGEQAAEES + 
Sbjct  109   RMIGSGIQGVDFWAINTDVQALQKSQAQHRVQIGEALTRGLGTGGKPFLGEQAAEESIDI  168

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA A+  +D+VFITAGMGGGTGSGAAPVVA+++KEAG LTVGVVTYPF+FEGR+RS QA+
Sbjct  169   IAEAVVDADLVFITAGMGGGTGSGAAPVVARVAKEAGQLTVGVVTYPFTFEGRRRSQQAV  228

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             EAIE L+K+VD+LIVIPNDRLLD++ ++TPLQ+AF LADDVLRQGVQGISDIIT PGLVN
Sbjct  229   EAIENLRKSVDSLIVIPNDRLLDVSGDKTPLQEAFSLADDVLRQGVQGISDIITTPGLVN  288

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM +SGTAMLGVG SS KNRAEEAA QA  APLI  SI+ ATG+VYNITGG 
Sbjct  289   VDFADVRAVMSNSGTAMLGVGSSSGKNRAEEAAIQAASAPLIERSIEQATGIVYNITGGS  348

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPR  277
             D+TLQEVN VSQ+VT LADPSANIIFGAVVD++Y GE+HVTIIATGF+ +F++ LL DP+
Sbjct  349   DLTLQEVNTVSQIVTGLADPSANIIFGAVVDDKYTGEVHVTIIATGFSHTFEK-LLVDPK  407

Query  276   GAKA  265
              A+A
Sbjct  408   AARA  411



>dbj|BAD12165.1| plastid division protein FtsZ [Nannochloris bacillaris]
Length=434

 Score =   394 bits (1012),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 242/322 (75%), Positives = 278/322 (86%), Gaps = 1/322 (0%)
 Frame = -3

Query  1251  CSFIPMDS-AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIg  1075
              ++ PM   A+IKVVGVGGGG NAVNRMI SGLQGV+F+A+NTDAQ+L +  A   +QIG
Sbjct  62    ANYGPMGGDARIKVVGVGGGGGNAVNRMINSGLQGVEFWAVNTDAQALEKHDALNKLQIG  121

Query  1074  elltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISK  895
               LTRGLGTGG P LGE+AA+ES + IA+AL G+DMVFITAGMGGGTG+GAAPVVA++SK
Sbjct  122   TALTRGLGTGGKPELGEEAAQESHQEIASALNGADMVFITAGMGGGTGTGAAPVVARLSK  181

Query  894   EAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDA  715
             + G LTVGVVTYPF FEG++R+ QA + I+ L+KNVDTLIVIPNDRLLD+  E TPLQDA
Sbjct  182   DMGILTVGVVTYPFQFEGKRRASQATDGIDTLKKNVDTLIVIPNDRLLDVVGESTPLQDA  241

Query  714   FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAE  535
             FLLADDVLRQGVQGISDIITIPGLVNVDFADVKA+M +SGTAMLGVGVSS KNRAEEAA 
Sbjct  242   FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAIMCNSGTAMLGVGVSSGKNRAEEAAM  301

Query  534   QATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERY  355
              AT APLI  SI+ ATG+VYNITGGKD+TL EVNRVS+VVTSLADPSAN+IFGAV+D+ Y
Sbjct  302   AATSAPLIERSIERATGIVYNITGGKDLTLAEVNRVSEVVTSLADPSANVIFGAVIDDAY  361

Query  354   NGEIHVTIIATGFTQSFQRTLL  289
              GEIHVTIIATGF Q+F+  LL
Sbjct  362   EGEIHVTIIATGFEQTFEENLL  383



>ref|XP_001780238.1| ftsZ1-1 plastid division protein [Physcomitrella patens]
 emb|CAD22047.1| putative plastid division protein FtsZ1-1 [Physcomitrella patens]
 gb|EDQ54902.1| ftsZ1-1 plastid division protein [Physcomitrella patens]
Length=444

 Score =   393 bits (1010),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 229/299 (77%), Positives = 265/299 (89%), Gaps = 1/299 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMIGSG+QGVDF+AINTD Q+L +S A+  +QIGE LTRGLGTGG P LGEQAAEES E 
Sbjct  108   RMIGSGIQGVDFWAINTDVQALQKSQAEHRVQIGEALTRGLGTGGKPFLGEQAAEESIEI  167

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA A+  +D+VFITAGMGGGTGSGAAPVVA+++KEAG LTVGVVTYPF+FEGR+RS QA+
Sbjct  168   IAQAVVDADLVFITAGMGGGTGSGAAPVVARVAKEAGQLTVGVVTYPFTFEGRRRSQQAV  227

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             EAIE L+K+VD+LIVIPNDRLLD++ ++TPLQ+AF LADDVLRQGVQGISDIIT PGLVN
Sbjct  228   EAIENLRKSVDSLIVIPNDRLLDVSGDKTPLQEAFSLADDVLRQGVQGISDIITTPGLVN  287

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM +SGTAMLGVG SS KNRAEEAA QA  APLI  SI+ ATG+VYNITGG 
Sbjct  288   VDFADVRAVMSNSGTAMLGVGSSSGKNRAEEAAVQAASAPLIERSIEQATGIVYNITGGP  347

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDP  280
             D+TLQEVN VS++VT LADPSANIIFGAVVD++Y GEIHVTIIATGF+ SFQ++L+ DP
Sbjct  348   DLTLQEVNTVSEIVTGLADPSANIIFGAVVDDKYTGEIHVTIIATGFSHSFQKSLV-DP  405



>gb|KFM23856.1| Cell division protein FtsZ-like protein 1, chloroplastic [Auxenochlorella 
protothecoides]
Length=389

 Score =   390 bits (1002),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 236/314 (75%), Positives = 277/314 (88%), Gaps = 0/314 (0%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+GVGGGG NAVNRMI SGLQGV+F+A+NTDAQ+L    A   +QIG  LTRGLGT
Sbjct  28    ARIKVIGVGGGGGNAVNRMISSGLQGVEFWAVNTDAQALESHQALNKLQIGTTLTRGLGT  87

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             GG P LGE+AA+ES + +A+A++G+DMVFITAGMGGGTG+GAAPVVA++SK+ G LTVGV
Sbjct  88    GGKPELGEEAAQESHQELASAVQGADMVFITAGMGGGTGTGAAPVVARLSKDLGVLTVGV  147

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VT+PF+FEGR+R+ QA + I+ L+KNVDTLIVIPNDRLLD+  + TPLQDAFLLADDVLR
Sbjct  148   VTFPFTFEGRRRAGQATDGIDTLRKNVDTLIVIPNDRLLDVVGDSTPLQDAFLLADDVLR  207

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIG  508
             QGVQGISDIITIPGLVNVDFADVKA+M +SGTAMLGVGVSS KNRAEEAA  AT APLI 
Sbjct  208   QGVQGISDIITIPGLVNVDFADVKAIMCNSGTAMLGVGVSSGKNRAEEAAMAATSAPLIE  267

Query  507   SSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTII  328
              SI+ ATG+VYNITGG+D+TLQEVNRVS+VVTSLADPSAN+IFGAV+D+ Y GEIHVTII
Sbjct  268   RSIERATGIVYNITGGRDLTLQEVNRVSEVVTSLADPSANVIFGAVIDDAYEGEIHVTII  327

Query  327   ATGFTQSFQRTLLT  286
             ATGF Q+F+  LL+
Sbjct  328   ATGFNQTFEDQLLS  341



>gb|EMS66227.1| Cell division protein ftsZ-like protein 1, chloroplastic [Triticum 
urartu]
Length=357

 Score =   385 bits (988),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 227/262 (87%), Positives = 246/262 (94%), Gaps = 0/262 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMIGSGLQG++FYAINTD+Q+L+ S AQ P+QIGE LTRGLGTGGNP LGEQAAEESKE 
Sbjct  84    RMIGSGLQGIEFYAINTDSQALVNSQAQHPLQIGEQLTRGLGTGGNPNLGEQAAEESKEV  143

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IANAL+ SD+VFITAGMGGGTGSGAAPVVAQI+KEAGYLTVGVVTYPFSFEGRKRSLQAL
Sbjct  144   IANALRDSDLVFITAGMGGGTGSGAAPVVAQIAKEAGYLTVGVVTYPFSFEGRKRSLQAL  203

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             EA+EKL+++VDTLIVIPNDRLLDIADE  PLQDAFLLADDVLRQGVQGISDIITIPGLVN
Sbjct  204   EALEKLERSVDTLIVIPNDRLLDIADENMPLQDAFLLADDVLRQGVQGISDIITIPGLVN  263

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADVKAVMK+SGTAMLGVGVSSSKNRA+EAAEQATLAPLIGSSI++ATGVVYNITGGK
Sbjct  264   VDFADVKAVMKNSGTAMLGVGVSSSKNRAQEAAEQATLAPLIGSSIEAATGVVYNITGGK  323

Query  456   DITLQEVNRVSQVVTSLADPSA  391
             DITLQEVN+VSQ+      P A
Sbjct  324   DITLQEVNKVSQLWQPQGSPVA  345



>emb|CDP13770.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 187/200 (94%), Positives = 194/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  834  RSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIIT  655
             SL ALEAIE+LQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIIT
Sbjct  51   HSLHALEAIERLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIIT  110

Query  654  IPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVY  475
            IPGLVNVDFADVKAVMK+SGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVY
Sbjct  111  IPGLVNVDFADVKAVMKNSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVY  170

Query  474  NITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRT  295
            NITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQ+T
Sbjct  171  NITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQKT  230

Query  294  LLTDPRGAKAGDKGAGSQEN  235
            LLTDPRG K  +KG G+Q++
Sbjct  231  LLTDPRGTKLAEKGTGTQDS  250



>gb|KDD77168.1| tubulin/FtsZ GTPase [Helicosporidium sp. ATCC 50920]
Length=519

 Score =   384 bits (987),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 215/297 (72%), Positives = 257/297 (87%), Gaps = 0/297 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SGLQGV+F+A+NTDAQ+L    A+  +Q+G  LTRGLGTGG P LGEQAA+ES E+
Sbjct  189   RMISSGLQGVEFWAVNTDAQALEAHKAENKLQLGTALTRGLGTGGKPELGEQAAQESHES  248

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             +A A+ G+DM+F+TAGMGGGTG+GAAPVVA++SK+ G LTVGVVTYPFSFEGR+R+ QA 
Sbjct  249   LAEAVAGADMLFVTAGMGGGTGTGAAPVVARLSKDLGILTVGVVTYPFSFEGRRRAGQAT  308

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             + ++ L++NVDTLIVIPNDRLLD+  + TPLQDAFLLADDVLRQGVQGISDI+TIPGLVN
Sbjct  309   DGVDTLRRNVDTLIVIPNDRLLDVVGDHTPLQDAFLLADDVLRQGVQGISDIVTIPGLVN  368

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+++M +SGTAMLG G +  KNRAEEAA  AT APLI  SI+ ATG+VYNITGG 
Sbjct  369   VDFADVRSIMCNSGTAMLGTGAAQGKNRAEEAALAATSAPLIERSIERATGIVYNITGGP  428

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLT  286
             D+TLQEVNRVS+VVTSLADP AN+IFGAV+DE+Y GEIHVTIIATGF QSF+  LL+
Sbjct  429   DLTLQEVNRVSEVVTSLADPGANVIFGAVIDEKYQGEIHVTIIATGFNQSFEDHLLS  485



>ref|XP_002501749.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63007.1| predicted protein [Micromonas sp. RCC299]
Length=359

 Score =   365 bits (937),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 224/304 (74%), Positives = 265/304 (87%), Gaps = 0/304 (0%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+G GGGG NAVNRMI SGLQGV+F+++NTDAQ+L+QS A   IQIG+ +TRGLGT
Sbjct  7     ARIKVIGCGGGGGNAVNRMINSGLQGVEFWSLNTDAQALVQSQADNRIQIGKQVTRGLGT  66

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             GGNP LG++AAEES   I  A++G+D+VF+TAGMGGGTGSG+APVVA++S+EAG LTVGV
Sbjct  67    GGNPELGKKAAEESATEIQQAVRGADLVFVTAGMGGGTGSGSAPVVARLSREAGNLTVGV  126

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VT PF+FEGR+R +QA E+IE+L+ NVDTLIVIPNDRLLD+  +  PLQ+AFLLADDVLR
Sbjct  127   VTQPFTFEGRRRFIQAQESIEQLRANVDTLIVIPNDRLLDVVMDDAPLQEAFLLADDVLR  186

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIG  508
             QGVQGISDIITI GLVNVDFADVKAVMK SGTAMLGVGV+  KNRAEEAA  A  APLI 
Sbjct  187   QGVQGISDIITISGLVNVDFADVKAVMKGSGTAMLGVGVAQGKNRAEEAATAAISAPLIE  246

Query  507   SSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTII  328
              SI  ATG+VYNITGG D+TLQE+N VS+V+TSLADP+ANIIFGAVVD++Y GE+ VT+I
Sbjct  247   HSIDRATGIVYNITGGSDLTLQEINTVSEVITSLADPAANIIFGAVVDDQYKGELQVTVI  306

Query  327   ATGF  316
             ATGF
Sbjct  307   ATGF  310



>gb|EEC78198.1| hypothetical protein OsI_17816 [Oryza sativa Indica Group]
Length=399

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 242/338 (72%), Positives = 266/338 (79%), Gaps = 54/338 (16%)
 Frame = -3

Query  1275  HQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAA  1096
              +R  SVRCSF P+++A+IKVVGVGGGGNNAVNRMIGSGLQG++FYAINTD+Q+LL S A
Sbjct  32    RRRHASVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALLNSQA  91

Query  1095  QTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAP  916
             Q P+QIGE LTRGLGTGGNP LGEQAAEESKEAIANALK SD+VFITAGMGGGTGSGAAP
Sbjct  92    QYPLQIGEQLTRGLGTGGNPNLGEQAAEESKEAIANALKDSDLVFITAGMGGGTGSGAAP  151

Query  915   VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQA--LEAIEKLQKNVDTLIVIPNDRLLDIA  742
             VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQA  LEA+EKL+++VDTLIVIPNDRLLD+ 
Sbjct  152   VVAQISKEAGYLTVGVVTYPFSFEGRKRSLQASALEALEKLERSVDTLIVIPNDRLLDVV  211

Query  741   DEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSS  562
             DE TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK+SGTA L + V+S 
Sbjct  212   DENTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKNSGTACLVLIVTS-  270

Query  561   KNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANII  382
                                                                LADPSANII
Sbjct  271   ---------------------------------------------------LADPSANII  279

Query  381   FGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPRGAK  268
             FGAVVD+RY GEIHVTIIATGF QSFQ++LL DP+GA+
Sbjct  280   FGAVVDDRYTGEIHVTIIATGFPQSFQKSLLADPKGAR  317



>ref|XP_007515227.1| cell division protein FtsZ [Bathycoccus prasinos]
 emb|CCO14106.1| cell division protein FtsZ [Bathycoccus prasinos]
Length=407

 Score =   363 bits (933),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 224/306 (73%), Positives = 264/306 (86%), Gaps = 0/306 (0%)
 Frame = -3

Query  1230  SAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglg  1051
             SAKIKVVG GGGG NAVNRMI +G+ GV+F+ +NTDAQ+L+ +      QIGE +TRGLG
Sbjct  66    SAKIKVVGCGGGGGNAVNRMIEAGVSGVEFWVVNTDAQALVNAQTVNVCQIGEQVTRGLG  125

Query  1050  tggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVG  871
              GGNP LGE AA ES++ +   +KGSD+VFITAGMGGGTGSG+APVVA++SKEAG LTVG
Sbjct  126   CGGNPELGEVAANESRDKLNEIVKGSDLVFITAGMGGGTGSGSAPVVARMSKEAGNLTVG  185

Query  870   VVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVL  691
             VVTYPFSFEGR+R +QA EAI+ L+KNVDTLIVIPNDRLLD+  E TPLQ+AFLLADDVL
Sbjct  186   VVTYPFSFEGRRRIVQATEAIDALRKNVDTLIVIPNDRLLDVCPEGTPLQEAFLLADDVL  245

Query  690   RQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLI  511
             RQGVQGISDIIT+ GLVNVDFADVK VMKDSGTAMLGVGVSS KNRAEEAA  A  APL+
Sbjct  246   RQGVQGISDIITVSGLVNVDFADVKTVMKDSGTAMLGVGVSSGKNRAEEAAVAAMSAPLV  305

Query  510   GSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTI  331
              +SI  ATG+V+NI+GG D+TLQE+N +S+VVT +ADPSAN+IFGAVVD++++G+I VTI
Sbjct  306   ENSIDKATGIVFNISGGPDMTLQEINTISEVVTDMADPSANVIFGAVVDDKFSGQISVTI  365

Query  330   IATGFT  313
             IATGFT
Sbjct  366   IATGFT  371



>ref|XP_001702420.1| plastid division protein [Chlamydomonas reinhardtii]
 gb|EDO96915.1| plastid division protein [Chlamydomonas reinhardtii]
Length=479

 Score =   357 bits (916),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 238/378 (63%), Positives = 290/378 (77%), Gaps = 22/378 (6%)
 Frame = -3

Query  1356  HQKRAP---SSFIPRQCISSGYASRRKSLFHQ---------RRFSVRCS--FIPMDS-AK  1222
             H + AP    +  P+   S+ Y S+     HQ         R + V  S  +IP    A+
Sbjct  24    HVRAAPVPQRAVTPQPATSTSYPSQPVFRQHQVAPVRGRPGRNYMVVASTGYIPFGGDAR  83

Query  1221  IKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtgg  1042
             IKV+GVGGGG NA+NRMI SGLQGV+F+AINTDAQ+L    A   +QIG  LTRGLG GG
Sbjct  84    IKVIGVGGGGGNALNRMINSGLQGVEFWAINTDAQALAAHQALNKVQIGSELTRGLGCGG  143

Query  1041  npllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVT  862
             NP LG +AA ES+EA+   ++G+D+VFITAGMGGGTG+GAAPVVA++SKE G LTVGVVT
Sbjct  144   NPELGRRAAMESEEALRRMVQGADLVFITAGMGGGTGTGAAPVVARLSKELGILTVGVVT  203

Query  861   YPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQG  682
             YPF+FEGR+R+ QALE IE L++ VD++IVIPNDRLLD+A   T LQDAF LADDVLRQG
Sbjct  204   YPFNFEGRRRAGQALEGIEALREAVDSVIVIPNDRLLDVAGASTALQDAFALADDVLRQG  263

Query  681   VQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSS-------KNRAEEAAEQATL  523
             VQGISDIIT+PGL+NVDFADVKA+M +SGTAMLGVG +S+        +RAE+AA  AT 
Sbjct  264   VQGISDIITVPGLINVDFADVKAIMSNSGTAMLGVGAASTATAAPGGPDRAEQAAVAATS  323

Query  522   APLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEI  343
             APLI  SI+ ATG+VYNITGG+D+TL EVNRVS+VVT+LADPS NIIFGAVVDE+Y+GE+
Sbjct  324   APLIQRSIEKATGIVYNITGGRDLTLAEVNRVSEVVTALADPSCNIIFGAVVDEQYDGEL  383

Query  342   HVTIIATGFTQSFQRTLL  289
             HVTIIATGF  +++  LL
Sbjct  384   HVTIIATGFAPTYENELL  401



>ref|XP_002955661.1| plastid division protein FtsZ1 [Volvox carteri f. nagariensis]
 gb|EFJ43301.1| plastid division protein FtsZ1 [Volvox carteri f. nagariensis]
Length=480

 Score =   356 bits (913),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 225/321 (70%), Positives = 269/321 (84%), Gaps = 7/321 (2%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+GVGGGG NA+NRMI SGLQGV+F+AINTDAQ+L    A   +QIG  LTRGLG 
Sbjct  84    ARIKVIGVGGGGGNALNRMISSGLQGVEFWAINTDAQALAAHQALNKVQIGTELTRGLGC  143

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             GGNP LG QAA ES++A+   ++G+D+VFITAGMGGGTG+GAAPVVA+ISKE G LTVGV
Sbjct  144   GGNPELGRQAALESEDALRRMVQGADLVFITAGMGGGTGTGAAPVVARISKELGILTVGV  203

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VTYPF+FEGR+R+ QALE IE L+  VD++IVIPNDRLLD+A   T LQDAF LADDVLR
Sbjct  204   VTYPFNFEGRRRAGQALEGIEGLRAAVDSVIVIPNDRLLDVASASTALQDAFALADDVLR  263

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSK-------NRAEEAAEQA  529
             QGVQGISDIIT+PGL+NVDFADVKA+M +SGTAMLGVG +S+        +RAE+AA  A
Sbjct  264   QGVQGISDIITVPGLINVDFADVKAIMSNSGTAMLGVGAASTATITPGGPDRAEQAAMAA  323

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNG  349
             T APLI  SI+ ATG+VYNITGG+D+TL EVNRVS+VVT+LADPS NIIFGAVVDE+Y+G
Sbjct  324   TSAPLIQRSIEKATGIVYNITGGRDLTLAEVNRVSEVVTALADPSCNIIFGAVVDEQYDG  383

Query  348   EIHVTIIATGFTQSFQRTLLT  286
             E+HVTIIATGF  +++  LL+
Sbjct  384   ELHVTIIATGFAPTYENELLS  404



>dbj|BAB91150.1| FtsZ [Chlamydomonas reinhardtii]
Length=479

 Score =   355 bits (912),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 236/380 (62%), Positives = 288/380 (76%), Gaps = 26/380 (7%)
 Frame = -3

Query  1356  HQKRAP---SSFIPRQCISSGYASRRKSLFHQRRFS-------------VRCSFIPMDS-  1228
             H + AP    +  P+   S+ Y S  + +F Q R +                 +IP    
Sbjct  24    HVRAAPVPQRAVTPQPATSTSYPS--QPVFRQHRVAPVSGRPGRNYMVVASTGYIPFGGD  81

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A IKV+GVGGGG NA+NRMI SGLQGV+F+AINTDAQ+L    A   +QIG  LTRGLG 
Sbjct  82    ACIKVIGVGGGGGNALNRMINSGLQGVEFWAINTDAQALAAHQALNKVQIGSELTRGLGC  141

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             GGNP LG +AA ES+EA+   ++G+D+VFITAGMGGGTG+GAAPVVA++SKE G LTVGV
Sbjct  142   GGNPELGRRAAMESEEALRRMVQGADLVFITAGMGGGTGTGAAPVVARLSKELGILTVGV  201

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VTYPF+FEGR+R+ QALE IE L++ VD++IVIPNDRLLD+A   T LQDAF LADDVLR
Sbjct  202   VTYPFNFEGRRRAGQALEGIEALREAVDSVIVIPNDRLLDVAGASTALQDAFALADDVLR  261

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSS-------KNRAEEAAEQA  529
             QGVQGISDIIT+PGL+NVDFADVKA+M +SGTAMLGVG +S+        +RAE+AA  A
Sbjct  262   QGVQGISDIITVPGLINVDFADVKAIMSNSGTAMLGVGAASTATAAPGGPDRAEQAAVAA  321

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNG  349
             T APLI  SI+ ATG+VYNITGG+D+TL EVNRVS+VVT+LADPS NIIFGAVVDE+Y+G
Sbjct  322   TSAPLIQRSIEKATGIVYNITGGRDLTLAEVNRVSEVVTALADPSCNIIFGAVVDEQYDG  381

Query  348   EIHVTIIATGFTQSFQRTLL  289
             E+HVTIIATGF  +++  LL
Sbjct  382   ELHVTIIATGFAPTYENELL  401



>ref|XP_003080788.1| ftsZ1 (ISS) [Ostreococcus tauri]
Length=381

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 227/313 (73%), Positives = 265/313 (85%), Gaps = 0/313 (0%)
 Frame = -3

Query  1254  RCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIg  1075
             R S +   +AKIKV+G GGGG+NAVNRMI  GLQGV+F+ +NTD+Q+L+ S A   +QIG
Sbjct  14    RESVVARANAKIKVLGCGGGGSNAVNRMISGGLQGVEFWTVNTDSQALVNSLAPNKLQIG  73

Query  1074  elltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISK  895
             E +TRGLG GGNP LGE AA ES++A+  A+ GSD+VFITAGMGGGTGSG+APVVA++SK
Sbjct  74    EQVTRGLGAGGNPELGEIAANESRDALEQAVSGSDLVFITAGMGGGTGSGSAPVVAKLSK  133

Query  894   EAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDA  715
               G LTVGVVTYPFSFEGR+R  QA EAIE L+ NVDTLIVIPNDRLLD+ +E TPLQ+A
Sbjct  134   AKGILTVGVVTYPFSFEGRRRIQQATEAIEALRANVDTLIVIPNDRLLDVVEEGTPLQEA  193

Query  714   FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAE  535
             FLLADDVLRQGVQGISDIITIPGLVNVDFADV+ VMKDSGTAMLGVGV+S KNRAEEAA 
Sbjct  194   FLLADDVLRQGVQGISDIITIPGLVNVDFADVRTVMKDSGTAMLGVGVASGKNRAEEAAR  253

Query  534   QATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERY  355
              A  APL+  SI  A G+V+NITGG D+TL EVN VS+VVTSLADP+AN+IFG+VVDE++
Sbjct  254   AAMSAPLVEHSIDRAMGIVFNITGGPDMTLMEVNAVSEVVTSLADPNANVIFGSVVDEKH  313

Query  354   NGEIHVTIIATGF  316
              GEI VTI+ATGF
Sbjct  314   RGEIAVTIVATGF  326



>emb|CEG01485.1| Cell division protein FtsZ, C-terminal [Ostreococcus tauri]
Length=418

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 227/313 (73%), Positives = 265/313 (85%), Gaps = 0/313 (0%)
 Frame = -3

Query  1254  RCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIg  1075
             R S +   +AKIKV+G GGGG+NAVNRMI  GLQGV+F+ +NTD+Q+L+ S A   +QIG
Sbjct  51    RESVVARANAKIKVLGCGGGGSNAVNRMISGGLQGVEFWTVNTDSQALVNSLAPNKLQIG  110

Query  1074  elltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISK  895
             E +TRGLG GGNP LGE AA ES++A+  A+ GSD+VFITAGMGGGTGSG+APVVA++SK
Sbjct  111   EQVTRGLGAGGNPELGEIAANESRDALEQAVSGSDLVFITAGMGGGTGSGSAPVVAKLSK  170

Query  894   EAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDA  715
               G LTVGVVTYPFSFEGR+R  QA EAIE L+ NVDTLIVIPNDRLLD+ +E TPLQ+A
Sbjct  171   AKGILTVGVVTYPFSFEGRRRIQQATEAIEALRANVDTLIVIPNDRLLDVVEEGTPLQEA  230

Query  714   FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAE  535
             FLLADDVLRQGVQGISDIITIPGLVNVDFADV+ VMKDSGTAMLGVGV+S KNRAEEAA 
Sbjct  231   FLLADDVLRQGVQGISDIITIPGLVNVDFADVRTVMKDSGTAMLGVGVASGKNRAEEAAR  290

Query  534   QATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERY  355
              A  APL+  SI  A G+V+NITGG D+TL EVN VS+VVTSLADP+AN+IFG+VVDE++
Sbjct  291   AAMSAPLVEHSIDRAMGIVFNITGGPDMTLMEVNAVSEVVTSLADPNANVIFGSVVDEKH  350

Query  354   NGEIHVTIIATGF  316
              GEI VTI+ATGF
Sbjct  351   RGEIAVTIVATGF  363



>dbj|BAM11094.1| chloroplast division protein, partial [Chlorella vulgaris]
Length=264

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  918  PVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIAD  739
            PVVA++SK+ G LTVGVVTYPFSFEGR+R+LQA + IE L+KNVDTLIVIPNDRLLD+  
Sbjct  12   PVVARLSKDLGVLTVGVVTYPFSFEGRRRALQATDGIETLRKNVDTLIVIPNDRLLDVVG  71

Query  738  EQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSK  559
            E TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKA+M++SGT MLGVGVSS K
Sbjct  72   ESTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAIMQNSGTVMLGVGVSSGK  131

Query  558  NRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIF  379
            NRAEEAA  AT APLI  SI+ ATG+VYNITGGKD+TLQEVNRVS+VVTSLADPSAN+IF
Sbjct  132  NRAEEAALAATSAPLIERSIERATGIVYNITGGKDLTLQEVNRVSEVVTSLADPSANVIF  191

Query  378  GAVVDERYNGEIHVTIIATGFTQSFQRTLL  289
            GAV+D++Y GEIHVTIIATGF+Q+F+  L 
Sbjct  192  GAVIDDQYEGEIHVTIIATGFSQTFEDNLW  221



>ref|XP_001419359.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97652.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=305

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 212/287 (74%), Positives = 246/287 (86%), Gaps = 0/287 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SGLQGV+F+A+NTD+Q+L+ S A    QIGE +TRGLG GGNP LGE AA ES++ 
Sbjct  19    RMISSGLQGVEFWAVNTDSQALVNSLAPNKCQIGEQVTRGLGAGGNPELGEIAATESRQE  78

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             +  A+ G+D+VFITAGMGGGTGSG+APVVA++S+E G LTVGVVTYPFSFEGR+R  QA 
Sbjct  79    LERAVLGADLVFITAGMGGGTGSGSAPVVAKMSREKGILTVGVVTYPFSFEGRRRIQQAT  138

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             EAIE L+ NVDTLIVIPNDRLLD+ +E T LQ+AFLLADDVLRQGVQGISDIITIPGLVN
Sbjct  139   EAIEALRANVDTLIVIPNDRLLDVVEEGTALQEAFLLADDVLRQGVQGISDIITIPGLVN  198

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVMKDSGTAMLGVGV+S K RAEEAA  A  APL+  SI  ATG+V+NITGG 
Sbjct  199   VDFADVRAVMKDSGTAMLGVGVASGKGRAEEAARAAMSAPLVEHSIDRATGIVFNITGGP  258

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGF  316
             D+TL EVN VS+VVTSLADPSAN+IFG+VVDE++ GEI VTI+ATGF
Sbjct  259   DMTLMEVNTVSEVVTSLADPSANVIFGSVVDEKHTGEIAVTIVATGF  305



>ref|XP_006846633.1| hypothetical protein AMTR_s00156p00058400 [Amborella trichopoda]
 gb|ERN08308.1| hypothetical protein AMTR_s00156p00058400 [Amborella trichopoda]
Length=375

 Score =   336 bits (862),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 223/278 (80%), Positives = 252/278 (91%), Gaps = 1/278 (0%)
 Frame = -3

Query  1251  CSFIPM-DSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIg  1075
             C+ I + ++A+IKV+G+GGGGNNAVNRMIGSGLQGV+FYA+NTDAQ+LL S A+  +QIG
Sbjct  75    CALINVSETARIKVIGIGGGGNNAVNRMIGSGLQGVEFYAVNTDAQALLLSNAEHRVQIG  134

Query  1074  elltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISK  895
             E LTRGLGTGGNP LGEQAAEESK+AI+  L  SD+VFI AGMGGGTGSGAAPVVA +SK
Sbjct  135   EQLTRGLGTGGNPELGEQAAEESKDAISAVLANSDLVFIAAGMGGGTGSGAAPVVAHLSK  194

Query  894   EAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDA  715
             EAGYLTVGVVTYPFSFEGR+R++QALEAIEKLQK VDTLIVIPNDRLLD+   QTPLQ+A
Sbjct  195   EAGYLTVGVVTYPFSFEGRRRAVQALEAIEKLQKCVDTLIVIPNDRLLDVVPPQTPLQEA  254

Query  714   FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAE  535
             F  ADDVLRQGVQGISDIITIPGLVNVDFADVKA+M+DSGTAMLGVGVS+ KNRAEEAA+
Sbjct  255   FTFADDVLRQGVQGISDIITIPGLVNVDFADVKAIMRDSGTAMLGVGVSTGKNRAEEAAQ  314

Query  534   QATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQ  421
             QAT +PLI  SI+ ATGV+YNITGGKD+TLQEVNRVSQ
Sbjct  315   QATASPLIERSIERATGVMYNITGGKDLTLQEVNRVSQ  352



>gb|AEL23173.1| cell division protein [Arthrospira platensis ZJU0117]
 gb|AEL23174.1| cell division protein [Arthrospira platensis ZJU0117/S]
Length=342

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 202/323 (63%), Positives = 259/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  3     SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  62

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFITAG+GGGTG+G AP+VA+I
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  122

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VDTLIVIPN++LL + +EQTP+Q
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  182

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  183   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  242

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  243   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  303   RMQGEVKITVIATGFTGEAKSTV  325



>gb|AEL23175.1| cell division protein [Arthrospira platensis ZJU0118]
 gb|AFP55288.1| FtsZ, partial [Arthrospira platensis ZJU0118/S]
 gb|AFP55290.1| FtsZ, partial [Arthrospira platensis ZJU0137/S]
 gb|AFP55291.1| FtsZ, partial [Arthrospira platensis ZJU0137/R]
Length=342

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 202/323 (63%), Positives = 259/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  3     SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  62

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFITAG+GGGTG+G AP+VA+I
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  122

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VDTLIVIPN++LL + +EQTP+Q
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  182

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  183   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  242

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  243   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  303   RMQGEVKITVIATGFTGESKSTV  325



>gb|AEL23168.1| cell division protein [Arthrospira platensis ZJU0101/S]
Length=343

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 201/323 (62%), Positives = 259/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  3     SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  62

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFITAG+GGGTG+G AP+VA+I
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  122

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VDTLIVIPN++LL + +EQTP+Q
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  182

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  183   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  242

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GV++NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  243   ALTAISSPLLESSIEGARGVIFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  303   RMQGEVKITVIATGFTGESKSTV  325



>gb|AEL23169.1| cell division protein [Arthrospira platensis ZJU0103]
 gb|AEL23171.1| cell division protein [Arthrospira platensis ZJU0104/S]
 gb|AEL23172.1| cell division protein [Arthrospira platensis ZJU0112]
 gb|AFP55286.1| FtsZ, partial [Arthrospira platensis ZJU0103/S]
 gb|AFP55287.1| FtsZ, partial [Arthrospira platensis ZJU0112/S]
Length=342

 Score =   332 bits (852),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 202/323 (63%), Positives = 259/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  3     SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  62

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFITAG+GGGTG+G AP+VA+I
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  122

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VDTLIVIPN++LL + +EQTP+Q
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  182

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  183   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  242

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  243   ALTAISSPLLESSIEGARGVVFNITGGCDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  303   RMQGEVKITVIATGFTGEAKSTV  325



>gb|AFP55289.1| FtsZ, partial [Arthrospira platensis ZJU0137]
Length=341

 Score =   332 bits (850),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 201/323 (62%), Positives = 258/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  3     SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  62

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFITAG+GGGTG+G AP+VA+I
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  122

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VDTLIVIPN++LL + +EQTP+Q
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  182

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  183   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  242

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  243   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IA GFT   + T+
Sbjct  303   RMQGEVKITVIAAGFTGESKSTV  325



>ref|WP_009785798.1| cell division protein FtsZ [Lyngbya sp. PCC 8106]
 gb|EAW35671.1| cell division protein FtsZ [Lyngbya sp. PCC 8106]
Length=429

 Score =   333 bits (855),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 207/341 (61%), Positives = 268/341 (79%), Gaps = 6/341 (2%)
 Frame = -3

Query  1287  KSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLL  1108
              S+ H+  +S     IP ++AKIKV+GVGG G NAVNRMI S + GV+F+A+NTDAQ+L 
Sbjct  50    NSMPHEESWS--TDIIPSNAAKIKVIGVGGSGGNAVNRMIESEVSGVEFWAVNTDAQALA  107

Query  1107  QSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgs  928
             QS A   +Q+G+ LTRGLG GGNP +G++AAEES++ IA++L+G+D+VFITAG+GGGTG+
Sbjct  108   QSKALKRLQVGQKLTRGLGAGGNPAIGQKAAEESRDEIAHSLEGADLVFITAGLGGGTGT  167

Query  927   gaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLD  748
             G APVVA+++KE G LT+GVVT PF+FEGR+R  QA E +  LQ  VDTLI+IPN++LL 
Sbjct  168   GGAPVVAEVAKEVGALTIGVVTRPFTFEGRRRISQADEGVAALQSRVDTLIIIPNNKLLS  227

Query  747   IADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVS  568
             + +EQTP+Q+AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ 
Sbjct  228   VINEQTPVQEAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGLG  287

Query  567   SSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSAN  388
             S K+RA EAA  A  +PL+ SSI  A GVV+NITGG D+TL EVN  ++ +  + DP+AN
Sbjct  288   SGKSRAREAAMGAISSPLLESSIDGAKGVVFNITGGTDLTLHEVNAAAETIYEVVDPNAN  347

Query  387   IIFGAVVDERYNGEIHVTIIATGFT----QSFQRTLLTDPR  277
             IIFGAV+DER  GEI +T+IATGF+    QS   T  T P+
Sbjct  348   IIFGAVIDERLQGEIKITVIATGFSGEKQQSISSTRETTPQ  388



>ref|WP_008050554.1| cell division protein FtsZ [Arthrospira sp. PCC 8005]
 emb|CCE16326.1| cell division protein; tubulin-like GTP-binding protein and GTPase, 
forms circumferential ring in cell division [Arthrospira 
sp. PCC 8005]
 emb|CDM94936.1| cell division protein; tubulin-like GTP-binding protein and GTPase, 
forms circumferential ring in cell division [Arthrospira 
sp. PCC 8005]
Length=427

 Score =   333 bits (854),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 202/323 (63%), Positives = 259/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  54    SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  113

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFITAG+GGGTG+G AP+VA+I
Sbjct  114   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  173

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VDTLIVIPN++LL + +EQTP+Q
Sbjct  174   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  233

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  234   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  293

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  294   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  353

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  354   RMQGEVKITVIATGFTGESKSTV  376



>ref|WP_006625893.1| cell division protein FtsZ [Arthrospira platensis]
 gb|EKD06333.1| cell division protein FtsZ [Arthrospira platensis C1]
Length=428

 Score =   333 bits (854),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 202/323 (63%), Positives = 259/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  55    SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  114

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFITAG+GGGTG+G AP+VA+I
Sbjct  115   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  174

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VDTLIVIPN++LL + +EQTP+Q
Sbjct  175   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  234

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  235   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  294

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  295   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  354

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  355   RMQGEVKITVIATGFTGESKSTV  377



>ref|WP_006669768.1| cell division protein FtsZ [Arthrospira maxima]
 gb|EDZ93797.1| cell division protein FtsZ [Arthrospira maxima CS-328]
Length=428

 Score =   333 bits (854),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 202/323 (63%), Positives = 259/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  55    SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  114

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFITAG+GGGTG+G AP+VA+I
Sbjct  115   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  174

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VDTLIVIPN++LL + +EQTP+Q
Sbjct  175   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  234

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  235   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  294

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  295   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  354

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  355   RMQGEVKITVIATGFTGESKSTV  377



>ref|WP_023065873.1| cell division protein FtsZ [Lyngbya aestuarii]
 gb|ERT07916.1| cell division protein FtsZ [Lyngbya aestuarii BL J]
Length=428

 Score =   333 bits (854),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 266/332 (80%), Gaps = 2/332 (1%)
 Frame = -3

Query  1287  KSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLL  1108
              S+ H+  +S     IP ++AKIKV+GVGG G NAVNRMI S + GV+F+A+NTDAQ+L 
Sbjct  49    NSMPHEESWS--TDIIPSNAAKIKVIGVGGSGGNAVNRMIESEVSGVEFWAVNTDAQALA  106

Query  1107  QSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgs  928
             QS A   +Q+G+ LTRGLG GGNP +G++AAEES++ IA++L+G+D+VFITAG+GGGTG+
Sbjct  107   QSKALKRLQVGQKLTRGLGAGGNPAIGQKAAEESRDEIAHSLEGADLVFITAGLGGGTGT  166

Query  927   gaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLD  748
             G APVVA+++KE G LT+GVVT PF+FEGR+R  QA E +  LQ  VDTLI+IPN++LL 
Sbjct  167   GGAPVVAEVAKEVGALTIGVVTRPFTFEGRRRISQADEGVAALQSRVDTLIIIPNNKLLS  226

Query  747   IADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVS  568
             + +EQTP+Q+AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ 
Sbjct  227   VINEQTPVQEAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGLG  286

Query  567   SSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSAN  388
             S K+RA EAA  A  +PL+ SSI  A GVV+NITGG D+TL EVN  ++ +  + DP+AN
Sbjct  287   SGKSRAREAAMGAISSPLLESSIDGAKGVVFNITGGTDLTLHEVNAAAEAIYEVVDPNAN  346

Query  387   IIFGAVVDERYNGEIHVTIIATGFTQSFQRTL  292
             IIFGAV+DER  GEI +T+IATGF+   Q+++
Sbjct  347   IIFGAVIDERLQGEIKITVIATGFSGEKQQSI  378



>gb|AEL23167.1| cell division protein [Arthrospira platensis ZJU0101]
Length=342

 Score =   330 bits (845),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 199/323 (62%), Positives = 256/323 (79%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  3     SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  62

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFI AG+GGGTG+G AP+VA+I
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFIIAGLGGGTGTGGAPIVAEI  122

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VD LIVIPN++LL + +EQTP+Q
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDALIVIPNNKLLSVINEQTPVQ  182

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +A   ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  183   EALRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  242

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  243   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  303   RMQGEVKITVIATGFTGESKSTV  325



>gb|AFP55293.1| FtsZ [Arthrospira platensis ZJU0101/S]
Length=427

 Score =   332 bits (852),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 201/323 (62%), Positives = 259/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  54    SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  113

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFITAG+GGGTG+G AP+VA+I
Sbjct  114   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  173

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VDTLIVIPN++LL + +EQTP+Q
Sbjct  174   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  233

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  234   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  293

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GV++NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  294   ALTAISSPLLESSIEGARGVIFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  353

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  354   RMQGEVKITVIATGFTGESKSTV  376



>gb|AEL23170.1| cell division protein [Arthrospira platensis ZJU0104]
Length=342

 Score =   329 bits (844),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 201/323 (62%), Positives = 258/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  3     SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  62

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFITAG+GGGTG+G AP+VA+I
Sbjct  63    VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  122

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VDTLIVIPN++LL + +EQTP+Q
Sbjct  123   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  182

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM  +G+A+LG+G+ S K+RA EA
Sbjct  183   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMAGAGSALLGIGIGSGKSRAREA  242

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  243   ALTAISSPLLESSIEGARGVVFNITGGCDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  302

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  303   RMQGEVKITVIATGFTGEAKSTV  325



>ref|WP_006620261.1| cell division protein FtsZ [Arthrospira platensis]
 gb|KDR58373.1| cell division protein FtsZ [Arthrospira platensis str. Paraca]
Length=427

 Score =   332 bits (852),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 202/323 (63%), Positives = 259/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  54    SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  113

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFITAG+GGGTG+G AP+VA+I
Sbjct  114   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  173

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VDTLIVIPN++LL + +EQTP+Q
Sbjct  174   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  233

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  234   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  293

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  294   ALTAISSPLLESSIEGARGVVFNITGGCDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  353

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  354   RMQGEVKITVIATGFTGEAKSTV  376



>ref|WP_014276905.1| cell division protein FtsZ [Arthrospira platensis]
 ref|YP_005071738.1| cell division protein FtsZ [Arthrospira platensis NIES-39]
 dbj|BAI93200.1| cell division protein FtsZ [Arthrospira platensis NIES-39]
 gb|AFP55294.1| FtsZ [Arthrospira platensis ZJU0103]
 gb|AFP55295.1| FtsZ [Arthrospira platensis ZJU0103/S]
Length=426

 Score =   332 bits (852),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 202/323 (63%), Positives = 259/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  53    SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  112

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFITAG+GGGTG+G AP+VA+I
Sbjct  113   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFITAGLGGGTGTGGAPIVAEI  172

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VDTLIVIPN++LL + +EQTP+Q
Sbjct  173   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDTLIVIPNNKLLSVINEQTPVQ  232

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  233   EAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  292

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  293   ALTAISSPLLESSIEGARGVVFNITGGCDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  352

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  353   RMQGEVKITVIATGFTGEAKSTV  375



>ref|WP_009633359.1| cell division protein FtsZ [Synechocystis sp. PCC 7509]
Length=419

 Score =   330 bits (847),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 199/311 (64%), Positives = 258/311 (83%), Gaps = 0/311 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKV+GVGGGG NAVNRMI S + G++F++INTDAQ+L+QSA+   +QIG+ L
Sbjct  56    IVPGRVANIKVIGVGGGGGNAVNRMIASNVSGIEFWSINTDAQALVQSASVKRLQIGQKL  115

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA AL+ +D+VFIT+GMGGGTG+GAAP+VA+I+KE G
Sbjct  116   TRGLGAGGNPAIGQKAAEESRDEIAAALENADLVFITSGMGGGTGTGAAPIVAEIAKEMG  175

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF FEGR+R+ QA + IE L+  VDTLIVIPND+LL +  EQTP+Q+AF  
Sbjct  176   ALTVGVVTRPFIFEGRRRTSQAEQGIEGLESRVDTLIVIPNDKLLSVISEQTPVQEAFRF  235

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADD+LRQGVQGISDIITIPGLVNVDFADV+A+M D+G+A++G+GV S K+RA+EAA  A 
Sbjct  236   ADDILRQGVQGISDIITIPGLVNVDFADVRAIMADAGSALMGIGVGSGKSRAQEAANAAI  295

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ SSI+ A GV++NITGG D+TL EVN  ++++  + DP+ANIIFGAV+DER  GE
Sbjct  296   SSPLLESSIEGARGVIFNITGGSDLTLHEVNAAAEIIYEVVDPNANIIFGAVIDERLQGE  355

Query  345   IHVTIIATGFT  313
             + +T+IATGFT
Sbjct  356   VRITVIATGFT  366



>ref|XP_003058549.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57004.1| predicted protein [Micromonas pusilla CCMP1545]
Length=367

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 220/327 (67%), Positives = 253/327 (77%), Gaps = 2/327 (1%)
 Frame = -3

Query  1233  DSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrgl  1054
             +SA IKV+G GGGG NAVNRMI SG+QGV+F+++NTDAQ+L+QS A   IQIG   TRGL
Sbjct  7     NSATIKVIGCGGGGGNAVNRMIKSGIQGVEFWSLNTDAQALVQSEADNRIQIGRDTTRGL  66

Query  1053  gtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTV  874
             GTGGNP LG  AAEES   I  A+ G+D+VFITAGMGGGTGSG+APVVA+I+K+AG LTV
Sbjct  67    GTGGNPELGRAAAEESINEITEAVAGADLVFITAGMGGGTGSGSAPVVARIAKDAGTLTV  126

Query  873   GVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDV  694
             GVVT PFSFEGR+R  QA   IE+++ NVDTLIVIPNDRLLD     TPLQ AFLLADDV
Sbjct  127   GVVTQPFSFEGRRRQEQAKAYIEQMRANVDTLIVIPNDRLLDAVKTNTPLQQAFLLADDV  186

Query  693   LRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPL  514
             LRQGVQGISDIITI GLVNVDFADV  VM+DSGTAMLGVG +   +RA EAA  A   PL
Sbjct  187   LRQGVQGISDIITISGLVNVDFADVSTVMRDSGTAMLGVGQAQGTDRAVEAAMAAISMPL  246

Query  513   IGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVT  334
             I  SI   +G+V+NITGGKD++LQEV+ VS VVTS+A P ANIIFGAVVDE +   I VT
Sbjct  247   IEHSIDLCSGIVFNITGGKDLSLQEVSAVSDVVTSMAAPDANIIFGAVVDENFTDGIAVT  306

Query  333   IIATGFTQSFQRTLLTDPRGAKAGDKG  253
             IIATGF    +      PRG + GD G
Sbjct  307   IIATGFDLPEENQ--PPPRGQRRGDGG  331



>gb|AFP55292.1| FtsZ [Arthrospira platensis ZJU0101]
Length=427

 Score =   330 bits (845),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 199/323 (62%), Positives = 256/323 (79%), Gaps = 0/323 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S     +P ++AKIKV+GVGG G NA+NRMI S + GV+F+A+NTDAQ+L QS A   +Q
Sbjct  54    SWSSDIVPSNAAKIKVIGVGGSGGNAINRMIDSEVSGVEFWAVNTDAQALTQSKASKRLQ  113

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             +G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFI AG+GGGTG+G AP+VA+I
Sbjct  114   VGQKLTRGLGAGGNPAIGQKAAEESRDEIAQALDGADLVFIIAGLGGGTGTGGAPIVAEI  173

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LT+GVVT PF+FEGR+R  QA E I  LQ  VD LIVIPN++LL + +EQTP+Q
Sbjct  174   AKEVGALTIGVVTRPFTFEGRRRISQADEGIAALQTRVDALIVIPNNKLLSVINEQTPVQ  233

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +A   ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+LG+G+ S K+RA EA
Sbjct  234   EALRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALLGIGIGSGKSRAREA  293

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE
Sbjct  294   ALTAISSPLLESSIEGARGVVFNITGGTDLTLHEVNAAAETIYEVVDPNANIIFGAVIDE  353

Query  360   RYNGEIHVTIIATGFTQSFQRTL  292
             R  GE+ +T+IATGFT   + T+
Sbjct  354   RMQGEVKITVIATGFTGESKSTV  376



>ref|WP_015167500.1| cell division protein FtsZ [Synechococcus sp. PCC 7502]
 ref|YP_007104976.1| cell division protein FtsZ [Synechococcus sp. PCC 7502]
 gb|AFY72841.1| cell division protein FtsZ [Synechococcus sp. PCC 7502]
Length=407

 Score =   327 bits (838),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 181/290 (62%), Positives = 243/290 (84%), Gaps = 0/290 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F+++NTDAQ+LLQS++    QIG+ +T+GLG GGNP +G++AAEES+  
Sbjct  80    RMIASEISGVEFWSLNTDAQALLQSSSPKRFQIGQKITKGLGAGGNPAIGQKAAEESRAE  139

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA+AL+G+D+VFITAGMGGGTG+GAAPV+A+I+KEAG LTVG+VT PF+FEGR+R  QA 
Sbjct  140   IAHALEGADLVFITAGMGGGTGTGAAPVIAEIAKEAGALTVGIVTRPFTFEGRRRLQQAE  199

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I+ LQ  VDTLI+IPN++LL +  EQTP+Q+AF +ADD+LRQGVQGISD+ITIPGLVN
Sbjct  200   EGIDALQSRVDTLIIIPNNKLLSVTAEQTPIQEAFRVADDILRQGVQGISDMITIPGLVN  259

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFAD++AVM D+G+A+LG+G+ S K+RA EAA  A  +PL+ SSI+ A GVV+NITGG 
Sbjct  260   VDFADIRAVMADAGSALLGIGIGSGKSRAREAAMTAISSPLLESSIEGANGVVFNITGGS  319

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQS  307
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+ +
Sbjct  320   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMAGEVRITVIATGFSNN  369



>ref|WP_012630079.1| cell division protein FtsZ [Cyanothece sp. PCC 7425]
 ref|YP_002485398.1| cell division protein FtsZ [Cyanothece sp. PCC 7425]
 gb|ACL47037.1| cell division protein FtsZ [Cyanothece sp. PCC 7425]
Length=454

 Score =   328 bits (841),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 199/304 (65%), Positives = 255/304 (84%), Gaps = 0/304 (0%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+GVGGGG NAVNRMI S + GV+F+++NTDAQ+L QSAA   +Q+G+ LTRGLG 
Sbjct  88    ARIKVIGVGGGGGNAVNRMIASSISGVEFWSVNTDAQALTQSAAPNRLQLGQKLTRGLGA  147

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             GGNP +G++AAEES++ IA AL  SD++FIT+GMGGGTG+GAAP+VA+++KE G LTVGV
Sbjct  148   GGNPAIGQKAAEESRDEIAAALDNSDLIFITSGMGGGTGTGAAPIVAEVAKELGALTVGV  207

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VT PF+FEGR+R  QA E I  LQ  VDTLIVIPND++L +  EQTP+Q+AF +ADD+LR
Sbjct  208   VTRPFTFEGRRRGFQADEGIAALQSRVDTLIVIPNDKILSVISEQTPVQEAFQIADDILR  267

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIG  508
             QGVQGISDII +PGLVNVDFADV+AVM D+G+A++GVG++S K+RA+EAA  A  +PL+ 
Sbjct  268   QGVQGISDIINLPGLVNVDFADVRAVMADAGSALMGVGIASGKSRAKEAATTAISSPLLE  327

Query  507   SSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTII  328
             SSIQ A GVV+NITGG D+TL EV+  ++V+  + DPSANIIFGAV+DE+  GEIH+T+I
Sbjct  328   SSIQGAKGVVFNITGGLDLTLHEVSAAAEVIYEVVDPSANIIFGAVIDEQIQGEIHITVI  387

Query  327   ATGF  316
             ATGF
Sbjct  388   ATGF  391



>ref|WP_035156917.1| cell division protein FtsZ [Calothrix sp. 336/3]
 gb|KFB85522.1| cell division protein FtsZ [Calothrix sp. 336/3]
Length=429

 Score =   326 bits (836),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 202/315 (64%), Positives = 255/315 (81%), Gaps = 0/315 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKV+GVGGGG NAVNRMI S + GV+F+ INTDAQ+L  +AA + +QIG+ L
Sbjct  58    IVPGRVANIKVIGVGGGGGNAVNRMIASDVSGVEFWTINTDAQALTLAAAPSRLQIGQKL  117

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G +AAEES++ IA AL+G+D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  118   TRGLGAGGNPAIGTKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMG  177

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF FEGR+R+ QA + IE L+  VDTLI+IPN++LL++  EQTP+QDAF  
Sbjct  178   ALTVGVVTRPFVFEGRRRASQAEQGIEALKSRVDTLIIIPNNKLLEVIPEQTPMQDAFRY  237

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GVSS K+RA EAA  A 
Sbjct  238   ADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVSSGKSRAREAAMAAI  297

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+  SI+ A GVV+NITGG D TL EVN  ++ +  + DP+ANIIFGAV+D+R  GE
Sbjct  298   SSPLLECSIEGARGVVFNITGGSDFTLHEVNAAAETIYEVVDPNANIIFGAVIDDRLQGE  357

Query  345   IHVTIIATGFTQSFQ  301
             + +T+IATGFT   Q
Sbjct  358   VRITVIATGFTGELQ  372



>ref|WP_006106232.1| cell division protein FtsZ [Coleofasciculus chthonoplastes]
 gb|EDX70873.1| cell division protein FtsZ [Coleofasciculus chthonoplastes PCC 
7420]
Length=362

 Score =   323 bits (827),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 199/310 (64%), Positives = 256/310 (83%), Gaps = 0/310 (0%)
 Frame = -3

Query  1242  IPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgellt  1063
             +P   A+IKVVGVGGGG NAVNRMI S + G++F++INTD+Q+L Q++A   +Q+G+ LT
Sbjct  1     MPGSVARIKVVGVGGGGGNAVNRMIASEVAGIEFWSINTDSQALSQNSAAKRLQVGQKLT  60

Query  1062  rglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGY  883
             RGLG GGNP +G++AAEES++ IA AL  SD+VFITAGMGGGTG+GAAP+VA+I+KE G 
Sbjct  61    RGLGAGGNPAIGQKAAEESRDEIAQALAESDLVFITAGMGGGTGTGAAPIVAEIAKEMGA  120

Query  882   LTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLA  703
             LTVGVVT PF+FEGR+R+ QA E I  LQ  VDTLIVIPN++LL +  EQTP+QDAF +A
Sbjct  121   LTVGVVTRPFTFEGRRRTSQAEEGIAALQSRVDTLIVIPNNKLLSVISEQTPVQDAFRVA  180

Query  702   DDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATL  523
             DD+LRQGVQGISDIIT+PGLVNVDFADV+AVM D+G+A++G+GV S K+RA EAA  A  
Sbjct  181   DDILRQGVQGISDIITVPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAREAAVAAIS  240

Query  522   APLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEI  343
             +PL+ SS++ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D+R  GEI
Sbjct  241   SPLLESSVEGARGVVFNITGGSDLTLHEVNAAAETIYEVVDPNANIIFGAVIDDRLQGEI  300

Query  342   HVTIIATGFT  313
              +T+IATGF+
Sbjct  301   RITVIATGFS  310



>ref|WP_015147980.1| cell division protein FtsZ [Oscillatoria acuminata]
 ref|YP_007085256.1| cell division protein FtsZ [Oscillatoria acuminata PCC 6304]
 gb|AFY81336.1| cell division protein FtsZ [Oscillatoria acuminata PCC 6304]
Length=427

 Score =   324 bits (831),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 189/288 (66%), Positives = 237/288 (82%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F+A+NTDAQ+L+QS A   +Q+G+ LTRGLG GGNP +G++AAEES++ 
Sbjct  80    RMIASEVSGVEFWAVNTDAQALVQSTATKRLQVGQKLTRGLGAGGNPAIGQKAAEESRDE  139

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA+AL+ SD+VFITAGMGGGTG+GAAP+VA+ +KE G LTVGVVT PF FEGR+R+ QA 
Sbjct  140   IAHALEHSDLVFITAGMGGGTGTGAAPIVAEAAKEVGALTVGVVTRPFMFEGRRRTNQAE  199

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLIVIPND+LL +  EQTP+Q+AF +ADD+LRQGVQGISDIITIPGLVN
Sbjct  200   EGIAALQSRVDTLIVIPNDKLLSVISEQTPVQEAFRVADDILRQGVQGISDIITIPGLVN  259

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+GV S K+RA EAA  A  +PL+ SSI+ A GVV NITGG 
Sbjct  260   VDFADVRAVMADAGSALMGIGVGSGKSRAREAALSAISSPLLESSIEGAKGVVLNITGGT  319

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++ V  + DP+ANIIFGAV+DER  GEI +T+IATGF+
Sbjct  320   DLTLHEVNAAAETVYEVVDPNANIIFGAVIDERLQGEIRITVIATGFS  367



>ref|WP_011244037.1| cell division protein FtsZ [Synechococcus elongatus]
 ref|YP_172437.1| cell division protein FtsZ [Synechococcus elongatus PCC 6301]
 ref|YP_401395.1| cell division protein FtsZ [Synechococcus elongatus PCC 7942]
 gb|AAC26227.1| cell division protein FtsZ [Synechococcus elongatus PCC 7942]
 dbj|BAD79917.1| cell division protein FtsZ [Synechococcus elongatus PCC 6301]
 gb|ABB58408.1| cell division protein FtsZ [Synechococcus elongatus PCC 7942]
 gb|AJD57129.1| cell division protein FtsZ [Synechococcus sp. UTEX 2973]
Length=393

 Score =   323 bits (828),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 198/311 (64%), Positives = 251/311 (81%), Gaps = 0/311 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              IP   A+IKV+GVGGGG+N VNRMI S + GV+F+A+NTDAQ+LL SAA   +Q+G+ L
Sbjct  32    IIPSSVARIKVIGVGGGGSNGVNRMISSDVSGVEFWALNTDAQALLHSAAPKRMQLGQKL  91

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G +AAEES+E +  AL+G+D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  92    TRGLGAGGNPAIGMKAAEESREELIAALEGADLVFITAGMGGGTGTGAAPIVAEVAKEVG  151

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVG+VT PF+FEGR+R  QA E    LQ +VDTLI IPNDRLL    EQTP+Q+AF +
Sbjct  152   ALTVGIVTKPFTFEGRRRMKQAEEGTAALQSSVDTLITIPNDRLLHAISEQTPIQEAFRV  211

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADD+LRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+G  S K+RA EAA  A 
Sbjct  212   ADDILRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGSGSGKSRAREAAHAAI  271

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ SSI+ A GVV+NITGG+D+TL EVN  +  +  + DP ANIIFGAV+D+R  GE
Sbjct  272   SSPLLESSIEGARGVVFNITGGRDMTLHEVNAAADAIYEVVDPEANIIFGAVIDDRLEGE  331

Query  345   IHVTIIATGFT  313
             + +T+IATGF+
Sbjct  332   LRITVIATGFS  342



>ref|WP_015186821.1| cell division protein FtsZ [Gloeocapsa sp. PCC 7428]
 ref|YP_007126104.1| cell division protein FtsZ [Gloeocapsa sp. PCC 7428]
 gb|AFZ28944.1| cell division protein FtsZ [Gloeocapsa sp. PCC 7428]
Length=423

 Score =   324 bits (830),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 255/311 (82%), Gaps = 0/311 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKV+GVGGGG NAVNRMI S + G++F++INTDAQ+L  ++A   +QIG+ L
Sbjct  58    IVPGRVANIKVIGVGGGGGNAVNRMIASEVSGIEFWSINTDAQALTNTSATRRLQIGQKL  117

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES+E IA AL+ +D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  118   TRGLGAGGNPAIGQKAAEESREEIAAALENADLVFITAGMGGGTGTGAAPIVAEVAKELG  177

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGV+T PF FEGR+R+ QA + IE LQ  VDTLIVIPND+LL +  EQTP+Q+AF +
Sbjct  178   ALTVGVITRPFMFEGRRRTSQAEQGIEALQSRVDTLIVIPNDKLLSVISEQTPVQEAFRI  237

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADD+LRQGVQGISDIITIPGLVNVDFADV+A+M D+G+A++G+G+ S K+RA EAA  A 
Sbjct  238   ADDILRQGVQGISDIITIPGLVNVDFADVRAIMADAGSALMGIGIGSGKSRAREAANAAI  297

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE+  GE
Sbjct  298   SSPLLESSIEGAKGVVFNITGGHDLTLHEVNAAAETIYEVVDPNANIIFGAVIDEKLQGE  357

Query  345   IHVTIIATGFT  313
             I +T+IATGF+
Sbjct  358   IRITVIATGFS  368



>dbj|BAE20183.1| FtsZ protein [Microcystis aeruginosa]
Length=415

 Score =   323 bits (828),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 184/287 (64%), Positives = 239/287 (83%), Gaps = 0/287 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES+E 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESREE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +   +TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPAETPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGF  316
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGF  367



>ref|WP_015201234.1| cell division protein FtsZ [Crinalium epipsammum]
 ref|YP_007140600.1| cell division protein FtsZ [Crinalium epipsammum PCC 9333]
 gb|AFZ11090.1| cell division protein FtsZ [Crinalium epipsammum PCC 9333]
Length=418

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 207/334 (62%), Positives = 263/334 (79%), Gaps = 4/334 (1%)
 Frame = -3

Query  1314  ISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYA  1135
             + S Y SR   +   R  ++    +P   AKIKV+GVGGGG NAVNRMI S L GV+F+ 
Sbjct  38    LGSTYDSRNTPIEESRSDNI----VPSSVAKIKVIGVGGGGGNAVNRMIASDLNGVEFWT  93

Query  1134  INTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFIt  955
             +NTDAQ+L  S+A   +Q+G+ LTRGLG GGNP +G++AAEES++ IA AL G+D+VFIT
Sbjct  94    LNTDAQALSHSSAPKRLQVGQKLTRGLGAGGNPAIGQKAAEESRDDIAAALDGTDLVFIT  153

Query  954   agmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLI  775
             AGMGGGTG+GAAPVVA+++KE G LTVGVVT PF FEGR+R+ QA E I  LQ  VDTLI
Sbjct  154   AGMGGGTGTGAAPVVAEVAKEMGALTVGVVTRPFLFEGRRRTSQAEEGIAALQGRVDTLI  213

Query  774   VIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSG  595
             VIPND+LL +  EQTP+Q+AF +ADD+LRQGVQGISDIITIPGLVNVDFADV+AVM D+G
Sbjct  214   VIPNDKLLSVISEQTPVQEAFRVADDILRQGVQGISDIITIPGLVNVDFADVRAVMADAG  273

Query  594   TAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVV  415
             +A++G+G+ S K+RA EAA  A  +PL+ SS++ A GVV+NITGG D+TL EVN  ++ +
Sbjct  274   SALMGIGIGSGKSRAREAAMAAISSPLLESSVEGARGVVFNITGGSDLTLHEVNAAAETI  333

Query  414   TSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
               + DP+ANIIFGAV+D+R  GEI +T+IATGFT
Sbjct  334   YEVVDPNANIIFGAVIDDRLQGEIRITVIATGFT  367



>gb|AIE75824.1| Cell division protein FtsZ [Synechocystis sp. PCC 6714]
Length=430

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 190/327 (58%), Positives = 254/327 (78%), Gaps = 9/327 (3%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G+DF+AINTD+Q+L  + A   IQIG+ LTRGLG GGNP +G++AAEES++ 
Sbjct  84    RMIASGVTGIDFWAINTDSQALTNTTAPDRIQIGQKLTRGLGAGGNPAIGQKAAEESRDE  143

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA +L+G+D+VFITAGMGGGTG+GAAP+VA+++KE G LTVG+VT PF+FEGR+R+ QA 
Sbjct  144   IARSLEGTDLVFITAGMGGGTGTGAAPIVAEVAKEMGCLTVGIVTRPFTFEGRRRAKQAE  203

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLIVIPN++LL +   +TPLQ+AF +ADD+LRQGVQGISDII IPGLVN
Sbjct  204   EGISALQSRVDTLIVIPNNQLLSVIPAETPLQEAFRVADDILRQGVQGISDIIIIPGLVN  263

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+GV S K+RA+EAA  A  +PL+ SSIQ A GVV+N+TGG 
Sbjct  264   VDFADVRAVMADAGSALMGIGVGSGKSRAKEAATAAISSPLLESSIQGAKGVVFNVTGGT  323

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT--------QSFQ  301
             D+TL EVN  ++++  + DP ANIIFGAV+D+R  GE+ +T+IATGF         ++  
Sbjct  324   DLTLHEVNVAAEIIYEVVDPDANIIFGAVIDDRLQGEMRITVIATGFNGEKEKPQAKATN  383

Query  300   RTLLTD-PRGAKAGDKGAGSQENAGSL  223
             RT+L+  P G +  +  A S++  G +
Sbjct  384   RTVLSGPPAGVEMVESAAASEDPLGEI  410



>ref|WP_012161432.1| cell division protein FtsZ [Acaryochloris marina]
 ref|YP_001515164.1| cell division protein FtsZ [Acaryochloris marina MBIC11017]
 gb|ABW25850.1| cell division protein FtsZ [Acaryochloris marina MBIC11017]
Length=375

 Score =   321 bits (823),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 190/307 (62%), Positives = 242/307 (79%), Gaps = 4/307 (1%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F++INTDAQSL QS+A   +Q+G+ LTRGLG GGNP +G++AAEES++ 
Sbjct  31    RMIASNVSGVEFWSINTDAQSLTQSSAAKRLQVGQKLTRGLGAGGNPAIGQKAAEESRDD  90

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL GSD+VFIT GMGGGTG+GAAP++A+I+KE G LTVGVVT PF+FEGR+RS QA 
Sbjct  91    IAAALAGSDLVFITCGMGGGTGTGAAPIIAEIAKEMGALTVGVVTRPFTFEGRRRSHQAE  150

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLI+IPND++L +  EQTP+Q+AF  ADDVLRQGVQGISDII +PGLVN
Sbjct  151   EGIAALQTRVDTLIMIPNDKILSVIAEQTPVQEAFQTADDVLRQGVQGISDIINVPGLVN  210

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADVKA+M D+G+AM+G+GV S K+RA+EAA  A  +PL+ +SI+ A GVV+NITGG 
Sbjct  211   VDFADVKAIMADAGSAMMGIGVGSGKSRAKEAAIAAIDSPLLDASIRGAKGVVFNITGGH  270

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPR  277
             D++L EVN  ++ +  + D SANIIFGAV+DE   GEI +T+IATGF+        T PR
Sbjct  271   DLSLHEVNTAAETIYEVVDASANIIFGAVIDESLQGEIKMTVIATGFSSDAG----TPPR  326

Query  276   GAKAGDK  256
              ++A  K
Sbjct  327   KSEAKPK  333



>ref|WP_002781797.1| Cell division protein ftsZ [Microcystis aeruginosa]
 emb|CCI16360.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9806]
Length=415

 Score =   322 bits (826),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 240/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +   +TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPAETPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS  368



>ref|WP_015180997.1| cell division protein FtsZ [Microcoleus sp. PCC 7113]
 ref|YP_007120243.1| cell division protein FtsZ [Microcoleus sp. PCC 7113]
 gb|AFZ16837.1| cell division protein FtsZ [Microcoleus sp. PCC 7113]
Length=423

 Score =   323 bits (827),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 183/292 (63%), Positives = 241/292 (83%), Gaps = 0/292 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F++INTD+Q+L Q+AA   +Q+G+ LTRGLG GGNP +G++AAEES+E 
Sbjct  82    RMIASEVSGVEFWSINTDSQALAQNAAARRLQMGQKLTRGLGAGGNPAIGQKAAEESREE  141

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA+A++ +D+VFITAGMGGGTG+GAAP+VA+++KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  142   IAHAIENADLVFITAGMGGGTGTGAAPIVAEVAKEMGALTVGVVTRPFTFEGRRRTTQAE  201

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLIVIPN++LL + +EQTP+Q+AF +ADD+LRQGVQGISDIITIPGLVN
Sbjct  202   EGIAALQSRVDTLIVIPNNKLLSVINEQTPVQEAFRVADDILRQGVQGISDIITIPGLVN  261

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA EAA QA  +PL+ +SI  A GVV NITGG 
Sbjct  262   VDFADVRAVMADAGSALMGIGIGSGKSRAREAASQAISSPLLEASIDGARGVVLNITGGS  321

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQ  301
             D+TL EVN  ++ V  + DP+ANIIFGAV+D++  GE+ +T+IATGF+   Q
Sbjct  322   DLTLHEVNAAAETVYEVVDPNANIIFGAVIDDKMQGEVRITVIATGFSGETQ  373



>ref|WP_002801422.1| cell division protein FtsZ [Microcystis aeruginosa]
 emb|CCI39019.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9701]
Length=415

 Score =   322 bits (826),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 240/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +   +TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPAETPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS  368



>ref|WP_015164337.1| cell division protein FtsZ [Pseudanabaena sp. PCC 7367]
 ref|YP_007101792.1| cell division protein FtsZ [Pseudanabaena sp. PCC 7367]
 gb|AFY69364.1| cell division protein FtsZ [Pseudanabaena sp. PCC 7367]
Length=428

 Score =   323 bits (827),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 193/310 (62%), Positives = 256/310 (83%), Gaps = 0/310 (0%)
 Frame = -3

Query  1239  PMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltr  1060
             P   AKIKV+GVGG G NAVNRMI S + GV+F+++NTDAQ+L+QS+A    Q+G+ LTR
Sbjct  65    PGSMAKIKVIGVGGAGGNAVNRMIASEVSGVEFWSVNTDAQALIQSSASQRFQLGQKLTR  124

Query  1059  glgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYL  880
             GLG GGNP +G++AAEES++ IA A++G+D+VFITAGMGGGTG+GAAP++A+++KE G L
Sbjct  125   GLGAGGNPAIGQKAAEESRDDIAAAIEGADLVFITAGMGGGTGTGAAPIIAEVAKETGAL  184

Query  879   TVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLAD  700
             T+GVVT PF+FEGR+R+ Q+ + +E LQ  VDTLI+IPND+LL +  EQTP+Q+AF +AD
Sbjct  185   TIGVVTRPFTFEGRRRTQQSEDGVESLQSRVDTLIIIPNDKLLSVISEQTPVQEAFRVAD  244

Query  699   DVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLA  520
             DVLRQGVQGISDIITIPGLVNVDFAD++AVM D+G+A++G+G  S K+RA EAA  A  +
Sbjct  245   DVLRQGVQGISDIITIPGLVNVDFADIRAVMADAGSALMGIGTGSGKSRAREAAMTAISS  304

Query  519   PLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIH  340
             PL+ +SI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D+   GEI 
Sbjct  305   PLLEASIEGANGVVFNITGGSDLTLHEVNAAAETIYEVVDPNANIIFGAVIDDSMEGEIR  364

Query  339   VTIIATGFTQ  310
             +T+IATGF+Q
Sbjct  365   ITVIATGFSQ  374



>ref|WP_002742535.1| cell division protein FtsZ [Microcystis aeruginosa]
 emb|CAO87356.1| ftsZ [Microcystis aeruginosa PCC 7806]
 gb|ELS48887.1| cell division protein FtsZ [Microcystis aeruginosa DIANCHI905]
Length=415

 Score =   322 bits (825),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 240/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +   +TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPAETPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS  368



>ref|WP_008206746.1| cell division protein FtsZ [Microcystis sp. T1-4]
 emb|CCI34382.1| Cell division protein ftsZ [Microcystis sp. T1-4]
Length=415

 Score =   322 bits (825),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 240/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +   +TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPAETPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS  368



>ref|WP_038027290.1| cell division protein FtsZ [Synechococcus sp. PCC 7336]
Length=369

 Score =   320 bits (821),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 199/310 (64%), Positives = 250/310 (81%), Gaps = 0/310 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P  +AKIKVVGVGGGG NAVNRM+ S L GV+F+ INTDAQ+L+QS +   +QIG+ L
Sbjct  8     IVPGSAAKIKVVGVGGGGGNAVNRMVASSLNGVEFWTINTDAQALVQSQSMQRLQIGQKL  67

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES + I  AL+G+D+VFI AGMGGGTG+GAAP+VAQI+KE G
Sbjct  68    TRGLGAGGNPAVGQKAAEESHDEIQAALEGADLVFIAAGMGGGTGTGAAPIVAQIAKETG  127

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF+FEGR+R+ Q+ E I  LQ  VDTLIVIPND+LL +  EQTP+Q+AF +
Sbjct  128   ALTVGVVTRPFTFEGRRRTKQSNEGIVALQTCVDTLIVIPNDKLLSVISEQTPVQEAFRV  187

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADV++VM D+G+A++G+G+ S K+RA EAA  A 
Sbjct  188   ADDVLRQGVQGISDIITIPGLVNVDFADVRSVMADAGSALMGIGMGSGKSRAREAAMTAI  247

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ SSI  A GV+ N+TGG+D+TL EV   S+++    D  ANIIFGAV+DE+  GE
Sbjct  248   SSPLLESSIDGAKGVLLNVTGGEDLTLHEVTAASEIIAEAVDEEANIIFGAVIDEKMQGE  307

Query  345   IHVTIIATGF  316
             I +T+IATGF
Sbjct  308   IRITVIATGF  317



>ref|WP_039778672.1| cell division protein FtsZ [Acaryochloris sp. CCMEE 5410]
Length=375

 Score =   320 bits (821),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 185/288 (64%), Positives = 235/288 (82%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F++INTDAQSL QS+A   +Q+G+ LTRGLG GGNP +G++AAEES++ 
Sbjct  31    RMIASNVSGVEFWSINTDAQSLTQSSAAKRLQVGQKLTRGLGAGGNPAIGQKAAEESRDD  90

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL GSD+VFIT GMGGGTG+GAAP++A+I+KE G LTVGVVT PF+FEGR+RS QA 
Sbjct  91    IAAALAGSDLVFITCGMGGGTGTGAAPIIAEIAKEMGALTVGVVTRPFTFEGRRRSHQAE  150

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLI+IPND++L +  EQTP+Q+AF  ADDVLRQGVQGISDII +PGLVN
Sbjct  151   EGIAALQTRVDTLIMIPNDKILSVIAEQTPVQEAFQTADDVLRQGVQGISDIINVPGLVN  210

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADVKA+M D+G+AM+G+GV S K+RA+EAA  A  +PL+ +SI+ A GVV+NITGG 
Sbjct  211   VDFADVKAIMADAGSAMMGIGVGSGKSRAKEAAIAAIDSPLLDASIRGAKGVVFNITGGH  270

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D++L EVN  ++ +  + D SANIIFGAV+DE   GEI +T+IATGF+
Sbjct  271   DLSLHEVNTAAETIYEVVDASANIIFGAVIDESLQGEIKMTVIATGFS  318



>ref|WP_004161871.1| cell division protein FtsZ [Microcystis aeruginosa]
 emb|CCI23219.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9808]
Length=415

 Score =   322 bits (825),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 240/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +   +TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPAETPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS  368



>ref|WP_037222028.1| cell division protein FtsZ [Richelia intracellularis]
 emb|CDN14743.1| Cell division protein FtsZ [Richelia intracellularis]
Length=434

 Score =   322 bits (826),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 199/311 (64%), Positives = 256/311 (82%), Gaps = 0/311 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              IP   A IKV+GVGGGG NAVNRMI S + GV+F+ INTDAQ+L  +++ + +QIG+ L
Sbjct  58    IIPGRVANIKVIGVGGGGGNAVNRMIASDVSGVEFWTINTDAQALTLASSPSRLQIGQKL  117

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  118   TRGLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMG  177

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF FEGR+R+ QA + IE L+  VDTLI+IPN++LL++  EQTP+Q+AF  
Sbjct  178   ALTVGVVTRPFVFEGRRRTTQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQTPVQEAFRY  237

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GVSS K+RA EAA  A 
Sbjct  238   ADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVSSGKSRAREAAVAAI  297

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+  SI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D+R  GE
Sbjct  298   SSPLLECSIEGARGVVFNITGGSDLTLHEVNSAAEAIYEVVDPNANIIFGAVIDDRLQGE  357

Query  345   IHVTIIATGFT  313
             + +T+IATGFT
Sbjct  358   VRITVIATGFT  368



>ref|WP_002778450.1| cell division protein FtsZ [Microcystis aeruginosa]
 emb|CCI08634.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 7941]
 gb|EPF21322.1| Cell division protein FtsZ [Microcystis aeruginosa SPC777]
 gb|EPF24821.1| Cell division protein FtsZ [Microcystis aeruginosa SPC777]
Length=415

 Score =   322 bits (824),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 240/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +   +TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPAETPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS  368



>ref|WP_002738456.1| cell division protein FtsZ [Microcystis aeruginosa]
 emb|CCH94493.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9432]
 gb|ELP52604.1| cell division protein FtsZ [Microcystis aeruginosa TAIHU98]
Length=415

 Score =   322 bits (824),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 240/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +   +TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPAETPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS  368



>ref|WP_002765213.1| cell division protein FtsZ [Microcystis aeruginosa]
 emb|CCI05063.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9443]
Length=415

 Score =   322 bits (824),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 239/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +    TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPADTPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS  368



>ref|WP_015221984.1| cell division protein FtsZ [Cyanobacterium stanieri]
 ref|YP_007164315.1| cell division protein FtsZ [Cyanobacterium stanieri PCC 7202]
 gb|AFZ46666.1| cell division protein FtsZ [Cyanobacterium stanieri PCC 7202]
Length=418

 Score =   322 bits (824),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 199/311 (64%), Positives = 254/311 (82%), Gaps = 0/311 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P + A+IKV+GVGGGG NAVNRMI S + GV+F+ INTDAQ+L +S A   +QIG+ L
Sbjct  49    IVPSNVAQIKVIGVGGGGCNAVNRMIQSSVSGVEFWQINTDAQALTESMATYCLQIGQKL  108

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES+E IA AL+ +D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  109   TRGLGAGGNPSIGQKAAEESREEIAKALENTDLVFITAGMGGGTGTGAAPIVAEVAKEMG  168

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF+FEGR+R+ QA + I  LQ  VDTLIVIPN++LL +    TPLQ++F +
Sbjct  169   CLTVGVVTRPFTFEGRRRTTQADDGISALQSRVDTLIVIPNNKLLSVIPSDTPLQESFRI  228

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADD+LRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+G+ S K+RA+E+A  A 
Sbjct  229   ADDILRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRAKESAVAAI  288

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PLI SSIQ A GVV NITGG D+TL EVN V++ +  + DP+ANIIFGAV+DE   GE
Sbjct  289   SSPLIESSIQGAKGVVLNITGGNDLTLHEVNTVAETIYDIVDPNANIIFGAVIDESMQGE  348

Query  345   IHVTIIATGFT  313
             I +T+IATGF+
Sbjct  349   IRITVIATGFS  359



>ref|WP_007355195.1| MULTISPECIES: cell division protein FtsZ [Kamptonema]
 emb|CBN55980.1| cell division protein FtsZ [ [[Oscillatoria] sp. PCC 6506]
Length=420

 Score =   322 bits (824),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 257/320 (80%), Gaps = 1/320 (0%)
 Frame = -3

Query  1269  RRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQT  1090
             R  S     +P  +A+IKV+GVGGGGNNAVNRMI S + GV+F+ +NTDAQ+L  S A  
Sbjct  52    REESRSGDIVPSSAARIKVIGVGGGGNNAVNRMIASEVAGVEFWTVNTDAQALSLSNAPK  111

Query  1089  PIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVV  910
              +Q+G+ LTRGLG GGNP +G++AAEES++ I NAL  SD+VFITAGMGGGTG+GAAP+V
Sbjct  112   RLQVGQKLTRGLGAGGNPAIGQKAAEESRDEIVNALSNSDLVFITAGMGGGTGTGAAPIV  171

Query  909   AQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQT  730
             A+++KE G LTVGVVT PF+FEGR+R+ QA E I  LQ  VDTLIVIPND+LL +  EQ 
Sbjct  172   AEVAKEMGALTVGVVTRPFTFEGRRRTSQADEGIAALQSRVDTLIVIPNDKLLSVISEQM  231

Query  729   PLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRA  550
             P+Q+AF +ADD+LRQGVQGISDIIT+PGLVNVDFADV+AVM D+G+A++G+G+ S K+RA
Sbjct  232   PVQEAFRVADDILRQGVQGISDIITVPGLVNVDFADVRAVMADAGSALMGIGLGSGKSRA  291

Query  549   EEAAEQATLAPLI-GSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  373
              EAA QA  +PL+  SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGA
Sbjct  292   REAAMQAISSPLLEASSIEGARGVVFNITGGTDMTLHEVNAAAETIYEVVDPNANIIFGA  351

Query  372   VVDERYNGEIHVTIIATGFT  313
             V+DER  GEI +T+IATGF+
Sbjct  352   VIDERLQGEIKITVIATGFS  371



>ref|WP_026099047.1| cell division protein FtsZ [Oscillatoria sp. PCC 10802]
Length=423

 Score =   321 bits (823),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 199/311 (64%), Positives = 253/311 (81%), Gaps = 0/311 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A+IKV+GVGGGG NA+NRMI S + GV+F+ INTDAQ+L QS+A   +QIG+ L
Sbjct  58    IVPSTIARIKVIGVGGGGGNAINRMIASDVSGVEFWTINTDAQALNQSSAPQRLQIGQKL  117

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA AL   D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  118   TRGLGAGGNPAIGQKAAEESRDEIAQALGQCDLVFITAGMGGGTGTGAAPIVAEVAKEVG  177

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF+FEGR+R+ QA E I  LQ  VDTLI+IPND+LL +  EQTP+Q+AF +
Sbjct  178   ALTVGVVTRPFTFEGRRRTSQADEGINALQSRVDTLIIIPNDKLLAVISEQTPVQEAFRV  237

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADD+LRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+G+ S K+RA EAA  A 
Sbjct  238   ADDILRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRAREAATAAI  297

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ SSI+ A GVV+NITGG D+TL EV+  + ++    DP+ANIIFGAV+D+R  GE
Sbjct  298   SSPLLESSIEGAKGVVFNITGGSDLTLHEVSGAADIIYEAVDPNANIIFGAVIDDRLQGE  357

Query  345   IHVTIIATGFT  313
             I +T+IATGFT
Sbjct  358   IRITVIATGFT  368



>ref|WP_002789310.1| cell division protein FtsZ [Microcystis aeruginosa]
 emb|CCI19274.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9807]
Length=415

 Score =   321 bits (822),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 239/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +    TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPADTPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS  368



>ref|WP_006457598.1| cell division protein FtsZ [Synechococcus sp. PCC 7335]
 gb|EDX87769.1| cell division protein FtsZ [Synechococcus sp. PCC 7335]
Length=412

 Score =   321 bits (822),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 196/311 (63%), Positives = 254/311 (82%), Gaps = 0/311 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A+IKV+GVGGGG NAVNRMI +GL G++F+ +NTDAQ+L  S+    +Q+G+ L
Sbjct  40    IVPSSVARIKVIGVGGGGCNAVNRMIDTGLVGIEFWTVNTDAQALTYSSTTNAMQLGQKL  99

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ I  AL+GSD+VFITAGMGGGTG+GAAPVVA+ +KEAG
Sbjct  100   TRGLGAGGNPSIGQKAAEESRDEIFQALEGSDLVFITAGMGGGTGTGAAPVVAECAKEAG  159

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGV+T PF+FEGR+R+ QA   I  LQ  VDTLI+IPND+LL +  EQTP+Q+AF +
Sbjct  160   ALTVGVITRPFTFEGRRRTSQADSGIAALQACVDTLIIIPNDKLLSVISEQTPVQEAFRV  219

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADD+LRQGVQGISDIITI GLVNVDFADV+AVM D+G+A++G+GV S K+RA EAA  AT
Sbjct  220   ADDILRQGVQGISDIITISGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAREAAIAAT  279

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ +SI  A GVV+NITGG D+TL EVN+ ++++    DP+ANIIFGAV+D+R  GE
Sbjct  280   SSPLLETSINGAGGVVFNITGGNDLTLHEVNQAAEIIYESVDPNANIIFGAVIDDRLQGE  339

Query  345   IHVTIIATGFT  313
             + +T+IATGF+
Sbjct  340   VRITVIATGFS  350



>ref|WP_002756934.1| cell division protein FtsZ [Microcystis aeruginosa]
 emb|CCH97661.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9717]
 emb|CCI28972.1| Cell division protein ftsZ [Microcystis aeruginosa PCC 9809]
Length=415

 Score =   321 bits (822),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 239/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +    TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPADTPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS  368



>dbj|GAL92496.1| cell division protein FtsZ [Microcystis aeruginosa NIES-44]
Length=415

 Score =   321 bits (822),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 239/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +    TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPADTPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS  368



>ref|WP_012265734.1| cell division protein FtsZ [Microcystis aeruginosa]
 ref|YP_001657656.1| cell division protein FtsZ [Microcystis aeruginosa NIES-843]
 dbj|BAG02464.1| cell division protein [Microcystis aeruginosa NIES-843]
Length=415

 Score =   321 bits (822),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 239/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L  S+A   +QIG  LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASGVTGIEFWAINTDAQALAHSSAPQRLQIGTKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEGTDLVFITAGMGGGTGTGAAPIVAEIAKEIGCLTVGVVTRPFTFEGRRRTNQAD  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLI+IPN++LL +    TPLQ+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  201   EGVGGLQSRVDTLIIIPNNQLLQVIPADTPLQEAFRVADDVLRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSI+ A GVV+NITGG+
Sbjct  261   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLLESSIEGAKGVVFNITGGQ  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++  + DP+ANIIFGAV+DE+  GE+ +T+IATGF+
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDEKMQGEVRITVIATGFS  368



>ref|WP_017303420.1| hypothetical protein [Spirulina subsalsa]
Length=382

 Score =   319 bits (818),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 197/334 (59%), Positives = 265/334 (79%), Gaps = 7/334 (2%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P ++A+IKV+GVGGGG NAVNRMI SG+ GV+F+AINTD+Q+L  +AA   +QIG+ L
Sbjct  6     IVPSNAAQIKVIGVGGGGCNAVNRMIASGITGVEFWAINTDSQALELTAAPHRLQIGQKL  65

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IANAL+G+D+VFIT+GMGGGTG+GA+ +VA+++KE G
Sbjct  66    TRGLGAGGNPAIGQKAAEESRDEIANALEGTDLVFITSGMGGGTGTGASAIVAEVAKEIG  125

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVG+VT PF+FEG +R+ QA E I  LQ  VDTLIVIPN++LL +   +TP+Q AF++
Sbjct  126   CLTVGIVTRPFTFEGHRRTTQANEGIAALQGRVDTLIVIPNNKLLSVISPETPVQQAFMV  185

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADD+LRQGVQGISDII IPGLVNVDFADV+AVM D+G+A++G+G  S K+RA EAA  A 
Sbjct  186   ADDILRQGVQGISDIIIIPGLVNVDFADVRAVMADAGSALMGIGTGSGKSRAREAASMAI  245

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D++  GE
Sbjct  246   SSPLLESSIEGAKGVVFNITGGSDLTLHEVNTAAETIYEVVDPNANIIFGAVIDDQSQGE  305

Query  345   IHVTIIATGF-------TQSFQRTLLTDPRGAKA  265
             + +T+IATGF       + +  RT+ T P+  +A
Sbjct  306   LTITVIATGFSGETPAKSTTSGRTIPTAPKPNRA  339



>ref|WP_039716790.1| cell division protein FtsZ [Scytonema millei]
 gb|KIF19305.1| cell division protein FtsZ [Scytonema millei VB511283]
Length=421

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 201/315 (64%), Positives = 253/315 (80%), Gaps = 0/315 (0%)
 Frame = -3

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
              + +P   A IKV+GVGGGG NAVNRMI SG+ GV+F++INTDAQ+L  SAA   +QIG+
Sbjct  57    SNILPSRVANIKVIGVGGGGGNAVNRMIESGVTGVEFWSINTDAQALTHSAAPRKLQIGQ  116

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
              LTRGLG GGNP +GE+AAEES++ IANA+  +D+VFITAGMGGGTG+GAAP VA+I+KE
Sbjct  117   KLTRGLGAGGNPAMGEKAAEESRDEIANAIGEADLVFITAGMGGGTGTGAAPTVAEIAKE  176

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
              G LTVGVVT PF FEGR+R+ QA + I+ L+  VDT+I+IPND+LL +  EQT L+DAF
Sbjct  177   KGILTVGVVTRPFGFEGRRRANQAHQGIDALKDRVDTMILIPNDKLLSVISEQTALRDAF  236

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
             L AD+VLRQGVQGISDIITIPGLVNVDFADVKAVM D+G+A++G+G  S K RA+EAA  
Sbjct  237   LTADEVLRQGVQGISDIITIPGLVNVDFADVKAVMADAGSALMGIGTGSGKTRAKEAANA  296

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             A  +PL+ SSI+ A GVV NITGG D+TL EVN  +  +  + DP+ANIIFGAV+D++  
Sbjct  297   AISSPLLESSIEGAKGVVINITGGSDMTLHEVNMAADTIYEVVDPNANIIFGAVIDDKLQ  356

Query  351   GEIHVTIIATGFTQS  307
             GE+ +T+IATGF Q+
Sbjct  357   GEMKITVIATGFNQA  371



>ref|WP_015225997.1| cell division protein FtsZ [Halothece sp. PCC 7418]
 ref|YP_007168336.1| cell division protein FtsZ [Halothece sp. PCC 7418]
 gb|AFZ44122.1| cell division protein FtsZ [Halothece sp. PCC 7418]
Length=420

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 198/313 (63%), Positives = 257/313 (82%), Gaps = 1/313 (0%)
 Frame = -3

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             + +P + A+IKV+GVGG G NAVNRMI S + GV+F+AINTDAQ+L +++A   +Q+GE 
Sbjct  55    NIVPGNVARIKVIGVGGAGCNAVNRMIASDVTGVEFWAINTDAQALSRASAPNRLQVGEK  114

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLG GGNP +G++AAEES++ I++AL+ +D+ FITAGMGGGTG+GAAP+VA+++KE 
Sbjct  115   LTRGLGAGGNPSIGQKAAEESRDEISSALENTDLAFITAGMGGGTGTGAAPIVAEVAKEM  174

Query  888   GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  709
             G LTVGVVT PF+FEGR+R+ QA E    LQ  VDTLIVIPN++LL + DEQTP+QDAF 
Sbjct  175   GCLTVGVVTRPFTFEGRRRTSQAEEGTSALQTRVDTLIVIPNNKLLSVIDEQTPVQDAFR  234

Query  708   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  529
             +ADD+LRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+G +S K+RA EAA  A
Sbjct  235   VADDILRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGTASGKSRAAEAATGA  294

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVV-DERYN  352
               +PL+ SSIQ A GVV+NITGG D+TL EVN  ++ +    DP+ANIIFGAV+ DE+  
Sbjct  295   ISSPLLESSIQGAKGVVFNITGGSDLTLHEVNTAAETIYDNVDPNANIIFGAVIDDEKME  354

Query  351   GEIHVTIIATGFT  313
             GEI +T+IATGF+
Sbjct  355   GEIRITVIATGFS  367



>ref|WP_019499271.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=424

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 183/289 (63%), Positives = 240/289 (83%), Gaps = 0/289 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F+A+NTDAQ+LLQSAA    Q+G+ LTRGLG GGNP +G++AAEES++ 
Sbjct  84    RMIVSEVAGVEFWAVNTDAQALLQSAAPKRFQMGQKLTRGLGAGGNPSIGQKAAEESRDE  143

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAPV+A+I+K  G LTVGVVT PF+FEG+KR  QA 
Sbjct  144   IAQALEGADLVFITAGMGGGTGTGAAPVIAEIAKGVGALTVGVVTKPFTFEGKKRINQAT  203

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             + IE+LQ +VDTLIVIPND+LL +  E TP+Q+AF +ADDVLRQGVQGISDIITIPGLVN
Sbjct  204   DGIEQLQGHVDTLIVIPNDKLLSVVPENTPVQEAFRIADDVLRQGVQGISDIITIPGLVN  263

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+A+M D+G+A++G+G+ S K+RA EAA  A  +PL+ +SI+ A GVV+NITGG 
Sbjct  264   VDFADVRAIMADAGSALMGIGLGSGKSRAREAAMTAISSPLLEASIEGANGVVFNITGGN  323

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQ  310
             D+TL EV   ++ +  + DP+ANIIFGAV+D++ +GE+ +T+IATGF+ 
Sbjct  324   DLTLHEVTAAAETIYEVVDPNANIIFGAVIDDKMDGEVRITVIATGFSH  372



>ref|WP_015117120.1| cell division protein FtsZ [Rivularia sp. PCC 7116]
 ref|YP_007054089.1| cell division protein FtsZ [Rivularia sp. PCC 7116]
 gb|AFY53542.1| cell division protein FtsZ [Rivularia sp. PCC 7116]
Length=440

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 199/315 (63%), Positives = 255/315 (81%), Gaps = 0/315 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              IP   A IKV+GVGGGG NAVNRMI S L GV+F++INTDAQ+L  +AA   +QIG+ L
Sbjct  63    IIPGRVANIKVIGVGGGGGNAVNRMIASDLSGVEFWSINTDAQALTMAAAPCRLQIGQKL  122

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGMGGGTG+GAA VVA+++KE G
Sbjct  123   TRGLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAASVVAEVAKEMG  182

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF FEGR+R+ QA + +E L+  VDTLI+IPN++LL++  EQTP+Q+AF  
Sbjct  183   ALTVGVVTRPFVFEGRRRTTQAEQGVEALKSRVDTLIIIPNNKLLEVIPEQTPVQEAFRY  242

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+G+ S K+R+ EAA  A 
Sbjct  243   ADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRSREAAIAAI  302

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+  SI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D+R  GE
Sbjct  303   SSPLLECSIEGARGVVFNITGGSDLTLHEVNAAAEAIYEVVDPNANIIFGAVIDDRLEGE  362

Query  345   IHVTIIATGFTQSFQ  301
             + +T+IATGFT   Q
Sbjct  363   VRITVIATGFTGEIQ  377



>ref|WP_017712109.1| cell division protein FtsZ [Prochlorothrix hollandica]
Length=381

 Score =   318 bits (816),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 257/312 (82%), Gaps = 0/312 (0%)
 Frame = -3

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
              + IP   A+IKV+GVGGGG+NAVNRMI S L GV+F+A+NTDAQ+LL +A    +QIG+
Sbjct  5     SNIIPSSIARIKVIGVGGGGSNAVNRMIASDLGGVEFWAMNTDAQALLNAATIQRLQIGQ  64

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
              LTRGLG GGNP +G++AAEES++ IA AL+ +D+VFITAGMGGGTG+GAAP+VA+++KE
Sbjct  65    KLTRGLGAGGNPAIGQKAAEESRDEIAKALEHADLVFITAGMGGGTGTGAAPIVAEVAKE  124

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
              G LTVG++T PF+FEGR+R +QA E I  LQ  VDTLI+IPND+LL +  +QTP+Q+AF
Sbjct  125   LGALTVGIITRPFTFEGRRRQMQADEGIAALQTRVDTLIMIPNDKLLAVISDQTPVQEAF  184

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
              +ADD+LRQGVQGISDIITIPGLVNVDFAD++AVM D+G+AM+G+G+ S K+RA+EAA  
Sbjct  185   RMADDILRQGVQGISDIITIPGLVNVDFADIRAVMADAGSAMMGIGIGSGKSRAKEAAAA  244

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             A  +PL+ +S++ A GVV+NITGG D+TL EVN  ++ +  + DP ANIIFG+V+DER  
Sbjct  245   AISSPLLDASVEGAKGVVFNITGGSDLTLHEVNAAAETIYEVVDPEANIIFGSVIDERLQ  304

Query  351   GEIHVTIIATGF  316
             GE+ +T+IATGF
Sbjct  305   GEVQITVIATGF  316



>ref|WP_015154609.1| cell division protein FtsZ [Chroococcidiopsis thermalis]
 ref|YP_007091931.1| cell division protein FtsZ [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY88062.1| cell division protein FtsZ [Chroococcidiopsis thermalis PCC 7203]
Length=421

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 201/315 (64%), Positives = 252/315 (80%), Gaps = 0/315 (0%)
 Frame = -3

Query  1251  CSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIge  1072
              + +P   A IKV+GVGGGG NAVNRMI SG+ GV+F++INTDAQ+L  SAA   +QIG+
Sbjct  57    SNILPSRVANIKVIGVGGGGGNAVNRMIESGVTGVEFWSINTDAQALTHSAAPRKLQIGQ  116

Query  1071  lltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKE  892
              LTRGLG GGNP +GE+AAEES++ IANA+  +D+VFITAGMGGGTG+GAAP VA+I+KE
Sbjct  117   KLTRGLGAGGNPAMGEKAAEESRDEIANAIGEADLVFITAGMGGGTGTGAAPTVAEIAKE  176

Query  891   AGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAF  712
              G LTVGVVT PF FEGR+R+ QA + I+ L+  VDT+I+IPND+LL +  EQT L+DAF
Sbjct  177   KGILTVGVVTRPFGFEGRRRANQAHQGIDALKDRVDTMILIPNDKLLSVISEQTALRDAF  236

Query  711   LLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQ  532
             L AD+VLRQGVQGISDIITIPGLVNVDFADVKAVM D+G+A++G+G  S K RA EAA  
Sbjct  237   LTADEVLRQGVQGISDIITIPGLVNVDFADVKAVMADAGSALMGIGTGSGKTRAREAANA  296

Query  531   ATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYN  352
             A  +PL+ SSI+ A GVV NITGG D+TL EVN  +  +  + DP+ANIIFGAV+D++  
Sbjct  297   AISSPLLESSIEGAKGVVINITGGSDMTLHEVNMAADTIYEVVDPNANIIFGAVIDDKLQ  356

Query  351   GEIHVTIIATGFTQS  307
             GE+ +T+IATGF Q+
Sbjct  357   GEMKITVIATGFNQA  371



>ref|WP_008186504.1| cell division protein FtsZ [Moorea producens]
 gb|EGJ31657.1| cell division protein FtsZ [Moorea producens 3L]
Length=423

 Score =   320 bits (819),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 186/292 (64%), Positives = 238/292 (82%), Gaps = 0/292 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F++INTDAQ+L QS+A   +Q+G+ LTRGLG GGNP +G++AAEES+E 
Sbjct  81    RMIASDVSGVEFWSINTDAQALAQSSAPQRLQMGQKLTRGLGAGGNPAIGQKAAEESREE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+ +D+VFITAGMGGGTG+GAAP+VA+++KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  141   IAQALEDTDLVFITAGMGGGTGTGAAPIVAEVAKEMGALTVGVVTRPFTFEGRRRTSQAE  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  L   VDTLIVIPN++LL +  EQTP+Q+AF +ADD+LRQGVQGISDIITIPGLVN
Sbjct  201   EGIAALGSRVDTLIVIPNNKLLSVISEQTPVQEAFKVADDILRQGVQGISDIITIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA EAA  A  +PL+ SSI+ A GVV NITGG 
Sbjct  261   VDFADVRAVMADAGSALMGIGMGSGKSRAREAAVAAISSPLLESSIEGARGVVLNITGGS  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQ  301
             D+TL EVN  ++ V  + DP+ANIIFGAV+D++  GEI +T+IATGFT   Q
Sbjct  321   DLTLHEVNSAAETVYEVVDPNANIIFGAVIDDKLQGEIRITVIATGFTGEAQ  372



>ref|WP_010468588.1| cell division protein FtsZ [Acaryochloris sp. CCMEE 5410]
Length=437

 Score =   320 bits (819),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 185/288 (64%), Positives = 235/288 (82%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F++INTDAQSL QS+A   +Q+G+ LTRGLG GGNP +G++AAEES++ 
Sbjct  93    RMIASNVSGVEFWSINTDAQSLTQSSAAKRLQVGQKLTRGLGAGGNPAIGQKAAEESRDD  152

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL GSD+VFIT GMGGGTG+GAAP++A+I+KE G LTVGVVT PF+FEGR+RS QA 
Sbjct  153   IAAALAGSDLVFITCGMGGGTGTGAAPIIAEIAKEMGALTVGVVTRPFTFEGRRRSHQAE  212

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLI+IPND++L +  EQTP+Q+AF  ADDVLRQGVQGISDII +PGLVN
Sbjct  213   EGIAALQTRVDTLIMIPNDKILSVIAEQTPVQEAFQTADDVLRQGVQGISDIINVPGLVN  272

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADVKA+M D+G+AM+G+GV S K+RA+EAA  A  +PL+ +SI+ A GVV+NITGG 
Sbjct  273   VDFADVKAIMADAGSAMMGIGVGSGKSRAKEAAIAAIDSPLLDASIRGAKGVVFNITGGH  332

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D++L EVN  ++ +  + D SANIIFGAV+DE   GEI +T+IATGF+
Sbjct  333   DLSLHEVNTAAETIYEVVDASANIIFGAVIDESLQGEIKMTVIATGFS  380



>ref|WP_015142504.1| cell division protein FtsZ [Pleurocapsa minor]
 ref|YP_007079753.1| cell division protein FtsZ [Pleurocapsa sp. PCC 7327]
 gb|AFY76196.1| cell division protein FtsZ [Pleurocapsa sp. PCC 7327]
Length=416

 Score =   319 bits (817),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 180/292 (62%), Positives = 239/292 (82%), Gaps = 0/292 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G++F+AINTDAQ+L QS A   +QIG+ LTRGLG GGNP +G++AAEES+E 
Sbjct  79    RMIESGVSGIEFWAINTDAQALSQSEAPQRLQIGQKLTRGLGAGGNPAIGQKAAEESREE  138

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA+AL+ +D+VFITAGMGGGTG+GAAP+VA+++KE G LTVGVVT PF+FEGR+R+  A 
Sbjct  139   IAHALENTDLVFITAGMGGGTGTGAAPIVAEVAKEIGCLTVGVVTRPFTFEGRRRNSHAE  198

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ  VDTLIVIPN++LL +A+ +TP+Q+AF +ADD+LRQGVQGISDIITIPGL+N
Sbjct  199   EGVSNLQSRVDTLIVIPNNQLLAVANAETPMQEAFRMADDILRQGVQGISDIITIPGLIN  258

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+A+M D+G+A++G+G+ + K+RA+E A  A  +PL+ SSI+ A GV+ NITGG 
Sbjct  259   VDFADVRAIMADAGSALMGIGIGTGKSRAKEGAIAAISSPLLESSIEGAKGVILNITGGH  318

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQ  301
             D+TL EVN  + ++  + DP+ANIIFGAV+DE+  GEI +T IATGF+   Q
Sbjct  319   DLTLHEVNAAADIIYEIVDPNANIIFGAVIDEKMQGEIRITAIATGFSGEIQ  370



>ref|WP_035996963.1| cell division protein FtsZ [Leptolyngbya sp. JSC-1]
Length=437

 Score =   319 bits (818),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 181/292 (62%), Positives = 238/292 (82%), Gaps = 0/292 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ GV+F+++NTDAQ+L  ++A   +Q+G+ LTRGLG GGNP +G++AAEES++ 
Sbjct  83    RMIMSGVAGVEFWSVNTDAQALTLASAHNRLQVGQKLTRGLGAGGNPAIGQKAAEESRDE  142

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             I  AL+ +D+VFITAGMGGGTG+GAAPVVA+++KE G LTVGVVT PF+FEG++R+ QA 
Sbjct  143   IGAALENADLVFITAGMGGGTGTGAAPVVAEVAKEVGALTVGVVTRPFTFEGKRRTSQAD  202

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLI+IPND+LL +  EQTP+Q+AF +ADD+LRQGVQGISDIITIPGLVN
Sbjct  203   EGIAALQSRVDTLIIIPNDKLLSVISEQTPVQEAFRVADDILRQGVQGISDIITIPGLVN  262

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA EAA  A  +PL+ SSI  A GVV+NITGG 
Sbjct  263   VDFADVRAVMADAGSALMGIGIGSGKSRAREAATAAISSPLLESSIDGAKGVVFNITGGS  322

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQ  301
             D+TL EVN  ++++    DP+ANIIFGAV+D+R  GE+ +T+IATGF+   Q
Sbjct  323   DLTLHEVNSAAEIIYEAVDPNANIIFGAVLDDRLQGEVRITVIATGFSTEVQ  374



>ref|WP_011613145.1| cell division protein FtsZ [Trichodesmium erythraeum]
 ref|YP_723288.1| cell division protein FtsZ [Trichodesmium erythraeum IMS101]
 gb|ABG52815.1| cell division protein FtsZ [Trichodesmium erythraeum IMS101]
Length=423

 Score =   319 bits (817),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 182/292 (62%), Positives = 239/292 (82%), Gaps = 0/292 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + G++F+ +NTDAQ+L  S A   +Q+G+ LTRGLG GGNP +G++AAEES++ 
Sbjct  83    RMIASEVSGIEFWTVNTDAQALTLSRAPKRLQLGQKLTRGLGAGGNPAIGQKAAEESRDE  142

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IANAL   D+VFITAGMGGGTG+GAAPV+A+I+KEAG LTVGVVT PF+FEGR+R  QA 
Sbjct  143   IANALDHPDLVFITAGMGGGTGTGAAPVIAEIAKEAGSLTVGVVTRPFTFEGRRRITQAD  202

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLIVIPN+RLL + ++QTP+Q+AF++ADD+LRQG+QGISDIIT+PGLVN
Sbjct  203   EGITALQTRVDTLIVIPNNRLLSVINDQTPVQEAFIIADDILRQGIQGISDIITVPGLVN  262

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA EAA  A  +PL+ SSI+ A GVV+NITGG 
Sbjct  263   VDFADVRAVMADAGSALMGIGMGSGKSRAREAANAAISSPLLESSIEGAKGVVFNITGGT  322

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQ  301
             D+TL EVN  ++++  + DP+ANIIFGAV+D++  GEI +T+IATGF+   Q
Sbjct  323   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDDKLQGEIKITVIATGFSGEVQ  374



>ref|WP_015229558.1| cell division protein FtsZ [Dactylococcopsis salina]
 ref|YP_007171918.1| cell division protein FtsZ [Dactylococcopsis salina PCC 8305]
 gb|AFZ50561.1| cell division protein FtsZ [Dactylococcopsis salina PCC 8305]
Length=363

 Score =   317 bits (811),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 183/289 (63%), Positives = 237/289 (82%), Gaps = 1/289 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F+A+NTDAQ+L +  A   +Q+GE LTRGLG GGNP +G++AAEES++ 
Sbjct  23    RMIASDVTGVEFWAVNTDAQALSRVTAPNSLQVGEKLTRGLGAGGNPSIGQKAAEESRDE  82

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             I+NAL+ +D+VFITAGMGGGTG+GAAP+VA+++KE G LTVGVVT PF+FEGR+R+ Q  
Sbjct  83    ISNALEETDLVFITAGMGGGTGTGAAPIVAEVAKEMGCLTVGVVTRPFTFEGRRRTSQGE  142

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLI+IPND+LL + DE+TP+QDAF +ADD+LRQGVQGISDIITIPGLVN
Sbjct  143   EGIAALQTRVDTLIIIPNDKLLSVIDERTPVQDAFRVADDILRQGVQGISDIITIPGLVN  202

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G +S K+RA EAA  A  +PL+ SSIQ A GVV+NITGG 
Sbjct  203   VDFADVRAVMADAGSALMGIGTASGKSRAAEAATGAISSPLLESSIQGAKGVVFNITGGS  262

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDE-RYNGEIHVTIIATGFT  313
             D+TL EVN  ++ +    DP+ANIIFGAV+D+ +  GEI +T+IATGF+
Sbjct  263   DLTLHEVNTAAETIYEGVDPNANIIFGAVIDDGKMEGEIRITVIATGFS  311



>ref|WP_011433691.1| cell division protein FtsZ [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_478319.1| cell division protein FtsZ [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD03056.1| cell division protein FtsZ [Synechococcus sp. JA-2-3B'a(2-13)]
Length=371

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 192/311 (62%), Positives = 252/311 (81%), Gaps = 0/311 (0%)
 Frame = -3

Query  1242  IPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgellt  1063
             +P ++AKIKVVGVGGGG NAV+RM  S L GV+F+++NTDAQ+L QS+    +QIG+ LT
Sbjct  1     MPSNAAKIKVVGVGGGGGNAVSRMAASNLVGVEFWSVNTDAQALAQSSTVNRLQIGQKLT  60

Query  1062  rglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGY  883
             RGLG GGNP +G++AAEES E I+ A+KG+D+VFI AGMGGGTG+G APV+AQI+K +G 
Sbjct  61    RGLGAGGNPAIGQKAAEESSEEISAAIKGADLVFIAAGMGGGTGTGGAPVIAQIAKASGA  120

Query  882   LTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLA  703
             LTVGVVT PFSFEG++RS QA E I+ L++ VDTLIVIPND+LL +  EQTP+Q+AF +A
Sbjct  121   LTVGVVTRPFSFEGKRRSKQAEEGIQALREAVDTLIVIPNDKLLSVISEQTPVQEAFRVA  180

Query  702   DDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATL  523
             DDVLRQGVQGISDII IPG++NVDFADV++VM D+G+A++G+G+ S K+RA EAA  A  
Sbjct  181   DDVLRQGVQGISDIILIPGMINVDFADVRSVMADAGSALMGIGMGSGKSRAREAAITAVS  240

Query  522   APLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEI  343
             +PL+ +SI+ A GV++NITGG D++L EV   ++++    DP ANIIFG V DER  GE+
Sbjct  241   SPLLETSIEGAKGVLFNITGGPDLSLHEVTVAAEIIAEAVDPEANIIFGTVQDERMQGEV  300

Query  342   HVTIIATGFTQ  310
              +T+IATGF +
Sbjct  301   RITVIATGFQE  311



>ref|WP_015956956.1| cell division protein FtsZ [Cyanothece sp. PCC 7424]
 ref|YP_002380244.1| cell division protein FtsZ [Cyanothece sp. PCC 7424]
 gb|ACK73376.1| cell division protein FtsZ [Cyanothece sp. PCC 7424]
Length=418

 Score =   318 bits (815),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 199/316 (63%), Positives = 257/316 (81%), Gaps = 0/316 (0%)
 Frame = -3

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             + +  + A+IKV+GVGGGG NAVNRMI SG+ G++F++INTDAQ+L  SAA   +QIG+ 
Sbjct  57    TIVQSNVAQIKVIGVGGGGCNAVNRMIASGIIGIEFWSINTDAQALAHSAAPQRLQIGQK  116

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             +TRGLG GGNP +G++AAEES++ IA+AL+ +D+VFITAGMGGGTG+GAAP+VA+++KE 
Sbjct  117   ITRGLGAGGNPAIGQKAAEESRDEIAHALENTDLVFITAGMGGGTGTGAAPIVAEVAKEM  176

Query  888   GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  709
             G LTVGVVT PF+FEGR+R+ QA E I  LQ  VDTLIVIPN++LL +  ++TPLQDAF 
Sbjct  177   GCLTVGVVTRPFTFEGRRRTNQAEEGINALQSRVDTLIVIPNNQLLAVIPQETPLQDAFR  236

Query  708   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  529
              ADD+LRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GV S K+RA+E A  A
Sbjct  237   AADDILRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAKEGAIAA  296

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNG  349
               +PL+  SI+ A GVV NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE+  G
Sbjct  297   ISSPLLEHSIEGAKGVVLNITGGTDLTLFEVNTAAETIYEVVDPNANIIFGAVIDEKMQG  356

Query  348   EIHVTIIATGFTQSFQ  301
             EI +T+IATGFT   Q
Sbjct  357   EILITVIATGFTGESQ  372



>ref|WP_009557129.1| cell division protein FtsZ [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ68364.1| cell division protein FtsZ [Oscillatoriales cyanobacterium JSC-12]
Length=422

 Score =   318 bits (815),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 183/292 (63%), Positives = 238/292 (82%), Gaps = 0/292 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F++INTDAQ+L  S A   +Q+G+ LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASDVTGVEFWSINTDAQALEGSDAPKRLQVGQKLTRGLGAGGNPAIGQKAAEESRDE  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+G+D+VFITAGMGGGTG+GAAP+VA+++KE G LTVG+VT PF+FEGR+R+ QA 
Sbjct  141   IATALEGADLVFITAGMGGGTGTGAAPIVAEVAKELGALTVGIVTRPFTFEGRRRASQAA  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E IE LQ  VDTLI+IPND+LL +  EQTP+Q+AF  ADD+LRQGVQGISDIITI GLVN
Sbjct  201   EGIEALQSRVDTLIMIPNDKLLSVISEQTPVQEAFRAADDILRQGVQGISDIITIRGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+GV + K+RA EAA  +  +PL+ SSI  A GVV+NITGG 
Sbjct  261   VDFADVRAVMADAGSALMGIGVGTGKSRAREAAVASISSPLLESSIDGARGVVFNITGGT  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQ  301
             D+TL EVN  ++++  + DP+ANIIFGAV+DER  GE+ +T+IATGF+   Q
Sbjct  321   DLTLHEVNAAAEIIYEVVDPNANIIFGAVIDERLQGELRITVIATGFSGEVQ  372



>ref|WP_013322397.1| cell division protein FtsZ [Cyanothece sp. PCC 7822]
 ref|YP_003887567.1| cell division protein FtsZ [Cyanothece sp. PCC 7822]
 gb|ADN14292.1| cell division protein FtsZ [Cyanothece sp. PCC 7822]
Length=418

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 198/305 (65%), Positives = 252/305 (83%), Gaps = 0/305 (0%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+GVGGGG NAVNRMI SG+ GV+F++INTDAQ+L  SAA   +QIG+ +TRGLG 
Sbjct  64    AQIKVIGVGGGGCNAVNRMIASGIVGVEFWSINTDAQALAHSAAPQRLQIGQKITRGLGA  123

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             GGNP +G++AAEES++ IA+AL+ +D+VFITAGMGGGTG+GAAP+VA+++KE G LTVGV
Sbjct  124   GGNPAIGQKAAEESRDEIAHALENTDLVFITAGMGGGTGTGAAPIVAEVAKEMGCLTVGV  183

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VT PF+FEGR+R+ QA + I  LQ  VDTLIVIPN++LL +  + TPLQDAF  ADD+LR
Sbjct  184   VTRPFTFEGRRRTNQAEDGISGLQSRVDTLIVIPNNQLLAVIPQDTPLQDAFRAADDILR  243

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIG  508
             QGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GV S K+RA+E A  A  +PL+ 
Sbjct  244   QGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAKEGAIAAISSPLLE  303

Query  507   SSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTII  328
              SI+ A GVV NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+DE+  GEI +T+I
Sbjct  304   HSIEGAKGVVLNITGGSDLTLHEVNTAAETIYEVVDPNANIIFGAVIDEKMQGEILITVI  363

Query  327   ATGFT  313
             ATGFT
Sbjct  364   ATGFT  368



>ref|WP_024125914.1| cell division tubulin protein FtsZ [Thermosynechococcus sp. NK55a]
 ref|YP_008901059.1| cell division tubulin protein FtsZ [Thermosynechococcus sp. NK55a]
 gb|AHB89546.1| cell division tubulin protein FtsZ [Thermosynechococcus sp. NK55a]
Length=411

 Score =   317 bits (813),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 193/312 (62%), Positives = 254/312 (81%), Gaps = 0/312 (0%)
 Frame = -3

Query  1248  SFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgel  1069
             S +   +A+IKV+GVGGGG NAVNRMI S + GV+F+ +NTDAQ+L QS A   +QIG+ 
Sbjct  46    SLVETSAARIKVIGVGGGGGNAVNRMIASNVAGVEFWCVNTDAQALAQSQAHRCLQIGQK  105

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLG GGNP +G++AAEES+E +A ALK +D++FIT GMGGGTG+GAAP+VA+++KE 
Sbjct  106   LTRGLGAGGNPAIGQKAAEESREDLAAALKDADLIFITCGMGGGTGTGAAPIVAEVAKEQ  165

Query  888   GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  709
             G LTV VVT PF+FEGR+R+ QA E IE LQ  VDTLIVIPND++L +  EQT +QDAF 
Sbjct  166   GALTVAVVTRPFTFEGRRRASQADEGIEALQSRVDTLIVIPNDKILSVISEQTSVQDAFR  225

Query  708   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  529
             +ADDVLRQGVQGISDII +PGL+NVDFAD+++VM D+G+AM+G+G++S K+RA EAA  A
Sbjct  226   VADDVLRQGVQGISDIINLPGLINVDFADIRSVMADAGSAMMGIGIASGKSRATEAALSA  285

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNG  349
               +PL+  SI+ A GVV+NITGG D+TL EVN  ++V+ ++AD +ANIIFGAV+D +  G
Sbjct  286   ISSPLLEGSIEGAKGVVFNITGGTDLTLHEVNAAAEVIYNVADANANIIFGAVIDPQMQG  345

Query  348   EIHVTIIATGFT  313
             E+ +T+IATGF+
Sbjct  346   EVQITVIATGFS  357



>ref|WP_006632966.1| cell division protein FtsZ [Microcoleus vaginatus]
 gb|EGK88184.1| cell division protein FtsZ [Microcoleus vaginatus FGP-2]
Length=424

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 183/289 (63%), Positives = 237/289 (82%), Gaps = 1/289 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F+ +NTD+Q+L+ S A   +Q+G+ LTRGLG GGNP +G++AAEES++ 
Sbjct  78    RMIASEVSGVEFWCVNTDSQALVLSNAPKRLQVGQKLTRGLGAGGNPAIGQKAAEESRDE  137

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             +ANAL  +D+VFITAGMGGGTG+GAAP+VA+++KE G LTVG+VT PF+FEGR+R+ QA 
Sbjct  138   VANALNHADLVFITAGMGGGTGTGAAPIVAEVAKEMGALTVGIVTRPFTFEGRRRTSQAE  197

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLIVIPND+LL +  EQ P+Q+AF +ADD+LRQGVQGISDIITIPGLVN
Sbjct  198   EGIAALQTRVDTLIVIPNDKLLSVISEQMPVQEAFRVADDILRQGVQGISDIITIPGLVN  257

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLI-GSSIQSATGVVYNITGG  460
             VDFADV+AVM D+G+A++G+GV S K+RA EAA QA  +PL+  SSI+ A GVV+NITGG
Sbjct  258   VDFADVRAVMADAGSALMGIGVGSGKSRAREAAMQAISSPLLEASSIEGARGVVFNITGG  317

Query  459   KDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
              D+TL EVN  ++ +  + DP+ANIIFGAV+DER  GEI +T+IATGF+
Sbjct  318   TDMTLHEVNAAAETIYEVVDPNANIIFGAVIDERLQGEIKITVIATGFS  366



>ref|WP_015785230.1| MULTISPECIES: cell division protein FtsZ [Cyanothece]
 ref|YP_002374333.1| cell division protein FtsZ [Cyanothece sp. PCC 8801]
 ref|YP_003139935.1| cell division protein FtsZ [Cyanothece sp. PCC 8802]
 gb|ACK68177.1| cell division protein FtsZ [Cyanothece sp. PCC 8801]
 gb|ACV03100.1| cell division protein FtsZ [Cyanothece sp. PCC 8802]
Length=425

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 254/314 (81%), Gaps = 0/314 (0%)
 Frame = -3

Query  1254  RCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIg  1075
             R   +P + AKIKV+GVGGGG NAVNRMI S L G++F+AINTDAQ+L QSAA   +QIG
Sbjct  56    RNQIVPNNVAKIKVIGVGGGGCNAVNRMIESSLTGIEFWAINTDAQALSQSAASQRLQIG  115

Query  1074  elltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISK  895
             + LTRGLG GGNP +G QAAEES++ IA AL+ +D+VFITAGMGGGTG+GAAP+VA+++K
Sbjct  116   QKLTRGLGAGGNPSIGTQAAEESRDEIAQALENTDLVFITAGMGGGTGTGAAPIVAEVAK  175

Query  894   EAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDA  715
             E G LTVGVVT PF+FEGR+R+ QA + +EKLQ NVDTLIVIPN++LL +    TPLQ A
Sbjct  176   EMGCLTVGVVTRPFTFEGRRRTSQASQGVEKLQNNVDTLIVIPNNQLLQVIPPDTPLQQA  235

Query  714   FLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAE  535
             FL AD++LRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+G+ S K+RA +AA 
Sbjct  236   FLAADNILRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGLGIGSGKSRASDAAV  295

Query  534   QATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERY  355
              A  +PL+  SI+ A GVV+NITGG D+TL EVN  ++ +  + DP ANIIFGAV+D   
Sbjct  296   AAISSPLLEHSIKGARGVVFNITGGDDLTLHEVNTAAETIFEVVDPDANIIFGAVIDPTL  355

Query  354   NGEIHVTIIATGFT  313
              GE+ +T+IATGFT
Sbjct  356   QGEVIITVIATGFT  369



>ref|WP_027841036.1| cell division protein FtsZ [Mastigocoleus testarum]
Length=426

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 254/311 (82%), Gaps = 0/311 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKV+GVGGGG NAVNRMI S + GV+F+ INTDAQ+L  ++A + +QIG+ L
Sbjct  57    IVPGRVANIKVIGVGGGGGNAVNRMIASDVSGVEFWTINTDAQALTMASAPSRLQIGQKL  116

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  117   TRGLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMG  176

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF FEGR+RS QA + IE L+  VDTLI+IPN++LL++  EQT +Q+AF  
Sbjct  177   ALTVGVVTRPFIFEGRRRSTQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQTSMQEAFRY  236

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+G+ S K+R+ EAA  A 
Sbjct  237   ADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRSREAAIAAI  296

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ SSI+ A GVV NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D+R  GE
Sbjct  297   SSPLLESSIEGARGVVLNITGGSDLTLHEVNAAAEAIYEVVDPNANIIFGAVIDDRLQGE  356

Query  345   IHVTIIATGFT  313
             + +T+IATGFT
Sbjct  357   VRITVIATGFT  367



>ref|WP_008274607.1| cell division protein FtsZ [Cyanothece sp. CCY0110]
 gb|EAZ92371.1| cell division protein FtsZ [Cyanothece sp. CCY0110]
Length=419

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 199/322 (62%), Positives = 256/322 (80%), Gaps = 0/322 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S R   +P + A+IKV+GVGGGG NAV+RMI S L GV+F+ +NTDAQ+L QS+A   +Q
Sbjct  52    SRRNVIVPNNIARIKVIGVGGGGCNAVDRMIESALMGVEFWTMNTDAQALTQSSAPHRLQ  111

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IG  LT+GLG GGNP +G++AA ES++ IA AL+ +D+VFITAGMGGGTG+GAA +VA+I
Sbjct  112   IGRKLTKGLGAGGNPNIGKEAAVESRDEIAEALEDTDLVFITAGMGGGTGTGAAAIVAEI  171

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LTVGVVT PF+FEGR+R +QA + I  LQ NVDTLIVIPN++LL +   +TPL+
Sbjct  172   AKEKGCLTVGVVTRPFTFEGRRRMVQAGQGISDLQNNVDTLIVIPNNQLLQVISPETPLK  231

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AFL AD+VLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GV S K+RA +A
Sbjct  232   EAFLAADNVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRANDA  291

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+  SIQ A GVV+NITGG D++L EVN  ++ +  + DP ANIIFGAV+DE
Sbjct  292   ASLAISSPLLEHSIQGAKGVVFNITGGSDLSLHEVNTAAETIYEVVDPDANIIFGAVIDE  351

Query  360   RYNGEIHVTIIATGFTQSFQRT  295
             R  GE+ VT+IATGF+   + T
Sbjct  352   RVQGEVIVTVIATGFSAEAENT  373



>ref|WP_008226369.1| Cell division protein FtsZ [Richelia intracellularis]
 emb|CCH64899.1| Cell division protein FtsZ [Richelia intracellularis HM01]
Length=426

 Score =   317 bits (812),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 199/334 (60%), Positives = 264/334 (79%), Gaps = 2/334 (1%)
 Frame = -3

Query  1314  ISSGYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYA  1135
             ++ G+    + + H+ R       IP   A IKV+GVGGGG NAVNRMI S ++ V+F+ 
Sbjct  37    VNLGHNHHSQKISHENRNI--GDIIPGRVANIKVIGVGGGGGNAVNRMIASDVESVEFWT  94

Query  1134  INTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFIt  955
             INTDAQ+L  +++ + +QIG+ LTRGLG GGNP +G++AAEES++ I  AL+G+D+VFIT
Sbjct  95    INTDAQALTLASSPSRLQIGQKLTRGLGAGGNPAIGQKAAEESRDEIITALEGADLVFIT  154

Query  954   agmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLI  775
             AGMGGGTG+GAAP+VA+++KE G LTVGVVT PF FEGR+R+ QA + I  L+  VDTLI
Sbjct  155   AGMGGGTGTGAAPIVAEVAKEMGALTVGVVTRPFIFEGRRRTTQAEQGIGGLKDCVDTLI  214

Query  774   VIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSG  595
             +IPN++LL++  EQTP+Q+AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G
Sbjct  215   IIPNNKLLEVIPEQTPVQEAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAG  274

Query  594   TAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVV  415
             +A++G+G+SS K+RA+EAA  A  +PL+  SI+ A GVV+NITGG D+TL EVN  ++ V
Sbjct  275   SALMGIGISSGKSRAKEAAVAAISSPLLECSIEGARGVVFNITGGSDLTLHEVNSAAEAV  334

Query  414   TSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
               + DP+ANIIFGAV+D+R  GE+ +T+IATGFT
Sbjct  335   YEVVDPNANIIFGAVIDDRLQGEVRITVIATGFT  368



>ref|WP_015179039.1| cell division protein FtsZ [Oscillatoria nigro-viridis]
 ref|YP_007118250.1| cell division protein FtsZ [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ09834.1| cell division protein FtsZ [Oscillatoria nigro-viridis PCC 7112]
Length=454

 Score =   318 bits (815),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 183/289 (63%), Positives = 237/289 (82%), Gaps = 1/289 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F+ +NTD+Q+L+ S A   +Q+G+ LTRGLG GGNP +G++AAEES++ 
Sbjct  108   RMIASEVSGVEFWCVNTDSQALVLSNAPKRLQVGQKLTRGLGAGGNPAIGQKAAEESRDE  167

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             +ANAL  +D+VFITAGMGGGTG+GAAP+VA+++KE G LTVG+VT PF+FEGR+R+ QA 
Sbjct  168   VANALNHADLVFITAGMGGGTGTGAAPIVAEVAKEMGALTVGIVTRPFTFEGRRRTSQAE  227

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLIVIPND+LL +  EQ P+Q+AF +ADD+LRQGVQGISDIITIPGLVN
Sbjct  228   EGIAALQTRVDTLIVIPNDKLLSVISEQMPVQEAFRVADDILRQGVQGISDIITIPGLVN  287

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLI-GSSIQSATGVVYNITGG  460
             VDFADV+AVM D+G+A++G+GV S K+RA EAA QA  +PL+  SSI+ A GVV+NITGG
Sbjct  288   VDFADVRAVMADAGSALMGIGVGSGKSRAREAAMQAISSPLLEASSIEGARGVVFNITGG  347

Query  459   KDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
              D+TL EVN  ++ +  + DP+ANIIFGAV+DER  GEI +T+IATGF+
Sbjct  348   TDMTLHEVNAAAETIYEVVDPNANIIFGAVIDERLQGEIKITVIATGFS  396



>ref|WP_009544135.1| MULTISPECIES: cell division protein FtsZ [Cyanothece]
 ref|YP_001802730.1| cell division protein [Cyanothece sp. ATCC 51142]
 gb|ACB50664.1| cell division protein [Cyanothece sp. ATCC 51142]
Length=419

 Score =   317 bits (811),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 198/316 (63%), Positives = 254/316 (80%), Gaps = 0/316 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S R   +P + A+IKV+GVGGGG NAV+RMI S L GV+F+ +NTDAQ+L QS+A   +Q
Sbjct  52    SRRNVIVPNNVARIKVIGVGGGGCNAVDRMIESALMGVEFWTMNTDAQALTQSSAPHRLQ  111

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IG  LT+GLG GGNP +G++AA ES++ IA AL+ +D+VFITAGMGGGTG+GAA +VA+I
Sbjct  112   IGRKLTKGLGAGGNPNIGKEAAVESRDEIAEALEDTDLVFITAGMGGGTGTGAAAIVAEI  171

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LTVGVVT PF+FEGR+R +QA + I  LQ NVDTLIVIPN++LL +   +TPL+
Sbjct  172   AKEKGCLTVGVVTRPFTFEGRRRMVQASQGISDLQNNVDTLIVIPNNQLLQVISPETPLK  231

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AFL AD+VLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GV S K+RA +A
Sbjct  232   EAFLAADNVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRANDA  291

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+  SIQ A GVV+NITGG D++L EVN  ++ +  + DP ANIIFGAV+DE
Sbjct  292   ASLAISSPLLEHSIQGAKGVVFNITGGSDLSLHEVNTAAETIFEVVDPDANIIFGAVIDE  351

Query  360   RYNGEIHVTIIATGFT  313
             R  GE+ VT+IATGF+
Sbjct  352   RVQGEVIVTVIATGFS  367



>gb|KEI67555.1| FtsZ [Planktothrix agardhii NIVA-CYA 126/8]
Length=424

 Score =   317 bits (811),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 203/336 (60%), Positives = 260/336 (77%), Gaps = 9/336 (3%)
 Frame = -3

Query  1293  RRKSLF---------HQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDF  1141
             RRK L            R  S     IP ++AKIKV+GVGG G NAVNRMI S + G++F
Sbjct  33    RRKELIVNPNNDSKDMPREDSWSSDIIPSNAAKIKVIGVGGSGGNAVNRMIDSQVAGIEF  92

Query  1140  YAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVF  961
             +++NTDAQ+L  S AQ  +Q+G+ LT+GLG GGNP +G++AAEES+E I  AL+G+D+VF
Sbjct  93    WSMNTDAQALTLSKAQKRLQVGQKLTKGLGAGGNPAIGQKAAEESREEIQKALEGADLVF  152

Query  960   ItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDT  781
             ITAG+GGGTG+G APVVA+++KE G LT+GVVT PF FEGR+R  QA + I  LQ  VDT
Sbjct  153   ITAGLGGGTGTGGAPVVAEVAKELGALTIGVVTRPFHFEGRRRISQADDGILALQSRVDT  212

Query  780   LIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKD  601
             LIVIPN++LL++  EQTP+Q+AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D
Sbjct  213   LIVIPNNKLLEVIAEQTPVQEAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMAD  272

Query  600   SGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQ  421
             +G+A+LG+G++S K+RA EAA  A  +PL+ SSI  A GVV+NITGG D+TL EVN  ++
Sbjct  273   AGSALLGIGIASGKSRAREAAVAAIASPLLESSIDGAKGVVFNITGGTDLTLHEVNAAAE  332

Query  420   VVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
              +  + DP+ANIIFGAV+DER  GE+ +T+IATGF+
Sbjct  333   TIYEVVDPNANIIFGAVIDERMQGEVKITVIATGFS  368



>ref|WP_015219491.1| cell division protein FtsZ [Cyanobacterium aponinum]
 ref|YP_007161808.1| cell division protein FtsZ [Cyanobacterium aponinum PCC 10605]
 gb|AFZ53764.1| cell division protein FtsZ [Cyanobacterium aponinum PCC 10605]
Length=420

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 184/288 (64%), Positives = 235/288 (82%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GVDF+ INTDAQ+L QS     +QIG+ LTRGLG GGNP +G++AAEES++ 
Sbjct  74    RMIQSSVVGVDFWQINTDAQALAQSMTTYCLQIGQKLTRGLGAGGNPAIGQKAAEESRDE  133

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+ +D+VFITAGMGGGTG+GAAP+VA+I+K+ G LTVGVVT PF+FEGR+R+ QA 
Sbjct  134   IAKALENTDLVFITAGMGGGTGTGAAPIVAEIAKDMGCLTVGVVTRPFTFEGRRRTNQAD  193

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  L+  VDTLIVIPN++LL +   +TPLQ++F +ADD LRQGVQGISDIITIPGLVN
Sbjct  194   EGIRALESKVDTLIVIPNNQLLAVIPPETPLQESFRMADDTLRQGVQGISDIITIPGLVN  253

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PLI SSI+ ATGVV NITGGK
Sbjct  254   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAIAAISSPLIESSIEGATGVVLNITGGK  313

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++ +  + DP+ANIIFGAV+DE+  GE+ VT+IATGF+
Sbjct  314   DLTLHEVNAAAETIYEIVDPNANIIFGAVIDEKMQGEVRVTVIATGFS  361



>ref|WP_015263178.1| cell division protein FtsZ [Desulfitobacterium dichloroeliminans]
 ref|YP_007221608.1| cell division protein FtsZ [Desulfitobacterium dichloroeliminans 
LMG P-21439]
 gb|AGA70212.1| cell division protein FtsZ [Desulfitobacterium dichloroeliminans 
LMG P-21439]
Length=353

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 237/302 (78%), Gaps = 2/302 (1%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI +GL+GVDF A+NTDAQ++  S A   IQIG  +T+GLG G NP +G +AAEES+E 
Sbjct  29    RMITAGLKGVDFVAVNTDAQAINLSRAGEKIQIGNKITKGLGAGANPEIGLKAAEESREE  88

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             + + LKG+DMVF+TAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PFSFEGRKR++QA 
Sbjct  89    LISVLKGADMVFVTAGMGGGTGTGAAPIVAEIAKELGALTVGVVTRPFSFEGRKRAMQAE  148

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             + I +L+  VDTLI IPNDRLL + D+ T L +AF +ADDVLRQGVQGISD+I +PGL+N
Sbjct  149   KGIAELKSKVDTLITIPNDRLLQVVDKHTALHEAFRIADDVLRQGVQGISDLIAVPGLIN  208

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             +DFADVK +M+++G+A++G+G ++ +NRA +AA +A  +PL+ +SI+ A GV+ NITGG 
Sbjct  209   LDFADVKTIMRNTGSALMGIGAATGENRAADAARKAISSPLLETSIEGAQGVLLNITGGS  268

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPR  277
             ++TL EVN  S+++   ADP ANIIFGAV+DE    EI VT+IATGF Q  Q+T     R
Sbjct  269   NLTLFEVNEASEIIAEAADPEANIIFGAVIDESLKEEIRVTVIATGFEQ--QKTATVGLR  326

Query  276   GA  271
             G+
Sbjct  327   GS  328



>ref|WP_009628587.1| cell division protein FtsZ [Pseudanabaena biceps]
 gb|ELS31330.1| cell division protein FtsZ [Pseudanabaena biceps PCC 7429]
Length=426

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 179/287 (62%), Positives = 238/287 (83%), Gaps = 0/287 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F++ NTDAQ+LLQS+A    Q+G+ LTRGLG GGNP +G++AAEES++ 
Sbjct  81    RMIASDVVGVEFWSFNTDAQALLQSSASKRFQMGQKLTRGLGAGGNPAIGQKAAEESRDD  140

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA A++G+D+VFITAGMGGGTG+GAAP++A+++KEAG LTVG+VT PF+FEGR+R  QA 
Sbjct  141   IAAAVEGADLVFITAGMGGGTGTGAAPIIAEVAKEAGALTVGIVTRPFTFEGRRRGQQAE  200

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLIVIPND+LL +  EQTP+Q+AF +ADD+LRQGVQGISDII IPGLVN
Sbjct  201   EGIAGLQSRVDTLIVIPNDKLLSVISEQTPVQEAFRVADDILRQGVQGISDIIMIPGLVN  260

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFAD++AVM D+G+AM+G+G+ S K+RA EAA  A  +PL+ +S++ A+GVV+NITGG+
Sbjct  261   VDFADIRAVMADAGSAMMGIGIGSGKSRAREAAMTAISSPLLETSVEGASGVVFNITGGE  320

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGF  316
             D+TL EVN  ++ +  + D +ANIIFGAV+D + +GEI +T+IATGF
Sbjct  321   DMTLHEVNAAAETIYEVVDQNANIIFGAVIDPKLDGEIRITVIATGF  367



>ref|WP_011429031.1| cell division protein FtsZ [Synechococcus sp. JA-3-3Ab]
 ref|YP_473602.1| cell division protein FtsZ [Synechococcus sp. JA-3-3Ab]
 gb|ABC98339.1| cell division protein FtsZ [Synechococcus sp. JA-3-3Ab]
Length=373

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 194/308 (63%), Positives = 249/308 (81%), Gaps = 2/308 (1%)
 Frame = -3

Query  1233  DSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQT--PIQIgelltr  1060
             ++AKIKVVGVGGGG NAV+RM  S L+GV+F++INTDAQ+L Q +  T   +QIG+ LTR
Sbjct  4     NAAKIKVVGVGGGGGNAVSRMAASNLKGVEFWSINTDAQALAQCSTSTVNRLQIGQKLTR  63

Query  1059  glgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYL  880
             GLG GGNP +G++AAEES E IA ALKG+D+VFI AGMGGGTG+G AP+VAQI+K +G L
Sbjct  64    GLGAGGNPAIGQKAAEESSEEIAAALKGADLVFIAAGMGGGTGTGGAPIVAQIAKASGAL  123

Query  879   TVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLAD  700
             TVGVVT PFSFEG++R+ QA E I+ LQ+ VDTLIVIPND+LL +  EQTP+ +AF +AD
Sbjct  124   TVGVVTRPFSFEGKRRTKQAEEGIQALQEAVDTLIVIPNDKLLSVISEQTPVHEAFRVAD  183

Query  699   DVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLA  520
             DVLRQGVQGISDII IPG++NVDFADV++VM D+GTA++G+G+ S K+RA EAA  A  +
Sbjct  184   DVLRQGVQGISDIILIPGMINVDFADVRSVMADAGTALMGIGMGSGKSRAREAAITAVSS  243

Query  519   PLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIH  340
             PL+ +SI+ A GV++NITGG D++L EV   ++++    DP ANIIFG V DER  GE+ 
Sbjct  244   PLLETSIEGAKGVLFNITGGLDLSLHEVTVAAEIIAEAVDPEANIIFGTVQDERMQGEVR  303

Query  339   VTIIATGF  316
             +T+IATGF
Sbjct  304   ITVIATGF  311



>ref|WP_010872126.1| cell division protein FtsZ [Synechocystis sp. PCC 6803]
 ref|NP_440816.1| cell division protein FtsZ [Synechocystis sp. PCC 6803]
 ref|YP_005382684.1| cell division protein FtsZ [Synechocystis sp. PCC 6803 substr. 
GT-I]
 ref|YP_005385853.1| cell division protein FtsZ [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 ref|YP_005408560.1| cell division protein FtsZ [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 ref|YP_005650875.1| cell division protein FtsZ [Synechocystis sp. PCC 6803]
 ref|YP_007450699.1| cell division FtsZ protein [Synechocystis sp. PCC 6803]
 sp|P73456.1|FTSZ_SYNY3 RecName: Full=Cell division protein FtsZ [Synechocystis sp. PCC 
6803 substr. Kazusa]
 dbj|BAA17496.1| cell division FtsZ protein [Synechocystis sp. PCC 6803]
 dbj|BAK49670.1| cell division protein FtsZ [Synechocystis sp. PCC 6803]
 dbj|BAL28669.1| cell division protein FtsZ [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31838.1| cell division protein FtsZ [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL35007.1| cell division protein FtsZ [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM51228.1| cell division protein FtsZ [Bacillus subtilis BEST7613]
 gb|AGF51185.1| cell division FtsZ protein [Synechocystis sp. PCC 6803]
Length=430

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 181/287 (63%), Positives = 236/287 (82%), Gaps = 0/287 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SG+ G+DF+AINTD+Q+L  + A   IQIG+ LTRGLG GGNP +G++AAEES++ 
Sbjct  84    RMIASGVTGIDFWAINTDSQALTNTNAPDCIQIGQKLTRGLGAGGNPAIGQKAAEESRDE  143

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA +L+G+D+VFITAGMGGGTG+GAAP+VA+++KE G LTVG+VT PF+FEGR+R+ QA 
Sbjct  144   IARSLEGTDLVFITAGMGGGTGTGAAPIVAEVAKEMGCLTVGIVTRPFTFEGRRRAKQAE  203

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E I  LQ  VDTLIVIPN++LL +   +TPLQ+AF +ADD+LRQGVQGISDII IPGLVN
Sbjct  204   EGINALQSRVDTLIVIPNNQLLSVIPAETPLQEAFRVADDILRQGVQGISDIIIIPGLVN  263

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+GV S K+RA+EAA  A  +PL+ SSIQ A GVV+N+TGG 
Sbjct  264   VDFADVRAVMADAGSALMGIGVGSGKSRAKEAATAAISSPLLESSIQGAKGVVFNVTGGT  323

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGF  316
             D+TL EVN  ++++  + D  ANIIFGAV+D+R  GE+ +T+IATGF
Sbjct  324   DLTLHEVNVAAEIIYEVVDADANIIFGAVIDDRLQGEMRITVIATGF  370



>ref|WP_026788004.1| MULTISPECIES: cell division protein FtsZ [Planktothrix]
Length=424

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 203/336 (60%), Positives = 260/336 (77%), Gaps = 9/336 (3%)
 Frame = -3

Query  1293  RRKSLF---------HQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDF  1141
             RRK L            R  S     IP ++AKIKV+GVGG G NAVNRMI S + G++F
Sbjct  33    RRKELIVNPNNDSKDMPREDSWSGDIIPSNAAKIKVIGVGGSGGNAVNRMIDSQVAGIEF  92

Query  1140  YAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVF  961
             +++NTDAQ+L  S AQ  +Q+G+ LT+GLG GGNP +G++AAEES+E I  AL+G+D+VF
Sbjct  93    WSMNTDAQALTLSKAQKRLQVGQKLTKGLGAGGNPAIGQKAAEESREEIQKALEGADLVF  152

Query  960   ItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDT  781
             ITAG+GGGTG+G APVVA+++KE G LT+GVVT PF FEGR+R  QA + I  LQ  VDT
Sbjct  153   ITAGLGGGTGTGGAPVVAEVAKELGALTIGVVTRPFHFEGRRRISQADDGILALQSRVDT  212

Query  780   LIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKD  601
             LIVIPN++LL++  EQTP+Q+AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D
Sbjct  213   LIVIPNNKLLEVIAEQTPVQEAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMAD  272

Query  600   SGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQ  421
             +G+A+LG+G++S K+RA EAA  A  +PL+ SSI  A GVV+NITGG D+TL EVN  ++
Sbjct  273   AGSALLGIGIASGKSRAREAAVAAIASPLLESSIDGAKGVVFNITGGTDLTLHEVNAAAE  332

Query  420   VVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
              +  + DP+ANIIFGAV+DER  GE+ +T+IATGF+
Sbjct  333   TIYEVVDPNANIIFGAVIDERMQGEVKITVIATGFS  368



>ref|WP_018212641.1| cell division protein FtsZ [Desulfitobacterium hafniense]
Length=353

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 238/301 (79%), Gaps = 2/301 (1%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI +GL+GVDF A+NTDAQ++  S A   +QIG  LT+GLG G NP +G +AAEES+E 
Sbjct  29    RMITAGLKGVDFVAVNTDAQAINLSQAGQKVQIGNKLTKGLGAGANPEIGSKAAEESREE  88

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             + N LKG+DMVF+TAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PFSFEGRKR++QA 
Sbjct  89    LINVLKGADMVFVTAGMGGGTGTGAAPIVAEIAKELGALTVGVVTRPFSFEGRKRAMQAE  148

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             + I +L+  VDTLI IPNDRLL + D+ T L +AF +ADDVLRQGVQGISD+I +PGL+N
Sbjct  149   KGIAELKSKVDTLITIPNDRLLQVVDKHTALHEAFRIADDVLRQGVQGISDLIAVPGLIN  208

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             +DFADVK +M+++G+A++G+G ++ +NRA +AA +A  +PL+ +SI+ A GV+ NITGG+
Sbjct  209   LDFADVKTIMRNTGSALMGIGSATGENRAADAARKAISSPLLETSIEGAQGVLLNITGGQ  268

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPR  277
             ++TL EVN  S+++   ADP ANIIFGAV+DE    EI VT+IATGF Q  Q++   + R
Sbjct  269   NLTLFEVNEASEIIAEAADPEANIIFGAVIDEGLKDEIRVTVIATGFDQ--QKSAAGNLR  326

Query  276   G  274
             G
Sbjct  327   G  327



>ref|WP_017287543.1| cell division protein FtsZ [Leptolyngbya boryana]
Length=425

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 181/292 (62%), Positives = 236/292 (81%), Gaps = 0/292 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F++INTDAQ+L QS A   +Q+G+ LTRGLG GGNP +G++AAEES++ 
Sbjct  80    RMIASNVSGVEFWSINTDAQALAQSTALKRLQVGQKLTRGLGAGGNPAIGQKAAEESRDE  139

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA AL+ +D+VFITAGMGGGTG+GAAP+VA+++KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  140   IAAALENADLVFITAGMGGGTGTGAAPIVAEVAKELGALTVGVVTRPFTFEGRRRTGQAE  199

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             + +  L   VDTLI+IPND+LL +  EQTP+Q+AF  ADD+LRQGVQGISDIITIPGLVN
Sbjct  200   DGVSALASRVDTLIIIPNDKLLTVISEQTPVQEAFRTADDILRQGVQGISDIITIPGLVN  259

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA EAA  A  +PL+ +SI  A GVV+NITGG 
Sbjct  260   VDFADVRAVMADAGSALMGIGIGSGKSRAREAAVAAISSPLLEASIDGARGVVFNITGGS  319

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQ  301
             D+TL EV+  + ++    DP+ANIIFGAV+D+R  GE+ +T+IATGFTQ  Q
Sbjct  320   DLTLHEVSAAADIIYEAVDPNANIIFGAVIDDRLQGEVRITVIATGFTQEAQ  371



>ref|WP_005811376.1| cell division protein FtsZ [Desulfitobacterium hafniense]
 ref|YP_519135.1| cell division protein FtsZ [Desulfitobacterium hafniense Y51]
 ref|YP_002460503.1| cell division protein FtsZ [Desulfitobacterium hafniense DCB-2]
 dbj|BAE84691.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gb|ACL22067.1| cell division protein FtsZ [Desulfitobacterium hafniense DCB-2]
 gb|EHL07397.1| cell division protein FtsZ [Desulfitobacterium hafniense DP7]
 emb|CDX03021.1| Cell division protein FtsZ [Desulfitobacterium hafniense]
Length=353

 Score =   313 bits (802),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 238/301 (79%), Gaps = 2/301 (1%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI +GL+GVDF A+NTDAQ++  S A   +QIG  LT+GLG G NP +G +AAEES+E 
Sbjct  29    RMITAGLKGVDFVAVNTDAQAINLSRAGQKVQIGNKLTKGLGAGANPEIGSKAAEESREE  88

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             + N LKG+DMVF+TAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PFSFEGRKR++QA 
Sbjct  89    LINVLKGADMVFVTAGMGGGTGTGAAPIVAEIAKELGALTVGVVTRPFSFEGRKRAMQAE  148

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             + I +L+  VDTLI IPNDRLL + D+ T L +AF +ADDVLRQGVQGISD+I +PGL+N
Sbjct  149   KGIAELKSKVDTLITIPNDRLLQVVDKHTALHEAFRIADDVLRQGVQGISDLIAVPGLIN  208

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             +DFADVK +M+++G+A++G+G ++ +NRA +AA +A  +PL+ +SI+ A GV+ NITGG+
Sbjct  209   LDFADVKTIMRNTGSALMGIGSATGENRAADAARKAISSPLLETSIEGAQGVLLNITGGQ  268

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPR  277
             ++TL EVN  S+++   ADP ANIIFGAV+DE    EI VT+IATGF Q  Q++   + R
Sbjct  269   NLTLFEVNEASEIIAEAADPEANIIFGAVIDEGLKDEIRVTVIATGFDQ--QKSAAGNLR  326

Query  276   G  274
             G
Sbjct  327   G  327



>ref|WP_008232986.1| Cell division protein FtsZ [Richelia intracellularis]
 emb|CCH66956.1| Cell division protein FtsZ [Richelia intracellularis HH01]
Length=426

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 199/326 (61%), Positives = 260/326 (80%), Gaps = 4/326 (1%)
 Frame = -3

Query  1278  FHQRRFSVRCS----FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSL  1111
              H ++ S   S     IP   A IKV+GVGGGG NAVNRMI S ++ V+F+ INTDAQ+L
Sbjct  43    HHSQKISHENSNIGDIIPGRVANIKVIGVGGGGGNAVNRMIASDVESVEFWTINTDAQAL  102

Query  1110  LQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtg  931
               +++ + +QIG+ LTRGLG GGNP +G++AAEES++ I  AL+G+D+VFITAGMGGGTG
Sbjct  103   TLASSPSRLQIGQKLTRGLGAGGNPAIGQKAAEESRDEIITALEGADLVFITAGMGGGTG  162

Query  930   sgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLL  751
             +GAAP+VA+++KE G LTVGVVT PF FEGR+R+ QA + I  L+  VDTLI+IPN++LL
Sbjct  163   TGAAPIVAEVAKEMGALTVGVVTRPFIFEGRRRTTQAEQGIGGLKDCVDTLIIIPNNKLL  222

Query  750   DIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGV  571
             ++  EQTP+Q+AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+G+
Sbjct  223   EVIPEQTPVQEAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGI  282

Query  570   SSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSA  391
             SS K+RA+EAA  A  +PL+  SI+ A GVV+NITGG D+TL EVN  ++ V  + DP+A
Sbjct  283   SSGKSRAKEAAVAAISSPLLECSIEGARGVVFNITGGSDLTLHEVNSAAEAVYEVVDPNA  342

Query  390   NIIFGAVVDERYNGEIHVTIIATGFT  313
             NIIFGAV+D+R  GE+ +T+IATGFT
Sbjct  343   NIIFGAVIDDRLQGEVRITVIATGFT  368



>dbj|BAP17020.1| cell division protein [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=362

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 181/288 (63%), Positives = 232/288 (81%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RM+ S L G++F+AINTDAQ+L QSAA   +QIG+ LTRGLG GGNP +G QAAEES++ 
Sbjct  23    RMVESSLTGIEFWAINTDAQALSQSAAPQRLQIGQKLTRGLGAGGNPSIGTQAAEESRDE  82

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA+AL+ +D+ FITAGMGGGTG+GAAP+VA+++KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  83    IAHALENTDLAFITAGMGGGTGTGAAPIVAEVAKEMGCLTVGVVTRPFTFEGRRRTTQAA  142

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E +  LQ NVDTLIVIPN++LL +    TPLQ+AFL AD++LRQGVQGISDIITIPGLVN
Sbjct  143   EGVNNLQNNVDTLIVIPNNQLLQVIPPDTPLQEAFLTADNILRQGVQGISDIITIPGLVN  202

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G  S K+RA +AA QA  +PL+  SI+ A GVV+NITGG 
Sbjct  203   VDFADVRAVMADAGSALMGLGTGSGKSRANDAAVQAISSPLLEHSIKGAKGVVFNITGGS  262

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EV   ++ +  + DP ANIIFGAV+D    GE+ +T+IATGF+
Sbjct  263   DLTLHEVTTAAETIFEVVDPEANIIFGAVIDSVLQGEVIITVIATGFS  310



>ref|WP_014795201.1| MULTISPECIES: cell division protein FtsZ [Desulfitobacterium]
 ref|YP_006431519.1| cell division protein FtsZ [Desulfitobacterium dehalogenans ATCC 
51507]
 gb|AFM01726.1| cell division protein FtsZ [Desulfitobacterium dehalogenans ATCC 
51507]
Length=353

 Score =   311 bits (798),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 239/302 (79%), Gaps = 2/302 (1%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI +GL+GVDF A+NTDAQ++  S A   +QIG  LT+GLG G NP +G +AAEES+E 
Sbjct  29    RMITAGLKGVDFVAVNTDAQAINLSRAGQKVQIGNKLTKGLGAGANPEVGSKAAEESREE  88

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             + + LKG+DMVF+TAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PFSFEGRKR++QA 
Sbjct  89    LISVLKGADMVFVTAGMGGGTGTGAAPIVAEIAKELGALTVGVVTRPFSFEGRKRAMQAE  148

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             + I +L+  VDTLI IPNDRLL + D+ T L +AF +ADDVLRQGVQGISD+I +PGL+N
Sbjct  149   KGIAELKSKVDTLITIPNDRLLQVVDKHTALHEAFRIADDVLRQGVQGISDLIAVPGLIN  208

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             +DFADVK +M+++G+A++G+G ++ +NRA +AA +A  +PL+ +SI+ A GV+ NITGG+
Sbjct  209   LDFADVKTIMRNTGSALMGIGGATGENRAADAARKAISSPLLETSIEGAQGVLLNITGGQ  268

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQRTLLTDPR  277
             ++TL EVN  S+++   ADP ANIIFGAV+DE    EI VT+IATGF Q  Q++  +  R
Sbjct  269   NLTLFEVNEASEIIAEAADPEANIIFGAVIDESLKEEIRVTVIATGFDQ--QKSATSTLR  326

Query  276   GA  271
             G+
Sbjct  327   GS  328



>ref|WP_011058214.1| cell division protein FtsZ [Thermosynechococcus elongatus]
 ref|NP_683172.1| cell division protein FtsZ [Thermosynechococcus elongatus BP-1]
 dbj|BAC09934.1| cell division protein [Thermosynechococcus elongatus BP-1]
Length=418

 Score =   313 bits (803),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 193/321 (60%), Positives = 256/321 (80%), Gaps = 1/321 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +   +A+IKV+GVGGGG NAVNRMI S + GV+F+ +NTDAQ++ QS A   +QIG+ L
Sbjct  54    LVETSAARIKVIGVGGGGGNAVNRMIASNVAGVEFWCVNTDAQAIAQSQAHRCLQIGQKL  113

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES+E +A ALK +D++FIT GMGGGTG+GAAP+VA+++KE G
Sbjct  114   TRGLGAGGNPAIGQKAAEESREDLAAALKDADLIFITCGMGGGTGTGAAPIVAEVAKEQG  173

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTV VVT PF+FEGR+R+ QA E IE LQ  VDTLIVIPND++L +  EQT +QDAF +
Sbjct  174   ALTVAVVTRPFTFEGRRRANQADEGIEALQSRVDTLIVIPNDKILSVISEQTSVQDAFRV  233

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDII +PGL+NVDFAD+++VM D+G+AM+G+G++S K+RA EAA  A 
Sbjct  234   ADDVLRQGVQGISDIINVPGLINVDFADIRSVMADAGSAMMGIGIASGKSRATEAALSAI  293

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+  SI+ A GVV+NITGG D++L EVN  + V+ ++AD +ANIIFGAV+D +  GE
Sbjct  294   SSPLLERSIEGAKGVVFNITGGTDLSLHEVNAAADVIYNVADANANIIFGAVIDPQMQGE  353

Query  345   IHVTIIATGFT-QSFQRTLLT  286
             + +T+IATGF+ +   RT  T
Sbjct  354   VQITVIATGFSGEPMSRTRAT  374



>ref|WP_039725564.1| cell division protein FtsZ [Lyngbya confervoides]
 gb|KIF13893.1| cell division protein FtsZ [Aphanocapsa montana BDHKU210001]
 gb|KIF41629.1| cell division protein FtsZ [Lyngbya confervoides BDU141951]
Length=370

 Score =   312 bits (799),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 185/288 (64%), Positives = 237/288 (82%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI SGL G++F+ +NTDAQ+LL +A +  +QIG+ LTRGLG GGNP +G++AAEES++ 
Sbjct  30    RMIHSGLSGIEFWTVNTDAQALLNTATENRLQIGQKLTRGLGAGGNPAIGQKAAEESRDE  89

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA +L+ SD+VFITAGMGGGTG+GAAPVVA+++KE+G LTVGVVT PF+FEGR+R+ QA 
Sbjct  90    IAASLEESDLVFITAGMGGGTGTGAAPVVAEVAKESGALTVGVVTRPFTFEGRRRTGQAD  149

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             + IE LQ  VDTLIVIPNDRLL +  EQTP+Q+AF  ADD+LRQGVQGISDII IPGLVN
Sbjct  150   DGIEALQSRVDTLIVIPNDRLLSVISEQTPVQEAFQSADDILRQGVQGISDIIMIPGLVN  209

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA EAA  A  +PL+ SSI  A+G V+NITGG 
Sbjct  210   VDFADVRAVMADAGSALMGIGMGSGKSRAREAAIAAISSPLLESSIDGASGAVFNITGGA  269

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++++    DP+ANIIFGAV+DER  GE+ +T+IATGF 
Sbjct  270   DLTLHEVNSAAEIIYEAVDPNANIIFGAVIDERMQGEVQITVIATGFN  317



>ref|WP_017745628.1| cell division protein FtsZ [Scytonema hofmanni]
Length=432

 Score =   314 bits (804),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 207/339 (61%), Positives = 267/339 (79%), Gaps = 3/339 (1%)
 Frame = -3

Query  1272  QRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQ  1093
             +R  +     +P   A IKV+GVGGGG+NAVNRMI S + GV+F++INTDAQ+L  +AA 
Sbjct  49    EREDTRMGDIVPGRVANIKVIGVGGGGSNAVNRMIASDVIGVEFWSINTDAQALTLTAAP  108

Query  1092  TPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPV  913
             + +QIG+ LTRGLG GGNP +G++AAEES++ IA AL+GSD+VFITAGMGGGTG+GAAP+
Sbjct  109   SRLQIGQKLTRGLGAGGNPAIGQKAAEESRDEIARALEGSDLVFITAGMGGGTGTGAAPI  168

Query  912   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ  733
             VA+++KE G LTVGVVT PF FEGR+R  QA + IE L+  VDTLI+IPN++LL++  EQ
Sbjct  169   VAEVAKEMGALTVGVVTRPFIFEGRRRIQQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQ  228

Query  732   TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNR  553
             TP+QDAF  ADDVLRQGVQGISDIITIPGL+NVDFADV+AVM D+G+A++G+G+ S K+R
Sbjct  229   TPMQDAFRYADDVLRQGVQGISDIITIPGLINVDFADVRAVMADAGSALMGIGIGSGKSR  288

Query  552   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  373
             A EAA  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGA
Sbjct  289   AREAAIAAISSPLLESSIEGARGVVFNITGGSDLTLHEVNAAAETIYEVVDPNANIIFGA  348

Query  372   VVDERYNGEIHVTIIATGFT---QSFQRTLLTDPRGAKA  265
             V+D+R  GE+ +T+IATGFT   QS     +  PRG  A
Sbjct  349   VIDDRLQGEVRLTVIATGFTGEAQSVPPQNVNQPRGVVA  387



>ref|WP_031291206.1| cell division protein FtsZ [Leptolyngbya sp. Heron Island J]
Length=414

 Score =   313 bits (802),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 257/315 (82%), Gaps = 0/315 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A+IKVVGVGGGG NAV+RMI SG+ G++F+A+NTDAQ+L ++    P+Q+G+ L
Sbjct  41    IVPGSMARIKVVGVGGGGCNAVSRMIDSGVAGIEFWALNTDAQALTKATDANPLQLGQKL  100

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ I+ A++G+D+VFITAGMGGGTG+GAAPVVA+ +KEAG
Sbjct  101   TRGLGAGGNPAIGQKAAEESRDEISTAIEGADLVFITAGMGGGTGTGAAPVVAEAAKEAG  160

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LT+GVVT PF+FEGR+R+ Q+ E I  LQ++VDTLI+IPND+LL +  EQTP+Q+AF  
Sbjct  161   ALTIGVVTRPFTFEGRRRTSQSEEGIMALQESVDTLIIIPNDKLLSVISEQTPVQEAFRF  220

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADD+LRQGVQGISDIITI GLVNVDFADV+AVM D+G+A++G+GV S K+RA EAA  A 
Sbjct  221   ADDILRQGVQGISDIITISGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAREAAIAAI  280

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ +SI  ATG V NITGG D+TL EVN  ++++    DP+ANIIFGAV+DER  GE
Sbjct  281   SSPLLETSIDGATGAVLNITGGNDMTLHEVNAAAEIIYEAVDPNANIIFGAVIDERMQGE  340

Query  345   IHVTIIATGFTQSFQ  301
             + +T+IATGF  S +
Sbjct  341   VRITVIATGFNASTE  355



>ref|WP_035826132.1| cell division protein FtsZ [Crocosphaera watsonii]
Length=419

 Score =   313 bits (802),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 254/320 (79%), Gaps = 0/320 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S R   +P   A+IKV+GVGGGG NAV+RMI S L GV+F+ +NTDAQ+L QS+A   +Q
Sbjct  52    SRRNVIVPNSIARIKVIGVGGGGCNAVDRMIESDLMGVEFWTMNTDAQALTQSSAPHRLQ  111

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IG  LT+GLG GGNP +G++AA ES++ IA AL+ +D+VFITAGMGGGTG+GAA +VA+I
Sbjct  112   IGRKLTKGLGAGGNPNIGKEAAVESRDEIAEALEDTDLVFITAGMGGGTGTGAAAIVAEI  171

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LTVGVVT PF+FEGR+R +QA + I  LQ NVDTLI+IPN++LL +   +TPL+
Sbjct  172   AKERGCLTVGVVTRPFTFEGRRRMVQAGQGISDLQNNVDTLIIIPNNQLLQVISPETPLR  231

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AFL AD+VLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+G+ S K+RA +A
Sbjct  232   EAFLAADNVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRANDA  291

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+  SIQ A GVV+NITGG D++L EVN  ++ +  + DP ANIIFGAV+DE
Sbjct  292   ASSAISSPLLEHSIQGAKGVVFNITGGHDLSLHEVNTAAETIFDVVDPDANIIFGAVIDE  351

Query  360   RYNGEIHVTIIATGFTQSFQ  301
             R  GE+ VT+IATGF+   +
Sbjct  352   RVQGEVIVTVIATGFSPEVE  371



>gb|ESA39048.1| cell division protein [Leptolyngbya sp. Heron Island J]
Length=378

 Score =   312 bits (799),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 257/315 (82%), Gaps = 0/315 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A+IKVVGVGGGG NAV+RMI SG+ G++F+A+NTDAQ+L ++    P+Q+G+ L
Sbjct  5     IVPGSMARIKVVGVGGGGCNAVSRMIDSGVAGIEFWALNTDAQALTKATDANPLQLGQKL  64

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ I+ A++G+D+VFITAGMGGGTG+GAAPVVA+ +KEAG
Sbjct  65    TRGLGAGGNPAIGQKAAEESRDEISTAIEGADLVFITAGMGGGTGTGAAPVVAEAAKEAG  124

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LT+GVVT PF+FEGR+R+ Q+ E I  LQ++VDTLI+IPND+LL +  EQTP+Q+AF  
Sbjct  125   ALTIGVVTRPFTFEGRRRTSQSEEGIMALQESVDTLIIIPNDKLLSVISEQTPVQEAFRF  184

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADD+LRQGVQGISDIITI GLVNVDFADV+AVM D+G+A++G+GV S K+RA EAA  A 
Sbjct  185   ADDILRQGVQGISDIITISGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAREAAIAAI  244

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ +SI  ATG V NITGG D+TL EVN  ++++    DP+ANIIFGAV+DER  GE
Sbjct  245   SSPLLETSIDGATGAVLNITGGNDMTLHEVNAAAEIIYEAVDPNANIIFGAVIDERMQGE  304

Query  345   IHVTIIATGFTQSFQ  301
             + +T+IATGF  S +
Sbjct  305   VRITVIATGFNASTE  319



>ref|WP_017296057.1| hypothetical protein [Geminocystis herdmanii]
Length=425

 Score =   313 bits (803),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 181/288 (63%), Positives = 233/288 (81%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI   + GV+F+ INTDAQ+L QS     +QIG+ LTRGLG GGNP +G++AAEES+E 
Sbjct  80    RMIQGNVVGVEFWQINTDAQALAQSMVTNCLQIGQKLTRGLGAGGNPAIGQKAAEESREE  139

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             IA  L+ +D+VFITAGMGGGTG+GAAP+VA+I+KE G LTVGVVT PF+FEGR+R+ QA 
Sbjct  140   IAKTLENTDLVFITAGMGGGTGTGAAPIVAEIAKEMGCLTVGVVTRPFTFEGRRRTNQAE  199

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             + I+ L+  VDTLIVIPN++LL +   +TPLQ++F +ADD LRQGVQGISDIITIPGLVN
Sbjct  200   DGIQALESKVDTLIVIPNNKLLSVIPPETPLQESFRMADDTLRQGVQGISDIITIPGLVN  259

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+A++G+G+ S K+RA+E A  A  +PL+ SSIQ ATGVV NITGG 
Sbjct  260   VDFADVRAVMADAGSALMGIGIGSGKSRAKEGAVAAISSPLLESSIQGATGVVINITGGS  319

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++ +  + DP+ANIIFGAV+DE+  GEI +T+IATGF+
Sbjct  320   DLTLHEVNTAAETIYEIVDPNANIIFGAVIDEKMQGEIRITVIATGFS  367



>ref|WP_006278715.1| cell division protein FtsZ [Cylindrospermopsis raciborskii]
 gb|EFA68482.1| Cell division protein FtsZ [Cylindrospermopsis raciborskii CS-505]
Length=432

 Score =   313 bits (803),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 203/331 (61%), Positives = 262/331 (79%), Gaps = 3/331 (1%)
 Frame = -3

Query  1305  GYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINT  1126
             G  S    +   +R       +P   A IKV+GVGGGG NAVNRMI S + GV+F++INT
Sbjct  40    GQGSDNTKMLEAKRIG---EIVPGRVANIKVIGVGGGGGNAVNRMIESDVTGVEFWSINT  96

Query  1125  DAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagm  946
             DAQ+L  + A + +QIG+ LTRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGM
Sbjct  97    DAQALTWANASSRLQIGQKLTRGLGAGGNPSIGQKAAEESRDEIATALEGADLVFITAGM  156

Query  945   gggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  766
             GGGTG+GAAP+VA+++KE G LTVGVVT PF FEGR+R+ QA + IE L+  VDTLI+IP
Sbjct  157   GGGTGTGAAPIVAEVAKEMGALTVGVVTRPFVFEGRRRTSQAEQGIEGLKSRVDTLIIIP  216

Query  765   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  586
             N++LL++  EQTP+Q+AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+
Sbjct  217   NNKLLEVIPEQTPVQEAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSAL  276

Query  585   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL  406
             +G+GVSS K+RA EAA  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  +
Sbjct  277   MGIGVSSGKSRAREAAIAAISSPLLESSIEGARGVVFNITGGSDLTLHEVNAAAETIYEV  336

Query  405   ADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
              DP+ANIIFGAV+D+R  GE+ +T+IATGFT
Sbjct  337   VDPNANIIFGAVIDDRLQGEVRITVIATGFT  367



>ref|WP_013191011.1| cell division protein FtsZ [Trichormus azollae]
 ref|YP_003721117.1| cell division protein FtsZ ['Nostoc azollae' 0708]
 gb|ADI63994.1| cell division protein FtsZ ['Nostoc azollae' 0708]
Length=429

 Score =   313 bits (802),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 203/335 (61%), Positives = 263/335 (79%), Gaps = 3/335 (1%)
 Frame = -3

Query  1305  GYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINT  1126
             G ++  K +    R       +P   A IKV+GVGGGG NAVNRMI S + GV+F++INT
Sbjct  40    GQSNDSKKMVENSRIG---EIVPGRVANIKVIGVGGGGGNAVNRMIESDVSGVEFWSINT  96

Query  1125  DAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagm  946
             DAQ+L  + A + +QIG+ LTRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGM
Sbjct  97    DAQALTLAGAPSRLQIGQKLTRGLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGM  156

Query  945   gggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  766
             GGGTG+GAAP+VA+++KE G LTVGVVT PF FEGR+R+ QA + IE L+  VDTLI+IP
Sbjct  157   GGGTGTGAAPIVAEVAKEMGALTVGVVTRPFVFEGRRRTTQAEQGIEGLKSRVDTLIIIP  216

Query  765   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  586
             N++LL++  EQTP+Q+AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+
Sbjct  217   NNKLLEVIPEQTPVQEAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSAL  276

Query  585   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL  406
             +G+GVSS K+RA EAA  A  +PL+  SI+ A GVV+NITGG D+TL EVN  ++ +  +
Sbjct  277   MGIGVSSGKSRAREAAIAAISSPLLECSIEGARGVVFNITGGSDLTLHEVNAAAETIYEV  336

Query  405   ADPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQ  301
              DP+ANIIFGAV+D+R  GE+ +T+IATGFT   Q
Sbjct  337   VDPNANIIFGAVIDDRLQGEVRITVIATGFTGEIQ  371



>gb|EHJ13165.1| cell division protein [Crocosphaera watsonii WH 0003]
 emb|CCQ67080.1| Cell division protein FtsZ [Crocosphaera watsonii WH 0402]
Length=362

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 252/314 (80%), Gaps = 0/314 (0%)
 Frame = -3

Query  1242  IPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgellt  1063
             +P   A+IKV+GVGGGG NAV+RMI S L GV+F+ +NTDAQ+L QS+A   +QIG  LT
Sbjct  1     MPNSIARIKVIGVGGGGCNAVDRMIESDLMGVEFWTMNTDAQALTQSSAPHRLQIGRKLT  60

Query  1062  rglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGY  883
             +GLG GGNP +G++AA ES++ IA AL+ +D+VFITAGMGGGTG+GAA +VA+I+KE G 
Sbjct  61    KGLGAGGNPNIGKEAAVESRDEIAEALEDTDLVFITAGMGGGTGTGAAAIVAEIAKERGC  120

Query  882   LTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLA  703
             LTVGVVT PF+FEGR+R +QA + I  LQ NVDTLI+IPN++LL +   +TPL++AFL A
Sbjct  121   LTVGVVTRPFTFEGRRRMVQAGQGISDLQNNVDTLIIIPNNQLLQVISPETPLREAFLAA  180

Query  702   DDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATL  523
             D+VLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+G+ S K+RA +AA  A  
Sbjct  181   DNVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRANDAASSAIS  240

Query  522   APLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEI  343
             +PL+  SIQ A GVV+NITGG D++L EVN  ++ +  + DP ANIIFGAV+DER  GE+
Sbjct  241   SPLLEHSIQGAKGVVFNITGGHDLSLHEVNTAAETIFDVVDPDANIIFGAVIDERVQGEV  300

Query  342   HVTIIATGFTQSFQ  301
              VT+IATGF+   +
Sbjct  301   IVTVIATGFSPEVE  314



>gb|AHJ27769.1| Cell division protein FtsZ [Nodularia spumigena CCY9414]
Length=380

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 200/315 (63%), Positives = 257/315 (82%), Gaps = 0/315 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKV+GVGGGG NAVNRMI S + GV+F++INTDAQ+L  + A + +QIG+ L
Sbjct  11    IVPGRVANIKVIGVGGGGGNAVNRMIESDVSGVEFWSINTDAQALTLAGAPSRLQIGQKL  70

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  71    TRGLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMG  130

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF FEGR+R+ QA + IE L+  VDTLI+IPN++LL++  EQTP+Q+AF  
Sbjct  131   ALTVGVVTRPFVFEGRRRTSQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQTPVQEAFRY  190

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GVSS K+RA EAA  A 
Sbjct  191   ADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVSSGKSRAREAAIAAI  250

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+  SI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D+R  GE
Sbjct  251   SSPLLECSIEGARGVVFNITGGSDLTLHEVNAAAEAIYEVVDPNANIIFGAVIDDRLQGE  310

Query  345   IHVTIIATGFTQSFQ  301
             + +T+IATGFT   Q
Sbjct  311   VRITVIATGFTGEIQ  325



>ref|WP_009342894.1| cell division protein FtsZ [Raphidiopsis brookii]
 gb|EFA73184.1| Cell division protein FtsZ [Raphidiopsis brookii D9]
Length=432

 Score =   313 bits (802),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 203/331 (61%), Positives = 262/331 (79%), Gaps = 3/331 (1%)
 Frame = -3

Query  1305  GYASRRKSLFHQRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINT  1126
             G  S    +   +R       +P   A IKV+GVGGGG NAVNRMI S + GV+F++INT
Sbjct  40    GQGSDNTKMLEAKRIG---EIVPGRVANIKVIGVGGGGGNAVNRMIESDVTGVEFWSINT  96

Query  1125  DAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagm  946
             DAQ+L  + A + +QIG+ LTRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGM
Sbjct  97    DAQALTWANASSRLQIGQKLTRGLGAGGNPSIGQKAAEESRDEIATALEGADLVFITAGM  156

Query  945   gggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIP  766
             GGGTG+GAAP+VA+++KE G LTVGVVT PF FEGR+R+ QA + IE L+  VDTLI+IP
Sbjct  157   GGGTGTGAAPIVAEVAKEMGALTVGVVTRPFVFEGRRRTSQAEQGIEGLKSRVDTLIIIP  216

Query  765   NDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAM  586
             N++LL++  EQTP+Q+AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A+
Sbjct  217   NNKLLEVIPEQTPVQEAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSAL  276

Query  585   LGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSL  406
             +G+GVSS K+RA EAA  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  +
Sbjct  277   MGIGVSSGKSRAREAAIAAISSPLLESSIEGARGVVFNITGGSDLTLHEVNAAAETIYEV  336

Query  405   ADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
              DP+ANIIFGAV+D+R  GE+ +T+IATGFT
Sbjct  337   VDPNANIIFGAVIDDRLQGEVRITVIATGFT  367



>ref|WP_018753246.1| cell division protein FtsZ [Paenibacillus sanguinis]
Length=382

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 261/338 (77%), Gaps = 7/338 (2%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+GVGGGG+NAVNRMI +G+QGV+F  +NTDAQ+L  + ++  +QIG+ LTRGLG 
Sbjct  12    AQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHLAKSEHKLQIGDKLTRGLGA  71

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             G NP +G++AAEES+E IAN LKG+DMVF+TAGMGGGTG+GAAPV+A+I++E G LTVGV
Sbjct  72    GANPEVGKKAAEESRELIANTLKGADMVFVTAGMGGGTGTGAAPVIAEIARECGALTVGV  131

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VT PF+FEGRKRS QA+  IE L++ VDTLIVIPNDRLL+I D++TP+ +AF  AD+VLR
Sbjct  132   VTRPFTFEGRKRSSQAVLGIEALKEKVDTLIVIPNDRLLEIVDKKTPMLEAFREADNVLR  191

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIG  508
             Q VQGISD+I +PGL+N+DFADVK +M + G+A++G+G+++ +NRA EAA +A ++PL+ 
Sbjct  192   QAVQGISDLIAVPGLINLDFADVKTIMTERGSALMGIGLATGENRAAEAARKAIMSPLLE  251

Query  507   SSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTII  328
             +SI+ A GV+ NITGG +++L EVN  +++V + +DP  N+IFGA++DE    EI VT+I
Sbjct  252   TSIEGARGVIMNITGGANLSLYEVNEAAEIVIAASDPEVNMIFGAIIDEDMKEEIKVTVI  311

Query  327   ATGFTQSFQRTLLTDPRGAKAGDKGAG-------SQEN  235
             ATGF       L   P     G  GA        SQEN
Sbjct  312   ATGFEHKDVSHLTRKPTATAPGAPGASGTPSISESQEN  349



>ref|WP_011140302.1| cell division protein FtsZ [Gloeobacter violaceus]
 ref|NP_923244.1| cell division protein FtsZ [Gloeobacter violaceus PCC 7421]
 dbj|BAC88239.1| cell division protein [Gloeobacter violaceus PCC 7421]
Length=419

 Score =   312 bits (800),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 250/311 (80%), Gaps = 0/311 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKVVGVGGGG NAVNRMI S + GV+F+AINTDAQSL QS+A   +QIG+ L
Sbjct  50    IVPSSVALIKVVGVGGGGGNAVNRMIASNVVGVEFWAINTDAQSLTQSSAPQRLQIGQKL  109

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES+E I  AL+G+D+VFITAGMGGGTG+GAA +VA+ +KE G
Sbjct  110   TRGLGAGGNPSIGQKAAEESREEIMTALEGADLVFITAGMGGGTGTGAAAIVAEAAKEVG  169

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTV VVT PF+FEGR+R  QA   IE LQ  VDTLIVIPND+LL +  EQTP+Q+AF +
Sbjct  170   ALTVAVVTRPFTFEGRRRMQQADSGIEALQGRVDTLIVIPNDKLLSVISEQTPVQEAFRI  229

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADD+LRQGVQGISDIITIPGL+NVDFADV+A+M D+G+A++G+G+ S K+RA EAA  A 
Sbjct  230   ADDILRQGVQGISDIITIPGLINVDFADVRAIMADAGSALMGIGMGSGKSRAREAAMTAI  289

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ SSI+ A GVV N+TGG D+TL EVN  + V+  + DP+ANIIFGAV+DE+  GE
Sbjct  290   SSPLLESSIEGANGVVLNVTGGHDLTLHEVNEAAAVIYEVVDPNANIIFGAVIDEKLQGE  349

Query  345   IHVTIIATGFT  313
             + +T+IATGF 
Sbjct  350   LRITVIATGFN  360



>ref|WP_021834441.1| Cell division protein FtsZ [Crocosphaera watsonii]
 emb|CCQ59866.1| Cell division protein FtsZ [Crocosphaera watsonii WH 0401]
Length=419

 Score =   312 bits (800),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 195/320 (61%), Positives = 254/320 (79%), Gaps = 0/320 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S R   +P   A+IKV+GVGGGG NAV+RMI S L G++F+ +NTDAQ+L QS+A   +Q
Sbjct  52    SRRNVIVPNSIARIKVIGVGGGGCNAVDRMIESDLMGIEFWTMNTDAQALTQSSAPHRLQ  111

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IG  LT+GLG GGNP +G++AA ES++ IA AL+ +D+VFITAGMGGGTG+GAA +VA+I
Sbjct  112   IGRKLTKGLGAGGNPNIGKEAAVESRDEIAEALEDTDLVFITAGMGGGTGTGAAAIVAEI  171

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LTVGVVT PF+FEGR+R +QA + I  LQ NVDTLI+IPN++LL +   +TPL+
Sbjct  172   AKERGCLTVGVVTRPFTFEGRRRMVQAGQGISDLQNNVDTLIIIPNNQLLQVISPETPLR  231

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AFL AD+VLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+G+ S K+RA +A
Sbjct  232   EAFLAADNVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRANDA  291

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+  SIQ A GVV+NITGG D++L EVN  ++ +  + DP ANIIFGAV+DE
Sbjct  292   ASSAISSPLLEHSIQGAKGVVFNITGGHDLSLHEVNTAAETIFDVVDPDANIIFGAVIDE  351

Query  360   RYNGEIHVTIIATGFTQSFQ  301
             R  GE+ VT+IATGF+   +
Sbjct  352   RVQGEVIVTVIATGFSPEVE  371



>ref|WP_006516669.1| cell division protein FtsZ [Leptolyngbya sp. PCC 7375]
 gb|EKV02286.1| cell division protein FtsZ [Leptolyngbya sp. PCC 7375]
Length=413

 Score =   312 bits (799),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 197/315 (63%), Positives = 257/315 (82%), Gaps = 0/315 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A+IKVVGVGGGG NAVNRMI +G+ G++F+A+NTDAQ+L ++ +  P+Q+G+ L
Sbjct  41    IVPGSMARIKVVGVGGGGCNAVNRMIDTGVSGIEFWALNTDAQALTKANSANPLQLGQKL  100

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ I+ A++G+D+VFITAGMGGGTG+GAAPVVA+ +KEAG
Sbjct  101   TRGLGAGGNPAIGQKAAEESRDEISTAIEGADLVFITAGMGGGTGTGAAPVVAEAAKEAG  160

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF+FEGR+R+ Q+ E I  LQ+ VDTLI+IPND+LL +  EQTP+Q+AF  
Sbjct  161   ALTVGVVTRPFTFEGRRRTTQSEEGIMALQECVDTLIIIPNDKLLSVISEQTPVQEAFRF  220

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADD+LRQGVQGISDIITI GLVNVDFADV+AVM D+G+A++G+GV S K+RA EAA  A 
Sbjct  221   ADDILRQGVQGISDIITISGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAREAAIAAI  280

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ +SI  ATG V NITGG D+TL EVN  ++++    DP+ANIIFGAV+DER  GE
Sbjct  281   SSPLLETSIDGATGAVLNITGGNDMTLHEVNAAAEIIYEAVDPNANIIFGAVIDERMQGE  340

Query  345   IHVTIIATGFTQSFQ  301
             I +T+IATGF  + +
Sbjct  341   IRITVIATGFNSNSE  355



>ref|WP_015173791.1| cell division protein FtsZ [Geitlerinema sp. PCC 7407]
 ref|YP_007111279.1| cell division protein FtsZ [Geitlerinema sp. PCC 7407]
 gb|AFY68227.1| cell division protein FtsZ [Geitlerinema sp. PCC 7407]
Length=427

 Score =   312 bits (800),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 255/312 (82%), Gaps = 1/312 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQ-SAAQTPIQIgel  1069
              +P   A+IKV+GVGGGG NAVNRMI S + GV+F++INTDAQ+L     A   +QIG+ 
Sbjct  61    IVPSSIARIKVIGVGGGGCNAVNRMIASEVSGVEFWSINTDAQALTNVPRASQHLQIGQK  120

Query  1068  ltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEA  889
             LTRGLG GGNP +G++AAEES++ +A A++G+D+VFITAGMGGGTG+GAAPVVA+++KEA
Sbjct  121   LTRGLGAGGNPAIGQKAAEESRDELAAAIEGADLVFITAGMGGGTGTGAAPVVAEVAKEA  180

Query  888   GYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFL  709
             G LTVGVVT PF+FEGR+R+ QA E    LQ  VDTLI+IPND+LL +  EQTP+Q+AF 
Sbjct  181   GALTVGVVTRPFTFEGRRRTNQAEEGTAALQGRVDTLIIIPNDKLLSVISEQTPVQEAFR  240

Query  708   LADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQA  529
             +ADD+LRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GV S K+RA EAA  A
Sbjct  241   VADDILRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAREAAMAA  300

Query  528   TLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNG  349
               +PL+ SSI  A GVV+NITGG D+TL EVN  ++++  + DP+ANIIFGAV+DER  G
Sbjct  301   IASPLLESSIDGAKGVVFNITGGHDLTLHEVNSAAEIIYEVVDPNANIIFGAVIDERMQG  360

Query  348   EIHVTIIATGFT  313
             EI +T+IATGF+
Sbjct  361   EIRITVIATGFS  372



>ref|WP_007305196.1| cell division protein FtsZ [Crocosphaera watsonii]
 gb|EAM51192.1| Cell division protein FtsZ [Crocosphaera watsonii WH 8501]
Length=419

 Score =   312 bits (799),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 195/320 (61%), Positives = 254/320 (79%), Gaps = 0/320 (0%)
 Frame = -3

Query  1260  SVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQ  1081
             S R   +P   A+IKV+GVGGGG NAV+RMI S L G++F+ +NTDAQ+L QS+A   +Q
Sbjct  52    SRRDVIVPNSIARIKVIGVGGGGCNAVDRMIESDLMGIEFWTMNTDAQALTQSSAPHRLQ  111

Query  1080  IgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQI  901
             IG  LT+GLG GGNP +G++AA ES++ IA AL+ +D+VFITAGMGGGTG+GAA +VA+I
Sbjct  112   IGRKLTKGLGAGGNPNIGKEAAVESRDEIAEALEDTDLVFITAGMGGGTGTGAAAIVAEI  171

Query  900   SKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQ  721
             +KE G LTVGVVT PF+FEGR+R +QA + I  LQ NVDTLI+IPN++LL +   +TPL+
Sbjct  172   AKERGCLTVGVVTRPFTFEGRRRMVQAGQGISDLQNNVDTLIIIPNNQLLQVISPETPLR  231

Query  720   DAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEA  541
             +AFL AD+VLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+G+ S K+RA +A
Sbjct  232   EAFLAADNVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGIGSGKSRANDA  291

Query  540   AEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDE  361
             A  A  +PL+  SIQ A GVV+NITGG D++L EVN  ++ +  + DP ANIIFGAV+DE
Sbjct  292   ASSAISSPLLEHSIQGAKGVVFNITGGHDLSLHEVNTAAETIFDVVDPDANIIFGAVIDE  351

Query  360   RYNGEIHVTIIATGFTQSFQ  301
             R  GE+ VT+IATGF+   +
Sbjct  352   RVQGEVIVTVIATGFSPEVE  371



>ref|WP_015212387.1| cell division protein FtsZ [Anabaena cylindrica]
 ref|YP_007154641.1| cell division protein FtsZ [Anabaena cylindrica PCC 7122]
 gb|AFZ55731.1| cell division protein FtsZ [Anabaena cylindrica PCC 7122]
Length=428

 Score =   312 bits (800),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 201/317 (63%), Positives = 258/317 (81%), Gaps = 0/317 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKV+GVGGGG NAVNRMI S + GV+F++INTDAQ+L  + A + +QIG+ L
Sbjct  57    IVPGRVANIKVIGVGGGGGNAVNRMIESDVSGVEFWSINTDAQALTLAGAPSRLQIGQKL  116

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGMGGGTG+GAAP+VA+I+KE G
Sbjct  117   TRGLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEIAKEMG  176

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF FEGR+R+ QA + +E L+  VDTLI+IPN++LL++  EQTP+Q+AF  
Sbjct  177   ALTVGVVTRPFVFEGRRRTSQAEQGVEGLKSRVDTLIIIPNNKLLEVIPEQTPVQEAFRY  236

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GVSS K+RA EAA  A 
Sbjct  237   ADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVSSGKSRAREAAIAAI  296

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+  SI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D+R  GE
Sbjct  297   SSPLLECSIEGARGVVFNITGGSDLTLHEVNAAAETIYEVVDPNANIIFGAVIDDRLQGE  356

Query  345   IHVTIIATGFTQSFQRT  295
             + +T+IATGFT   Q T
Sbjct  357   VRITVIATGFTGEIQAT  373



>ref|WP_036646713.1| cell division protein FtsZ [Paenibacillus pini]
 dbj|GAF07095.1| cell division protein FtsZ [Paenibacillus pini JCM 16418]
Length=376

 Score =   310 bits (795),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 252/304 (83%), Gaps = 0/304 (0%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+GVGGGG+NAVNRMI +G+QGV+F  +NTDAQ+L  + ++  +QIG+ LTRGLG 
Sbjct  12    AQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHMAKSEHKLQIGDKLTRGLGA  71

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             G NP +G++AAEES+E I N LKG+DMVF+TAGMGGGTG+GAAPV+A+I+KE G LTVGV
Sbjct  72    GANPDVGKKAAEESRELIMNTLKGADMVFVTAGMGGGTGTGAAPVIAEIAKECGALTVGV  131

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VT PF+FEGRKRSLQA   IE L++ VDTLIVIPNDRLL+I D++TP+ +AF  AD+VLR
Sbjct  132   VTRPFTFEGRKRSLQAELGIEGLKEKVDTLIVIPNDRLLEIVDKKTPMLEAFREADNVLR  191

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIG  508
             Q VQGISD+I +PGL+N+DFADVK +M + G+A++G+G+++ +NRA EAA +A ++PL+ 
Sbjct  192   QAVQGISDLIAVPGLINLDFADVKTIMTERGSALMGIGMATGENRAAEAARKAIMSPLLE  251

Query  507   SSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTII  328
             +SI+ A GV+ NITGG +++L EVN  +++VTS +DP  N+IFGA+++E    EI VT+I
Sbjct  252   TSIEGALGVIMNITGGTNLSLYEVNEAAEIVTSASDPEVNMIFGAIIEENMKDEIKVTVI  311

Query  327   ATGF  316
             ATGF
Sbjct  312   ATGF  315



>ref|WP_015194198.1| cell division protein FtsZ [Stanieria cyanosphaera]
 ref|YP_007133498.1| cell division protein FtsZ [Stanieria cyanosphaera PCC 7437]
 gb|AFZ36532.1| cell division protein FtsZ [Stanieria cyanosphaera PCC 7437]
Length=417

 Score =   311 bits (798),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 192/310 (62%), Positives = 251/310 (81%), Gaps = 0/310 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              IP + AKIKV+GVGGGG NAVNRMI SG+ G++F+AINTDAQ+L  + A   +QIG+ +
Sbjct  56    IIPSNIAKIKVMGVGGGGCNAVNRMIDSGVSGIEFWAINTDAQALSHAGAPQRLQIGQKI  115

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA+AL+ +D+VFITAGMGGGTG+GAAP+ A+++KE G
Sbjct  116   TRGLGAGGNPAIGQKAAEESRDEIAHALENTDLVFITAGMGGGTGTGAAPIAAEVAKEMG  175

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF+FEGR+R+ QA E I      VDTLIVIPN++LL +   +TP+Q+AF +
Sbjct  176   CLTVGVVTRPFTFEGRRRTNQAEEGIAAFGTRVDTLIVIPNNQLLTVISPETPMQEAFRI  235

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGL+NVDFADV+A+M D+G+A++G+G+ S K+RA EAA  A 
Sbjct  236   ADDVLRQGVQGISDIITIPGLINVDFADVRAIMADAGSALMGIGIGSGKSRAREAAIAAV  295

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ +SI+ A GVV NITGG D++L EVN  ++ +  + DP ANIIFGAV+DER  GE
Sbjct  296   SSPLLEASIEGAKGVVINITGGTDLSLHEVNAAAESIYDVVDPDANIIFGAVIDERMQGE  355

Query  345   IHVTIIATGF  316
             + +T+IATGF
Sbjct  356   VCITVIATGF  365



>ref|WP_015209597.1| cell division protein FtsZ [Cylindrospermum stagnale]
 ref|YP_007149035.1| cell division protein FtsZ [Cylindrospermum stagnale PCC 7417]
 gb|AFZ26355.1| cell division protein FtsZ [Cylindrospermum stagnale PCC 7417]
Length=429

 Score =   312 bits (799),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 200/315 (63%), Positives = 257/315 (82%), Gaps = 0/315 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKV+GVGGGG NAVNRMI S + GV+F++INTDAQ+L  + A + +QIG+ L
Sbjct  58    IVPGRVANIKVIGVGGGGGNAVNRMIESDVSGVEFWSINTDAQALTLAGAPSRLQIGQKL  117

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  118   TRGLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMG  177

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF FEGR+R+ QA + IE L+  VDTLI+IPN++LL++  EQTP+Q+AF  
Sbjct  178   ALTVGVVTRPFVFEGRRRTSQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQTPVQEAFRY  237

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GVSS K+RA EAA  A 
Sbjct  238   ADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVSSGKSRAREAAIAAI  297

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+  SI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D+R  GE
Sbjct  298   SSPLLECSIEGARGVVFNITGGSDLTLHEVNAAAETIYEVVDPNANIIFGAVIDDRLQGE  357

Query  345   IHVTIIATGFTQSFQ  301
             + +T+IATGFT   Q
Sbjct  358   VRITVIATGFTGELQ  372



>ref|WP_015125672.1| cell division protein FtsZ [Synechococcus sp. PCC 6312]
 ref|YP_007062673.1| cell division protein FtsZ [Synechococcus sp. PCC 6312]
 gb|AFY62130.1| cell division protein FtsZ [Synechococcus sp. PCC 6312]
Length=363

 Score =   310 bits (793),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 181/288 (63%), Positives = 231/288 (80%), Gaps = 0/288 (0%)
 Frame = -3

Query  1176  RMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEA  997
             RMI S + GV+F+++NTDAQ+L QS A   +Q+G  LTRGLG GGNP +G++AAEES+E 
Sbjct  22    RMISSQVAGVEFWSVNTDAQALSQSLAHQCLQLGNKLTRGLGAGGNPSIGQKAAEESRED  81

Query  996   IANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQAL  817
             +ANALK +D++FIT GMGGGTG+GAAPVVA+++KE G LTV VVT PF+FEGR+R  QA 
Sbjct  82    LANALKDADLIFITCGMGGGTGTGAAPVVAEVAKEQGALTVAVVTRPFTFEGRRRGQQAE  141

Query  816   EAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVN  637
             E IE LQ  VDTLIVIPND++L +  EQT +Q+AF +ADDVLRQGVQGISDII +PGL+N
Sbjct  142   EGIEALQSRVDTLIVIPNDKILSVISEQTTVQEAFQVADDVLRQGVQGISDIINLPGLIN  201

Query  636   VDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK  457
             VDFADV+AVM D+G+AM+G+GV+S K+RA EAA  A  +PL+ SSI+ A G+V N+ GG 
Sbjct  202   VDFADVRAVMADAGSAMMGIGVASGKSRAREAAITAISSPLLESSIEGARGIVLNVRGGV  261

Query  456   DITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTIIATGFT  313
             D+TL EVN  ++V+  + D  ANIIFGAVVD+   GEI VT+IATGF+
Sbjct  262   DLTLHEVNAAAEVIYEVVDVDANIIFGAVVDDSLQGEIKVTVIATGFS  309



>gb|KIE11505.1| cell division protein FtsZ, partial [Tolypothrix bouteillei VB521301]
Length=429

 Score =   311 bits (798),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 205/339 (60%), Positives = 265/339 (78%), Gaps = 6/339 (2%)
 Frame = -3

Query  1272  QRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQ  1093
             +R  +     +P   A IKV+GVGGGG+NAVNRMI S + GV+F++INTDAQ+L  ++A 
Sbjct  49    EREDTRMGDIVPGRVANIKVIGVGGGGSNAVNRMIASDVIGVEFWSINTDAQALTLTSAP  108

Query  1092  TPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPV  913
             + +QIG+ LTRGLG GGNP +G++AAEES++ IA AL+GSD+VFITAGMGGGTG+GAAP+
Sbjct  109   SRLQIGQKLTRGLGAGGNPAIGQKAAEESRDEIARALEGSDLVFITAGMGGGTGTGAAPI  168

Query  912   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ  733
             VA+++KE G LTVGVVT PF FEGR+R  QA + IE L+  VDTLI+IPN++LL++  EQ
Sbjct  169   VAEVAKEMGALTVGVVTRPFIFEGRRRIQQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQ  228

Query  732   TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNR  553
             TP+QDAF  ADDVLRQGVQGISDIITIPGL+NVDFADV+AVM D+G+A++G+G+ S K+R
Sbjct  229   TPMQDAFRYADDVLRQGVQGISDIITIPGLINVDFADVRAVMADAGSALMGIGIGSGKSR  288

Query  552   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  373
             A EAA  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGA
Sbjct  289   AREAAIAAISSPLLESSIEGARGVVFNITGGSDLTLHEVNAAAETIYEVVDPNANIIFGA  348

Query  372   VVDERYNGEIHVTIIATGFTQSFQR------TLLTDPRG  274
             V+D+R  GE+ +T+IATGFT   Q         L  PRG
Sbjct  349   VIDDRLQGEVRLTVIATGFTGEAQSAPSQNVNQLNQPRG  387



>gb|AHV98374.1| cell division protein FtsZ [Paenibacillus sabinae T27]
Length=369

 Score =   310 bits (793),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 185/304 (61%), Positives = 252/304 (83%), Gaps = 0/304 (0%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+GVGGGG+NAVNRMI +G+QGV+F  +NTDAQ+L  + ++  +QIG+ LTRGLG 
Sbjct  12    AQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHMAKSEHKLQIGDKLTRGLGA  71

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             G NP +G++AAEES++ I+N LKG+DMVF+TAGMGGGTG+GAAPV+A+I+KE G LTVGV
Sbjct  72    GANPEVGKKAAEESRDLISNTLKGADMVFVTAGMGGGTGTGAAPVIAEIAKECGALTVGV  131

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VT PF+FEGRKRS QA   IE L++ VDTLIVIPNDRLL+I D++TP+ +AF  AD+VLR
Sbjct  132   VTRPFTFEGRKRSTQAELGIEALKEKVDTLIVIPNDRLLEIVDKKTPMLEAFREADNVLR  191

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIG  508
             Q VQGISD+I +PGL+N+DFADVK +M + G+A++G+G+++ +NRA EAA +A ++PL+ 
Sbjct  192   QAVQGISDLIAVPGLINLDFADVKTIMTERGSALMGIGIATGENRASEAARKAIMSPLLE  251

Query  507   SSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTII  328
             +SI+ A GV+ NITGG +++L EVN  +++VTS +DP  N+IFGA+++E    EI VT+I
Sbjct  252   TSIEGARGVIMNITGGSNLSLYEVNEAAEIVTSASDPEVNMIFGAIIEESMKDEIKVTVI  311

Query  327   ATGF  316
             ATGF
Sbjct  312   ATGF  315



>dbj|GAK39701.1| cell division protein FtsZ [Paenibacillus sp. TCA20]
Length=372

 Score =   310 bits (793),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 252/304 (83%), Gaps = 0/304 (0%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+GVGGGG+NAVNRMI +G+QGV+F  +NTDAQ+L  + ++  +QIG+ LTRGLG 
Sbjct  12    AQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHLARSEHKLQIGDKLTRGLGA  71

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             G NP +G++AAEES++ IAN LKG+DMVF+TAGMGGGTG+GAAPV+A+I+KE G LTVGV
Sbjct  72    GANPEVGKKAAEESRDLIANTLKGADMVFVTAGMGGGTGTGAAPVIAEIAKECGALTVGV  131

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VT PF+FEGRKRS QA   IE L++ VDTLIVIPNDRLL+I D++TP+ +AF  AD+VLR
Sbjct  132   VTRPFTFEGRKRSNQAEHGIEALKEKVDTLIVIPNDRLLEIVDKKTPMLEAFREADNVLR  191

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIG  508
             Q VQGISD+I +PGL+N+DFADVK +M + G+A++G+G+++ +NRA EAA +A ++PL+ 
Sbjct  192   QAVQGISDLIAVPGLINLDFADVKTIMTERGSALMGIGMATGENRAAEAARKAIMSPLLE  251

Query  507   SSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTII  328
             +SI+ A GV+ NITGG +++L EVN  +++VTS +DP  N+IFGA++DE    EI VT+I
Sbjct  252   TSIEGARGVIMNITGGANLSLYEVNEAAEIVTSASDPEVNMIFGAIIDENLKEEIKVTVI  311

Query  327   ATGF  316
             ATGF
Sbjct  312   ATGF  315



>ref|WP_038074722.1| cell division protein FtsZ [Tolypothrix bouteillei]
Length=435

 Score =   312 bits (799),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 205/339 (60%), Positives = 265/339 (78%), Gaps = 6/339 (2%)
 Frame = -3

Query  1272  QRRFSVRCSFIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQ  1093
             +R  +     +P   A IKV+GVGGGG+NAVNRMI S + GV+F++INTDAQ+L  ++A 
Sbjct  49    EREDTRMGDIVPGRVANIKVIGVGGGGSNAVNRMIASDVIGVEFWSINTDAQALTLTSAP  108

Query  1092  TPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPV  913
             + +QIG+ LTRGLG GGNP +G++AAEES++ IA AL+GSD+VFITAGMGGGTG+GAAP+
Sbjct  109   SRLQIGQKLTRGLGAGGNPAIGQKAAEESRDEIARALEGSDLVFITAGMGGGTGTGAAPI  168

Query  912   VAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQ  733
             VA+++KE G LTVGVVT PF FEGR+R  QA + IE L+  VDTLI+IPN++LL++  EQ
Sbjct  169   VAEVAKEMGALTVGVVTRPFIFEGRRRIQQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQ  228

Query  732   TPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNR  553
             TP+QDAF  ADDVLRQGVQGISDIITIPGL+NVDFADV+AVM D+G+A++G+G+ S K+R
Sbjct  229   TPMQDAFRYADDVLRQGVQGISDIITIPGLINVDFADVRAVMADAGSALMGIGIGSGKSR  288

Query  552   AEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGA  373
             A EAA  A  +PL+ SSI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGA
Sbjct  289   AREAAIAAISSPLLESSIEGARGVVFNITGGSDLTLHEVNAAAETIYEVVDPNANIIFGA  348

Query  372   VVDERYNGEIHVTIIATGFTQSFQR------TLLTDPRG  274
             V+D+R  GE+ +T+IATGFT   Q         L  PRG
Sbjct  349   VIDDRLQGEVRLTVIATGFTGEAQSAPSQNVNQLNQPRG  387



>ref|WP_023171980.1| cell division protein FtsZ [Gloeobacter kilaueensis]
 ref|YP_008710642.1| cell division protein FtsZ [Gloeobacter kilaueensis JS1]
 gb|AGY56935.1| cell division protein FtsZ [Gloeobacter kilaueensis JS1]
Length=417

 Score =   311 bits (797),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 200/310 (65%), Positives = 250/310 (81%), Gaps = 0/310 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKVVGVGGGG NAVNRMI S + GV+F+AINTDAQSL QS+A   +QIG+ L
Sbjct  50    IVPSSVALIKVVGVGGGGGNAVNRMIASNVVGVEFWAINTDAQSLTQSSAPQRLQIGQKL  109

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES+E I  AL+G+D+VFITAGMGGGTG+GAA +VA+ +KE G
Sbjct  110   TRGLGAGGNPSIGQKAAEESREEIMAALEGADLVFITAGMGGGTGTGAAAIVAEAAKEVG  169

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTV VVT PF+FEGR+R  QA   IE LQ  VDTLIVIPND+LL +  EQTP+Q+AF +
Sbjct  170   ALTVAVVTRPFTFEGRRRMQQAESGIEALQGRVDTLIVIPNDKLLTVISEQTPVQEAFRI  229

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADD+LRQGVQGISDIITIPGL+NVDFADV+A+M D+G+A++G+G+ S K+RA EAA  A 
Sbjct  230   ADDILRQGVQGISDIITIPGLINVDFADVRAIMADAGSALMGIGMGSGKSRAREAAMTAI  289

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+ SSI+ A GVV N+TGG D+TL EVN  + V+  + DP+ANIIFGAV+DE+  GE
Sbjct  290   SSPLLESSIEGANGVVLNVTGGHDLTLHEVNEAAAVIYEVVDPNANIIFGAVIDEKLQGE  349

Query  345   IHVTIIATGF  316
             + +T+IATGF
Sbjct  350   LRITVIATGF  359



>ref|WP_006197392.1| cell division protein FtsZ [Nodularia spumigena]
 gb|EAW44422.1| cell division protein FtsZ [Nodularia spumigena CCY9414]
Length=427

 Score =   311 bits (797),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 200/315 (63%), Positives = 257/315 (82%), Gaps = 0/315 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKV+GVGGGG NAVNRMI S + GV+F++INTDAQ+L  + A + +QIG+ L
Sbjct  58    IVPGRVANIKVIGVGGGGGNAVNRMIESDVSGVEFWSINTDAQALTLAGAPSRLQIGQKL  117

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  118   TRGLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMG  177

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF FEGR+R+ QA + IE L+  VDTLI+IPN++LL++  EQTP+Q+AF  
Sbjct  178   ALTVGVVTRPFVFEGRRRTSQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQTPVQEAFRY  237

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GVSS K+RA EAA  A 
Sbjct  238   ADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVSSGKSRAREAAIAAI  297

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+  SI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D+R  GE
Sbjct  298   SSPLLECSIEGARGVVFNITGGSDLTLHEVNAAAEAIYEVVDPNANIIFGAVIDDRLQGE  357

Query  345   IHVTIIATGFTQSFQ  301
             + +T+IATGFT   Q
Sbjct  358   VRITVIATGFTGEIQ  372



>ref|WP_015139802.1| cell division protein FtsZ [Nostoc sp. PCC 7524]
 ref|YP_007076972.1| cell division protein FtsZ [Nostoc sp. PCC 7524]
 gb|AFY49375.1| cell division protein FtsZ [Nostoc sp. PCC 7524]
Length=429

 Score =   311 bits (797),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 200/315 (63%), Positives = 257/315 (82%), Gaps = 0/315 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKV+GVGGGG NAVNRMI S + GV+F++INTDAQ+L  + A + +QIG+ L
Sbjct  58    IVPGRVANIKVIGVGGGGGNAVNRMIESDVSGVEFWSINTDAQALTLAGAPSRLQIGQKL  117

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  118   TRGLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMG  177

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF FEGR+R+ QA + IE L+  VDTLI+IPN++LL++  EQTP+Q+AF  
Sbjct  178   ALTVGVVTRPFVFEGRRRTSQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQTPVQEAFRY  237

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GVSS K+RA EAA  A 
Sbjct  238   ADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVSSGKSRAREAAIAAI  297

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+  SI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D+R  GE
Sbjct  298   SSPLLECSIEGARGVVFNITGGSDLTLHEVNAAAETIYEVVDPNANIIFGAVIDDRLQGE  357

Query  345   IHVTIIATGFTQSFQ  301
             + +T+IATGFT   Q
Sbjct  358   VRITVIATGFTGEIQ  372



>ref|WP_025692149.1| cell division protein FtsZ [Paenibacillus zanthoxyli]
Length=370

 Score =   309 bits (792),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 185/304 (61%), Positives = 252/304 (83%), Gaps = 0/304 (0%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+GVGGGG+NAVNRMI +G+QGV+F  +NTDAQ+L  + ++  +QIG+ LTRGLG 
Sbjct  12    AQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHMAKSEHKLQIGDKLTRGLGA  71

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             G NP +G++AAEES++ I+N LKG+DMVF+TAGMGGGTG+GAAPV+A+I+KE G LTVGV
Sbjct  72    GANPEVGKKAAEESRDLISNTLKGADMVFVTAGMGGGTGTGAAPVIAEIAKECGALTVGV  131

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VT PF+FEGRKRS QA   IE L++ VDTLIVIPNDRLL+I D++TP+ +AF  AD+VLR
Sbjct  132   VTRPFTFEGRKRSTQAELGIEALKEKVDTLIVIPNDRLLEIVDKKTPMLEAFREADNVLR  191

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIG  508
             Q VQGISD+I +PGL+N+DFADVK +M + G+A++G+G+++ +NRA EAA +A ++PL+ 
Sbjct  192   QAVQGISDLIAVPGLINLDFADVKTIMTERGSALMGIGIATGENRASEAARKAIMSPLLE  251

Query  507   SSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTII  328
             +SI+ A GV+ NITGG +++L EVN  +++VTS +DP  N+IFGA+++E    EI VT+I
Sbjct  252   TSIEGARGVIMNITGGSNLSLYEVNEAAEIVTSASDPEVNMIFGAIIEESMKDEIKVTVI  311

Query  327   ATGF  316
             ATGF
Sbjct  312   ATGF  315



>ref|WP_016949004.1| cell division protein FtsZ [Anabaena sp. PCC 7108]
Length=427

 Score =   311 bits (797),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 200/315 (63%), Positives = 257/315 (82%), Gaps = 0/315 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKV+GVGGGG NAVNRMI S + GV+F++INTDAQ+L  + A + +QIG+ L
Sbjct  56    IVPGRVANIKVIGVGGGGGNAVNRMIESDVSGVEFWSINTDAQALTLAGAPSRLQIGQKL  115

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  116   TRGLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMG  175

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF FEGR+R+ QA + IE L+  VDTLI+IPN++LL++  EQTP+Q+AF  
Sbjct  176   ALTVGVVTRPFVFEGRRRTSQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQTPVQEAFRY  235

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GVSS K+RA EAA  A 
Sbjct  236   ADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVSSGKSRAREAAIAAI  295

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+  SI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D+R  GE
Sbjct  296   SSPLLECSIEGARGVVFNITGGSDLTLHEVNAAAETIYEVVDPNANIIFGAVIDDRLQGE  355

Query  345   IHVTIIATGFTQSFQ  301
             + +T+IATGFT   Q
Sbjct  356   VRITVIATGFTGEIQ  370



>gb|AIQ13897.1| cell division protein FtsZ [Paenibacillus durus]
Length=370

 Score =   309 bits (792),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 185/304 (61%), Positives = 252/304 (83%), Gaps = 0/304 (0%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+GVGGGG+NAVNRMI +G+QGV+F  +NTDAQ+L  + ++  +QIG+ LTRGLG 
Sbjct  12    AQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHMAKSEHKLQIGDKLTRGLGA  71

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             G NP +G++AAEES++ I+N LKG+DMVF+TAGMGGGTG+GAAPV+A+I+KE G LTVGV
Sbjct  72    GANPEVGKKAAEESRDLISNTLKGADMVFVTAGMGGGTGTGAAPVIAEIAKECGALTVGV  131

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VT PF+FEGRKRS QA   IE L++ VDTLIVIPNDRLL+I D++TP+ +AF  AD+VLR
Sbjct  132   VTRPFTFEGRKRSTQAELGIEALKEKVDTLIVIPNDRLLEIVDKKTPMLEAFREADNVLR  191

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIG  508
             Q VQGISD+I +PGL+N+DFADVK +M + G+A++G+G+++ +NRA EAA +A ++PL+ 
Sbjct  192   QAVQGISDLIAVPGLINLDFADVKTIMTERGSALMGIGIATGENRASEAARKAIMSPLLE  251

Query  507   SSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTII  328
             +SI+ A GV+ NITGG +++L EVN  +++VTS +DP  N+IFGA+++E    EI VT+I
Sbjct  252   TSIEGARGVIMNITGGSNLSLYEVNEAAEIVTSASDPEVNMIFGAIIEESMKDEIKVTVI  311

Query  327   ATGF  316
             ATGF
Sbjct  312   ATGF  315



>ref|WP_025699186.1| cell division protein FtsZ [Paenibacillus durus]
Length=370

 Score =   309 bits (792),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 185/304 (61%), Positives = 252/304 (83%), Gaps = 0/304 (0%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+GVGGGG+NAVNRMI +G+QGV+F  +NTDAQ+L  + ++  +QIG+ LTRGLG 
Sbjct  12    AQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHMAKSEHKLQIGDKLTRGLGA  71

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             G NP +G++AAEES++ I+N LKG+DMVF+TAGMGGGTG+GAAPV+A+I+KE G LTVGV
Sbjct  72    GANPEVGKKAAEESRDLISNTLKGADMVFVTAGMGGGTGTGAAPVIAEIAKECGALTVGV  131

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VT PF+FEGRKRS QA   IE L++ VDTLIVIPNDRLL+I D++TP+ +AF  AD+VLR
Sbjct  132   VTRPFTFEGRKRSTQAELGIEALKEKVDTLIVIPNDRLLEIVDKKTPMLEAFREADNVLR  191

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIG  508
             Q VQGISD+I +PGL+N+DFADVK +M + G+A++G+G+++ +NRA EAA +A ++PL+ 
Sbjct  192   QAVQGISDLIAVPGLINLDFADVKTIMTERGSALMGIGIATGENRASEAARKAIMSPLLE  251

Query  507   SSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTII  328
             +SI+ A GV+ NITGG +++L EVN  +++VTS +DP  N+IFGA+++E    EI VT+I
Sbjct  252   TSIEGARGVIMNITGGSNLSLYEVNEAAEIVTSASDPDVNMIFGAIIEESMKDEIKVTVI  311

Query  327   ATGF  316
             ATGF
Sbjct  312   ATGF  315



>ref|WP_039204701.1| cell division protein FtsZ [Aphanizomenon flos-aquae]
 gb|KHG39259.1| cell division protein FtsZ [Aphanizomenon flos-aquae 2012/KM/D3]
Length=432

 Score =   311 bits (797),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 206/334 (62%), Positives = 263/334 (79%), Gaps = 8/334 (2%)
 Frame = -3

Query  1278  FHQRRFSVRCS--------FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTD  1123
             F Q + S R S         +P   A IKV+GVGGGG NAVNRMI S + GV+F++INTD
Sbjct  38    FAQGKDSKRISPENSGIGEIVPGRVANIKVIGVGGGGGNAVNRMIESDVSGVEFWSINTD  97

Query  1122  AQSLLQSAAQTPIQIgelltrglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmg  943
             AQ+L  + A + +QIG+ LTRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGMG
Sbjct  98    AQALTLAGAPSRLQIGQKLTRGLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMG  157

Query  942   ggtgsgaAPVVAQISKEAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPN  763
             GGTG+GAAP+VA+I+KE G LTVGVVT PF FEGR+R+ QA + IE L+  VDTLI+IPN
Sbjct  158   GGTGTGAAPIVAEIAKEMGALTVGVVTRPFIFEGRRRTSQAEQGIEGLKSRVDTLIIIPN  217

Query  762   DRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAML  583
             ++LL++  EQTP+Q+AF  ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++
Sbjct  218   NKLLEVIPEQTPVQEAFRYADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALM  277

Query  582   GVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLA  403
             G+GVSS K+RA EAA  A  +PL+  SI+ A GVV+NITGG D+TL EVN  ++ +  + 
Sbjct  278   GIGVSSGKSRAREAAIAAISSPLLECSIEGARGVVFNITGGSDLTLHEVNAAAETIYEVV  337

Query  402   DPSANIIFGAVVDERYNGEIHVTIIATGFTQSFQ  301
             DP+ANIIFGAV+D+R  GE+ +T+IATGFT   Q
Sbjct  338   DPNANIIFGAVIDDRLQGEVRITVIATGFTGDIQ  371



>ref|WP_036598772.1| cell division protein FtsZ [Paenibacillus sophorae]
Length=370

 Score =   309 bits (792),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 185/304 (61%), Positives = 252/304 (83%), Gaps = 0/304 (0%)
 Frame = -3

Query  1227  AKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgelltrglgt  1048
             A+IKV+GVGGGG+NAVNRMI +G+QGV+F  +NTDAQ+L  + ++  +QIG+ LTRGLG 
Sbjct  12    AQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHMAKSEHKLQIGDKLTRGLGA  71

Query  1047  ggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAGYLTVGV  868
             G NP +G++AAEES++ I+N LKG+DMVF+TAGMGGGTG+GAAPV+A+I+KE G LTVGV
Sbjct  72    GANPEVGKKAAEESRDLISNTLKGADMVFVTAGMGGGTGTGAAPVIAEIAKECGALTVGV  131

Query  867   VTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLR  688
             VT PF+FEGRKRS QA   IE L++ VDTLIVIPNDRLL+I D++TP+ +AF  AD+VLR
Sbjct  132   VTRPFTFEGRKRSTQAELGIEALKEKVDTLIVIPNDRLLEIVDKKTPMLEAFREADNVLR  191

Query  687   QGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIG  508
             Q VQGISD+I +PGL+N+DFADVK +M + G+A++G+G+++ +NRA EAA +A ++PL+ 
Sbjct  192   QAVQGISDLIAVPGLINLDFADVKTIMTERGSALMGIGIATGENRASEAARKAIMSPLLE  251

Query  507   SSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVTII  328
             +SI+ A GV+ NITGG +++L EVN  +++VTS +DP  N+IFGA+++E    EI VT+I
Sbjct  252   TSIEGARGVIMNITGGSNLSLYEVNEAAEIVTSASDPEVNMIFGAIIEESMKDEIKVTVI  311

Query  327   ATGF  316
             ATGF
Sbjct  312   ATGF  315



>gb|AAA85526.1| FtsZ [Nostoc sp. PCC 7120]
Length=379

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 199/311 (64%), Positives = 256/311 (82%), Gaps = 0/311 (0%)
 Frame = -3

Query  1245  FIPMDSAKIKvvgvggggnnavNRMIGSGLQGVDFYAINTDAQSLLQSAAQTPIQIgell  1066
              +P   A IKV+GVGGGG NAVNRMI S + GV+F++INTDAQ+L  + A + +QIG+ L
Sbjct  9     IVPGRVANIKVIGVGGGGGNAVNRMIESDVSGVEFWSINTDAQALTLAGAPSRLQIGQKL  68

Query  1065  trglgtggnpllgEQAAEESKEAIANALKGSDMVFItagmgggtgsgaAPVVAQISKEAG  886
             TRGLG GGNP +G++AAEES++ IA AL+G+D+VFITAGMGGGTG+GAAP+VA+++KE G
Sbjct  69    TRGLGAGGNPAIGQKAAEESRDEIATALEGADLVFITAGMGGGTGTGAAPIVAEVAKEMG  128

Query  885   YLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLL  706
              LTVGVVT PF FEGR+R+ QA + IE L+  VDTLI+IPN++LL++  EQTP+Q+AF  
Sbjct  129   ALTVGVVTRPFVFEGRRRTSQAEQGIEGLKSRVDTLIIIPNNKLLEVIPEQTPVQEAFRY  188

Query  705   ADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQAT  526
             ADDVLRQGVQGISDIITIPGLVNVDFADV+AVM D+G+A++G+GVSS K+RA EAA  A 
Sbjct  189   ADDVLRQGVQGISDIITIPGLVNVDFADVRAVMADAGSALMGIGVSSGKSRAREAAIAAI  248

Query  525   LAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGE  346
              +PL+  SI+ A GVV+NITGG D+TL EVN  ++ +  + DP+ANIIFGAV+D+R  GE
Sbjct  249   SSPLLECSIEGARGVVFNITGGSDLTLHEVNAAAETIYEVVDPNANIIFGAVIDDRLQGE  308

Query  345   IHVTIIATGFT  313
             + +T+IATGFT
Sbjct  309   VRITVIATGFT  319



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4164492915968