BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16935_g1_i1 len=1588 path=[51:0-1587]

Length=1588
                                                                      Score     E

ref|XP_009769606.1|  PREDICTED: V-type proton ATPase subunit a2-like    702   0.0      
ref|XP_009598988.1|  PREDICTED: V-type proton ATPase subunit a2-like    702   0.0      
ref|XP_006356756.1|  PREDICTED: vacuolar proton ATPase a2-like          694   0.0      
ref|XP_004243162.1|  PREDICTED: V-type proton ATPase subunit a2-like    689   0.0      
ref|XP_007017674.1|  Vacuolar proton ATPase A2 isoform 2                683   0.0      
ref|XP_011083638.1|  PREDICTED: V-type proton ATPase subunit a3-like    687   0.0      
ref|XP_007017673.1|  Vacuolar proton ATPase A3 isoform 1                684   0.0      
ref|XP_010061011.1|  PREDICTED: V-type proton ATPase subunit a3-l...    681   0.0      
emb|CDP07451.1|  unnamed protein product                                681   0.0      
ref|XP_010061010.1|  PREDICTED: V-type proton ATPase subunit a3-l...    681   0.0      
ref|XP_010271519.1|  PREDICTED: V-type proton ATPase subunit a2-l...    679   0.0      
ref|XP_011088459.1|  PREDICTED: V-type proton ATPase subunit a3-like    679   0.0      
ref|XP_010271518.1|  PREDICTED: V-type proton ATPase subunit a2-l...    678   0.0      
dbj|BAJ53179.1|  JHL18I08.13                                            678   0.0      
ref|XP_009401931.1|  PREDICTED: vacuolar proton ATPase a3-like          678   0.0      
gb|KHG00114.1|  Vacuolar proton translocating ATPase subunit            677   0.0      
ref|XP_008783594.1|  PREDICTED: vacuolar proton ATPase a3-like          677   0.0      
ref|XP_002265086.1|  PREDICTED: V-type proton ATPase subunit a3         676   0.0      Vitis vinifera
ref|XP_010918985.1|  PREDICTED: V-type proton ATPase subunit a3 i...    674   0.0      
ref|XP_004500962.1|  PREDICTED: vacuolar proton ATPase a2-like          674   0.0      
gb|KHG13921.1|  Vacuolar proton translocating ATPase subunit            674   0.0      
ref|NP_001049572.1|  Os03g0251500                                       673   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010918984.1|  PREDICTED: V-type proton ATPase subunit a3 i...    672   0.0      
ref|XP_010918981.1|  PREDICTED: V-type proton ATPase subunit a3 i...    672   0.0      
ref|XP_008445568.1|  PREDICTED: vacuolar proton ATPase a3-like          664   0.0      
ref|XP_002300733.1|  hypothetical protein POPTR_0002s03010g             671   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004152666.1|  PREDICTED: vacuolar proton ATPase a3-like          671   0.0      
ref|XP_007042074.1|  Vacuolar proton ATPase A3 isoform 1                671   0.0      
ref|XP_002510470.1|  vacuolar proton atpase, putative                   671   0.0      Ricinus communis
ref|XP_007158764.1|  hypothetical protein PHAVU_002G179900g             671   0.0      
ref|XP_007199708.1|  hypothetical protein PRUPE_ppa001492mg             670   0.0      
ref|XP_011028943.1|  PREDICTED: V-type proton ATPase subunit a2-l...    667   0.0      
ref|XP_007042076.1|  Vacuolar proton ATPase A3 isoform 3                667   0.0      
ref|XP_011028942.1|  PREDICTED: V-type proton ATPase subunit a2-l...    669   0.0      
ref|XP_008221327.1|  PREDICTED: vacuolar proton ATPase a3-like          669   0.0      
ref|XP_011028941.1|  PREDICTED: V-type proton ATPase subunit a2-l...    669   0.0      
ref|XP_006649752.1|  PREDICTED: vacuolar proton ATPase a3-like          668   0.0      
ref|XP_008236967.1|  PREDICTED: vacuolar proton ATPase a3               667   0.0      
ref|XP_010028630.1|  PREDICTED: V-type proton ATPase subunit a2         667   0.0      
ref|XP_004165227.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...    657   0.0      
ref|XP_007042075.1|  Vacuolar proton ATPase A3 isoform 2                666   0.0      
gb|EYU37836.1|  hypothetical protein MIMGU_mgv1a001455mg                665   0.0      
ref|XP_008448072.1|  PREDICTED: vacuolar proton ATPase a3               665   0.0      
ref|XP_010934090.1|  PREDICTED: V-type proton ATPase subunit a3-like    665   0.0      
ref|XP_006404588.1|  hypothetical protein EUTSA_v10000048mg             658   0.0      
ref|XP_006411705.1|  hypothetical protein EUTSA_v10024425mg             665   0.0      
ref|XP_006286207.1|  hypothetical protein CARUB_v10007773mg             665   0.0      
emb|CDY12118.1|  BnaC03g60340D                                          664   0.0      
ref|XP_010431861.1|  PREDICTED: V-type proton ATPase subunit a3-like    664   0.0      
ref|XP_004148529.1|  PREDICTED: vacuolar proton ATPase a3-like          664   0.0      
ref|XP_009373024.1|  PREDICTED: vacuolar proton ATPase a3-like          664   0.0      
ref|XP_004984994.1|  PREDICTED: vacuolar proton ATPase a3-like          664   0.0      
ref|XP_009373002.1|  PREDICTED: vacuolar proton ATPase a3               664   0.0      
ref|XP_010437006.1|  PREDICTED: V-type proton ATPase subunit a3-like    664   0.0      
ref|XP_010446444.1|  PREDICTED: V-type proton ATPase subunit a3         663   0.0      
emb|CDY42603.1|  BnaC01g00150D                                          663   0.0      
ref|XP_009109504.1|  PREDICTED: vacuolar proton ATPase a3               662   0.0      
emb|CDY41958.1|  BnaA01g05300D                                          662   0.0      
dbj|BAF02018.1|  hypothetical protein                                   650   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011047706.1|  PREDICTED: V-type proton ATPase subunit a3         660   0.0      
ref|XP_002307693.1|  hypothetical protein POPTR_0005s25550g             660   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011045160.1|  PREDICTED: V-type proton ATPase subunit a2-like    659   0.0      
ref|XP_002313024.2|  vacuolar proton ATPase family protein              660   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006661663.1|  PREDICTED: vacuolar proton ATPase a3-like          659   0.0      
ref|XP_006362018.1|  PREDICTED: vacuolar proton ATPase a3-like          659   0.0      
gb|AEH95770.1|  vacuolar ATPase subunit A                               659   0.0      
ref|XP_006404587.1|  hypothetical protein EUTSA_v10000048mg             659   0.0      
dbj|BAJ89139.1|  predicted protein                                      659   0.0      
ref|XP_002866830.1|  VHA-A3                                             659   0.0      
ref|XP_010431556.1|  PREDICTED: V-type proton ATPase subunit a2-like    657   0.0      
ref|XP_010096180.1|  Vacuolar proton translocating ATPase 100 kDa...    658   0.0      
gb|KDP41742.1|  hypothetical protein JCGZ_26760                         658   0.0      
ref|XP_004230865.1|  PREDICTED: V-type proton ATPase subunit a3         658   0.0      
ref|XP_010472132.1|  PREDICTED: V-type proton ATPase subunit a2 i...    655   0.0      
ref|XP_004291813.1|  PREDICTED: vacuolar proton ATPase a3-like          656   0.0      
gb|KHN22210.1|  Vacuolar proton translocating ATPase 100 kDa subunit    654   0.0      
ref|NP_568051.1|  vacuolar proton ATPase A3                             656   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293691.1|  hypothetical protein CARUB_v10022648mg             653   0.0      
ref|XP_003527676.1|  PREDICTED: vacuolar proton ATPase a3-like          655   0.0      
emb|CDX82029.1|  BnaC08g35720D                                          655   0.0      
ref|XP_010664756.1|  PREDICTED: V-type proton ATPase subunit a2-l...    654   0.0      
ref|XP_006487336.1|  PREDICTED: vacuolar proton ATPase a3-like          654   0.0      
gb|AAL78104.1|AC093568_14  Putative proton pump                         653   0.0      Oryza sativa [red rice]
ref|XP_003558337.1|  PREDICTED: V-type proton ATPase subunit a3-like    654   0.0      
ref|XP_009602232.1|  PREDICTED: V-type proton ATPase subunit a2-like    653   0.0      
gb|EEC66656.1|  hypothetical protein OsI_32928                          653   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010555275.1|  PREDICTED: V-type proton ATPase subunit a3-like    653   0.0      
gb|EEE50667.1|  hypothetical protein OsJ_30905                          653   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KDO49484.1|  hypothetical protein CISIN_1g003392mg                   653   0.0      
gb|ABB46970.1|  V-type ATPase 116kDa subunit family protein, expr...    653   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006423404.1|  hypothetical protein CICLE_v10027828mg             653   0.0      
gb|KDO49485.1|  hypothetical protein CISIN_1g003392mg                   653   0.0      
ref|NP_179736.1|  vacuolar proton ATPase A2                             652   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293690.1|  hypothetical protein CARUB_v10022648mg             652   0.0      
ref|XP_009785999.1|  PREDICTED: V-type proton ATPase subunit a2-like    652   0.0      
ref|XP_003537855.1|  PREDICTED: vacuolar proton ATPase a3-like          652   0.0      
ref|XP_011092832.1|  PREDICTED: V-type proton ATPase subunit a3-like    652   0.0      
emb|CDX99594.1|  BnaC04g33510D                                          652   0.0      
ref|XP_003573831.1|  PREDICTED: V-type proton ATPase subunit a3-like    652   0.0      
gb|KHN25411.1|  Vacuolar proton translocating ATPase 100 kDa subunit    650   0.0      
dbj|BAJ99586.1|  predicted protein                                      638   0.0      
ref|XP_003540986.1|  PREDICTED: vacuolar proton ATPase a3-like          650   0.0      
gb|KHN39818.1|  V-type proton ATPase 116 kDa subunit a isoform 1        649   0.0      
ref|XP_009149095.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...    649   0.0      
gb|AAK96647.1|  At2g21410/F3K23.17                                      649   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878553.1|  predicted protein                                  648   0.0      
emb|CDY15895.1|  BnaA04g12160D                                          648   0.0      
ref|XP_002468170.1|  hypothetical protein SORBIDRAFT_01g040970          648   0.0      Sorghum bicolor [broomcorn]
gb|KFK30491.1|  hypothetical protein AALP_AA7G268500                    648   0.0      
emb|CDP20651.1|  unnamed protein product                                648   0.0      
ref|XP_009117405.1|  PREDICTED: vacuolar proton ATPase a2               647   0.0      
ref|XP_002512965.1|  vacuolar proton atpase, putative                   647   0.0      Ricinus communis
ref|XP_009140276.1|  PREDICTED: vacuolar proton ATPase a2-like          646   0.0      
ref|XP_007131786.1|  hypothetical protein PHAVU_011G041500g             645   0.0      
dbj|BAF98583.1|  CM0216.490.nc                                          644   0.0      Lotus japonicus
emb|CAE45587.1|  vacuolar proton-ATPase subunit-like protein            644   0.0      Lotus japonicus
ref|XP_010672374.1|  PREDICTED: V-type proton ATPase subunit a3-like    643   0.0      
ref|XP_004507485.1|  PREDICTED: vacuolar proton ATPase a2-like          643   0.0      
ref|XP_010690814.1|  PREDICTED: V-type proton ATPase subunit a3         640   0.0      
ref|XP_008653566.1|  PREDICTED: vacuolar proton ATPase a3               640   0.0      
ref|XP_003607000.1|  V-type proton ATPase 116 kDa subunit a isoform     640   0.0      
ref|XP_002306128.1|  vacuolar proton ATPase family protein              640   0.0      Populus trichocarpa [western balsam poplar]
gb|KHG13283.1|  Vacuolar proton translocating ATPase subunit            640   0.0      
ref|XP_011037174.1|  PREDICTED: V-type proton ATPase subunit a3-like    639   0.0      
emb|CAD27718.1|  putative vacuolar ATPase subunit 100 kDa subunit       635   0.0      Mesembryanthemum crystallinum
ref|XP_008660336.1|  PREDICTED: vacuolar proton ATPase a3-like          635   0.0      
ref|XP_010531458.1|  PREDICTED: V-type proton ATPase subunit a2         634   0.0      
ref|XP_004290287.1|  PREDICTED: vacuolar proton ATPase a3-like          633   0.0      
emb|CAB38828.1|  putative proton pump                                   634   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EMT31646.1|  Vacuolar proton translocating ATPase 100 kDa subunit    628   0.0      
gb|EMT24018.1|  Vacuolar proton translocating ATPase 100 kDa subunit    629   0.0      
ref|XP_006828785.1|  hypothetical protein AMTR_s00001p00110790          628   0.0      
dbj|BAC41321.1|  hypothetical protein                                   616   0.0      Lotus japonicus
dbj|BAJ94235.1|  predicted protein                                      619   0.0      
ref|XP_006594994.1|  PREDICTED: vacuolar proton ATPase a1-like is...    603   0.0      
ref|XP_007015509.1|  Vacuolar proton ATPase A1 isoform 3                603   0.0      
ref|XP_007150235.1|  hypothetical protein PHAVU_005G137800g             601   0.0      
ref|XP_003547511.1|  PREDICTED: vacuolar proton ATPase a1-like          600   0.0      
ref|XP_004294683.1|  PREDICTED: vacuolar proton ATPase a1-like          599   0.0      
gb|KHN33443.1|  V-type proton ATPase 116 kDa subunit a isoform 1        599   0.0      
ref|XP_010253515.1|  PREDICTED: V-type proton ATPase subunit a1-like    599   0.0      
ref|XP_007017676.1|  Vacuolar proton ATPase A3 isoform 4                596   0.0      
ref|XP_007017675.1|  Vacuolar proton ATPase A3 isoform 3                596   0.0      
ref|XP_007015511.1|  Vacuolar proton ATPase A1 isoform 5                598   0.0      
ref|XP_011089368.1|  PREDICTED: V-type proton ATPase subunit a1-l...    597   0.0      
ref|XP_010691625.1|  PREDICTED: V-type proton ATPase subunit a1         596   0.0      
gb|KDO73121.1|  hypothetical protein CISIN_1g003454mg                   591   0.0      
ref|XP_010032049.1|  PREDICTED: V-type proton ATPase subunit a1-l...    595   0.0      
ref|XP_010043693.1|  PREDICTED: V-type proton ATPase subunit a1 i...    593   0.0      
ref|XP_010032050.1|  PREDICTED: V-type proton ATPase subunit a1-l...    595   0.0      
ref|XP_008358210.1|  PREDICTED: vacuolar proton ATPase a1               594   0.0      
ref|XP_010244988.1|  PREDICTED: V-type proton ATPase subunit a1-like    594   0.0      
ref|XP_002456592.1|  hypothetical protein SORBIDRAFT_03g038990          593   0.0      Sorghum bicolor [broomcorn]
ref|XP_008463888.1|  PREDICTED: vacuolar proton ATPase a1               593   0.0      
ref|XP_004487144.1|  PREDICTED: vacuolar proton ATPase a1-like          594   0.0      
ref|XP_006843249.1|  hypothetical protein AMTR_s00080p00100430          593   0.0      
gb|EPS62244.1|  hypothetical protein M569_12548                         591   0.0      
ref|XP_010043691.1|  PREDICTED: V-type proton ATPase subunit a1 i...    593   0.0      
dbj|BAD73786.1|  putative vacuolar-type H(+)-ATPase                     584   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004149561.1|  PREDICTED: vacuolar proton ATPase a1-like          593   0.0      
ref|XP_006424665.1|  hypothetical protein CICLE_v10027830mg             592   0.0      
ref|XP_003539739.1|  PREDICTED: vacuolar proton ATPase a1-like          590   0.0      
ref|XP_002282009.1|  PREDICTED: V-type proton ATPase subunit a1         590   0.0      Vitis vinifera
ref|XP_009358259.1|  PREDICTED: vacuolar proton ATPase a1-like          590   0.0      
gb|KHN05709.1|  V-type proton ATPase 116 kDa subunit a isoform 1        590   0.0      
ref|XP_010922514.1|  PREDICTED: V-type proton ATPase subunit a1         589   0.0      
ref|XP_004241262.1|  PREDICTED: V-type proton ATPase subunit a1-like    588   0.0      
ref|XP_009759133.1|  PREDICTED: V-type proton ATPase subunit a1-l...    582   0.0      
ref|XP_004970481.1|  PREDICTED: vacuolar proton ATPase a1-like          587   0.0      
gb|EYU18884.1|  hypothetical protein MIMGU_mgv1a001442mg                587   0.0      
ref|XP_006644966.1|  PREDICTED: vacuolar proton ATPase a1-like          587   0.0      
gb|KHG00921.1|  Vacuolar proton translocating ATPase subunit            587   0.0      
emb|CDP08938.1|  unnamed protein product                                587   0.0      
ref|NP_001044718.2|  Os01g0834200                                       586   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KHN22033.1|  V-type proton ATPase 116 kDa subunit a isoform 1        584   0.0      
ref|XP_004505946.1|  PREDICTED: vacuolar proton ATPase a1-like          586   0.0      
ref|XP_002532256.1|  vacuolar proton atpase, putative                   586   0.0      Ricinus communis
ref|XP_009352397.1|  PREDICTED: vacuolar proton ATPase a1-like          586   0.0      
gb|AFW88967.1|  hypothetical protein ZEAMMB73_558595                    570   0.0      
ref|XP_011089858.1|  PREDICTED: V-type proton ATPase subunit a1 i...    585   0.0      
ref|XP_009606446.1|  PREDICTED: V-type proton ATPase subunit a1-l...    580   0.0      
gb|KDP44125.1|  hypothetical protein JCGZ_05592                         585   0.0      
gb|KEH39308.1|  vacuolar proton ATPase a3-like protein                  583   0.0      
ref|XP_003538035.1|  PREDICTED: vacuolar proton ATPase a1-like          584   0.0      
gb|AES67400.2|  vacuolar proton ATPase a3-like protein                  583   0.0      
ref|XP_008783709.1|  PREDICTED: vacuolar proton ATPase a1-like is...    580   0.0      
ref|XP_009346583.1|  PREDICTED: vacuolar proton ATPase a1-like          583   0.0      
ref|XP_008783708.1|  PREDICTED: vacuolar proton ATPase a1-like is...    580   0.0      
ref|XP_006365749.1|  PREDICTED: vacuolar proton ATPase a1-like is...    582   0.0      
ref|XP_009759132.1|  PREDICTED: V-type proton ATPase subunit a1-l...    582   0.0      
gb|KHG14971.1|  vatM                                                    581   0.0      
ref|XP_006366398.1|  PREDICTED: vacuolar proton ATPase a1-like          581   0.0      
ref|XP_004251275.1|  PREDICTED: V-type proton ATPase subunit a1         581   0.0      
ref|XP_010472136.1|  PREDICTED: V-type proton ATPase subunit a2 i...    577   0.0      
ref|XP_010472134.1|  PREDICTED: V-type proton ATPase subunit a2 i...    577   0.0      
ref|XP_009617904.1|  PREDICTED: V-type proton ATPase subunit a1-like    580   0.0      
ref|XP_007204941.1|  hypothetical protein PRUPE_ppa001470mg             580   0.0      
gb|KHN45895.1|  Vacuolar proton translocating ATPase 100 kDa subunit    573   0.0      
ref|XP_010472133.1|  PREDICTED: V-type proton ATPase subunit a2 i...    577   0.0      
ref|XP_008783707.1|  PREDICTED: vacuolar proton ATPase a1-like is...    580   0.0      
ref|XP_008224871.1|  PREDICTED: vacuolar proton ATPase a1-like          580   0.0      
ref|XP_009606445.1|  PREDICTED: V-type proton ATPase subunit a1-l...    580   0.0      
ref|XP_009795362.1|  PREDICTED: V-type proton ATPase subunit a1-like    580   0.0      
ref|XP_010472131.1|  PREDICTED: V-type proton ATPase subunit a2 i...    577   0.0      
ref|XP_010542602.1|  PREDICTED: V-type proton ATPase subunit a1         579   0.0      
ref|XP_010521779.1|  PREDICTED: V-type proton ATPase subunit a1         578   0.0      
ref|XP_010112349.1|  V-type proton ATPase 116 kDa subunit a isofo...    577   0.0      
ref|XP_002986306.1|  hypothetical protein SELMODRAFT_182335             578   0.0      
ref|XP_007132168.1|  hypothetical protein PHAVU_011G071600g             577   0.0      
ref|XP_002988745.1|  hypothetical protein SELMODRAFT_184043             577   0.0      
ref|XP_007015507.1|  Vacuolar proton ATPase A1 isoform 1                576   0.0      
gb|AES88702.2|  vacuolar proton ATPase a3-like protein                  575   0.0      
ref|XP_008657093.1|  PREDICTED: vacuolar proton ATPase a1               575   0.0      
ref|XP_002970298.1|  hypothetical protein SELMODRAFT_93837              573   0.0      
emb|CDM85023.1|  unnamed protein product                                573   0.0      
ref|XP_002978460.1|  hypothetical protein SELMODRAFT_109102             573   0.0      
ref|XP_010414511.1|  PREDICTED: V-type proton ATPase subunit a1         572   0.0      
ref|XP_010510601.1|  PREDICTED: V-type proton ATPase subunit a1-like    572   0.0      
dbj|BAF01786.1|  vacuolar proton-ATPase subunit -like                   557   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009410597.1|  PREDICTED: vacuolar proton ATPase a1               572   0.0      
ref|XP_003564548.1|  PREDICTED: V-type proton ATPase subunit a1         571   0.0      
ref|XP_003597149.1|  V-type proton ATPase 116 kDa subunit a isoform     569   0.0      
ref|XP_001763380.1|  predicted protein                                  569   0.0      
ref|XP_006409880.1|  hypothetical protein EUTSA_v10016255mg             569   0.0      
ref|XP_002879161.1|  VHA-A1                                             568   0.0      
ref|XP_009140911.1|  PREDICTED: vacuolar proton ATPase a1               567   0.0      
ref|XP_009133874.1|  PREDICTED: vacuolar proton ATPase a1-like          566   0.0      
ref|XP_008805029.1|  PREDICTED: vacuolar proton ATPase a1-like          565   0.0      
ref|XP_009103695.1|  PREDICTED: vacuolar proton ATPase a1-like          564   0.0      
ref|XP_001768891.1|  predicted protein                                  564   0.0      
ref|XP_008382347.1|  PREDICTED: vacuolar proton ATPase a3               554   0.0      
ref|XP_006293692.1|  hypothetical protein CARUB_v10022649mg             564   0.0      
ref|NP_850122.1|  vacuolar proton ATPase A1                             563   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_001752776.1|  predicted protein                                  561   0.0      
gb|KHG14972.1|  vatM                                                    560   0.0      
gb|EEE55633.1|  hypothetical protein OsJ_03980                          557   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC71752.1|  hypothetical protein OsI_04326                          557   0.0      Oryza sativa Indica Group [Indian rice]
gb|KEH36223.1|  vacuolar proton ATPase a3-like protein                  554   0.0      
emb|CDX83292.1|  BnaA03g22140D                                          555   0.0      
gb|EPS59200.1|  hypothetical protein M569_15610                         548   0.0      
emb|CDY63878.1|  BnaCnng42810D                                          552   0.0      
gb|EMT21067.1|  hypothetical protein F775_21366                         545   0.0      
gb|KCW55396.1|  hypothetical protein EUGRSUZ_I01306                     545   0.0      
ref|XP_006365750.1|  PREDICTED: vacuolar proton ATPase a1-like is...    546   0.0      
gb|EYU36217.1|  hypothetical protein MIMGU_mgv1a001612mg                535   1e-178   
emb|CDY53381.1|  BnaA04g16460D                                          533   6e-178   
emb|CDY15756.1|  BnaC04g15680D                                          526   7e-175   
emb|CDX77187.1|  BnaC04g39820D                                          522   1e-173   
emb|CDY04571.1|  BnaA07g13970D                                          520   1e-172   
ref|XP_001781151.1|  predicted protein                                  520   2e-172   
gb|AAD21487.2|  putative vacuolar proton-ATPase subunit                 516   2e-171   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001769505.1|  predicted protein                                  516   2e-171   
ref|XP_008240574.1|  PREDICTED: vacuolar proton ATPase a1-like          506   5e-170   
ref|XP_006365751.1|  PREDICTED: vacuolar proton ATPase a1-like is...    511   6e-170   
ref|XP_008363498.1|  PREDICTED: vacuolar proton ATPase a1-like          496   3e-169   
ref|XP_007015508.1|  Vacuolar proton ATPase A1 isoform 2                502   2e-166   
ref|XP_008223647.1|  PREDICTED: vacuolar proton ATPase a1-like          474   2e-159   
ref|XP_001692167.1|  vacuolar proton ATPase subunit A                   482   1e-157   Chlamydomonas reinhardtii
emb|CDY13818.1|  BnaA09g43200D                                          475   3e-155   
gb|KDD73719.1|  V-type ATPase                                           464   1e-154   
ref|XP_005648060.1|  V0/A0 complex, 116-kDa subunit of ATPase           473   4e-154   
gb|KCW55395.1|  hypothetical protein EUGRSUZ_I01306                     467   2e-152   
ref|XP_005849093.1|  hypothetical protein CHLNCDRAFT_34870              467   1e-151   
ref|XP_010664757.1|  PREDICTED: V-type proton ATPase subunit a3-l...    459   7e-151   
ref|XP_003080962.1|  putative vacuolar proton-ATPase subunit (ISS)      463   2e-149   
ref|XP_002508239.1|  H+-or Na+-translocating f-type, v-type and A...    457   4e-148   Micromonas commoda
ref|XP_002947070.1|  hypothetical protein VOLCADRAFT_79461              457   2e-147   
ref|XP_007515546.1|  predicted protein                                  457   7e-147   
ref|XP_001695223.1|  vacuolar proton translocating ATPase subunit A     455   1e-146   Chlamydomonas reinhardtii
ref|XP_001419233.1|  F-ATPase family transporter: protons (vacuolar)    450   3e-145   Ostreococcus lucimarinus CCE9901
ref|XP_003058929.1|  H+-or Na+-translocating f-type, v-type and A...    449   4e-145   
ref|XP_007015512.1|  Vacuolar proton ATPase A1 isoform 6                429   6e-139   
ref|XP_011089369.1|  PREDICTED: V-type proton ATPase subunit a1-l...    422   3e-136   
ref|XP_011089859.1|  PREDICTED: V-type proton ATPase subunit a1 i...    411   7e-132   
ref|XP_005710830.1|  V-type ATP synthase, Subunit V0a                   414   9e-131   
gb|KEH39307.1|  vacuolar proton ATPase a3-like protein                  404   2e-129   
ref|XP_005707240.1|  F-type H+-transporting ATPase subunit a            409   3e-129   
ref|XP_003606505.1|  V-type proton ATPase 116 kDa subunit a isoform     411   6e-129   
ref|XP_008222457.1|  PREDICTED: vacuolar proton ATPase a1               381   2e-124   
ref|XP_005535455.1|  V-type ATPase V0 subunit a                         395   6e-124   
ref|XP_008228812.1|  PREDICTED: vacuolar proton ATPase a1-like          379   6e-123   
ref|XP_005706374.1|  F-type H+-transporting ATPase subunit a            392   2e-122   
ref|XP_005717502.1|  unnamed protein product                            390   2e-122   
gb|EXX54134.1|  Vph1p                                                   382   4e-121   
gb|EFA74721.1|  vacuolar proton ATPase 100-kDa subunit                  387   7e-121   
gb|EXX54133.1|  Vph1p                                                   382   1e-119   
gb|EXX54132.1|  Vph1p                                                   383   2e-119   
gb|EXX54130.1|  Vph1p                                                   383   3e-119   
dbj|GAM28107.1|  hypothetical protein SAMD00019534_112830               380   2e-118   
gb|ESA08168.1|  hypothetical protein GLOINDRAFT_349227                  377   2e-117   
dbj|GAM28112.1|  hypothetical protein SAMD00019534_112880               377   3e-117   
ref|XP_004351790.1|  vacuolar proton ATPase                             374   3e-116   
ref|XP_001698738.1|  hypothetical protein CHLREDRAFT_131895             369   2e-114   
gb|AAB49621.1|  vacuolar proton ATPase 100-kDa subunit                  367   1e-113   
sp|Q54E04.2|VATM_DICDI  RecName: Full=Vacuolar proton translocati...    367   2e-113   
ref|XP_003289866.1|  vacuolar proton ATPase 100-kDa subunit             367   4e-113   
emb|CCJ29709.1|  unnamed protein product                                366   5e-113   
ref|XP_629892.1|  vacuolar proton ATPase 100-kDa subunit                363   5e-112   
ref|XP_004356732.1|  vacuolar proton ATPase, putative                   362   6e-112   
emb|CDO68929.1|  hypothetical protein BN946_scf185000.g72               364   7e-112   
ref|XP_006110153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase, H+ t...    360   1e-111   
ref|XP_006990495.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    362   2e-111   
ref|XP_005405509.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    362   2e-111   
ref|XP_005405508.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    362   3e-111   
ref|XP_006473899.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...    355   3e-111   
ref|XP_009267372.1|  V-type proton ATPase subunit a                     362   3e-111   
ref|XP_005205904.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    361   4e-111   
ref|XP_007177148.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    359   4e-111   
ref|XP_008148708.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    361   4e-111   
ref|NP_001192780.1|  V-type proton ATPase 116 kDa subunit a isofo...    361   4e-111   
ref|XP_010629996.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    360   7e-111   
gb|KDQ33990.1|  hypothetical protein PLEOSDRAFT_1091713                 360   9e-111   
ref|XP_005875045.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    360   1e-110   
ref|XP_006910547.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    360   1e-110   
ref|XP_004272203.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    360   1e-110   
ref|XP_007642027.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    360   2e-110   
ref|XP_002414796.1|  vacuolar proton ATPase, putative                   358   2e-110   
ref|XP_001745401.1|  hypothetical protein                               359   2e-110   
ref|XP_005679573.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    359   2e-110   
ref|XP_010853231.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    359   2e-110   
ref|XP_007177146.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    359   2e-110   
ref|XP_006956773.1|  V0/A0 complex, 116-kDa subunit of ATPase           359   3e-110   
ref|XP_006076958.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    359   3e-110   
ref|XP_007504458.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    359   3e-110   
gb|EGV99041.1|  V-type proton ATPase 116 kDa subunit a isoform 4        359   3e-110   
ref|XP_005984567.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    359   3e-110   
ref|XP_007225587.1|  hypothetical protein PRUPE_ppa001483m2g            340   3e-110   
ref|XP_007177145.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    359   3e-110   
gb|EDL13645.1|  ATPase, H+ transporting, lysosomal V0 subunit A4        358   3e-110   
ref|XP_004008145.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    359   3e-110   
gb|ERE86772.1|  V-type proton ATPase subunit a isoform 4                359   4e-110   
ref|XP_006777185.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    358   4e-110   
ref|XP_006145090.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    357   5e-110   
ref|XP_004594429.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    358   5e-110   
ref|NP_001100061.1|  V-type proton ATPase 116 kDa subunit a isofo...    357   6e-110   
gb|AAL30435.1|AF326316_1  H-ATPase accessory subunit a4                 358   6e-110   
ref|NP_536715.3|  V-type proton ATPase 116 kDa subunit a isoform 4      358   7e-110   
ref|XP_005082467.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    358   7e-110   
emb|CBH11041.1|  vacuolar proton translocating ATPase subunit A,p...    357   7e-110   
ref|XP_844804.1|  vacuolar proton translocating ATPase subunit A        357   7e-110   
ref|XP_005332469.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    358   9e-110   
ref|XP_008821701.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    358   9e-110   
ref|XP_001634544.1|  predicted protein                                  358   1e-109   
ref|XP_004629107.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    357   1e-109   
ref|XP_006236358.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    357   1e-109   
ref|XP_007177141.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    358   1e-109   
ref|XP_007177144.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    358   1e-109   
gb|ELW68822.1|  V-type proton ATPase 116 kDa subunit a isoform 4        356   2e-109   
ref|XP_008055032.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    357   2e-109   
gb|AAN45855.1|AF435090_1  vacuolar proton translocating ATPase a4...    356   3e-109   
ref|XP_007345797.1|  V0/A0 complex, 116-kDa subunit of ATPase           357   3e-109   
gb|KFM64427.1|  V-type proton ATPase subunit a isoform 1                356   3e-109   
ref|XP_006145088.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    356   4e-109   
ref|XP_007908561.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    356   4e-109   
ref|XP_002116377.1|  hypothetical protein TRIADDRAFT_30908              356   4e-109   
ref|XP_003772494.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    356   5e-109   
ref|XP_004992887.1|  Atp6v0a1 protein                                   355   6e-109   
ref|XP_006929508.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    352   7e-109   
emb|CDH55586.1|  hypothetical protein RO3G_04819                        355   8e-109   
ref|XP_007407035.1|  hypothetical protein MELLADRAFT_115620             355   1e-108   
ref|XP_005909854.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    354   1e-108   
ref|XP_003475561.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    354   1e-108   
ref|XP_004416745.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    355   2e-108   
ref|XP_003741076.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    354   2e-108   
emb|CCW68223.1|  unnamed protein product                                344   2e-108   
ref|XP_002723058.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    354   2e-108   
ref|XP_001878517.1|  predicted protein                                  354   2e-108   
ref|XP_004382449.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    353   4e-108   
ref|XP_009894675.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    353   5e-108   
ref|XP_003741078.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    353   6e-108   
ref|XP_004462196.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    351   6e-108   
ref|XP_004886985.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    351   7e-108   
ref|XP_004430767.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    352   9e-108   
ref|XP_004677260.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    353   1e-107   
ref|XP_010722967.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   1e-107   
ref|XP_003791634.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    352   1e-107   
ref|XP_007364779.1|  H+-ATPase subunit                                  352   1e-107   
ref|XP_002914245.1|  PREDICTED: v-type proton ATPase 116 kDa subu...    352   2e-107   
gb|EFA74712.1|  vacuolar proton ATPase 100-kDa subunit                  352   2e-107   
ref|XP_004714102.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    350   2e-107   
ref|XP_008964225.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   3e-107   
ref|XP_004462194.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    351   3e-107   
ref|XP_007082697.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    351   3e-107   
ref|XP_004886983.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    351   3e-107   
ref|XP_010411088.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    350   3e-107   
ref|XP_007466662.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    351   3e-107   
gb|AAK81705.1|  vacuolar (H+)-ATPase subunit                            351   3e-107   
ref|XP_007873702.1|  hypothetical protein PNEG_01738                    350   3e-107   
ref|XP_570271.1|  vacuolar (H+)-ATPase subunit                          351   4e-107   
ref|XP_008036157.1|  H+-ATPase subunit                                  351   4e-107   
ref|XP_010302559.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    346   4e-107   
ref|XP_007525243.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    350   5e-107   
ref|XP_008108718.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    343   5e-107   
ref|XP_007118876.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    350   5e-107   
ref|XP_006458612.1|  hypothetical protein AGABI2DRAFT_217333            350   5e-107   
ref|XP_010192740.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    350   5e-107   
ref|XP_005429639.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    350   6e-107   
ref|XP_005429637.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    350   6e-107   
ref|XP_002109493.1|  hypothetical protein TRIADDRAFT_63670              351   6e-107   
ref|XP_006861227.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    350   6e-107   
ref|XP_006264756.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    350   7e-107   
gb|KFO11733.1|  V-type proton ATPase 116 kDa subunit a isoform 4        346   7e-107   
ref|XP_006175251.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   7e-107   
ref|XP_006940425.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   7e-107   
ref|XP_009894121.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   8e-107   
gb|KFU95801.1|  V-type proton ATPase 116 kDa subunit a isoform 4        350   8e-107   
ref|XP_003420265.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    350   8e-107   
ref|XP_005531525.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    350   9e-107   
gb|EDM06072.1|  ATPase, H+ transporting, lysosomal V0 subunit A1,...    343   9e-107   
ref|XP_007326967.1|  hypothetical protein AGABI1DRAFT_111634            350   1e-106   
ref|XP_005021567.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    350   1e-106   
gb|KFQ26628.1|  V-type proton ATPase 116 kDa subunit a isoform 4        350   1e-106   
ref|XP_005365893.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   1e-106   
ref|XP_539895.2|  PREDICTED: V-type proton ATPase 116 kDa subunit...    349   1e-106   
ref|XP_006175250.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   1e-106   
ref|XP_009954730.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   1e-106   
ref|XP_006019618.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   2e-106   
ref|XP_006175249.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   2e-106   
gb|KFP88172.1|  V-type proton ATPase 116 kDa subunit a isoform 1        348   2e-106   
ref|XP_006185400.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   2e-106   
ref|XP_009646682.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   2e-106   
ref|XP_010945786.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   2e-106   
ref|XP_004741734.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   2e-106   
gb|EHH52542.1|  hypothetical protein EGM_12998                          349   2e-106   
ref|XP_010007637.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   2e-106   
ref|XP_006175247.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   2e-106   
ref|XP_006138122.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   2e-106   
emb|CDS09709.1|  hypothetical protein LRAMOSA02386                      349   2e-106   
ref|XP_010310955.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   2e-106   
ref|XP_006210081.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   2e-106   
gb|EHH17718.1|  hypothetical protein EGK_14179                          349   2e-106   
gb|KFU99739.1|  V-type proton ATPase 116 kDa subunit a isoform 4        342   3e-106   
ref|XP_010162740.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   3e-106   
ref|XP_007301224.1|  ATPase V0/A0 complex subunit                       348   3e-106   
ref|XP_005059715.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   3e-106   
gb|EMC80244.1|  V-type proton ATPase 116 kDa subunit a isoform 4        348   3e-106   
ref|XP_005609491.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    349   3e-106   
ref|XP_005059713.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   3e-106   
gb|KGB74838.1|  vacuolar (H)-ATPase subunit                             348   3e-106   
gb|EOA99879.1|  Vacuolar proton translocating ATPase 116 kDa subu...    348   3e-106   
ref|XP_009202211.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   4e-106   
ref|XP_010162743.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   4e-106   
ref|XP_005421115.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   4e-106   
ref|XP_007441298.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    338   4e-106   
ref|XP_008922224.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    346   4e-106   
ref|XP_009672457.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   4e-106   
ref|XP_010004118.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   4e-106   
ref|XP_005500326.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   4e-106   
ref|XP_005482800.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   5e-106   
ref|XP_006175248.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   5e-106   
ref|XP_009672455.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   5e-106   
gb|EDM06073.1|  ATPase, H+ transporting, lysosomal V0 subunit A1,...    341   5e-106   
ref|XP_001499338.3|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   5e-106   
ref|XP_007535068.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   6e-106   
ref|XP_003647005.1|  hypothetical protein Ecym_5436                     348   6e-106   
ref|XP_005550951.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   6e-106   
ref|XP_010184775.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    346   6e-106   
ref|XP_009489987.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    346   6e-106   
ref|XP_009580978.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    346   7e-106   
ref|XP_006175246.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   7e-106   
ref|XP_010077500.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    341   7e-106   
ref|XP_006679086.1|  hypothetical protein BATDEDRAFT_33255              347   7e-106   
ref|NP_065683.2|  V-type proton ATPase 116 kDa subunit a isoform 4      348   7e-106   
ref|XP_009331214.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   7e-106   
ref|XP_008531078.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    348   7e-106   
ref|XP_003261445.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   7e-106   
ref|XP_003929798.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   8e-106   
ref|XP_010354608.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   8e-106   
gb|AAG11415.1|AF245517_1  vacuolar proton pump 116 kDa accessory ...    347   8e-106   
ref|XP_005657806.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   8e-106   
ref|XP_009080506.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    346   8e-106   
ref|XP_003318871.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   8e-106   
gb|AAI09306.1|  ATPase, H+ transporting, lysosomal V0 subunit a4        347   9e-106   
gb|KFP68865.1|  V-type proton ATPase 116 kDa subunit a isoform 4        347   9e-106   
ref|XP_006887216.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   9e-106   
gb|KFQ21574.1|  V-type proton ATPase 116 kDa subunit a isoform 4        347   1e-105   
ref|XP_001105743.2|  PREDICTED: v-type proton ATPase 116 kDa subu...    347   1e-105   
ref|XP_003741077.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   1e-105   
ref|XP_003134678.3|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   1e-105   
ref|XP_009092423.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   1e-105   
ref|XP_010338670.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   1e-105   
ref|XP_009980669.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   1e-105   
ref|XP_008636325.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   1e-105   
ref|XP_004684219.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    345   1e-105   
ref|XP_005059716.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   2e-105   
ref|XP_004434508.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    345   2e-105   
ref|XP_009706255.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   2e-105   
ref|XP_003996934.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   2e-105   
ref|XP_010408731.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   2e-105   
ref|XP_008147578.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    345   2e-105   
ref|XP_005098435.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    343   2e-105   
ref|XP_007535067.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    345   2e-105   
ref|XP_006940424.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    346   2e-105   
ref|XP_005232765.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    346   2e-105   
ref|XP_008921613.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    347   2e-105   
ref|NP_001073571.2|  V-type proton ATPase 116 kDa subunit a isofo...    347   2e-105   
gb|KFQ01796.1|  V-type proton ATPase 116 kDa subunit a isoform 4        347   2e-105   
ref|XP_002922184.1|  PREDICTED: v-type proton ATPase 116 kDa subu...    346   2e-105   
ref|XP_005232767.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    346   2e-105   
gb|KFW73440.1|  V-type proton ATPase 116 kDa subunit a isoform 4        346   2e-105   



>ref|XP_009769606.1| PREDICTED: V-type proton ATPase subunit a2-like [Nicotiana sylvestris]
Length=819

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/423 (87%), Positives = 393/423 (93%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQE NPGVFTIVTFPFLFAVMFGDWGHGICL LATLYF+ REKKLSSQKLG
Sbjct  399   IVDAYGVAKYQEVNPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYFILREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MALFSIYTGFIYNEFFSVPFE+FGRSAY C D SCRDATT GLIK
Sbjct  459   DIMEMTFGGRYVIMMMALFSIYTGFIYNEFFSVPFEIFGRSAYGCRDLSCRDATTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LSYFNG+FFKND+N+W
Sbjct  519   VRDAYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNGKFFKNDVNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             HQFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQKYL
Sbjct  579   HQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFIGQKYL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+LLV LALVAVPWMLFPKPFLLKKQHEERHRGQ YA L + DD+ E ET N  H HGHE
Sbjct  639   QLLLVSLALVAVPWMLFPKPFLLKKQHEERHRGQLYAMLDSTDDSFELETHN--HSHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLAMGFNNI
Sbjct  697   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMGFNNI  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +IL+IGI+VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSF  I+ 
Sbjct  757   IILVIGIVVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFGLISE  816

Query  327   QDE  319
              ++
Sbjct  817   DED  819



>ref|XP_009598988.1| PREDICTED: V-type proton ATPase subunit a2-like [Nicotiana tomentosiformis]
Length=819

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/423 (87%), Positives = 393/423 (93%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQE NPGVFTIVTFPFLFAVMFGDWGHGICL LATLYF+F EKKLSSQKLG
Sbjct  399   IVDAYGVAKYQEVNPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYFIFWEKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MALFSIYTGFIYNEFFSVPFE+FGRSAY C DPSCRDATT GLIK
Sbjct  459   DIMEMTFGGRYVIIMMALFSIYTGFIYNEFFSVPFEIFGRSAYGCRDPSCRDATTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LSYFNG+FFKND+N+W
Sbjct  519   VRDAYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNGKFFKNDVNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             HQFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQKYL
Sbjct  579   HQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFIGQKYL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+LLV LALVAVPWMLFPKPF LKKQHEERHRGQ YA L N DD+ E ET +  H HGHE
Sbjct  639   QLLLVSLALVAVPWMLFPKPFFLKKQHEERHRGQLYAMLDNTDDSFELETHD--HSHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLAMGFNNI
Sbjct  697   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMGFNNI  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +IL+IGI+VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSF  I+ 
Sbjct  757   IILVIGIVVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFGLISE  816

Query  327   QDE  319
              ++
Sbjct  817   DED  819



>ref|XP_006356756.1| PREDICTED: vacuolar proton ATPase a2-like [Solanum tuberosum]
Length=818

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/423 (84%), Positives = 391/423 (92%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQE NP VFT+VTFPFLFAVMFGDWGHGICLFLATLYF+ +E+KLS QKLG
Sbjct  398   IVDAYGIAKYQEVNPAVFTVVTFPFLFAVMFGDWGHGICLFLATLYFILQERKLSGQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRY+I++MALFSIYTGFIYNEFFSVPFE+FG+SAY C DPSCRDAT TGLIK
Sbjct  458   DIMEMTFGGRYIIMMMALFSIYTGFIYNEFFSVPFEIFGQSAYGCHDPSCRDATITGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP WHG+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN +FF+N++N+W
Sbjct  518   VRDAYPFGVDPKWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAKFFQNNVNVW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             HQFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQKYL
Sbjct  578   HQFVPQIIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFPGQKYL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+L V LALVAVPWMLFPKPFLLKKQHEERHRGQ YA L + DD+ E ET +  H HGHE
Sbjct  638   QLLFVSLALVAVPWMLFPKPFLLKKQHEERHRGQLYAMLESTDDSFELETHD--HSHGHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F+FSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLAMG+NN+
Sbjct  696   EFDFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMGYNNL  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILIIGI+VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSF  I+ 
Sbjct  756   IILIIGIVVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFCLISE  815

Query  327   QDE  319
              D+
Sbjct  816   DDD  818



>ref|XP_004243162.1| PREDICTED: V-type proton ATPase subunit a2-like [Solanum lycopersicum]
Length=818

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/423 (83%), Positives = 388/423 (92%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQE NP VFT+VTFPFLFAVMFGDWGHGICLF  TLYF+ RE+KLS QKLG
Sbjct  398   IVDAYGIAKYQEVNPAVFTVVTFPFLFAVMFGDWGHGICLFFTTLYFILRERKLSGQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRY+I++MALFSIYTGFIYNEFFSVPFE+FG+SAY C DPSCRDAT TGL+K
Sbjct  458   DIMEMTFGGRYIIMMMALFSIYTGFIYNEFFSVPFEIFGQSAYGCRDPSCRDATITGLVK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP WHG+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN +FF+N++N+W
Sbjct  518   VRDAYPFGVDPKWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAKFFQNNVNVW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             HQFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQKYL
Sbjct  578   HQFVPQIIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFPGQKYL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+L V LALVAVPWMLFPKPFLLKKQHEERHRGQ YA L + DD+ E ET +  H HGHE
Sbjct  638   QLLFVSLALVAVPWMLFPKPFLLKKQHEERHRGQLYAMLDSTDDSFELETHD--HSHGHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F+FSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA+G+NN+
Sbjct  696   EFDFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAVGYNNL  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILIIGI+VF  ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSF  I+ 
Sbjct  756   IILIIGIVVFTFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFCLISE  815

Query  327   QDE  319
              D+
Sbjct  816   DDD  818



>ref|XP_007017674.1| Vacuolar proton ATPase A2 isoform 2 [Theobroma cacao]
 gb|EOY14899.1| Vacuolar proton ATPase A2 isoform 2 [Theobroma cacao]
Length=703

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/423 (83%), Positives = 384/423 (91%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANP VFTI+TFPFLFAVMFGDWGHGICL LAT YF+ REKK SSQKLG
Sbjct  282   IVDAYGIAKYQEANPAVFTIITFPFLFAVMFGDWGHGICLCLATSYFIIREKKFSSQKLG  341

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++MALFSIYTG IYNEFFSVPFELFG SAY C DPSC DA+T GL+K
Sbjct  342   DITEMIFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGPSAYGCHDPSCSDASTAGLVK  401

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHGTRSELPFLNSLKMKMSIL+GVAQMNLGI+LSYFN +FFKN+INIW
Sbjct  402   VRATYPFGVDPKWHGTRSELPFLNSLKMKMSILIGVAQMNLGIILSYFNAKFFKNEINIW  461

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK+L
Sbjct  462   YQFVPQLIFLNSLFGYLSLLIVVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFFGQKFL  521

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+L ALV+VPWMLFPKPFLLKKQHEERHRGQSYA L ++DD    E + H     HE
Sbjct  522   QIVLLLAALVSVPWMLFPKPFLLKKQHEERHRGQSYALLDSSDDD-PLEMELHHGSGSHE  580

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GFNNI
Sbjct  581   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNI  640

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILIIGI VFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA ++ 
Sbjct  641   IILIIGIFVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFQPFSFALVSE  700

Query  327   QDE  319
             +D+
Sbjct  701   EDD  703



>ref|XP_011083638.1| PREDICTED: V-type proton ATPase subunit a3-like [Sesamum indicum]
Length=817

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/423 (84%), Positives = 388/423 (92%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICLFLATLYF+ REKKLS+QKLG
Sbjct  396   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLFLATLYFILREKKLSNQKLG  455

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI++MALFSIYTG IYNEFFSVPFELFGRSAY C D +CR+A+T GLIK
Sbjct  456   DIMEMAFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGRSAYDCRDSTCREASTLGLIK  515

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHGTRSELPFLNSLKMKMSILLGV QMNLGI+LSY+N +FF+ND+N+W
Sbjct  516   VRHTYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVVQMNLGIILSYYNAKFFRNDLNVW  575

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK+L
Sbjct  576   YQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFMGQKFL  635

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI L+L ALVAVPWMLFPKPFLLKKQHEERHRGQ+YA L + +D    E + H    GHE
Sbjct  636   QIALLLAALVAVPWMLFPKPFLLKKQHEERHRGQAYALLDSTEDD-SFELEEHKGSRGHE  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNNI
Sbjct  695   EFEFSEVFVHQVIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNI  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILIIGI+VFICATVGVLL+METLSAFLHALRLHWVEFQ+KFYEGDGYKFSPFSF SI  
Sbjct  755   FILIIGIVVFICATVGVLLLMETLSAFLHALRLHWVEFQSKFYEGDGYKFSPFSFVSIGD  814

Query  327   QDE  319
              +E
Sbjct  815   DEE  817



>ref|XP_007017673.1| Vacuolar proton ATPase A3 isoform 1 [Theobroma cacao]
 gb|EOY14898.1| Vacuolar proton ATPase A3 isoform 1 [Theobroma cacao]
Length=818

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/423 (83%), Positives = 384/423 (91%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANP VFTI+TFPFLFAVMFGDWGHGICL LAT YF+ REKK SSQKLG
Sbjct  397   IVDAYGIAKYQEANPAVFTIITFPFLFAVMFGDWGHGICLCLATSYFIIREKKFSSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++MALFSIYTG IYNEFFSVPFELFG SAY C DPSC DA+T GL+K
Sbjct  457   DITEMIFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGPSAYGCHDPSCSDASTAGLVK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHGTRSELPFLNSLKMKMSIL+GVAQMNLGI+LSYFN +FFKN+INIW
Sbjct  517   VRATYPFGVDPKWHGTRSELPFLNSLKMKMSILIGVAQMNLGIILSYFNAKFFKNEINIW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK+L
Sbjct  577   YQFVPQLIFLNSLFGYLSLLIVVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFFGQKFL  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+L ALV+VPWMLFPKPFLLKKQHEERHRGQSYA L ++DD    E + H     HE
Sbjct  637   QIVLLLAALVSVPWMLFPKPFLLKKQHEERHRGQSYALLDSSDDD-PLEMELHHGSGSHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GFNNI
Sbjct  696   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNI  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILIIGI VFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA ++ 
Sbjct  756   IILIIGIFVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFQPFSFALVSE  815

Query  327   QDE  319
             +D+
Sbjct  816   EDD  818



>ref|XP_010061011.1| PREDICTED: V-type proton ATPase subunit a3-like isoform X2 [Eucalyptus 
grandis]
Length=755

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/423 (83%), Positives = 386/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYG+AKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL +ATLYF+FREKKLS+QKLG
Sbjct  335   IIDAYGIAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLMATLYFIFREKKLSNQKLG  394

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI  M F GRYVI++MALFSIYTG IYNEFFSVPFE+FG SAYAC D SCRDA+T GLIK
Sbjct  395   DITGMIFGGRYVIMMMALFSIYTGLIYNEFFSVPFEIFGPSAYACRDLSCRDASTQGLIK  454

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFN RFF ND+NI 
Sbjct  455   VRATYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNARFFANDLNIR  514

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSP +DL ENQ+F GQK+L
Sbjct  515   YQFVPQIIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPMEDLGENQLFFGQKFL  574

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLAL AVPWMLFPKPF+LKKQHEERH+GQ YA LH+ DD +E + D     H HE
Sbjct  575   QVILLLLALAAVPWMLFPKPFILKKQHEERHKGQQYAILHSIDDPLEMDLD--PDSHRHE  632

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GFNN 
Sbjct  633   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNT  692

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             ++LIIGI+VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA ++ 
Sbjct  693   LVLIIGIVVFISATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFQPFSFALLSE  752

Query  327   QDE  319
             +DE
Sbjct  753   EDE  755



>emb|CDP07451.1| unnamed protein product [Coffea canephora]
Length=808

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/423 (84%), Positives = 389/423 (92%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTI TFPFLFAVMFGDWGHG+CLFLATLYF+ REKKLS QKLG
Sbjct  388   IVDAYGVAKYQEANPGVFTIATFPFLFAVMFGDWGHGLCLFLATLYFILREKKLSHQKLG  447

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI++MALFSIYTG IYNEFFSVPFELFGRSAY C D SCRDA+T GLIK
Sbjct  448   DIMEMAFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGRSAYDCRDSSCRDASTVGLIK  507

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHGTRSELPFLNSLKMKMSILLG+AQMNLGIVLSYFN +FF NDINIW
Sbjct  508   VRGTYPFGVDPKWHGTRSELPFLNSLKMKMSILLGIAQMNLGIVLSYFNAKFFGNDINIW  567

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW +GSQADLYHVMIYMFLSPT DL +NQ+F GQKYL
Sbjct  568   YQFVPQIIFLNSLFGYLSLLIIVKWCSGSQADLYHVMIYMFLSPTADLGDNQLFFGQKYL  627

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L ALVAVPWMLFPKP LLKKQH+ERHRGQ+Y PL++ +D+ E E  +    HGHE
Sbjct  628   QILLLLFALVAVPWMLFPKPLLLKKQHQERHRGQAYRPLYSTEDSFELEIQS--DLHGHE  685

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GFNN+
Sbjct  686   EFEFSEVFVHQFIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNV  745

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILIIGIIVFICATVGVLL+METLSAFLHALRLHWVEFQ+KFYEGDGYKF PFSFAS++ 
Sbjct  746   IILIIGIIVFICATVGVLLLMETLSAFLHALRLHWVEFQSKFYEGDGYKFYPFSFASLSE  805

Query  327   QDE  319
              +E
Sbjct  806   DEE  808



>ref|XP_010061010.1| PREDICTED: V-type proton ATPase subunit a3-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW67909.1| hypothetical protein EUGRSUZ_F01613 [Eucalyptus grandis]
Length=819

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/423 (83%), Positives = 386/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYG+AKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL +ATLYF+FREKKLS+QKLG
Sbjct  399   IIDAYGIAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLMATLYFIFREKKLSNQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI  M F GRYVI++MALFSIYTG IYNEFFSVPFE+FG SAYAC D SCRDA+T GLIK
Sbjct  459   DITGMIFGGRYVIMMMALFSIYTGLIYNEFFSVPFEIFGPSAYACRDLSCRDASTQGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFN RFF ND+NI 
Sbjct  519   VRATYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNARFFANDLNIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSP +DL ENQ+F GQK+L
Sbjct  579   YQFVPQIIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPMEDLGENQLFFGQKFL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLAL AVPWMLFPKPF+LKKQHEERH+GQ YA LH+ DD +E + D     H HE
Sbjct  639   QVILLLLALAAVPWMLFPKPFILKKQHEERHKGQQYAILHSIDDPLEMDLD--PDSHRHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GFNN 
Sbjct  697   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNT  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             ++LIIGI+VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA ++ 
Sbjct  757   LVLIIGIVVFISATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFQPFSFALLSE  816

Query  327   QDE  319
             +DE
Sbjct  817   EDE  819



>ref|XP_010271519.1| PREDICTED: V-type proton ATPase subunit a2-like isoform X2 [Nelumbo 
nucifera]
Length=782

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/423 (83%), Positives = 390/423 (92%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKY EANPGV+TI+TFPFLFAVMFGDWGHGICL LATL+F+ REKKLS+QKLG
Sbjct  362   IVDAYGVAKYLEANPGVYTIITFPFLFAVMFGDWGHGICLLLATLFFIIREKKLSTQKLG  421

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++MALFSIYTG IYNEFFSVPFELFGRSAYAC DPSC D+TT GLIK
Sbjct  422   DITEMTFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGRSAYACRDPSCSDSTTVGLIK  481

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP W+GTRSELPFLNSLKMKMSIL+GVAQMNLGIVLSYFN +F+ +++NIW
Sbjct  482   VRGTYPFGVDPAWYGTRSELPFLNSLKMKMSILIGVAQMNLGIVLSYFNAKFYGSNLNIW  541

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  542   YQFVPQIIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFAGQKTL  601

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWML PKPFLLKKQH+ERH+GQSYA L + DD+ E E  +    HGHE
Sbjct  602   QMVLLLLALVAVPWMLLPKPFLLKKQHQERHQGQSYALLQSTDDSFEVEAHH--DSHGHE  659

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNNI
Sbjct  660   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNI  719

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +IL++GIIVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSFA ++ 
Sbjct  720   IILVVGIIVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFNPFSFALLSD  779

Query  327   QDE  319
             +D+
Sbjct  780   EDD  782



>ref|XP_011088459.1| PREDICTED: V-type proton ATPase subunit a3-like [Sesamum indicum]
Length=817

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/423 (83%), Positives = 389/423 (92%), Gaps = 3/423 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LATLYF+ REKKLSSQKLG
Sbjct  398   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYFIIREKKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI+LMALFSIYTG IYNEFFSVPFELF  SAY C DP+CRDATT GLIK
Sbjct  458   DIMEMTFGGRYVIMLMALFSIYTGLIYNEFFSVPFELFAPSAYVCRDPACRDATTVGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN +FFKN +N W
Sbjct  518   ARDTYPFGVDPAWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAQFFKNSLNTW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGS+ADLYHVMIYMFLSPTD+L EN++F GQK +
Sbjct  578   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSKADLYHVMIYMFLSPTDELGENELFPGQKTI  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLALV+VPWML PKPFLLK QH +RH G+SYAPL +A+++++SE ++    HGHE
Sbjct  638   QIVLLLLALVSVPWMLLPKPFLLKMQH-DRHHGESYAPLPDAEESLQSEANH--DSHGHE  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NNI
Sbjct  695   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNI  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GII+FICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA + +
Sbjct  755   IILIVGIIIFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALLDY  814

Query  327   QDE  319
             ++E
Sbjct  815   EEE  817



>ref|XP_010271518.1| PREDICTED: V-type proton ATPase subunit a2-like isoform X1 [Nelumbo 
nucifera]
Length=817

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/423 (83%), Positives = 390/423 (92%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKY EANPGV+TI+TFPFLFAVMFGDWGHGICL LATL+F+ REKKLS+QKLG
Sbjct  397   IVDAYGVAKYLEANPGVYTIITFPFLFAVMFGDWGHGICLLLATLFFIIREKKLSTQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++MALFSIYTG IYNEFFSVPFELFGRSAYAC DPSC D+TT GLIK
Sbjct  457   DITEMTFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGRSAYACRDPSCSDSTTVGLIK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP W+GTRSELPFLNSLKMKMSIL+GVAQMNLGIVLSYFN +F+ +++NIW
Sbjct  517   VRGTYPFGVDPAWYGTRSELPFLNSLKMKMSILIGVAQMNLGIVLSYFNAKFYGSNLNIW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  577   YQFVPQIIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFAGQKTL  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWML PKPFLLKKQH+ERH+GQSYA L + DD+ E E  +    HGHE
Sbjct  637   QMVLLLLALVAVPWMLLPKPFLLKKQHQERHQGQSYALLQSTDDSFEVEAHH--DSHGHE  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNNI
Sbjct  695   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNI  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +IL++GIIVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSFA ++ 
Sbjct  755   IILVVGIIVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFNPFSFALLSD  814

Query  327   QDE  319
             +D+
Sbjct  815   EDD  817



>dbj|BAJ53179.1| JHL18I08.13 [Jatropha curcas]
 gb|KDP38579.1| hypothetical protein JCGZ_04504 [Jatropha curcas]
Length=817

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/423 (83%), Positives = 389/423 (92%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL LATLYF+ REKKLSSQKLG
Sbjct  397   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLATLYFIVREKKLSSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MA+FSIYTG IYNEFFSVPFELFG SAY+C D SCRDA+T+GL+K
Sbjct  457   DIMEMTFGGRYVIMMMAIFSIYTGLIYNEFFSVPFELFGPSAYSCRDLSCRDASTSGLLK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TY FGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGIV+SYFN +FF +++N+W
Sbjct  517   VRATYTFGVDPKWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVMSYFNAKFFGDNLNVW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW+TGSQADLYHVMIYMFLSPTDDL +NQ+F GQK+L
Sbjct  577   YQFVPQIIFLNSLFGYLSLLIIVKWFTGSQADLYHVMIYMFLSPTDDLGDNQLFVGQKFL  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLALVAVPWMLFPKPFLLKKQ++ERH+GQSYA L + +D +E E         HE
Sbjct  637   QILLLLLALVAVPWMLFPKPFLLKKQYQERHQGQSYAILDSTEDPLEMEPQ--YDSQKHE  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GFNNI
Sbjct  695   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNI  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VIL+IGIIVF+CATVGVLLVMETLSAFLHALRLHWVEFQNKFYEG+GYKF PFSFA +  
Sbjct  755   VILMIGIIVFVCATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGNGYKFHPFSFALLTV  814

Query  327   QDE  319
             +DE
Sbjct  815   EDE  817



>ref|XP_009401931.1| PREDICTED: vacuolar proton ATPase a3-like [Musa acuminata subsp. 
malaccensis]
Length=827

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/423 (82%), Positives = 387/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGV+TIVTFPFLFAVMFGDWGHG+CL LATL  +FREKKLSSQKLG
Sbjct  407   IVDAYGIAKYQEANPGVYTIVTFPFLFAVMFGDWGHGMCLLLATLMLIFREKKLSSQKLG  466

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVIL+MALFSIYTG IYNEFFSVPFE+FGRSAYAC D SCRDATT GL+K
Sbjct  467   DIMEMMFGGRYVILMMALFSIYTGLIYNEFFSVPFEMFGRSAYACRDLSCRDATTEGLVK  526

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR+ YPFGVDP WHG+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN +FF N IN W
Sbjct  527   VREAYPFGVDPKWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAKFFSNSINTW  586

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  587   YQFIPQLIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFPGQKTL  646

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLAL++VPWMLFPKP LL+KQH ERH+GQSY  LHN ++++E E D+    H HE
Sbjct  647   QLVLLLLALISVPWMLFPKPILLRKQHNERHQGQSYTMLHNTEESLEIEEDH--DSHDHE  704

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNNI
Sbjct  705   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNI  764

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILIIGI+VF+CAT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSFA +  
Sbjct  765   AILIIGIVVFVCATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALLTD  824

Query  327   QDE  319
             +++
Sbjct  825   EED  827



>gb|KHG00114.1| Vacuolar proton translocating ATPase subunit [Gossypium arboreum]
Length=818

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/423 (83%), Positives = 381/423 (90%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGVFTI+TFPFLFAVMFGDWGHGICLFLAT YF+ +EKK SSQKLG
Sbjct  397   IVDAYGIAKYQEANPGVFTIITFPFLFAVMFGDWGHGICLFLATSYFIIKEKKFSSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++MALFSIYTG IYNEFFSVPFELFG SAY C DP+CRDA+T GL+K
Sbjct  457   DITEMIFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGPSAYGCRDPACRDASTAGLVK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN +F  N++NI 
Sbjct  517   VRATYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAKFSGNELNIR  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LI++KW  GSQADLYHVMIYMFLSPTDDL ENQ+F GQK+L
Sbjct  577   YQFLPQMIFLNSLFGYLSLLIVVKWCIGSQADLYHVMIYMFLSPTDDLGENQLFFGQKFL  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+L ALVAVPWMLFPKPFLLKKQHEERHRGQSYA L N+ D  + E +       HE
Sbjct  637   QIVLLLAALVAVPWMLFPKPFLLKKQHEERHRGQSYALLENSLDESD-EMEVRHGSSSHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GFNNI
Sbjct  696   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNI  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILIIGI VFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFAS+  
Sbjct  756   FILIIGIFVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFQPFSFASLDA  815

Query  327   QDE  319
             +DE
Sbjct  816   EDE  818



>ref|XP_008783594.1| PREDICTED: vacuolar proton ATPase a3-like [Phoenix dactylifera]
Length=826

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/423 (83%), Positives = 392/423 (93%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL LATLYF+FREKKLSSQKLG
Sbjct  406   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLATLYFIFREKKLSSQKLG  465

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYV+++MA+FSIYTG IYNEFFSVPFELFG+SAYAC DPSCRDAT+ GLIK
Sbjct  466   DITEMTFGGRYVLMMMAMFSIYTGLIYNEFFSVPFELFGKSAYACRDPSCRDATSEGLIK  525

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHG+RSELPFLNSLKMK+SILLGVAQMNLGIVLSYFN +FF+N++NIW
Sbjct  526   VRSTYPFGVDPKWHGSRSELPFLNSLKMKLSILLGVAQMNLGIVLSYFNAKFFRNNLNIW  585

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  586   YQFVPQLIFLNSLFGYLSLLIIVKWCTGSKADLYHVMIYMFLSPTDDLGENQLFPGQKTL  645

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLAL++VPWML PKP LLKKQH+ERH+GQSYA L N ++++E E D+    HGHE
Sbjct  646   QLVLLLLALISVPWMLLPKPILLKKQHQERHQGQSYALLQNTEESLELEQDH--SSHGHE  703

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNNI
Sbjct  704   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNI  763

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI AT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFA +  
Sbjct  764   IILIVGIIVFIFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLGE  823

Query  327   QDE  319
              ++
Sbjct  824   DED  826



>ref|XP_002265086.1| PREDICTED: V-type proton ATPase subunit a3 [Vitis vinifera]
 ref|XP_010647686.1| PREDICTED: V-type proton ATPase subunit a3 [Vitis vinifera]
 emb|CBI38019.3| unnamed protein product [Vitis vinifera]
Length=822

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/423 (82%), Positives = 385/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHG+CL LATL+F+ REKKLS+QKLG
Sbjct  402   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGLCLLLATLFFIIREKKLSNQKLG  461

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVIL+MALFSIYTG IYNEFFSVPFELFG SAYAC D SCRDA+T GLIK
Sbjct  462   DITEMTFGGRYVILMMALFSIYTGLIYNEFFSVPFELFGPSAYACRDLSCRDASTAGLIK  521

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDPVWHG+RSELPFLNSLKMKMSIL+GVAQMNLGI+LSYFN +FF+N +NIW
Sbjct  522   VRRTYPFGVDPVWHGSRSELPFLNSLKMKMSILIGVAQMNLGIILSYFNAKFFQNSLNIW  581

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLNSLFGYL+VLII+KW TGSQADLYH+MIYMFLSPTDDL ENQ+F GQK  
Sbjct  582   FQFVPQMIFLNSLFGYLSVLIIVKWCTGSQADLYHIMIYMFLSPTDDLGENQLFIGQKTG  641

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLALVAVPWML PKPFL+KKQHEERH+ Q Y PL + +D+ + +T +    H HE
Sbjct  642   QIVLLLLALVAVPWMLLPKPFLMKKQHEERHQSQLYVPLQSTEDSFQLDTSH--DSHDHE  699

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEF EVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNN+
Sbjct  700   EFEFGEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNV  759

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFICAT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA ++ 
Sbjct  760   IILIVGIIVFICATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFCPFSFALLSE  819

Query  327   QDE  319
             +D+
Sbjct  820   EDD  822



>ref|XP_010918985.1| PREDICTED: V-type proton ATPase subunit a3 isoform X3 [Elaeis 
guineensis]
Length=777

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/423 (83%), Positives = 389/423 (92%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL L TLYF+ REKKLSSQKLG
Sbjct  355   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLTTLYFIIREKKLSSQKLG  414

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MA+FSIYTG IYNEFFSVPFELFG+SAYAC D SCRDATT GLIK
Sbjct  415   DIMEMTFGGRYVIMMMAIFSIYTGLIYNEFFSVPFELFGKSAYACRDSSCRDATTEGLIK  474

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR  YPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFN +FF+N++NIW
Sbjct  475   VRPAYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNAKFFRNNLNIW  534

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  535   YQFVPQLIFLNSLFGYLSLLIIVKWCTGSKADLYHVMIYMFLSPTDDLGENQLFPGQKTL  594

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLAL++VPWMLFPKP LLKKQH+ERH+GQSY  L + ++ +E +  +  HGHG+E
Sbjct  595   QLVLLLLALISVPWMLFPKPILLKKQHQERHQGQSYTMLQSTEEMLELDHGHSSHGHGNE  654

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNNI
Sbjct  655   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNI  714

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILIIG IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFA +A 
Sbjct  715   IILIIGFIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLAE  774

Query  327   QDE  319
              ++
Sbjct  775   DED  777



>ref|XP_004500962.1| PREDICTED: vacuolar proton ATPase a2-like [Cicer arietinum]
Length=819

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/422 (82%), Positives = 385/422 (91%), Gaps = 2/422 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL LATLYF+  EKK S QKLG
Sbjct  398   IVDAYGIAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLATLYFIINEKKFSCQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI+EM F GRY+I++MALFSIYTG IYNEFFS+PFELFG +AY C DPSCRDATT GLIK
Sbjct  458   DILEMVFGGRYIIMMMALFSIYTGLIYNEFFSIPFELFGPTAYGCRDPSCRDATTIGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             +RDTYPFGVDP WHGTRSELPFLNSLKMKMSILLGV+QMNLGIVLSY+N ++F+N IN W
Sbjct  518   MRDTYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVSQMNLGIVLSYYNAKYFENSINTW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW  GSQADLYHVMIYMFLSPTDDL ENQ+F GQ++L
Sbjct  578   YQFVPQMIFLNSLFGYLSLLIIVKWCCGSQADLYHVMIYMFLSPTDDLGENQLFVGQQFL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI L+LLAL+AVPWML PKPFLLKKQHEERHRGQSY+ L++ DD +ES++      H HE
Sbjct  638   QITLLLLALIAVPWMLIPKPFLLKKQHEERHRGQSYSLLYSGDDPLESKSHG--IHHNHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G+NN 
Sbjct  696   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGYNNT  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             ++LI+G+IVFICATVGVLLVME+LSAFLHALRLHWVEFQNKFYEGDGYKF PFSF S+A 
Sbjct  756   IVLIVGVIVFICATVGVLLVMESLSAFLHALRLHWVEFQNKFYEGDGYKFFPFSFTSLAD  815

Query  327   QD  322
             +D
Sbjct  816   ED  817



>gb|KHG13921.1| Vacuolar proton translocating ATPase subunit [Gossypium arboreum]
Length=821

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/423 (82%), Positives = 384/423 (91%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LATLYF+ REKKLSSQKLG
Sbjct  399   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIVREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++M+LFSIYTG +YNEFFSVPFELFGRSAYAC D SCRDATT GLIK
Sbjct  459   DITEMTFGGRYVIMMMSLFSIYTGLVYNEFFSVPFELFGRSAYACRDLSCRDATTVGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDP WHG+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  FF+N +N+W
Sbjct  519   VRDTYPFGVDPAWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAIFFRNSLNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+ LII+KW TGSQADLYH++IYMFLSPTD+L ENQ+F GQK  
Sbjct  579   FQFIPQMIFLNSLFGYLSFLIIVKWCTGSQADLYHILIYMFLSPTDELGENQLFPGQKIT  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q +L+LLALV+VPWML PKPFLLK+QHE RH+GQSYAPL + D+ + S  +N  HGH HE
Sbjct  639   QQVLLLLALVSVPWMLLPKPFLLKRQHENRHQGQSYAPLESTDETLLSVANNDSHGHDHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS VFY+KVLLLA G+NNI
Sbjct  699   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSVVFYEKVLLLAWGYNNI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  759   IILIVGIIVFIFATVGVLLIMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALLDD  818

Query  327   QDE  319
             +D+
Sbjct  819   EDD  821



>ref|NP_001049572.1| Os03g0251500 [Oryza sativa Japonica Group]
 gb|ABF94992.1| V-type ATPase 116kDa subunit family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11486.1| Os03g0251500 [Oryza sativa Japonica Group]
 gb|EAY89276.1| hypothetical protein OsI_10776 [Oryza sativa Indica Group]
 gb|EAZ26290.1| hypothetical protein OsJ_10160 [Oryza sativa Japonica Group]
 dbj|BAG94928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=820

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/423 (79%), Positives = 383/423 (91%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGVFTIVTFPFLFAVMFGDWGHGIC+ ++TLY + REKK +SQKLG
Sbjct  398   IVDAYGIAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICILVSTLYLIIREKKFASQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MALFSIYTG IYNEFFSVPFELFG+SAYAC DPSC DA T GL+K
Sbjct  458   DIMEMMFGGRYVIIMMALFSIYTGLIYNEFFSVPFELFGKSAYACRDPSCGDAATEGLLK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGIV+SYFN +FF+N +N+W
Sbjct  518   VRRTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIVISYFNAKFFRNSVNVW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TG++ADLYH MIYMFLSPTD+L ENQ+F GQK +
Sbjct  578   YQFIPQLIFLNSLFGYLSMLIIIKWSTGAKADLYHTMIYMFLSPTDELGENQLFPGQKTV  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPF LK +HE RH+GQ YA L + DD+V +E  +H   + HE
Sbjct  638   QLVLLLLALVSVPWMLIPKPFFLKMEHERRHQGQQYAMLQSTDDSVVAEMGHHNGSNHHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G+NNI
Sbjct  698   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAFGYNNI  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I I GI +FICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSFA I+ 
Sbjct  758   LIRIAGITIFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALISE  817

Query  327   QDE  319
             +++
Sbjct  818   EED  820



>ref|XP_010918984.1| PREDICTED: V-type proton ATPase subunit a3 isoform X2 [Elaeis 
guineensis]
Length=828

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/423 (83%), Positives = 389/423 (92%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL L TLYF+ REKKLSSQKLG
Sbjct  406   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLTTLYFIIREKKLSSQKLG  465

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MA+FSIYTG IYNEFFSVPFELFG+SAYAC D SCRDATT GLIK
Sbjct  466   DIMEMTFGGRYVIMMMAIFSIYTGLIYNEFFSVPFELFGKSAYACRDSSCRDATTEGLIK  525

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR  YPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFN +FF+N++NIW
Sbjct  526   VRPAYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNAKFFRNNLNIW  585

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  586   YQFVPQLIFLNSLFGYLSLLIIVKWCTGSKADLYHVMIYMFLSPTDDLGENQLFPGQKTL  645

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLAL++VPWMLFPKP LLKKQH+ERH+GQSY  L + ++ +E +  +  HGHG+E
Sbjct  646   QLVLLLLALISVPWMLFPKPILLKKQHQERHQGQSYTMLQSTEEMLELDHGHSSHGHGNE  705

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNNI
Sbjct  706   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNI  765

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILIIG IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFA +A 
Sbjct  766   IILIIGFIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLAE  825

Query  327   QDE  319
              ++
Sbjct  826   DED  828



>ref|XP_010918981.1| PREDICTED: V-type proton ATPase subunit a3 isoform X1 [Elaeis 
guineensis]
 ref|XP_010918983.1| PREDICTED: V-type proton ATPase subunit a3 isoform X1 [Elaeis 
guineensis]
Length=837

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/423 (83%), Positives = 389/423 (92%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL L TLYF+ REKKLSSQKLG
Sbjct  415   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLTTLYFIIREKKLSSQKLG  474

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MA+FSIYTG IYNEFFSVPFELFG+SAYAC D SCRDATT GLIK
Sbjct  475   DIMEMTFGGRYVIMMMAIFSIYTGLIYNEFFSVPFELFGKSAYACRDSSCRDATTEGLIK  534

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR  YPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFN +FF+N++NIW
Sbjct  535   VRPAYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNAKFFRNNLNIW  594

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  595   YQFVPQLIFLNSLFGYLSLLIIVKWCTGSKADLYHVMIYMFLSPTDDLGENQLFPGQKTL  654

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLAL++VPWMLFPKP LLKKQH+ERH+GQSY  L + ++ +E +  +  HGHG+E
Sbjct  655   QLVLLLLALISVPWMLFPKPILLKKQHQERHQGQSYTMLQSTEEMLELDHGHSSHGHGNE  714

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNNI
Sbjct  715   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNI  774

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILIIG IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFA +A 
Sbjct  775   IILIIGFIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLAE  834

Query  327   QDE  319
              ++
Sbjct  835   DED  837



>ref|XP_008445568.1| PREDICTED: vacuolar proton ATPase a3-like, partial [Cucumis melo]
Length=611

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/423 (82%), Positives = 380/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LATLYF+ REKK S QKLG
Sbjct  191   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIIREKKFSGQKLG  250

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI+EM F GRYVI++MALFSIYTG IYNEFFSVPFELFG SAY C D SCRDAT+ GL+K
Sbjct  251   DIVEMTFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGPSAYGCRDTSCRDATSIGLVK  310

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN +FF   INIW
Sbjct  311   VRDTYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAKFFGESINIW  370

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KWY+GSQADLYHVMIYMFLSPTDDL ENQ+F GQK+L
Sbjct  371   YQFVPQMIFLNSLFGYLSLLIIVKWYSGSQADLYHVMIYMFLSPTDDLGENQLFPGQKFL  430

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+LL+L AL AVPWMLFPKP LLKKQ+EERH+GQSY+ LH  DD  E E  +    HGHE
Sbjct  431   QLLLLLSALTAVPWMLFPKPLLLKKQNEERHQGQSYSVLHCTDDNHEIEPHH--GSHGHE  488

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F+ SEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GFN++
Sbjct  489   EFDLSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNSL  548

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I I+G+ VFI ATVGVLL+METLSAFLHALRLHWVEFQNKFY GDG+KFSPFSF+ +  
Sbjct  549   IIRIVGMAVFIFATVGVLLIMETLSAFLHALRLHWVEFQNKFYAGDGFKFSPFSFSLLRE  608

Query  327   QDE  319
             +DE
Sbjct  609   EDE  611



>ref|XP_002300733.1| hypothetical protein POPTR_0002s03010g [Populus trichocarpa]
 gb|EEE80006.1| hypothetical protein POPTR_0002s03010g [Populus trichocarpa]
Length=807

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/423 (81%), Positives = 381/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL LATLYF+FREKKLSSQKLG
Sbjct  387   IVDAYGVAKYQEANPSVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIFREKKLSSQKLG  446

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAFSGRYVI++MA+FSIYTG IYNEFFSVPFELFG SAY C D SC DA+T GL+K
Sbjct  447   DIMEMAFSGRYVIMMMAIFSIYTGLIYNEFFSVPFELFGLSAYGCRDQSCGDASTAGLVK  506

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFG+DP WHGTRSELPFLNS+KMKMSIL GVAQMNLGI++SYFN +FF ++INIW
Sbjct  507   VRATYPFGLDPKWHGTRSELPFLNSMKMKMSILFGVAQMNLGIIISYFNAKFFGDNINIW  566

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL++NQ+F GQK+ 
Sbjct  567   YQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLDDNQLFFGQKFF  626

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L AL AVPWMLFPKPFLLKKQHEER +GQSYA L ++D + E E  +    H HE
Sbjct  627   QILLLLSALAAVPWMLFPKPFLLKKQHEERFQGQSYARLDSSDYSPEVEQHS--VSHNHE  684

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSEL+SVFYDKVLLL+ G+N+I
Sbjct  685   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELASVFYDKVLLLSWGYNSI  744

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +   IG+IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  745   LARSIGLIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYVGDGYKFYPFSFASLGE  804

Query  327   QDE  319
              DE
Sbjct  805   DDE  807



>ref|XP_004152666.1| PREDICTED: vacuolar proton ATPase a3-like [Cucumis sativus]
 ref|XP_004169002.1| PREDICTED: vacuolar proton ATPase a3-like [Cucumis sativus]
 gb|KGN62648.1| hypothetical protein Csa_2G364570 [Cucumis sativus]
Length=808

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/423 (82%), Positives = 382/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LATLYF+ REKK S QKLG
Sbjct  388   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIIREKKFSGQKLG  447

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI+EM F GRYVI++MALFSIYTG IYNEFFSVPFELFG SAY C D SCRDAT+ GLIK
Sbjct  448   DIVEMTFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGPSAYGCRDTSCRDATSIGLIK  507

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN +FF   INIW
Sbjct  508   VRDTYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAKFFGESINIW  567

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KWY+GSQADLYHVMIYMFLSPTDDL ENQ+F GQK+L
Sbjct  568   YQFVPQMIFLNSLFGYLSLLIIVKWYSGSQADLYHVMIYMFLSPTDDLGENQLFPGQKFL  627

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+LL+L AL AVPWMLFPKPFLLKKQ+EERH+GQSY+ LH  DD    E + H   HGHE
Sbjct  628   QLLLLLSALTAVPWMLFPKPFLLKKQNEERHQGQSYSVLHCTDD--NHEIERHHGSHGHE  685

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F+FSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GF+++
Sbjct  686   EFDFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFDSL  745

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I I+G+ VFI ATVGVLL+METLSAFLHALRLHWVEFQNKFY GDG+KFSPFSF+ +  
Sbjct  746   IIRIVGMAVFIFATVGVLLIMETLSAFLHALRLHWVEFQNKFYAGDGFKFSPFSFSLLRE  805

Query  327   QDE  319
             +DE
Sbjct  806   EDE  808



>ref|XP_007042074.1| Vacuolar proton ATPase A3 isoform 1 [Theobroma cacao]
 gb|EOX97905.1| Vacuolar proton ATPase A3 isoform 1 [Theobroma cacao]
Length=821

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/423 (82%), Positives = 387/423 (91%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL LATL+F+ REKKLSSQKLG
Sbjct  399   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLATLFFIVREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++MALFSIYTG IYNEFFSVPFELFGRSAYAC D +CRDA+T GLIK
Sbjct  459   DITEMTFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGRSAYACRDLTCRDASTVGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR+TYPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  FF + +N+W
Sbjct  519   VRETYPFGVDPAWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNATFFGSSLNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQK +
Sbjct  579   FQFIPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDELGENQLFPGQKTV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML P+PFLLKKQHE +H+GQSY PL + DD + SE +N  HGHGHE
Sbjct  639   QLVLLLLALVSVPWMLLPRPFLLKKQHENQHQGQSYTPLESTDDTLHSEANNDSHGHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS VFY+KVLLLA GFNNI
Sbjct  699   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSVVFYEKVLLLAWGFNNI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GII+FI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  759   IILIVGIIIFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALLGD  818

Query  327   QDE  319
             +D+
Sbjct  819   EDD  821



>ref|XP_002510470.1| vacuolar proton atpase, putative [Ricinus communis]
 gb|EEF52657.1| vacuolar proton atpase, putative [Ricinus communis]
Length=810

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/423 (83%), Positives = 384/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL LATLYF+ REKKLSSQKLG
Sbjct  390   IVDAYGIAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLATLYFITREKKLSSQKLG  449

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MA+FSIYTG IYNEFFSVPFELFG SAYAC D SCRDA T GLIK
Sbjct  450   DIMEMTFGGRYVIMMMAIFSIYTGLIYNEFFSVPFELFGPSAYACRDQSCRDAYTAGLIK  509

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGIV+SYFN +FF +++N+ 
Sbjct  510   VRATYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVMSYFNAKFFGDNLNVR  569

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSP DDL +NQ+F GQK+L
Sbjct  570   YQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPIDDLGDNQLFVGQKFL  629

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL++LALVA PWMLFPKP LLKKQHEERH+GQSYA L + +D +E E  +    H HE
Sbjct  630   QILLLILALVAAPWMLFPKPLLLKKQHEERHQGQSYALLESTEDPLEMEPHS--DSHKHE  687

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GFNNI
Sbjct  688   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNI  747

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VILIIGI+VF+CATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF  +  
Sbjct  748   VILIIGIVVFVCATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFVLLGD  807

Query  327   QDE  319
             +DE
Sbjct  808   EDE  810



>ref|XP_007158764.1| hypothetical protein PHAVU_002G179900g [Phaseolus vulgaris]
 gb|ESW30758.1| hypothetical protein PHAVU_002G179900g [Phaseolus vulgaris]
Length=817

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/423 (81%), Positives = 384/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL LA LY V  EKK S+QKLG
Sbjct  396   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLAALYLVINEKKFSTQKLG  455

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRY+I +MALFSIYTG IYNEFFSVPFELFG SAY C DPSC DA+T GLIK
Sbjct  456   DIMEMAFGGRYIITMMALFSIYTGMIYNEFFSVPFELFGPSAYGCRDPSCGDASTIGLIK  515

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDP WHGTRSELP+LNSLKMKMSILLGV+QMNLGI++SY+N ++F+N+INIW
Sbjct  516   VRDTYPFGVDPKWHGTRSELPYLNSLKMKMSILLGVSQMNLGIIMSYYNAKYFENNINIW  575

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHV+IYMFLSPT+DL ENQ+F GQK L
Sbjct  576   YQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVVIYMFLSPTEDLGENQLFVGQKLL  635

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWML PKPFLLKKQH+ERH+GQSYA L+NADD  ESE+ +      H+
Sbjct  636   QLVLLLLALVAVPWMLVPKPFLLKKQHKERHQGQSYALLYNADDPNESESQS--VSCDHD  693

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F+FSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G+NN 
Sbjct  694   EFDFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGYNNT  753

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GI VFICATVGVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF  +  
Sbjct  754   IILIVGIFVFICATVGVLLLMETLSAFLHALRLHWVEFQNKFYEGDGYKFFPFSFTLLTD  813

Query  327   QDE  319
             +DE
Sbjct  814   EDE  816



>ref|XP_007199708.1| hypothetical protein PRUPE_ppa001492mg [Prunus persica]
 gb|EMJ00907.1| hypothetical protein PRUPE_ppa001492mg [Prunus persica]
Length=814

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/423 (81%), Positives = 391/423 (92%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IV+AYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL LATLY + RE+KLSSQKLG
Sbjct  394   IVEAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLATLYLIGRERKLSSQKLG  453

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVILLMA+FSIYTG IYNEFFSVPFELFG SAYAC D SCRDATT GLIK
Sbjct  454   DIMEMAFGGRYVILLMAIFSIYTGLIYNEFFSVPFELFGSSAYACRDLSCRDATTAGLIK  513

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFG+DPVWHG+RSELPFLNSLKMKMSILLGV QMNLGI+LS+FN RFF++ +N+W
Sbjct  514   VRPTYPFGLDPVWHGSRSELPFLNSLKMKMSILLGVVQMNLGIILSFFNARFFRSGVNVW  573

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQ+IFLNSLFGYL+VLI++KW+TGS+ADLYHVMIYMFLSPTD+L ENQ+F+GQ+ +
Sbjct  574   FQFVPQIIFLNSLFGYLSVLIVMKWWTGSKADLYHVMIYMFLSPTDELGENQLFSGQRTV  633

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA V+VPWMLFPKPF+LKKQH++RH+GQSYA L N +++++  +++  HGHG  
Sbjct  634   QLVLLLLAFVSVPWMLFPKPFILKKQHQDRHQGQSYALLENTEESLQVNSNHDAHGHG--  691

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GFNN+
Sbjct  692   EFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNV  751

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFICATVGVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  752   IILIVGIIVFICATVGVLLLMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALLDD  811

Query  327   QDE  319
             +DE
Sbjct  812   EDE  814



>ref|XP_011028943.1| PREDICTED: V-type proton ATPase subunit a2-like isoform X3 [Populus 
euphratica]
Length=740

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/423 (81%), Positives = 381/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL LATLYF+FREKKLSSQKLG
Sbjct  320   IVDAYGVAKYQEANPSVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIFREKKLSSQKLG  379

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAFSGRYVI++MA+FSIYTG IYNEFFSVPFELFG SAY C D SC DA+T GL+K
Sbjct  380   DIMEMAFSGRYVIMMMAIFSIYTGLIYNEFFSVPFELFGPSAYGCRDQSCGDASTAGLVK  439

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFG+DP WHGTRSELPFLNS+KMKMSIL GVAQMNLGI++SYFN +FF ++INIW
Sbjct  440   VRATYPFGLDPKWHGTRSELPFLNSMKMKMSILFGVAQMNLGIIISYFNAKFFGDNINIW  499

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL++NQ+F GQK+ 
Sbjct  500   YQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLDDNQLFFGQKFF  559

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L AL AVPWMLFPKPFLLKKQHEER +GQSYA L ++D + E E  +    H HE
Sbjct  560   QILLLLSALAAVPWMLFPKPFLLKKQHEERFQGQSYARLDSSDFSPEIEPHS--VSHNHE  617

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSEL+SVFYDKVLLL+ G+N+I
Sbjct  618   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELASVFYDKVLLLSWGYNSI  677

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +   IG+IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  678   LARSIGLIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYVGDGYKFYPFSFASLGE  737

Query  327   QDE  319
              DE
Sbjct  738   DDE  740



>ref|XP_007042076.1| Vacuolar proton ATPase A3 isoform 3 [Theobroma cacao]
 gb|EOX97907.1| Vacuolar proton ATPase A3 isoform 3 [Theobroma cacao]
Length=752

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/424 (82%), Positives = 387/424 (91%), Gaps = 1/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL LATL+F+ REKKLSSQKLG
Sbjct  329   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLATLFFIVREKKLSSQKLG  388

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++MALFSIYTG IYNEFFSVPFELFGRSAYAC D +CRDA+T GLIK
Sbjct  389   DITEMTFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGRSAYACRDLTCRDASTVGLIK  448

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR+TYPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  FF + +N+W
Sbjct  449   VRETYPFGVDPAWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNATFFGSSLNVW  508

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQK +
Sbjct  509   FQFIPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDELGENQLFPGQKTV  568

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML P+PFLLKKQHE +H+GQSY PL + DD + SE +N  HGHGHE
Sbjct  569   QLVLLLLALVSVPWMLLPRPFLLKKQHENQHQGQSYTPLESTDDTLHSEANNDSHGHGHE  628

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWAL-SLAHSELSSVFYDKVLLLAMgfnn  511
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWAL SLAHSELS VFY+KVLLLA GFNN
Sbjct  629   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSSLAHSELSVVFYEKVLLLAWGFNN  688

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             I+ILI+GII+FI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA + 
Sbjct  689   IIILIVGIIIFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALLG  748

Query  330   HQDE  319
              +D+
Sbjct  749   DEDD  752



>ref|XP_011028942.1| PREDICTED: V-type proton ATPase subunit a2-like isoform X2 [Populus 
euphratica]
Length=816

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/423 (81%), Positives = 381/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL LATLYF+FREKKLSSQKLG
Sbjct  396   IVDAYGVAKYQEANPSVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIFREKKLSSQKLG  455

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAFSGRYVI++MA+FSIYTG IYNEFFSVPFELFG SAY C D SC DA+T GL+K
Sbjct  456   DIMEMAFSGRYVIMMMAIFSIYTGLIYNEFFSVPFELFGPSAYGCRDQSCGDASTAGLVK  515

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFG+DP WHGTRSELPFLNS+KMKMSIL GVAQMNLGI++SYFN +FF ++INIW
Sbjct  516   VRATYPFGLDPKWHGTRSELPFLNSMKMKMSILFGVAQMNLGIIISYFNAKFFGDNINIW  575

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL++NQ+F GQK+ 
Sbjct  576   YQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLDDNQLFFGQKFF  635

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L AL AVPWMLFPKPFLLKKQHEER +GQSYA L ++D + E E  +    H HE
Sbjct  636   QILLLLSALAAVPWMLFPKPFLLKKQHEERFQGQSYARLDSSDFSPEIEPHS--VSHNHE  693

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSEL+SVFYDKVLLL+ G+N+I
Sbjct  694   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELASVFYDKVLLLSWGYNSI  753

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +   IG+IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  754   LARSIGLIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYVGDGYKFYPFSFASLGE  813

Query  327   QDE  319
              DE
Sbjct  814   DDE  816



>ref|XP_008221327.1| PREDICTED: vacuolar proton ATPase a3-like [Prunus mume]
Length=816

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/423 (83%), Positives = 387/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LATLYF+ RE+K SSQKLG
Sbjct  396   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIIRERKFSSQKLG  455

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI+EM F GRYVI++MALFSIYTG IYNEFFSVPFELFG SAY C D SC DATT GL K
Sbjct  456   DIVEMTFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGPSAYGCRDQSCSDATTVGLSK  515

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHG+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN +FF +++NIW
Sbjct  516   VRGTYPFGVDPKWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAKFFGDNLNIW  575

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT+DL ENQ+F GQK+L
Sbjct  576   YQFVPQIIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTEDLGENQLFFGQKFL  635

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L ALVAVPWMLFPKP+LLKKQHEERH+GQSYA LH  DD +E   D+H   HGHE
Sbjct  636   QILLLLSALVAVPWMLFPKPYLLKKQHEERHQGQSYALLHGGDDPLEE--DHHQSLHGHE  693

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEF+EVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDK+LLLA GFNN+
Sbjct  694   EFEFTEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKILLLAWGFNNV  753

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILIIGIIVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEG GYKF PFSFA ++ 
Sbjct  754   IILIIGIIVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGAGYKFYPFSFALLSG  813

Query  327   QDE  319
             +DE
Sbjct  814   EDE  816



>ref|XP_011028941.1| PREDICTED: V-type proton ATPase subunit a2-like isoform X1 [Populus 
euphratica]
Length=826

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/423 (81%), Positives = 381/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL LATLYF+FREKKLSSQKLG
Sbjct  406   IVDAYGVAKYQEANPSVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIFREKKLSSQKLG  465

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAFSGRYVI++MA+FSIYTG IYNEFFSVPFELFG SAY C D SC DA+T GL+K
Sbjct  466   DIMEMAFSGRYVIMMMAIFSIYTGLIYNEFFSVPFELFGPSAYGCRDQSCGDASTAGLVK  525

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFG+DP WHGTRSELPFLNS+KMKMSIL GVAQMNLGI++SYFN +FF ++INIW
Sbjct  526   VRATYPFGLDPKWHGTRSELPFLNSMKMKMSILFGVAQMNLGIIISYFNAKFFGDNINIW  585

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL++NQ+F GQK+ 
Sbjct  586   YQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLDDNQLFFGQKFF  645

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L AL AVPWMLFPKPFLLKKQHEER +GQSYA L ++D + E E  +    H HE
Sbjct  646   QILLLLSALAAVPWMLFPKPFLLKKQHEERFQGQSYARLDSSDFSPEIEPHS--VSHNHE  703

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSEL+SVFYDKVLLL+ G+N+I
Sbjct  704   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELASVFYDKVLLLSWGYNSI  763

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +   IG+IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  764   LARSIGLIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYVGDGYKFYPFSFASLGE  823

Query  327   QDE  319
              DE
Sbjct  824   DDE  826



>ref|XP_006649752.1| PREDICTED: vacuolar proton ATPase a3-like [Oryza brachyantha]
Length=819

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/423 (79%), Positives = 384/423 (91%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGVFT+VTFPFLFAVMFGDWGHGICL +ATLY + REKKL+SQKLG
Sbjct  397   IVDAYGIAKYQEANPGVFTVVTFPFLFAVMFGDWGHGICLLVATLYLIIREKKLASQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MALFSIYTG IYNEFFSVPFELFG+SAYAC DPSC DA T GL+K
Sbjct  457   DIMEMMFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGKSAYACRDPSCGDAATEGLLK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR  YPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGIV+SYFN +FF+N +N+W
Sbjct  517   VRRAYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIVISYFNAKFFRNSVNVW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TG++ADLYH MIYMFLSPTD+L ENQ+F GQK +
Sbjct  577   YQFIPQLIFLNSLFGYLSMLIIIKWCTGAKADLYHTMIYMFLSPTDELGENQLFPGQKLV  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L++LALV+VPWML PKPF LK++HE RH+GQ YA L  ADD+V ++  +HG  + HE
Sbjct  637   QLVLLVLALVSVPWMLIPKPFFLKREHERRHQGQQYAMLQTADDSVVADLGDHGDSNHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G+NNI
Sbjct  697   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGYNNI  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I I+GI +FI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSF  I+ 
Sbjct  757   LIRIVGIAIFIAATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFDLISE  816

Query  327   QDE  319
             +++
Sbjct  817   EED  819



>ref|XP_008236967.1| PREDICTED: vacuolar proton ATPase a3 [Prunus mume]
Length=814

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/423 (80%), Positives = 391/423 (92%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IV+AYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL LATLY + RE+KLSSQKLG
Sbjct  394   IVEAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLATLYLIGRERKLSSQKLG  453

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVILLMA+FSIYTG IYNEFFSVPFELFG SAYAC D SCRDATT GLIK
Sbjct  454   DIMEMAFGGRYVILLMAIFSIYTGLIYNEFFSVPFELFGSSAYACRDLSCRDATTAGLIK  513

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFG+DPVWHG+RSELPFLNSLKMKMSILLGV QMNLGI++S+FN RFF++ +N+W
Sbjct  514   VRPTYPFGLDPVWHGSRSELPFLNSLKMKMSILLGVVQMNLGIIISFFNARFFRSGVNVW  573

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL+VLI++KW+TGS+ADLYHVMIYMFLSPTD+L ENQ+F+GQ+ +
Sbjct  574   FQFIPQIIFLNSLFGYLSVLIVMKWWTGSKADLYHVMIYMFLSPTDELGENQLFSGQRTV  633

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA V+VPWMLFPKPF+LKKQH++RH+GQSYA L N +++++  +++  HGHG  
Sbjct  634   QLVLLLLAFVSVPWMLFPKPFILKKQHQDRHQGQSYALLENTEESLQVNSNHDAHGHG--  691

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GFNN+
Sbjct  692   EFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNV  751

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFICATVGVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  752   IILIVGIIVFICATVGVLLLMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALLDD  811

Query  327   QDE  319
             +DE
Sbjct  812   EDE  814



>ref|XP_010028630.1| PREDICTED: V-type proton ATPase subunit a2 [Eucalyptus grandis]
 gb|KCW55394.1| hypothetical protein EUGRSUZ_I01306 [Eucalyptus grandis]
Length=824

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/423 (82%), Positives = 381/423 (90%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQE NPGVFTIVTFPFLFAVMFGDWGHGICL LATL ++F+EKKLS QKLG
Sbjct  402   IVDAYGVARYQEVNPGVFTIVTFPFLFAVMFGDWGHGICLLLATLVYIFKEKKLSGQKLG  461

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVIL+MALFSIYTG IYNEFFSVPFELFG SAYAC D SCRDATT GLIK
Sbjct  462   DITEMTFGGRYVILMMALFSIYTGLIYNEFFSVPFELFGLSAYACRDLSCRDATTVGLIK  521

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR+TYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LS+FN +FF N +NIW
Sbjct  522   VRETYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSFFNAKFFGNCVNIW  581

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL++LII+KW TGS+ADLYH+MIYMFLSPTD+L EN +F GQK +
Sbjct  582   FQFIPQLIFLNSLFGYLSLLIIVKWCTGSKADLYHIMIYMFLSPTDELGENALFPGQKMV  641

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLALV+VPWML PKPFLLKKQHEERHRG SY PL   D++ + +T NH     HE
Sbjct  642   QIVLLLLALVSVPWMLLPKPFLLKKQHEERHRGNSYMPLETTDNSFQLDT-NHDAHGDHE  700

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNN+
Sbjct  701   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNV  760

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GII+FI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA    
Sbjct  761   IILIVGIIIFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALAGD  820

Query  327   QDE  319
             +D+
Sbjct  821   EDD  823



>ref|XP_004165227.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar proton ATPase a2-like 
[Cucumis sativus]
Length=541

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/423 (82%), Positives = 382/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANPGV+TIVTFPFLFAVMFGDWGHGICL LATLYF+ RE KLSSQKLG
Sbjct  121   IVDAYGVARYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLYFILREXKLSSQKLG  180

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EMAF GRYVIL+M+LFSIYTG IYNEFFSVPF LFGRSAYAC  P C D+TT GL+K
Sbjct  181   DITEMAFGGRYVILMMSLFSIYTGLIYNEFFSVPFGLFGRSAYACRSPDCSDSTTVGLLK  240

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             V  TYPFG+DPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++SYFN  FF+N INIW
Sbjct  241   VGSTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIISYFNATFFRNSINIW  300

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGS ADLYHVMIYMFL PT+DL ENQ+F GQK +
Sbjct  301   FQFLPQMIFLNSLFGYLSLLIIIKWCTGSNADLYHVMIYMFLGPTEDLAENQLFPGQKNV  360

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLALVAVPWML PKPFLLK+QHE+R +GQSYAPL + DD++  E D+H   HGHE
Sbjct  361   QIVLLLLALVAVPWMLLPKPFLLKRQHEQRFQGQSYAPLPSGDDSL--ELDSHHDSHGHE  418

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVL+L+ GFNNI
Sbjct  419   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLVLSAGFNNI  478

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  479   IILIVGIIVFIFATVGVLLLMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFALLDE  538

Query  327   QDE  319
              D+
Sbjct  539   DDD  541



>ref|XP_007042075.1| Vacuolar proton ATPase A3 isoform 2 [Theobroma cacao]
 gb|EOX97906.1| Vacuolar proton ATPase A3 isoform 2 [Theobroma cacao]
Length=820

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/423 (82%), Positives = 386/423 (91%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL LATL+F+ REKKLSSQKLG
Sbjct  399   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLATLFFIVREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++MALFSIYTG IYNEFFSVPFELFGRSAYAC D +CRDA+T GLIK
Sbjct  459   DITEMTFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGRSAYACRDLTCRDASTVGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR+TYPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  FF + +N+W
Sbjct  519   VRETYPFGVDPAWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNATFFGSSLNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQK +
Sbjct  579   FQFIPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDELGENQLFPGQKTV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML P+PFLLKKQH E H+GQSY PL + DD + SE +N  HGHGHE
Sbjct  639   QLVLLLLALVSVPWMLLPRPFLLKKQH-ENHQGQSYTPLESTDDTLHSEANNDSHGHGHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS VFY+KVLLLA GFNNI
Sbjct  698   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSVVFYEKVLLLAWGFNNI  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GII+FI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  758   IILIVGIIIFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALLGD  817

Query  327   QDE  319
             +D+
Sbjct  818   EDD  820



>gb|EYU37836.1| hypothetical protein MIMGU_mgv1a001455mg [Erythranthe guttata]
Length=816

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/423 (81%), Positives = 382/423 (90%), Gaps = 3/423 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LAT YF+ REKKLSSQKLG
Sbjct  397   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATSYFIIREKKLSSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI+LMALFSIYTG IYNEFFSVPFELF RSAY C DP CRD+TT GLI 
Sbjct  457   DIMEMTFGGRYVIMLMALFSIYTGLIYNEFFSVPFELFARSAYVCRDPECRDSTTIGLIM  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLS+FN +FFKN IN W
Sbjct  517   ARDTYPFGVDPAWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSFFNAQFFKNRINTW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDDL ENQ+F+GQK  
Sbjct  577   FQFIPQIIFLNSLFGYLSILIIIKWCTGSKADLYHVMIYMFLSPTDDLGENQLFSGQKMT  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA V+VPWML PKPFLLK QH  RH+G +YAPL +++++++S  ++    HGHE
Sbjct  637   QLVLLLLAFVSVPWMLLPKPFLLKMQH-NRHQGGAYAPLQDSEESLQSGANH--DSHGHE  693

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVL LA G+NN+
Sbjct  694   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLQLAWGYNNV  753

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GII+FICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF+ I  
Sbjct  754   IILIVGIIIFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFSLIDI  813

Query  327   QDE  319
             ++E
Sbjct  814   EEE  816



>ref|XP_008448072.1| PREDICTED: vacuolar proton ATPase a3 [Cucumis melo]
Length=818

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/423 (83%), Positives = 383/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANPGV+TIVTFPFLFAVMFGDWGHGICLFLATLYF+ REKKLSSQKLG
Sbjct  398   IVDAYGVARYQEANPGVYTIVTFPFLFAVMFGDWGHGICLFLATLYFILREKKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EMAF GRYVIL+M+LFSIYTG IYNEFFSVPF LFGRSAY C  P C D+TT GLIK
Sbjct  458   DITEMAFGGRYVILMMSLFSIYTGLIYNEFFSVPFGLFGRSAYECRSPDCSDSTTMGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             V  TYPFG+DPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++SYFN  FF+N INIW
Sbjct  518   VGSTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIISYFNATFFRNSINIW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGS ADLYHVMIYMFL PTDDL ENQ+F GQK +
Sbjct  578   FQFLPQMIFLNSLFGYLSLLIIIKWCTGSNADLYHVMIYMFLGPTDDLAENQLFPGQKNV  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLALVAVPWML PKPFLLK+QHE+R +GQSYAPL + DD++  E D+H   HGHE
Sbjct  638   QIVLLLLALVAVPWMLLPKPFLLKRQHEQRFQGQSYAPLPSGDDSL--ELDSHHDSHGHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVL+L+ GFNNI
Sbjct  696   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLVLSAGFNNI  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  756   IILIVGIIVFIFATVGVLLLMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFALLDE  815

Query  327   QDE  319
              D+
Sbjct  816   DDD  818



>ref|XP_010934090.1| PREDICTED: V-type proton ATPase subunit a3-like [Elaeis guineensis]
Length=819

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/423 (81%), Positives = 386/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL L T+YF+FREKKLSSQKLG
Sbjct  399   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLVTMYFIFREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++M LFSIY G IYNEFFSVPFELFG+SAYAC DPSC +ATT GLIK
Sbjct  459   DITEMTFGGRYVIMMMGLFSIYAGLIYNEFFSVPFELFGKSAYACRDPSCSNATTVGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP W+G+RSELPFLNSLKMKMSILLGVAQMNLGIVLSYFN +FFKN++NIW
Sbjct  519   VRSTYPFGVDPKWYGSRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNAKFFKNNLNIW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  579   YQFVPQLIFLNSLFGYLSLLIIVKWCTGSKADLYHVMIYMFLSPTDDLGENQLFPGQKTL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LAL++VPWMLFPKP LLKKQH+ERH+GQSY  L + ++++E E D+    HGHE
Sbjct  639   QLVLLFLALISVPWMLFPKPILLKKQHQERHQGQSYTLLQSTEESLELEQDH--SSHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA GFNNI
Sbjct  697   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGFNNI  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+G IVF+ ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFA +  
Sbjct  757   IILIVGFIVFVFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLGE  816

Query  327   QDE  319
              ++
Sbjct  817   VED  819



>ref|XP_006404588.1| hypothetical protein EUTSA_v10000048mg [Eutrema salsugineum]
 dbj|BAJ33782.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46041.1| hypothetical protein EUTSA_v10000048mg [Eutrema salsugineum]
Length=617

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/423 (79%), Positives = 376/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  197   IVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  256

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  257   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYECRDASCSEATTIGLIK  316

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN +FFK+ +N+W
Sbjct  317   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVW  376

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  377   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIV  436

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET+     HGHE
Sbjct  437   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGQSYAQLDETDESLQVETNG--GSHGHE  494

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNNI
Sbjct  495   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNI  554

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILI+GI+VFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF+PF+F  + +
Sbjct  555   FILIVGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFVLVGN  614

Query  327   QDE  319
             +DE
Sbjct  615   EDE  617



>ref|XP_006411705.1| hypothetical protein EUTSA_v10024425mg [Eutrema salsugineum]
 gb|ESQ53158.1| hypothetical protein EUTSA_v10024425mg [Eutrema salsugineum]
Length=819

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/423 (81%), Positives = 381/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  399   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI++M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  459   DIMEMAFGGRYVIMMMSLFSIYTGLIYNEFFSIPYPLFATSAYDCRDASCSEATTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHGTRSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFFK+ +NIW
Sbjct  519   VRDTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  579   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+ L+ LALV+VP ML PKPF+LKKQHE RH+GQSYAPL   D+++  ET      HGHE
Sbjct  639   QLALLFLALVSVPCMLLPKPFILKKQHEARHQGQSYAPLDETDESLHVETSG--GSHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN+
Sbjct  697   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNV  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PF+F   A+
Sbjct  757   LILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFILAAN  816

Query  327   QDE  319
             +DE
Sbjct  817   EDE  819



>ref|XP_006286207.1| hypothetical protein CARUB_v10007773mg [Capsella rubella]
 gb|EOA19105.1| hypothetical protein CARUB_v10007773mg [Capsella rubella]
Length=819

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/423 (80%), Positives = 383/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGIC+ LAT+Y + REKKLSSQKLG
Sbjct  399   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICILLATMYLILREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVIL+M++FSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  459   DIMEMAFGGRYVILMMSIFSIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHGTRSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFFK+ +NIW
Sbjct  519   VRDTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  579   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKIV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALV+VP ML PKPF+LKKQHE RH+GQSYAPL   D+++  ET+     HGHE
Sbjct  639   QLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQSYAPLDETDESLHVETNG--GSHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN+
Sbjct  697   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNV  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PF+F   A+
Sbjct  757   LILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFIFTAN  816

Query  327   QDE  319
             +DE
Sbjct  817   EDE  819



>emb|CDY12118.1| BnaC03g60340D [Brassica napus]
Length=820

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/423 (80%), Positives = 380/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKL+SQKLG
Sbjct  400   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATMYLIVREKKLASQKLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI++M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  460   DIMEMAFGGRYVIMMMSLFSIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHGTRSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFFK+ +N+W
Sbjct  520   VRDTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNVW  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  580   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTV  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALV+VP ML PKPF+LKKQHE RH+GQSYAPL   D+++  ET      HGHE
Sbjct  640   QLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQSYAPLEETDESLHVETSG--GSHGHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN 
Sbjct  698   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNW  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVF+ ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSF   A 
Sbjct  758   LILIVGIIVFVFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFILTAS  817

Query  327   QDE  319
             +DE
Sbjct  818   EDE  820



>ref|XP_010431861.1| PREDICTED: V-type proton ATPase subunit a3-like [Camelina sativa]
Length=822

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/423 (80%), Positives = 382/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGIC+ LAT+Y + REKKLSSQKLG
Sbjct  402   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICILLATMYLILREKKLSSQKLG  461

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVIL+M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  462   DIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIK  521

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHGTRSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFFK+ +NIW
Sbjct  522   VRDTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIW  581

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  582   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTV  641

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALV+VP ML PKPF+LKKQHE RH+GQSYAPL   D+++  ET      HGHE
Sbjct  642   QLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQSYAPLDETDESLHVETTG--GSHGHE  699

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN+
Sbjct  700   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNV  759

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GI+VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PF+F   A+
Sbjct  760   LILILGIMVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFIFTAN  819

Query  327   QDE  319
             +DE
Sbjct  820   EDE  822



>ref|XP_004148529.1| PREDICTED: vacuolar proton ATPase a3-like [Cucumis sativus]
 gb|KGN43160.1| hypothetical protein Csa_7G004130 [Cucumis sativus]
Length=818

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/423 (82%), Positives = 383/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANPGV+TIVTFPFLFAVMFGDWGHGICL LATLYF+ REKKLSSQKLG
Sbjct  398   IVDAYGVARYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLYFILREKKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EMAF GRYVIL+M+LFSIYTG IYNEFFSVPF LFGRSAYAC  P C D+TT GL+K
Sbjct  458   DITEMAFGGRYVILMMSLFSIYTGLIYNEFFSVPFGLFGRSAYACRSPDCSDSTTVGLLK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             V  TYPFG+DPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++SYFN  FF+N INIW
Sbjct  518   VGSTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIISYFNATFFRNSINIW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGS ADLYHVMIYMFL PT+DL ENQ+F GQK +
Sbjct  578   FQFLPQMIFLNSLFGYLSLLIIIKWCTGSNADLYHVMIYMFLGPTEDLAENQLFPGQKNV  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLALVAVPWML PKPFLLK+QHE+R +GQSYAPL + DD++  E D+H   HGHE
Sbjct  638   QIVLLLLALVAVPWMLLPKPFLLKRQHEQRFQGQSYAPLPSGDDSL--ELDSHHDSHGHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVL+L+ GFNNI
Sbjct  696   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLVLSAGFNNI  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  756   IILIVGIIVFIFATVGVLLLMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFALLDE  815

Query  327   QDE  319
              D+
Sbjct  816   DDD  818



>ref|XP_009373024.1| PREDICTED: vacuolar proton ATPase a3-like [Pyrus x bretschneideri]
Length=814

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/423 (80%), Positives = 387/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL LA LY + REKKLSSQKLG
Sbjct  394   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLAALYLIGREKKLSSQKLG  453

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVILLMA+FSIYTGFIYNEFFSVPFELFG SAYAC D SCRDATT GLIK
Sbjct  454   DIMEMAFGGRYVILLMAIFSIYTGFIYNEFFSVPFELFGPSAYACRDLSCRDATTAGLIK  513

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFG+DPVWHG+RSELPFLNSLKMKMSI++GV QMNLGI++SYFN RFF++++N+W
Sbjct  514   VRPTYPFGLDPVWHGSRSELPFLNSLKMKMSIIIGVVQMNLGIMISYFNARFFRSNLNVW  573

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLN LFGYL+VLI++KW+TGS+ADLYHVMIYMFLSPTD+L ENQ+F GQK +
Sbjct  574   FQFIPQMIFLNGLFGYLSVLIVMKWWTGSKADLYHVMIYMFLSPTDELGENQLFNGQKTV  633

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA VAVPWMLFPKPFLLKKQH++RH+GQSYA L N +++++  +++    HGHE
Sbjct  634   QLVLLLLAFVAVPWMLFPKPFLLKKQHQDRHQGQSYALLENTEESLQVNSNH--DAHGHE  691

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLL A GFNN 
Sbjct  692   EFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLTAWGFNNW  751

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+G+IVF+CATVGVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF P+SFA +  
Sbjct  752   IILIVGLIVFVCATVGVLLLMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPYSFALLDD  811

Query  327   QDE  319
              DE
Sbjct  812   DDE  814



>ref|XP_004984994.1| PREDICTED: vacuolar proton ATPase a3-like [Setaria italica]
Length=822

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/424 (79%), Positives = 383/424 (90%), Gaps = 1/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL L TL+ + REKKL+SQKLG
Sbjct  399   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLGTLFLIIREKKLASQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++M++FSIYTG IYNEFFSVPFELFG+SAYAC DPSCRD+TT GLIK
Sbjct  459   DITEMMFGGRYVIMMMSIFSIYTGLIYNEFFSVPFELFGKSAYACRDPSCRDSTTEGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGIV+SYFN +FF+N IN+W
Sbjct  519   VRGTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIVMSYFNAKFFRNSINVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTD+L ENQ+F+GQK +
Sbjct  579   YQFIPQLIFLNSLFGYLSLLIIIKWCTGSKADLYHVMIYMFLSPTDELGENQLFSGQKTV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESE-TDNhghghgH  691
             Q++L+LLALV+VPWML PKP LLKKQHE RH+G  YA L   D++V +E  ++H   H H
Sbjct  639   QLVLLLLALVSVPWMLIPKPVLLKKQHERRHQGHQYAMLQGTDESVGAELGEHHDESHDH  698

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFYDKVL+L    NN
Sbjct  699   EEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYDKVLMLTWRMNN  758

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             +V LI+G+I+FI AT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSFA I 
Sbjct  759   VVALILGVIIFIFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALIR  818

Query  330   HQDE  319
              +++
Sbjct  819   EEED  822



>ref|XP_009373002.1| PREDICTED: vacuolar proton ATPase a3 [Pyrus x bretschneideri]
 ref|XP_009351217.1| PREDICTED: vacuolar proton ATPase a3-like [Pyrus x bretschneideri]
Length=814

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/423 (80%), Positives = 387/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL LA LY + REKKLSSQKLG
Sbjct  394   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLAALYLIGREKKLSSQKLG  453

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVILLMA+FSIYTGFIYNEFFSVPFELFG SAYAC D SCRDATT GLIK
Sbjct  454   DIMEMAFGGRYVILLMAIFSIYTGFIYNEFFSVPFELFGPSAYACRDLSCRDATTAGLIK  513

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFG+DPVWHG+RSELPFLNSLKMKMSI++GV QMNLGI++SYFN RFF++++N+W
Sbjct  514   VRPTYPFGLDPVWHGSRSELPFLNSLKMKMSIIIGVVQMNLGIMISYFNARFFRSNLNVW  573

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLN LFGYL+VLI++KW+TGS+ADLYHVMIYMFLSPTD+L ENQ+F GQK +
Sbjct  574   FQFIPQMIFLNGLFGYLSVLIVMKWWTGSKADLYHVMIYMFLSPTDELGENQLFNGQKTV  633

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA VAVPWMLFPKPFLLKKQH++RH+GQSYA L N +++++  +++    HGHE
Sbjct  634   QLVLLLLAFVAVPWMLFPKPFLLKKQHQDRHQGQSYALLENTEESLQVNSNH--DAHGHE  691

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLL A GFNN 
Sbjct  692   EFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLTAWGFNNW  751

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+G+IVF+CATVGVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF P+SFA +  
Sbjct  752   IILIVGLIVFVCATVGVLLLMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPYSFALLDD  811

Query  327   QDE  319
              DE
Sbjct  812   DDE  814



>ref|XP_010437006.1| PREDICTED: V-type proton ATPase subunit a3-like [Camelina sativa]
Length=821

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/423 (80%), Positives = 382/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGIC+ LAT+Y + REKKLSSQKLG
Sbjct  401   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICILLATMYLILREKKLSSQKLG  460

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVIL+M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  461   DIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIK  520

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHGTRSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFFK+ +NIW
Sbjct  521   VRDTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIW  580

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  581   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTV  640

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALV+VP ML PKPF+LKKQHE RH+GQSYAPL   D+++  ET      HGHE
Sbjct  641   QLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQSYAPLDETDESLHVETTG--GSHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN+
Sbjct  699   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNV  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GI+VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PF+F   A+
Sbjct  759   LILILGIMVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFIFTAN  818

Query  327   QDE  319
             +DE
Sbjct  819   EDE  821



>ref|XP_010446444.1| PREDICTED: V-type proton ATPase subunit a3 [Camelina sativa]
Length=822

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/423 (80%), Positives = 381/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGIC+ LAT+Y + REKKL+SQKLG
Sbjct  402   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICILLATMYLILREKKLASQKLG  461

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVIL+M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  462   DIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIK  521

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHGTRSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFFK+ +NIW
Sbjct  522   VRDTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIW  581

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  582   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTV  641

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALV+VP ML PKPF+LKKQHE RH+GQSYAPL   D+++  ET      HGHE
Sbjct  642   QLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQSYAPLDETDESLHVETTG--GSHGHE  699

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN+
Sbjct  700   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNV  759

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILIIGI+VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PF+F   A+
Sbjct  760   FILIIGILVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFIFTAN  819

Query  327   QDE  319
             +DE
Sbjct  820   EDE  822



>emb|CDY42603.1| BnaC01g00150D [Brassica napus]
Length=818

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/423 (81%), Positives = 381/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  398   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATMYLIVREKKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI++M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  458   DIMEMAFGGRYVIMMMSLFSIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHGTRSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFFK+ +NIW
Sbjct  518   VRDTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  578   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTV  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALV+VP ML PKPF+LKKQHE RH+GQSYAPL   D+++  E +     HGHE
Sbjct  638   QLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQSYAPLEETDESLHVEANG--GSHGHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN 
Sbjct  696   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNW  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSF   A+
Sbjct  756   LILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFILTAN  815

Query  327   QDE  319
             +DE
Sbjct  816   EDE  818



>ref|XP_009109504.1| PREDICTED: vacuolar proton ATPase a3 [Brassica rapa]
 emb|CDX90307.1| BnaA08g16770D [Brassica napus]
Length=819

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/423 (81%), Positives = 381/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKL+SQKLG
Sbjct  399   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATMYLIVREKKLASQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI++M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  459   DIMEMAFGGRYVIMMMSLFSIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHGTRSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFFK+ +NIW
Sbjct  519   VRDTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  579   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALV+VP ML PKPF+LKKQHE RH+GQSYAPL   D+++  ET     GHGHE
Sbjct  639   QLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQSYAPLEETDESLHVETSG--GGHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN 
Sbjct  697   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNW  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVF+ ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSF   A 
Sbjct  757   LILIVGIIVFVFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFILTAS  816

Query  327   QDE  319
             +DE
Sbjct  817   EDE  819



>emb|CDY41958.1| BnaA01g05300D [Brassica napus]
Length=817

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/423 (80%), Positives = 379/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  397   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATMYLIVREKKLSSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI++M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  457   DIMEMAFGGRYVIMMMSLFSIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHGTRSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFFK+ +NIW
Sbjct  517   VRDTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  577   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTV  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALV+VP ML PKPF+LKKQHE RH+GQSYAPL   D+++  E       HGHE
Sbjct  637   QLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQSYAPLEETDESLHVEASG--GSHGHE  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN 
Sbjct  695   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNW  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVF+ ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSF   A 
Sbjct  755   LILIVGIIVFVFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFILTAS  814

Query  327   QDE  319
             +DE
Sbjct  815   EDE  817



>dbj|BAF02018.1| hypothetical protein [Arabidopsis thaliana]
Length=537

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/423 (80%), Positives = 382/423 (90%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGIC+ LAT+Y + +EKKL+SQKLG
Sbjct  116   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICILLATMYLILKEKKLASQKLG  175

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVIL+M+LFSIYTG IYNEFFS+PF LF  SAY C D SC +ATT GLIK
Sbjct  176   DIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSIPFPLFAPSAYDCRDVSCSEATTIGLIK  235

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHG+RSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFFK+ +NIW
Sbjct  236   VRDTYPFGLDPVWHGSRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIW  295

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSP D+L ENQ+F  QK L
Sbjct  296   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDELGENQLFPHQKTL  355

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALV+VP ML PKPF+LKKQHE RH+GQ+YAPL   D+++  ET N G  HGHE
Sbjct  356   QLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQAYAPLDETDESLHVET-NGGGSHGHE  414

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASY+RLWALSLAHSELSSVFY+KVLLLA G+NN 
Sbjct  415   EFEFSEIFVHQLIHTIEFVLGAVSNTASYMRLWALSLAHSELSSVFYEKVLLLAWGYNNP  474

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+G++VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PF+F   A+
Sbjct  475   LILIVGVLVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFIFTAN  534

Query  327   QDE  319
             +DE
Sbjct  535   EDE  537



>ref|XP_011047706.1| PREDICTED: V-type proton ATPase subunit a3 [Populus euphratica]
Length=821

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/423 (81%), Positives = 382/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANPGV+TIVTFPFLFAVMFGDWGHGIC+ LATL F+ REKKLS QKLG
Sbjct  401   IVDAYGVARYQEANPGVYTIVTFPFLFAVMFGDWGHGICMLLATLVFIIREKKLSGQKLG  460

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVIL+MALFSIYTG IYNEFFSVPFELF  SAYAC D SCRDATT GLIK
Sbjct  461   DITEMTFGGRYVILMMALFSIYTGLIYNEFFSVPFELFAPSAYACRDLSCRDATTEGLIK  520

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  +FKN +NIW
Sbjct  521   VRPTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNATYFKNSLNIW  580

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  581   FQFIPQMIFLNSLFGYLSLLIIVKWSTGSQADLYHVMIYMFLSPTDELGENQLFPRQKNV  640

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPFLLKKQHE RH+G+SY PL + +++++ ET++    HGHE
Sbjct  641   QLVLLLLALVSVPWMLLPKPFLLKKQHEARHQGESYTPLQSTEESLQLETNH--DSHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G++NI
Sbjct  699   EFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYHNI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              IL+IG IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  759   FILVIGAIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALVND  818

Query  327   QDE  319
             +DE
Sbjct  819   EDE  821



>ref|XP_002307693.1| hypothetical protein POPTR_0005s25550g [Populus trichocarpa]
 gb|EEE94689.1| hypothetical protein POPTR_0005s25550g [Populus trichocarpa]
Length=817

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/423 (80%), Positives = 374/423 (88%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL LATLY + REKKLSSQKLG
Sbjct  397   IVDAYGVAKYQEANPSVYTIVTFPFLFAVMFGDWGHGICLLLATLYLIIREKKLSSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAFSGRYVI++M +FSIYTG IYNEFFSVPFELFG SAY C D SCRDA T GL+K
Sbjct  457   DIMEMAFSGRYVIMMMGIFSIYTGLIYNEFFSVPFELFGPSAYGCRDQSCRDAYTAGLVK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             V  TYPFG+DP WHG+RSELPFLNS+KMKMSIL GVAQMNLGI++SYFN +FF ++INIW
Sbjct  517   VHATYPFGLDPKWHGSRSELPFLNSMKMKMSILFGVAQMNLGIIMSYFNAKFFGDNINIW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL++NQ+F GQK+ 
Sbjct  577   YQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLDDNQLFIGQKFF  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L AL AVPWM+FPKPFLLKK+HEER +GQSYA L + D   E E  +    H HE
Sbjct  637   QILLLLSALAAVPWMMFPKPFLLKKRHEERFQGQSYARLDSNDYPPEIEPHS--VSHNHE  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G+N+I
Sbjct  695   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGYNSI  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +   IG+ VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  755   IARGIGLCVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYVGDGYKFYPFSFASLGQ  814

Query  327   QDE  319
              DE
Sbjct  815   DDE  817



>ref|XP_011045160.1| PREDICTED: V-type proton ATPase subunit a2-like [Populus euphratica]
Length=817

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/423 (80%), Positives = 373/423 (88%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL LATLY + REKKLSSQKLG
Sbjct  397   IVDAYGVAKYQEANPSVYTIVTFPFLFAVMFGDWGHGICLLLATLYLIIREKKLSSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI++M +FSIYTG IYNEFFSVPFELFG SAY C D SCRDA T GL+K
Sbjct  457   DIMEMAFGGRYVIMMMGIFSIYTGLIYNEFFSVPFELFGPSAYGCRDQSCRDAYTAGLVK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             V  TYPFG+DP WHGTRSELPFLNS+KMKMSIL GVAQMNLGI++SYFN +FF ++INIW
Sbjct  517   VHATYPFGLDPKWHGTRSELPFLNSMKMKMSILFGVAQMNLGIIMSYFNAKFFGDNINIW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL++NQ+F GQK+ 
Sbjct  577   YQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLDDNQLFIGQKFF  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L AL AVPWM+FPKPFLLKK+HEER +GQSYA L + D   E E  +    H HE
Sbjct  637   QILLLLSALAAVPWMMFPKPFLLKKRHEERFQGQSYARLDSNDYPPEIEPHS--VSHNHE  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G+N+I
Sbjct  695   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGYNSI  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +   IG+ VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  755   IARGIGLCVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYVGDGYKFYPFSFASLGQ  814

Query  327   QDE  319
              DE
Sbjct  815   DDE  817



>ref|XP_002313024.2| vacuolar proton ATPase family protein [Populus trichocarpa]
 gb|EEE86979.2| vacuolar proton ATPase family protein [Populus trichocarpa]
Length=821

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/423 (81%), Positives = 382/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGIC+ LATL F+ REKKLS QKLG
Sbjct  401   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICMLLATLVFIIREKKLSGQKLG  460

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVIL+MALFSIYTG IYNEFFSVPFELF  SAYAC D SCRDATT GLIK
Sbjct  461   DITEMTFGGRYVILMMALFSIYTGLIYNEFFSVPFELFAPSAYACRDLSCRDATTDGLIK  520

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  +FKN +NIW
Sbjct  521   VRPTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNATYFKNSLNIW  580

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L EN++F  QK +
Sbjct  581   FQFIPQMIFLNSLFGYLSLLIIVKWSTGSQADLYHVMIYMFLSPTDELGENELFPRQKTV  640

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPFLLKKQHE RH+G+SY PL + +++++ ET++    HGHE
Sbjct  641   QLVLLLLALVSVPWMLLPKPFLLKKQHEARHQGESYTPLQSTEESLQLETNH--DSHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G++NI
Sbjct  699   EFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYHNI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              IL+IG IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  759   FILVIGAIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALVND  818

Query  327   QDE  319
             +DE
Sbjct  819   EDE  821



>ref|XP_006661663.1| PREDICTED: vacuolar proton ATPase a3-like [Oryza brachyantha]
Length=808

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/423 (78%), Positives = 382/423 (90%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LATLY + REKKL+SQKL 
Sbjct  386   IVDAYGIAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYLIIREKKLASQKLD  445

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIM+M F GRYVIL+M+LFSIYTG IYNEFFSVPFELFG+SAYAC DPSC DATT GLIK
Sbjct  446   DIMDMMFGGRYVILMMSLFSIYTGLIYNEFFSVPFELFGKSAYACRDPSCGDATTEGLIK  505

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR  YPFGVDPVWHG+RSELPFLNSLKMK+SILLGVAQMNLGI++SYFN +FF+N +N+W
Sbjct  506   VRPAYPFGVDPVWHGSRSELPFLNSLKMKLSILLGVAQMNLGILMSYFNAKFFRNALNVW  565

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDDL EN++F GQK +
Sbjct  566   YQFIPQLIFLNSLFGYLSLLIIIKWCTGSKADLYHVMIYMFLSPTDDLGENELFPGQKLV  625

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKP  LK+QHE+RH+GQ Y  L   D++V    +NH   H HE
Sbjct  626   QLVLLLLALVSVPWMLIPKPLFLKRQHEQRHQGQQYTMLQATDESVTELEENHEDSHHHE  685

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVL+L+ G+NNI
Sbjct  686   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLVLSWGYNNI  745

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILIIG ++F+ AT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PF+FASI  
Sbjct  746   FILIIGAVIFLFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFAFASIIE  805

Query  327   QDE  319
             +++
Sbjct  806   EED  808



>ref|XP_006362018.1| PREDICTED: vacuolar proton ATPase a3-like [Solanum tuberosum]
Length=820

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/426 (80%), Positives = 383/426 (90%), Gaps = 7/426 (2%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LAT++F+F EKK SSQKLG
Sbjct  400   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATMFFLFNEKKFSSQKLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI +M+LFSIYTG +YNEFFSVPFELFG+SAY C DPSCRD+TT GLIK
Sbjct  460   DIMEMTFGGRYVIFMMSLFSIYTGLVYNEFFSVPFELFGKSAYGCRDPSCRDSTTAGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDP WHG+RSELP+LNSLKMKMSIL+GVAQMNLGI+LS+FNG FF+N +NIW
Sbjct  520   VRDTYPFGVDPAWHGSRSELPYLNSLKMKMSILIGVAQMNLGIILSFFNGLFFRNGVNIW  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN+LFGYL+VLII+KW TGS+ADLYHVMIYMFLSPTD+L EN++F GQK  
Sbjct  580   CQFVPQMIFLNALFGYLSVLIIMKWCTGSKADLYHVMIYMFLSPTDELGENELFPGQKMT  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDA--VESETDNhghghg  694
             Q++L+L ALVAVPWMLFPKPFLLK QH ERH+GQSY  L  A+++  VES  D+  HG  
Sbjct  640   QLVLLLSALVAVPWMLFPKPFLLKAQH-ERHQGQSYTALQEAEESLLVESNDDSGHHG--  696

Query  693   HEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfn  514
               +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+N
Sbjct  697   --EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYN  754

Query  513   niviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASI  334
             NI+ILI+GIIVF+ ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSF  I
Sbjct  755   NIIILIVGIIVFVFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFKLI  814

Query  333   AHQDEE  316
                ++E
Sbjct  815   DVGEDE  820



>gb|AEH95770.1| vacuolar ATPase subunit A [Triticum aestivum]
Length=821

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/424 (78%), Positives = 382/424 (90%), Gaps = 1/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGIC+ LATLY + REKK +SQKLG
Sbjct  398   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICILLATLYLIIREKKFASQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRY+I++M++FSIYTG IYNEFFSVPFELF +SAYAC D SC D+TT GLIK
Sbjct  458   DIMEMMFGGRYIIMMMSIFSIYTGLIYNEFFSVPFELFAKSAYACRDSSCSDSTTEGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHG+RSELPFLNSLKMKMSILLGV+QMNLGI +SYFN +FF+N +N+W
Sbjct  518   VRDTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVSQMNLGIFMSYFNAKFFRNSVNVW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDD+ ENQ+F GQK L
Sbjct  578   YQFVPQLIFLNSLFGYLSMLIIIKWCTGSKADLYHVMIYMFLSPTDDMGENQLFPGQKTL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESE-TDNhghghgH  691
             Q +L+LLALV+VPWML PKPF LK +HE RH+G  YA L  AD++V +E  +++   + H
Sbjct  638   QQVLLLLALVSVPWMLIPKPFFLKWEHERRHQGHQYAMLEGADESVVAELGEHNEESNHH  697

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+FEF+E+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFYDKVLLL +G+NN
Sbjct  698   EEFEFNEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYDKVLLLTLGYNN  757

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             I IL IG++VFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSFA I+
Sbjct  758   IFILAIGVVVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALIS  817

Query  330   HQDE  319
               +E
Sbjct  818   EDEE  821



>ref|XP_006404587.1| hypothetical protein EUTSA_v10000048mg [Eutrema salsugineum]
 gb|ESQ46040.1| hypothetical protein EUTSA_v10000048mg [Eutrema salsugineum]
Length=819

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/423 (79%), Positives = 376/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  399   IVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  459   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYECRDASCSEATTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN +FFK+ +N+W
Sbjct  519   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  579   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET+     HGHE
Sbjct  639   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGQSYAQLDETDESLQVETNG--GSHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNNI
Sbjct  697   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNI  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILI+GI+VFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF+PF+F  + +
Sbjct  757   FILIVGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFVLVGN  816

Query  327   QDE  319
             +DE
Sbjct  817   EDE  819



>dbj|BAJ89139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=821

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/424 (78%), Positives = 383/424 (90%), Gaps = 1/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGIC+ LATLY + REKK +SQKLG
Sbjct  398   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICILLATLYLIIREKKFASQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRY+I++M++FSIYTG IYNEFFSVPFELF +SAYAC D SC D+TT GLIK
Sbjct  458   DIMEMMFGGRYIIMMMSIFSIYTGLIYNEFFSVPFELFAKSAYACRDSSCSDSTTEGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHG+RSELPFLNSLKMKMSILLGV+QMNLGI +SYFN +FF+N +N+W
Sbjct  518   VRDTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVSQMNLGIFMSYFNAKFFRNSVNVW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTD++ ENQ+F GQK +
Sbjct  578   YQFVPQLIFLNSLFGYLSMLIIIKWCTGSKADLYHVMIYMFLSPTDEMGENQLFPGQKTV  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESE-TDNhghghgH  691
             Q +L+LLALV+VPWML PKPF LK +HE RH+G  YA L  AD++V +E  D++   + H
Sbjct  638   QQVLLLLALVSVPWMLIPKPFFLKWEHERRHQGHQYAMLEGADESVIAELGDHNEEPNHH  697

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFYDKVL+L +G+NN
Sbjct  698   EEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYDKVLILTLGYNN  757

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             I+IL IG++VFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSFA I+
Sbjct  758   ILILAIGVVVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALIS  817

Query  330   HQDE  319
               +E
Sbjct  818   EDEE  821



>ref|XP_002866830.1| VHA-A3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43089.1| VHA-A3 [Arabidopsis lyrata subsp. lyrata]
Length=820

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/423 (80%), Positives = 379/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGIC+ LAT+Y + REKKLSSQKLG
Sbjct  400   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICILLATMYLILREKKLSSQKLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVIL+M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  460   DIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSIPYPLFAPSAYDCRDTSCSEATTIGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHG+RSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFFK+ +NIW
Sbjct  520   VRDTYPFGLDPVWHGSRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIW  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSP D+L ENQ+F  QK +
Sbjct  580   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDELGENQLFPHQKTV  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+LL+ LALV+VP ML PKPF+LKKQHE RH+GQ YAPL   D+++  ET      HGHE
Sbjct  640   QLLLLFLALVSVPCMLLPKPFILKKQHEARHQGQLYAPLDETDESLHVETSG--GSHGHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN+
Sbjct  698   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAFGYNNV  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I I+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PF+F   A+
Sbjct  758   LIWIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFVFTAN  817

Query  327   QDE  319
             +DE
Sbjct  818   EDE  820



>ref|XP_010431556.1| PREDICTED: V-type proton ATPase subunit a2-like [Camelina sativa]
Length=767

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/423 (80%), Positives = 378/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  347   IVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  406

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  407   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIK  466

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN +FFK+ +N+W
Sbjct  467   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVW  526

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  527   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKLV  586

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET+    GHGHE
Sbjct  587   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGQSYAQLDETDESLQVETNG--GGHGHE  644

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNNI
Sbjct  645   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNI  704

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILIIGI+VFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF+PF+F  +A+
Sbjct  705   FILIIGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFTLVAN  764

Query  327   QDE  319
             ++E
Sbjct  765   EEE  767



>ref|XP_010096180.1| Vacuolar proton translocating ATPase 100 kDa subunit [Morus notabilis]
 gb|EXB63575.1| Vacuolar proton translocating ATPase 100 kDa subunit [Morus notabilis]
Length=814

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/423 (79%), Positives = 380/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICLFLATLYF+ REKKLS +KLG
Sbjct  394   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLFLATLYFIVREKKLSVEKLG  453

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVIL+M++FSIYTG IYNEFFSVPFELFGRSAYAC D SCRDATT GL+K
Sbjct  454   DITEMTFGGRYVILMMSIFSIYTGLIYNEFFSVPFELFGRSAYACRDISCRDATTEGLVK  513

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFG+DPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN ++F N+INIW
Sbjct  514   VRSTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAKYFGNNINIW  573

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL+VLI++KW TGSQ DLYHVMIYMFL PTDDL ENQ+F GQK +
Sbjct  574   FQFLPQLIFLNSLFGYLSVLILVKWCTGSQVDLYHVMIYMFLGPTDDLGENQLFAGQKTV  633

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LAL++VPWML PKPFLLKKQ E  H+GQSY  +   +++++ E+++    H HE
Sbjct  634   QLVLLFLALISVPWMLLPKPFLLKKQCENMHQGQSYTLIEGTEESLQVESNH--DSHNHE  691

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F+FSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G+NN+
Sbjct  692   EFDFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGYNNV  751

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +IL++GIIVFI AT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA    
Sbjct  752   IILVVGIIVFIFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFAVTDD  811

Query  327   QDE  319
              D+
Sbjct  812   DDD  814



>gb|KDP41742.1| hypothetical protein JCGZ_26760 [Jatropha curcas]
Length=819

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/423 (81%), Positives = 382/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANPGV+T+VTFPFLFAVMFGDWGHGICL LATL F+ REKKLSSQKLG
Sbjct  399   IVDAYGVARYQEANPGVYTVVTFPFLFAVMFGDWGHGICLLLATLVFIIREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVIL+MALFSIYTG IYNEFFSVPFELFG SAYAC D SCRDATT GLIK
Sbjct  459   DITEMTFGGRYVILMMALFSIYTGLIYNEFFSVPFELFGHSAYACRDLSCRDATTVGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             V  TYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LS+FN  +F+N++NIW
Sbjct  519   VGPTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSFFNALYFRNNVNIW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL++LII+KW+TGSQADLYHVMIYMFLSPTD+L ENQ+F GQK  
Sbjct  579   FQFIPQVIFLNSLFGYLSLLIIVKWWTGSQADLYHVMIYMFLSPTDELGENQLFPGQKTA  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+ L+LLALV+VPWML PKPF+LKKQH++RH+GQSY  L   ++++  + D +   +GHE
Sbjct  639   QLALLLLALVSVPWMLLPKPFVLKKQHQDRHQGQSYTLLQTTEESL--QVDANHGSYGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNN+
Sbjct  697   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNV  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VILI+GIIVFI AT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFS A I  
Sbjct  757   VILIVGIIVFIFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFFPFSLALIND  816

Query  327   QDE  319
             +DE
Sbjct  817   EDE  819



>ref|XP_004230865.1| PREDICTED: V-type proton ATPase subunit a3 [Solanum lycopersicum]
Length=820

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/426 (80%), Positives = 382/426 (90%), Gaps = 7/426 (2%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LAT++F+F EKK SSQKLG
Sbjct  400   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATMFFLFNEKKFSSQKLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI +M+LFSIYTG +YNEFFSVPFELFG+SAY C DPSCRD+TT GLIK
Sbjct  460   DIMEMTFGGRYVIFMMSLFSIYTGLVYNEFFSVPFELFGKSAYGCRDPSCRDSTTAGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDP WHG+RSELP+LNSLKMKMSIL+GVAQMNLGI+LS+FN  FF+N +NIW
Sbjct  520   VRDTYPFGVDPAWHGSRSELPYLNSLKMKMSILIGVAQMNLGIILSFFNALFFRNGVNIW  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLN+LFGYL+VLII+KW TGS+ADLYHVMIYMFLSPTD+L ENQ+F GQK  
Sbjct  580   CQFIPQMIFLNALFGYLSVLIIVKWCTGSKADLYHVMIYMFLSPTDELGENQLFAGQKMT  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDA--VESETDNhghghg  694
             Q++L+L ALVAVPWMLFPKPFLLK QH ERH+GQSY  L  A+++  VES  D+  HG  
Sbjct  640   QLVLLLSALVAVPWMLFPKPFLLKAQH-ERHQGQSYTALQEAEESLLVESNDDSGHHG--  696

Query  693   HEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfn  514
               +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+N
Sbjct  697   --EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYN  754

Query  513   niviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASI  334
             NI+ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSF  I
Sbjct  755   NIIILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFKLI  814

Query  333   AHQDEE  316
                ++E
Sbjct  815   DLGEDE  820



>ref|XP_010472132.1| PREDICTED: V-type proton ATPase subunit a2 isoform X2 [Camelina 
sativa]
Length=756

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/423 (79%), Positives = 378/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  336   IVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  395

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  396   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIK  455

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN +FFK+ +N+W
Sbjct  456   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVW  515

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  516   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIV  575

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET+    GHGHE
Sbjct  576   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGQSYAQLDETDESLQVETNG--GGHGHE  633

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNNI
Sbjct  634   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNI  693

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILIIGI+VFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF+PF+F  + +
Sbjct  694   LILIIGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFTLVGN  753

Query  327   QDE  319
             ++E
Sbjct  754   EEE  756



>ref|XP_004291813.1| PREDICTED: vacuolar proton ATPase a3-like [Fragaria vesca subsp. 
vesca]
Length=812

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/424 (80%), Positives = 381/424 (90%), Gaps = 0/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LATLYF+  E+K S+QKLG
Sbjct  389   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIISERKFSNQKLG  448

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI+EM F GRYVI +MALFSIYTG IYNEFFSVPFELFG SAYAC DPSCRDATT GL K
Sbjct  449   DIIEMTFGGRYVIFMMALFSIYTGLIYNEFFSVPFELFGPSAYACRDPSCRDATTVGLTK  508

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DP WHG+RSELPFLNSLKMKMSILLGVAQMNLGIVLSY N +FF + +N+W
Sbjct  509   VRDTYPFGLDPKWHGSRSELPFLNSLKMKMSILLGVAQMNLGIVLSYVNAKFFADKLNVW  568

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSP DDL ENQ+F GQ +L
Sbjct  569   YQFVPQMIFLNSLFGYLSLLIIVKWCTGSKADLYHVMIYMFLSPFDDLGENQLFWGQGFL  628

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+LL+L ALVAVPWMLFPKP+ LKKQHEERH+GQSYA L + +D ++ + ++H     HE
Sbjct  629   QVLLLLSALVAVPWMLFPKPYFLKKQHEERHQGQSYALLLSGEDPLDDDQEDHHKSKDHE  688

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G++N+
Sbjct  689   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGYDNV  748

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILIIGIIVFI AT GVLLVMETLSAFLHALRLHWVEF NKFYEG GYKF PFSFA ++ 
Sbjct  749   IILIIGIIVFISATGGVLLVMETLSAFLHALRLHWVEFMNKFYEGSGYKFYPFSFALLSS  808

Query  327   QDEE  316
             +D++
Sbjct  809   EDDD  812



>gb|KHN22210.1| Vacuolar proton translocating ATPase 100 kDa subunit [Glycine 
soja]
Length=769

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/423 (80%), Positives = 383/423 (91%), Gaps = 4/423 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LA LY + REKK +SQKLG
Sbjct  350   IVDAYGIAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLAALYLIIREKKFASQKLG  409

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRY+I+LMALFSIYTG IYNEFFSVPFELFG SAY C D SCRDA+TTG IK
Sbjct  410   DIMEMAFGGRYIIMLMALFSIYTGLIYNEFFSVPFELFGPSAYGCRDSSCRDASTTGFIK  469

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHGTRSELPFLNSLKMKMSILLGV+QMNLGI++SYFN ++F+N+INIW
Sbjct  470   VRSTYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNAKYFENNINIW  529

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  530   YQFVPQIIFLNSLFGYLSLLIIIKWSTGSQADLYHVMIYMFLSPTDDLGENQLFVGQKLL  589

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWML PKPFLLKKQH+ERH+GQSY  L+  DD +ESE+ +      H+
Sbjct  590   QLVLLLLALVAVPWMLVPKPFLLKKQHQERHQGQSYDLLYGTDDPLESESQS----IPHD  645

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F+FSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G+N+ 
Sbjct  646   EFDFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGYNST  705

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             ++LI+GI VFICATVGVLL+ME+LSAFLHALRLHWVE+QNKFYEGDGYKF PFSF  +  
Sbjct  706   IVLIVGIFVFICATVGVLLLMESLSAFLHALRLHWVEYQNKFYEGDGYKFFPFSFTLLTD  765

Query  327   QDE  319
             +DE
Sbjct  766   EDE  768



>ref|NP_568051.1| vacuolar proton ATPase A3 [Arabidopsis thaliana]
 sp|Q8W4S4.1|VHAA3_ARATH RecName: Full=V-type proton ATPase subunit a3; Short=V-ATPase 
subunit a3; AltName: Full=V-type proton ATPase 95 kDa subunit 
a isoform 3; Short=V-ATPase 95 kDa isoform a3; AltName: Full=Vacuolar 
H(+)-ATPase subunit a isoform 3; AltName: Full=Vacuolar 
proton pump subunit a3; AltName: Full=Vacuolar proton 
translocating ATPase 95 kDa subunit a isoform 3 [Arabidopsis 
thaliana]
 gb|AAL31187.1| AT4g39080/F19H22_180 [Arabidopsis thaliana]
 gb|AAO11531.1| At4g39080/F19H22_180 [Arabidopsis thaliana]
 dbj|BAE99335.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE87015.1| vacuolar proton ATPase A3 [Arabidopsis thaliana]
Length=821

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/423 (80%), Positives = 382/423 (90%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGIC+ LAT+Y + +EKKL+SQKLG
Sbjct  400   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICILLATMYLILKEKKLASQKLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVIL+M+LFSIYTG IYNEFFS+PF LF  SAY C D SC +ATT GLIK
Sbjct  460   DIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSIPFPLFAPSAYDCRDVSCSEATTIGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHG+RSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFFK+ +NIW
Sbjct  520   VRDTYPFGLDPVWHGSRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIW  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSP D+L ENQ+F  QK L
Sbjct  580   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDELGENQLFPHQKTL  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALV+VP ML PKPF+LKKQHE RH+GQ+YAPL   D+++  ET N G  HGHE
Sbjct  640   QLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQAYAPLDETDESLHVET-NGGGSHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN 
Sbjct  699   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNP  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+G++VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PF+F   A+
Sbjct  759   LILIVGVLVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFIFTAN  818

Query  327   QDE  319
             +DE
Sbjct  819   EDE  821



>ref|XP_006293691.1| hypothetical protein CARUB_v10022648mg [Capsella rubella]
 gb|EOA26589.1| hypothetical protein CARUB_v10022648mg [Capsella rubella]
Length=748

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/423 (79%), Positives = 375/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  328   IVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  387

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  388   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIK  447

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN +FFK+ +N+W
Sbjct  448   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVW  507

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  508   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIV  567

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+G SYA L   D++++ ET+    GHGHE
Sbjct  568   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGLSYAQLDETDESLQVETNG--GGHGHE  625

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNNI
Sbjct  626   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNI  685

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              +LI+GI+VFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF PF+F  I +
Sbjct  686   ALLILGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFDPFNFTLIGN  745

Query  327   QDE  319
             ++E
Sbjct  746   EEE  748



>ref|XP_003527676.1| PREDICTED: vacuolar proton ATPase a3-like [Glycine max]
Length=815

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/423 (80%), Positives = 383/423 (91%), Gaps = 4/423 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LA LY + REKK +SQKLG
Sbjct  396   IVDAYGIAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLAALYLIIREKKFASQKLG  455

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRY+I+LMALFSIYTG IYNEFFSVPFELFG SAY C D SCRDA+TTG IK
Sbjct  456   DIMEMAFGGRYIIMLMALFSIYTGLIYNEFFSVPFELFGPSAYGCRDSSCRDASTTGFIK  515

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHGTRSELPFLNSLKMKMSILLGV+QMNLGI++SYFN ++F+N+INIW
Sbjct  516   VRSTYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNAKYFENNINIW  575

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  576   YQFVPQIIFLNSLFGYLSLLIIIKWSTGSQADLYHVMIYMFLSPTDDLGENQLFVGQKLL  635

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWML PKPFLLKKQH+ERH+GQSY  L+  DD +ESE+ +      H+
Sbjct  636   QLVLLLLALVAVPWMLVPKPFLLKKQHQERHQGQSYDLLYGTDDPLESESQS----IPHD  691

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F+FSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G+N+ 
Sbjct  692   EFDFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGYNST  751

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             ++LI+GI VFICATVGVLL+ME+LSAFLHALRLHWVE+QNKFYEGDGYKF PFSF  +  
Sbjct  752   IVLIVGIFVFICATVGVLLLMESLSAFLHALRLHWVEYQNKFYEGDGYKFFPFSFTLLTD  811

Query  327   QDE  319
             +DE
Sbjct  812   EDE  814



>emb|CDX82029.1| BnaC08g35720D [Brassica napus]
Length=821

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/423 (79%), Positives = 375/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  401   IVDAYGVAKYQEANPTVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  460

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  461   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFSPSAYECRDASCSEATTIGLIK  520

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+ N +FFK+ +N+W
Sbjct  521   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFCNAKFFKSAVNVW  580

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  581   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKTV  640

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET+     HGHE
Sbjct  641   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGQSYAQLDETDESLQVETNG--GSHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNNI
Sbjct  699   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILI+GI+VFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF+PF+F  + +
Sbjct  759   FILIVGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFTLVGN  818

Query  327   QDE  319
             +DE
Sbjct  819   EDE  821



>ref|XP_010664756.1| PREDICTED: V-type proton ATPase subunit a2-like isoform X1 [Vitis 
vinifera]
 emb|CBI19786.3| unnamed protein product [Vitis vinifera]
Length=808

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/422 (81%), Positives = 377/422 (89%), Gaps = 2/422 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQE NPGV+ I+TFPFLFAVMFGDWGHGICL LATLYF+ +EKK SSQKLG
Sbjct  388   IVDAYGVAKYQEVNPGVYVIITFPFLFAVMFGDWGHGICLLLATLYFIVKEKKFSSQKLG  447

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MALFSIYTG IYNEFFSVPFELFG SAY C DPSCR A+  GLI+
Sbjct  448   DIMEMTFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGPSAYECPDPSCRGASIVGLIR  507

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHG+RSELPFLNSLKMKMSILLGVAQMNLGI+L YFN  FF N++NIW
Sbjct  508   VRPTYPFGVDPKWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILGYFNATFFGNNLNIW  567

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW  GSQADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  568   YQFVPQMIFLNSLFGYLSLLIIVKWCMGSQADLYHVMIYMFLSPTDDLGENQLFVGQKML  627

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV++PWMLFPKPFLLKKQH+ERH+G+SY  LH+ DD+ E E  +   GH   
Sbjct  628   QLVLLLLALVSIPWMLFPKPFLLKKQHQERHQGRSYTLLHSIDDSPELERHHDSLGHV--  685

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNN+
Sbjct  686   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNV  745

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VIL IGIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  746   VILTIGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALLTD  805

Query  327   QD  322
             +D
Sbjct  806   ED  807



>ref|XP_006487336.1| PREDICTED: vacuolar proton ATPase a3-like [Citrus sinensis]
Length=823

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/423 (80%), Positives = 380/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKY+EANPGVFTIVTFPFLFAVMFGDWGHGICL L TL  + REKKL+SQKL 
Sbjct  403   IVDAYGVAKYREANPGVFTIVTFPFLFAVMFGDWGHGICLLLGTLVLIVREKKLASQKLD  462

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI +M F GRYVIL+MALFSIYTG IYNEFFSVPFE+F  SAYAC D SC +ATT GLIK
Sbjct  463   DITDMTFGGRYVILMMALFSIYTGLIYNEFFSVPFEIFSHSAYACRDLSCSEATTVGLIK  522

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  FF+  +NIW
Sbjct  523   VRDTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNATFFRIGVNIW  582

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL++LIILKW TGSQADLYHVMIYMFLSPTD+L +NQ+F GQK  
Sbjct  583   CQFIPQIIFLNSLFGYLSLLIILKWITGSQADLYHVMIYMFLSPTDELGDNQLFPGQKTA  642

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA V+VPWML PKPF+LK QH+ RH+GQSY PL + D++++ +T++    HGHE
Sbjct  643   QLVLLLLAFVSVPWMLLPKPFILKMQHQGRHQGQSYEPLQSTDESLQPDTNH--DSHGHE  700

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NNI
Sbjct  701   EFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNI  760

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFA +  
Sbjct  761   LILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLDD  820

Query  327   QDE  319
             +DE
Sbjct  821   EDE  823



>gb|AAL78104.1|AC093568_14 Putative proton pump [Oryza sativa]
Length=783

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/423 (78%), Positives = 380/423 (90%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGVFTIVTFPFLFA+MFGDWGHGICL LATLY + REKKL+SQKL 
Sbjct  361   IVDAYGIAKYQEANPGVFTIVTFPFLFAIMFGDWGHGICLLLATLYLIIREKKLASQKLD  420

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIM+M F GRYVIL+M+LFSIYTG IYNEFFSVPFELFG+SAYAC DPSC DATT GLIK
Sbjct  421   DIMDMMFGGRYVILMMSLFSIYTGLIYNEFFSVPFELFGKSAYACRDPSCGDATTEGLIK  480

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR  Y FGVDPVWHG+RSELPFLNSLKMK+SIL+GVAQMNLGI++SYFN +FF+N IN+W
Sbjct  481   VRPAYSFGVDPVWHGSRSELPFLNSLKMKLSILIGVAQMNLGIMMSYFNAKFFRNAINVW  540

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDDL EN++F GQK +
Sbjct  541   YQFIPQLIFLNSLFGYLSLLIIIKWCTGSKADLYHVMIYMFLSPTDDLGENELFPGQKLV  600

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPF LKKQHE+RH+GQ Y  L   D++V    ++    H HE
Sbjct  601   QLVLLLLALVSVPWMLIPKPFFLKKQHEQRHQGQQYTMLQATDESVTELEEHQDDPHHHE  660

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVL+L+ G+NNI
Sbjct  661   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLVLSWGYNNI  720

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILIIG ++F+ AT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PF+FASI  
Sbjct  721   FILIIGAVIFLFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFVPFAFASIIE  780

Query  327   QDE  319
             +++
Sbjct  781   EED  783



>ref|XP_003558337.1| PREDICTED: V-type proton ATPase subunit a3-like [Brachypodium 
distachyon]
Length=821

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/424 (78%), Positives = 382/424 (90%), Gaps = 1/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFT++TFPFLFAVMFGDWGHGIC+ LATLY + REKK +SQKLG
Sbjct  398   IVDAYGVAKYQEANPGVFTVITFPFLFAVMFGDWGHGICILLATLYLIIREKKFASQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRY+I++MALFSIYTG IYNEFFSVPFELF +SAYAC DPSC DATT GL+K
Sbjct  458   DIMEMMFGGRYIIMMMALFSIYTGLIYNEFFSVPFELFAKSAYACRDPSCGDATTEGLVK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             +R TYPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGI++SYFN +FF+N +N+W
Sbjct  518   IRPTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIMMSYFNAKFFRNSVNVW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTD+L EN++F GQK +
Sbjct  578   YQFVPQLIFLNSLFGYLSMLIIIKWCTGSKADLYHVMIYMFLSPTDELGENELFPGQKTV  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETD-NhghghgH  691
             Q++L+LLALV+VPWML PKPF LK +HE RH+G  YA L  AD++V +E   +H   + H
Sbjct  638   QLVLLLLALVSVPWMLIPKPFFLKMEHERRHQGHQYAMLEGADESVVAELGEHHEESNHH  697

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFYDKVLLL +G+NN
Sbjct  698   EEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYDKVLLLTLGYNN  757

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             + IL IG+ VFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSFA I 
Sbjct  758   LFILAIGVFVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALIT  817

Query  330   HQDE  319
              ++E
Sbjct  818   EEEE  821



>ref|XP_009602232.1| PREDICTED: V-type proton ATPase subunit a2-like [Nicotiana tomentosiformis]
Length=819

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/425 (82%), Positives = 379/425 (89%), Gaps = 7/425 (2%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LATL+ + REKKLSSQKLG
Sbjct  400   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLFLLIREKKLSSQKLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI +M+LFSIYTG IYNEFFSVPFELFGRSAY C DPSCRD+T+ GLIK
Sbjct  460   DIMEMTFGGRYVIFMMSLFSIYTGLIYNEFFSVPFELFGRSAYGCRDPSCRDSTSAGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDP WHGTRSELP+LNSLKMKMSILLGVAQMNLGI LS+FN  FF++ INIW
Sbjct  520   VRDTYPFGVDPAWHGTRSELPYLNSLKMKMSILLGVAQMNLGIFLSFFNALFFRSGINIW  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQ+IFLN+LFGYL+VLII+KW TGS+ADLYHVMIYMFLSPTD+L ENQ+F GQK  
Sbjct  580   CQFVPQIIFLNALFGYLSVLIIVKWCTGSKADLYHVMIYMFLSPTDELGENQLFAGQKTT  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDA--VESETDNhghghg  694
             Q++L+  ALVAVPWML PKPFLLK QH ERH+GQSY  L  A+++  VES  D+      
Sbjct  640   QLVLLFSALVAVPWMLLPKPFLLKAQH-ERHQGQSYTALQEAEESLLVESSDDS----GH  694

Query  693   HEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfn  514
             HE+FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFN
Sbjct  695   HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFN  754

Query  513   niviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASI  334
             N+ ILIIGIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSF+ I
Sbjct  755   NVFILIIGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFSLI  814

Query  333   AHQDE  319
               +DE
Sbjct  815   DGEDE  819



>gb|EEC66656.1| hypothetical protein OsI_32928 [Oryza sativa Indica Group]
Length=814

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/423 (78%), Positives = 380/423 (90%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGVFTIVTFPFLFA+MFGDWGHGICL LATLY + REKKL+SQKL 
Sbjct  392   IVDAYGIAKYQEANPGVFTIVTFPFLFAIMFGDWGHGICLLLATLYLIIREKKLASQKLD  451

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIM+M F GRYVIL+M+LFSIYTG IYNEFFSVPFELFG+SAYAC DPSC DATT GLIK
Sbjct  452   DIMDMMFGGRYVILMMSLFSIYTGLIYNEFFSVPFELFGKSAYACRDPSCGDATTEGLIK  511

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR  Y FGVDPVWHG+RSELPFLNSLKMK+SIL+GVAQMNLGI++SYFN +FF+N IN+W
Sbjct  512   VRPAYSFGVDPVWHGSRSELPFLNSLKMKLSILIGVAQMNLGIMMSYFNAKFFRNAINVW  571

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDDL EN++F GQK +
Sbjct  572   YQFIPQLIFLNSLFGYLSLLIIIKWCTGSKADLYHVMIYMFLSPTDDLGENELFPGQKLV  631

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPF LKKQHE+RH+GQ Y  L   D++V    ++    H HE
Sbjct  632   QLVLLLLALVSVPWMLIPKPFFLKKQHEQRHQGQQYTMLQATDESVTELEEHQDDPHHHE  691

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVL+L+ G+NNI
Sbjct  692   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLVLSWGYNNI  751

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILIIG ++F+ AT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PF+FASI  
Sbjct  752   FILIIGAVIFLFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFVPFAFASIIE  811

Query  327   QDE  319
             +++
Sbjct  812   EED  814



>ref|XP_010555275.1| PREDICTED: V-type proton ATPase subunit a3-like [Tarenaya hassleriana]
Length=821

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/428 (80%), Positives = 382/428 (89%), Gaps = 9/428 (2%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LAT+YF+ REKKLSSQKLG
Sbjct  399   IVDAYGIAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATMYFIMREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EMAF GRYVI +M+LFSI+TG IYNEFFSVPF LF  SAY C D SC +ATT GLIK
Sbjct  459   DIAEMAFGGRYVIFMMSLFSIFTGLIYNEFFSVPFPLFAPSAYDCRDASCSEATTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN +FF + +NIW
Sbjct  519   VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFGSGVNIW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VL+I+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  579   FQFIPQMIFLNSLFGYLSVLVIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPYQKTV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAV----ESETDNhghg  700
             Q++L+LLALV+VPWML PKPF+LKKQHE RH+GQ+Y  +  ADD++    ESE  N    
Sbjct  639   QLVLLLLALVSVPWMLLPKPFILKKQHEARHQGQAYRAIQEADDSLLQVEESEDSN----  694

Query  699   hgHEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMg  520
              GHE+FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G
Sbjct  695   -GHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWG  753

Query  519   fnniviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFA  340
             FNN+VIL++GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSF+
Sbjct  754   FNNVVILVVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFS  813

Query  339   SIAHQDEE  316
               A  D+E
Sbjct  814   LSASADDE  821



>gb|EEE50667.1| hypothetical protein OsJ_30905 [Oryza sativa Japonica Group]
Length=820

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/423 (78%), Positives = 380/423 (90%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGVFTIVTFPFLFA+MFGDWGHGICL LATLY + REKKL+SQKL 
Sbjct  398   IVDAYGIAKYQEANPGVFTIVTFPFLFAIMFGDWGHGICLLLATLYLIIREKKLASQKLD  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIM+M F GRYVIL+M+LFSIYTG IYNEFFSVPFELFG+SAYAC DPSC DATT GLIK
Sbjct  458   DIMDMMFGGRYVILMMSLFSIYTGLIYNEFFSVPFELFGKSAYACRDPSCGDATTEGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR  Y FGVDPVWHG+RSELPFLNSLKMK+SIL+GVAQMNLGI++SYFN +FF+N IN+W
Sbjct  518   VRPAYSFGVDPVWHGSRSELPFLNSLKMKLSILIGVAQMNLGIMMSYFNAKFFRNAINVW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDDL EN++F GQK +
Sbjct  578   YQFIPQLIFLNSLFGYLSLLIIIKWCTGSKADLYHVMIYMFLSPTDDLGENELFPGQKLV  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPF LKKQHE+RH+GQ Y  L   D++V    ++    H HE
Sbjct  638   QLVLLLLALVSVPWMLIPKPFFLKKQHEQRHQGQQYTMLQATDESVTELEEHQDDPHHHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVL+L+ G+NNI
Sbjct  698   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLVLSWGYNNI  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILIIG ++F+ AT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PF+FASI  
Sbjct  758   FILIIGAVIFLFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFVPFAFASIIE  817

Query  327   QDE  319
             +++
Sbjct  818   EED  820



>gb|KDO49484.1| hypothetical protein CISIN_1g003392mg [Citrus sinensis]
Length=821

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/423 (80%), Positives = 380/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKY+EANPGVFTIVTFPFLFAVMFGDWGHGICL L TL  + REKKL+SQKL 
Sbjct  401   IVDAYGVAKYREANPGVFTIVTFPFLFAVMFGDWGHGICLLLGTLVLIVREKKLASQKLD  460

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI +M F GRYVIL+MALFSIYTG IYNEFFSVPFE+F  SAYAC D SC +ATT GLIK
Sbjct  461   DITDMTFGGRYVILMMALFSIYTGLIYNEFFSVPFEIFSHSAYACRDLSCSEATTVGLIK  520

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  FF+  +NIW
Sbjct  521   VRDTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNATFFRIGVNIW  580

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL++LIILKW TGSQADLYHVMIYMFLSPTD+L +NQ+F GQK  
Sbjct  581   CQFIPQIIFLNSLFGYLSLLIILKWITGSQADLYHVMIYMFLSPTDELGDNQLFPGQKTA  640

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA V+VPWML PKPF+LK QH++RH+GQSY  L + D++++ +T++    HGHE
Sbjct  641   QLVLLLLAFVSVPWMLLPKPFILKMQHQDRHQGQSYEALQSTDESLQPDTNH--DSHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NNI
Sbjct  699   EFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFA +  
Sbjct  759   LILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLDD  818

Query  327   QDE  319
             +DE
Sbjct  819   EDE  821



>gb|ABB46970.1| V-type ATPase 116kDa subunit family protein, expressed [Oryza 
sativa Japonica Group]
Length=819

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/423 (78%), Positives = 380/423 (90%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGVFTIVTFPFLFA+MFGDWGHGICL LATLY + REKKL+SQKL 
Sbjct  397   IVDAYGIAKYQEANPGVFTIVTFPFLFAIMFGDWGHGICLLLATLYLIIREKKLASQKLD  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIM+M F GRYVIL+M+LFSIYTG IYNEFFSVPFELFG+SAYAC DPSC DATT GLIK
Sbjct  457   DIMDMMFGGRYVILMMSLFSIYTGLIYNEFFSVPFELFGKSAYACRDPSCGDATTEGLIK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR  Y FGVDPVWHG+RSELPFLNSLKMK+SIL+GVAQMNLGI++SYFN +FF+N IN+W
Sbjct  517   VRPAYSFGVDPVWHGSRSELPFLNSLKMKLSILIGVAQMNLGIMMSYFNAKFFRNAINVW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDDL EN++F GQK +
Sbjct  577   YQFIPQLIFLNSLFGYLSLLIIIKWCTGSKADLYHVMIYMFLSPTDDLGENELFPGQKLV  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPF LKKQHE+RH+GQ Y  L   D++V    ++    H HE
Sbjct  637   QLVLLLLALVSVPWMLIPKPFFLKKQHEQRHQGQQYTMLQATDESVTELEEHQDDPHHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVL+L+ G+NNI
Sbjct  697   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLVLSWGYNNI  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILIIG ++F+ AT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PF+FASI  
Sbjct  757   FILIIGAVIFLFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFVPFAFASIIE  816

Query  327   QDE  319
             +++
Sbjct  817   EED  819



>ref|XP_006423404.1| hypothetical protein CICLE_v10027828mg [Citrus clementina]
 gb|ESR36644.1| hypothetical protein CICLE_v10027828mg [Citrus clementina]
Length=823

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/423 (80%), Positives = 380/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKY+EANPGVFTIVTFPFLFAVMFGDWGHGICL L TL  + REKKL+SQKL 
Sbjct  403   IVDAYGVAKYREANPGVFTIVTFPFLFAVMFGDWGHGICLLLGTLVLIVREKKLASQKLD  462

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI +M F GRYVIL+MALFSIYTG IYNEFFSVPFE+F  SAYAC D SC +ATT GLIK
Sbjct  463   DITDMTFGGRYVILMMALFSIYTGLIYNEFFSVPFEIFSHSAYACRDLSCSEATTVGLIK  522

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  FF+  +NIW
Sbjct  523   VRDTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNATFFRIGVNIW  582

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL++LIILKW TGSQADLYHVMIYMFLSPTD+L +NQ+F GQK  
Sbjct  583   CQFIPQIIFLNSLFGYLSLLIILKWITGSQADLYHVMIYMFLSPTDELGDNQLFPGQKTA  642

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA V+VPWML PKPF+LK QH++RH+GQSY  L + D++++ +T++    HGHE
Sbjct  643   QLVLLLLAFVSVPWMLLPKPFILKMQHQDRHQGQSYEALQSTDESLQPDTNH--DSHGHE  700

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NNI
Sbjct  701   EFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNI  760

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFA +  
Sbjct  761   LILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLDD  820

Query  327   QDE  319
             +DE
Sbjct  821   EDE  823



>gb|KDO49485.1| hypothetical protein CISIN_1g003392mg [Citrus sinensis]
Length=823

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/423 (80%), Positives = 380/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKY+EANPGVFTIVTFPFLFAVMFGDWGHGICL L TL  + REKKL+SQKL 
Sbjct  403   IVDAYGVAKYREANPGVFTIVTFPFLFAVMFGDWGHGICLLLGTLVLIVREKKLASQKLD  462

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI +M F GRYVIL+MALFSIYTG IYNEFFSVPFE+F  SAYAC D SC +ATT GLIK
Sbjct  463   DITDMTFGGRYVILMMALFSIYTGLIYNEFFSVPFEIFSHSAYACRDLSCSEATTVGLIK  522

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  FF+  +NIW
Sbjct  523   VRDTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNATFFRIGVNIW  582

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL++LIILKW TGSQADLYHVMIYMFLSPTD+L +NQ+F GQK  
Sbjct  583   CQFIPQIIFLNSLFGYLSLLIILKWITGSQADLYHVMIYMFLSPTDELGDNQLFPGQKTA  642

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA V+VPWML PKPF+LK QH++RH+GQSY  L + D++++ +T++    HGHE
Sbjct  643   QLVLLLLAFVSVPWMLLPKPFILKMQHQDRHQGQSYEALQSTDESLQPDTNH--DSHGHE  700

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NNI
Sbjct  701   EFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNI  760

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFA +  
Sbjct  761   LILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLDD  820

Query  327   QDE  319
             +DE
Sbjct  821   EDE  823



>ref|NP_179736.1| vacuolar proton ATPase A2 [Arabidopsis thaliana]
 sp|Q9SJT7.1|VHAA2_ARATH RecName: Full=V-type proton ATPase subunit a2; Short=V-ATPase 
subunit a2; AltName: Full=V-type proton ATPase 95 kDa subunit 
a isoform 2; Short=V-ATPase 95 kDa isoform a2; AltName: Full=Vacuolar 
H(+)-ATPase subunit a isoform 2; AltName: Full=Vacuolar 
proton pump subunit a2; AltName: Full=Vacuolar proton 
translocating ATPase 95 kDa subunit a isoform 2 [Arabidopsis 
thaliana]
 gb|AAL11550.1|AF424556_1 At2g21410/F3K23.17 [Arabidopsis thaliana]
 gb|AAD23686.1| putative vacuolar proton-ATPase subunit [Arabidopsis thaliana]
 gb|AAM20541.1| putative vacuolar proton-ATPase subunit [Arabidopsis thaliana]
 gb|AEC07175.1| vacuolar proton ATPase A2 [Arabidopsis thaliana]
Length=821

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/423 (79%), Positives = 375/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  401   IVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  460

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  461   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYDCRDVSCSEATTIGLIK  520

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSIL+GVAQMNLGI++S+FN +FFK+ +NIW
Sbjct  521   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILIGVAQMNLGIIMSFFNAKFFKSAVNIW  580

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  581   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIV  640

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+G SYA L   D++++ ET+    GHGHE
Sbjct  641   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGLSYAQLDETDESLQVETNG--GGHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNN+
Sbjct  699   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNV  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              I I+GI+VFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF+PF+F  + +
Sbjct  759   FIWIVGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFTLVGN  818

Query  327   QDE  319
             +DE
Sbjct  819   EDE  821



>ref|XP_006293690.1| hypothetical protein CARUB_v10022648mg [Capsella rubella]
 gb|EOA26588.1| hypothetical protein CARUB_v10022648mg [Capsella rubella]
Length=821

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/423 (79%), Positives = 375/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  401   IVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  460

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  461   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIK  520

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN +FFK+ +N+W
Sbjct  521   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVW  580

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  581   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIV  640

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+G SYA L   D++++ ET+    GHGHE
Sbjct  641   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGLSYAQLDETDESLQVETNG--GGHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNNI
Sbjct  699   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              +LI+GI+VFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF PF+F  I +
Sbjct  759   ALLILGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFDPFNFTLIGN  818

Query  327   QDE  319
             ++E
Sbjct  819   EEE  821



>ref|XP_009785999.1| PREDICTED: V-type proton ATPase subunit a2-like [Nicotiana sylvestris]
Length=819

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/425 (81%), Positives = 379/425 (89%), Gaps = 7/425 (2%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LATL+ + REKKLSSQKLG
Sbjct  400   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLFLLIREKKLSSQKLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI +M+LFSIYTG IYNEFFSVPFELFGRSAY C DPSCRD+T+ GLIK
Sbjct  460   DIMEMTFGGRYVIFMMSLFSIYTGLIYNEFFSVPFELFGRSAYGCRDPSCRDSTSAGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDP WHGTRSELP+LNSLKMKMSILLGVAQMNLGI LS+FN  FF++ INIW
Sbjct  520   VRDTYPFGVDPAWHGTRSELPYLNSLKMKMSILLGVAQMNLGIFLSFFNALFFRSGINIW  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQ+IFLN+LFGYL+VLII+KW TGS+ADLYHVMIYMFLSPTD+L ENQ+F GQK  
Sbjct  580   CQFVPQIIFLNALFGYLSVLIIVKWCTGSKADLYHVMIYMFLSPTDELGENQLFAGQKTT  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDA--VESETDNhghghg  694
             Q++L+  ALVAVPWML PKPFLLK QH ERH+GQSY  L  A+++  VES  D+      
Sbjct  640   QLVLLFSALVAVPWMLLPKPFLLKAQH-ERHQGQSYTALQEAEESLLVESSDDS----GH  694

Query  693   HEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfn  514
             HE+FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFN
Sbjct  695   HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFN  754

Query  513   niviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASI  334
             N+ ILIIGIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSF+ +
Sbjct  755   NVFILIIGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFSLV  814

Query  333   AHQDE  319
               +DE
Sbjct  815   DGEDE  819



>ref|XP_003537855.1| PREDICTED: vacuolar proton ATPase a3-like [Glycine max]
Length=818

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/424 (79%), Positives = 383/424 (90%), Gaps = 4/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+D+YGVAKYQEANP V+T+VTFPFLFAVMFGDWGHGICL LA LYF+ REKKLSSQKL 
Sbjct  399   IIDSYGVAKYQEANPTVYTVVTFPFLFAVMFGDWGHGICLLLAALYFIIREKKLSSQKLD  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVILLMA+FSIYTGFIYNEFFSVPF +F  SAY C D SCRDATT GLIK
Sbjct  459   DITEMTFGGRYVILLMAIFSIYTGFIYNEFFSVPFAIFAPSAYDCRDLSCRDATTVGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIV+SYFN  FF+N +N+W
Sbjct  519   VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVMSYFNAIFFRNSVNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYH++IYMFLSPTDDL ENQ+F GQK L
Sbjct  579   FQFIPQMIFLNSLFGYLSLLIIVKWATGSQADLYHILIYMFLSPTDDLGENQLFAGQKNL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA+++VPWML PKPF+LKKQHE RH  +SYAPL + D++++ E+++    HGHE
Sbjct  639   QLVLLLLAVISVPWMLLPKPFILKKQHEARHGVESYAPLQSTDESLQVESNH--DSHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVL++A G+NN+
Sbjct  697   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLMMAWGYNNV  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+G+IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF+ +  
Sbjct  757   IILIVGLIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFSWL--  814

Query  327   QDEE  316
              DEE
Sbjct  815   DDEE  818



>ref|XP_011092832.1| PREDICTED: V-type proton ATPase subunit a3-like [Sesamum indicum]
Length=819

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/423 (82%), Positives = 384/423 (91%), Gaps = 3/423 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LATLYF+ REKKLSSQKLG
Sbjct  400   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYFIVREKKLSSQKLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI+LMA+FSIYTGFIYNEFFSVPFELF  SAYAC DPSCRD+TT GLIK
Sbjct  460   DIMEMTFGGRYVIMLMAIFSIYTGFIYNEFFSVPFELFASSAYACRDPSCRDSTTVGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN  FFKN +N+W
Sbjct  520   VRDTYPFGVDPAWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNALFFKNSLNVW  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQK  
Sbjct  580   FQFIPQIIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPGQKTA  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPFLLK QH  R +G SYAPL +A++++ S  ++    H HE
Sbjct  640   QLVLLLLALVSVPWMLLPKPFLLKLQH-SRQQGDSYAPLPDAEESLRSAANH--DSHSHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS VFY+KVLLLA G+NN+
Sbjct  697   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSVVFYEKVLLLAWGYNNV  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VILI+GIIVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFS A + H
Sbjct  757   VILIVGIIVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSLALLDH  816

Query  327   QDE  319
             ++E
Sbjct  817   EEE  819



>emb|CDX99594.1| BnaC04g33510D [Brassica napus]
Length=823

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/423 (79%), Positives = 375/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL +AT+Y V REKKLSSQKLG
Sbjct  403   IVDAYGVAKYQEANPTVFTIVTFPFLFAVMFGDWGHGICLLIATMYLVLREKKLSSQKLG  462

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVIL+M+LFSIYTG IYNEFFS+PF LF  SAY C D SC +ATT GLIK
Sbjct  463   DIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSIPFPLFAPSAYECRDASCSEATTIGLIK  522

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+ N +FFK+ +NIW
Sbjct  523   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFCNAKFFKSAVNIW  582

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+ LII+KW TGSQADLYHVMIYMFLSP +DL ENQ+F  QK +
Sbjct  583   FQFVPQMIFLNCLFGYLSALIIIKWCTGSQADLYHVMIYMFLSPMEDLGENQLFPYQKTV  642

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LAL++VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET+     HGHE
Sbjct  643   QLTFLFLALISVPWMLLPKPFILKKQHEARHQGQSYAQLGETDESLQVETNG--GAHGHE  700

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNN 
Sbjct  701   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNF  760

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GI+VFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF+PF+F  + +
Sbjct  761   LILIVGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFTLLGN  820

Query  327   QDE  319
             +DE
Sbjct  821   EDE  823



>ref|XP_003573831.1| PREDICTED: V-type proton ATPase subunit a3-like [Brachypodium 
distachyon]
Length=823

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/423 (78%), Positives = 380/423 (90%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPG+FTIVTFPFLFAVMFGDWGHGICL L+ LY V REKKL+SQKL 
Sbjct  401   IVDAYGIAKYQEANPGLFTIVTFPFLFAVMFGDWGHGICLLLSALYLVIREKKLASQKLD  460

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI+E+ F GRYVIL+M+LFSIYTG IYNEFFSVPFELFG+SAYAC DPSC DAT+ GLIK
Sbjct  461   DIVEIMFGGRYVILMMSLFSIYTGLIYNEFFSVPFELFGKSAYACRDPSCVDATSEGLIK  520

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDPVWHG+RSELPFLNSLKMKMSIL+GV+QMNLGIV+S+FN ++FKN +N+W
Sbjct  521   VRQTYPFGVDPVWHGSRSELPFLNSLKMKMSILIGVSQMNLGIVMSFFNAKYFKNSVNVW  580

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFL PTDD+ ENQ+F GQK +
Sbjct  581   YQFVPQLIFLNSLFGYLSLLIIIKWCTGSKADLYHVMIYMFLGPTDDIGENQLFPGQKIV  640

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLALV+VPWML PKP  LKKQHE+RH+GQ Y  +    ++V     +H + H H+
Sbjct  641   QIVLLLLALVSVPWMLIPKPLFLKKQHEQRHQGQQYTMIQATTESVTGLQRHHENPHHHD  700

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G+NNI
Sbjct  701   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGYNNI  760

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              IL++G+IVF+ AT+GVLL METLSAFLHALRLHWVEFQNKFYEGDGYKF+PF+FASI  
Sbjct  761   TILVVGVIVFLFATIGVLLSMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFAFASIIE  820

Query  327   QDE  319
             +++
Sbjct  821   EED  823



>gb|KHN25411.1| Vacuolar proton translocating ATPase 100 kDa subunit [Glycine 
soja]
Length=806

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/424 (79%), Positives = 382/424 (90%), Gaps = 4/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+D+YGVAKYQEANP V+T+VTFPFLFAVMFGDWGHGICL LA LYF+ REKKLSSQKL 
Sbjct  387   IIDSYGVAKYQEANPTVYTVVTFPFLFAVMFGDWGHGICLLLAALYFIIREKKLSSQKLD  446

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVILLMA+FSIYTGFIYNEFFSVPF +F  SAY C D SCRDATT GLIK
Sbjct  447   DITEMTFGGRYVILLMAIFSIYTGFIYNEFFSVPFAIFAPSAYECRDLSCRDATTVGLIK  506

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIV+SYFN  FF+N +N+W
Sbjct  507   VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVMSYFNAIFFRNSVNVW  566

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYH++IYMFLSPTDDL ENQ+F GQK L
Sbjct  567   FQFIPQMIFLNSLFGYLSLLIIVKWATGSQADLYHILIYMFLSPTDDLGENQLFAGQKNL  626

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA+++VPWML PKPF+LKKQHE RH  +SY PL + D++++ E+++    HGHE
Sbjct  627   QLVLLLLAVISVPWMLLPKPFILKKQHEARHGVESYEPLQSTDESLQVESNH--DSHGHE  684

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVL++A G+NN+
Sbjct  685   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLMMAWGYNNV  744

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+G+IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF+ +  
Sbjct  745   IILIVGLIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFSWL--  802

Query  327   QDEE  316
              DEE
Sbjct  803   DDEE  806



>dbj|BAJ99586.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=491

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/423 (77%), Positives = 375/423 (89%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+A YQE NPG+FTIVTFPFLFAVMFGDWGHGIC+FL+ LY + REKKL+SQKL 
Sbjct  69    IVDAYGIASYQEINPGLFTIVTFPFLFAVMFGDWGHGICIFLSALYLIIREKKLASQKLD  128

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI+++ F GRYVIL+M+LFSIYTG IYNEFFSVPFELFG+SAYAC DPSC DATT GL+K
Sbjct  129   DIVQIMFDGRYVILMMSLFSIYTGLIYNEFFSVPFELFGKSAYACHDPSCGDATTEGLVK  188

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR  YPFGVDPVWHG+RSELPFLNSLKMKMSILLG+AQMNLGIVLS+FN ++FKN +NIW
Sbjct  189   VRQAYPFGVDPVWHGSRSELPFLNSLKMKMSILLGIAQMNLGIVLSFFNAKYFKNTVNIW  248

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             HQFVPQ+IFLNSLFGYL+ LII+KW TGS+ADLYH+MIYMFLSPTDD+ ENQ+F GQ+ +
Sbjct  249   HQFVPQLIFLNSLFGYLSFLIIIKWCTGSKADLYHIMIYMFLSPTDDIGENQLFPGQRIV  308

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q +L+LLALV+VPWMLFPKP  LKKQHE+RH+GQ Y  L   D++V      H + H HE
Sbjct  309   QPVLLLLALVSVPWMLFPKPLFLKKQHEQRHQGQHYTMLQETDESVAQLIGQHENPHQHE  368

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEV VHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G+NN+
Sbjct  369   EFEFSEVLVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGYNNV  428

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +IL++G+IVF+ AT+ VLL METLSAFLHALRLHWVEFQ KFYEG GYKF+PFSFASI  
Sbjct  429   IILVVGVIVFLFATIIVLLSMETLSAFLHALRLHWVEFQGKFYEGGGYKFAPFSFASIIE  488

Query  327   QDE  319
             +++
Sbjct  489   EED  491



>ref|XP_003540986.1| PREDICTED: vacuolar proton ATPase a3-like [Glycine max]
Length=818

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/424 (79%), Positives = 382/424 (90%), Gaps = 4/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+D+YGVAKYQEANP V+T+VTFPFLFAVMFGDWGHGICL LA LYF+ REKKLSSQKL 
Sbjct  399   IIDSYGVAKYQEANPTVYTVVTFPFLFAVMFGDWGHGICLLLAALYFIIREKKLSSQKLD  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVILLMA+FSIYTGFIYNEFFSVPF +F  SAY C D SCRDATT GLIK
Sbjct  459   DITEMTFGGRYVILLMAIFSIYTGFIYNEFFSVPFAIFAPSAYECRDLSCRDATTVGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIV+SYFN  FF+N +N+W
Sbjct  519   VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVMSYFNAIFFRNSVNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYH++IYMFLSPTDDL ENQ+F GQK L
Sbjct  579   FQFIPQMIFLNSLFGYLSLLIIVKWATGSQADLYHILIYMFLSPTDDLGENQLFAGQKNL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA+++VPWML PKPF+LKKQHE RH  +SY PL + D++++ E+++    HGHE
Sbjct  639   QLVLLLLAVISVPWMLLPKPFILKKQHEARHGVESYEPLQSTDESLQVESNH--DSHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVL++A G+NN+
Sbjct  697   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLMMAWGYNNV  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+G+IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF+ +  
Sbjct  757   IILIVGLIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFSWL--  814

Query  327   QDEE  316
              DEE
Sbjct  815   DDEE  818



>gb|KHN39818.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Glycine soja]
Length=818

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/424 (79%), Positives = 382/424 (90%), Gaps = 4/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+D+YGVAKYQEANP V+T+VTFPFLFAVMFGDWGHGICL LA LYF+ REKKLSSQKL 
Sbjct  399   IIDSYGVAKYQEANPTVYTVVTFPFLFAVMFGDWGHGICLLLAALYFIIREKKLSSQKLD  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVILLMA+FSIYTGFIYNEFFSVPF +F  SAY C D SCRDATT GLIK
Sbjct  459   DITEMTFGGRYVILLMAIFSIYTGFIYNEFFSVPFAIFAPSAYDCRDLSCRDATTVGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSI LGVAQMNLGIV+SYFN  FF+N +N+W
Sbjct  519   VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSIPLGVAQMNLGIVMSYFNAIFFRNSVNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYH++IYMFLSPTDDL ENQ+F GQK L
Sbjct  579   FQFIPQMIFLNSLFGYLSLLIIVKWATGSQADLYHILIYMFLSPTDDLGENQLFAGQKNL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA+++VPWML PKPF+LKKQHE RH  +SYAPL + D++++ E+++    HGHE
Sbjct  639   QLVLLLLAVISVPWMLLPKPFILKKQHEARHGVESYAPLQSTDESLQVESNH--DSHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVL++A G+NN+
Sbjct  697   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLMMAWGYNNV  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+G+IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF+ +  
Sbjct  757   IILIVGLIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFSWL--  814

Query  327   QDEE  316
              DEE
Sbjct  815   DDEE  818



>ref|XP_009149095.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar proton ATPase a3-like 
[Brassica rapa]
Length=817

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/423 (79%), Positives = 376/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  397   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATMYLIVREKKLSSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI++M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  457   DIMEMAFGGRYVIMMMSLFSIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWH  RSEL FLNSL MKMSILLGV+QM+LGI++SYFN RFFK+ +NIW
Sbjct  517   VRDTYPFGLDPVWHVPRSELQFLNSLXMKMSILLGVSQMSLGIIMSYFNARFFKSSVNIW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  577   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTV  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALV+VP ML PKPF+LKKQHE RH+GQSYAPL   D+++  E       HGHE
Sbjct  637   QLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQSYAPLEETDESLHVEASG--GSHGHE  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN 
Sbjct  695   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNW  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSF   A+
Sbjct  755   LILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFILTAN  814

Query  327   QDE  319
             +DE
Sbjct  815   EDE  817



>gb|AAK96647.1| At2g21410/F3K23.17 [Arabidopsis thaliana]
 gb|AAM70564.1| At2g21410/F3K23.17 [Arabidopsis thaliana]
Length=821

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/423 (78%), Positives = 374/423 (88%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTF FLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  401   IVDAYGVAKYQEANPSVFTIVTFLFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  460

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  461   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYDCRDVSCSEATTIGLIK  520

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSIL+GVAQMNLGI++S+FN +FFK+ +NIW
Sbjct  521   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILIGVAQMNLGIIMSFFNAKFFKSAVNIW  580

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  581   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIV  640

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+G SYA L   D++++ ET+    GHGHE
Sbjct  641   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGLSYAQLDETDESLQVETNG--GGHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNN+
Sbjct  699   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNV  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              I I+GI+VFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF+PF+F  + +
Sbjct  759   FIWIVGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFTLVGN  818

Query  327   QDE  319
             +DE
Sbjct  819   EDE  821



>ref|XP_002878553.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54812.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=819

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/423 (78%), Positives = 375/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  399   IVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  459   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSIL+GVAQMNLGI++S+FN +FFK+ +N+W
Sbjct  519   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILIGVAQMNLGIIMSFFNAKFFKSAVNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  579   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKKI  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+G SYA L   D++++ +T+    GHGHE
Sbjct  639   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGLSYAHLDETDESLQVDTNG--GGHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNN+
Sbjct  697   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNV  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILI+GI+VFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF+PF+F    +
Sbjct  757   FILIVGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFTLDGN  816

Query  327   QDE  319
             +DE
Sbjct  817   EDE  819



>emb|CDY15895.1| BnaA04g12160D [Brassica napus]
Length=819

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/423 (78%), Positives = 374/423 (88%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA YQEANP VFTIVTFPFLFAVMFGDWGHGICL +AT+Y V +EKKLSSQKLG
Sbjct  399   IVDAYGVAIYQEANPTVFTIVTFPFLFAVMFGDWGHGICLLIATMYLVLKEKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVIL+M+LFSIYTG IYNEFFS+PF LF  SAY C D SC +ATT GLIK
Sbjct  459   DIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSIPFPLFAPSAYECRDASCSEATTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+ N +FFK+ +NIW
Sbjct  519   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFCNAKFFKSAVNIW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+ LII+KW TGSQADLYHVMIYMFLSP +DL ENQ+F  QK +
Sbjct  579   FQFVPQMIFLNCLFGYLSALIIIKWCTGSQADLYHVMIYMFLSPMEDLGENQLFPHQKTV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LAL++VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET+     HGHE
Sbjct  639   QLTFLFLALISVPWMLLPKPFILKKQHEARHQGQSYAQLEETDESLQVETNG--GPHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNN 
Sbjct  697   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNF  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GI+VFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF+PF+F  + +
Sbjct  757   LILIVGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFTLLGN  816

Query  327   QDE  319
             +DE
Sbjct  817   EDE  819



>ref|XP_002468170.1| hypothetical protein SORBIDRAFT_01g040970 [Sorghum bicolor]
 gb|EER95168.1| hypothetical protein SORBIDRAFT_01g040970 [Sorghum bicolor]
Length=822

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/424 (80%), Positives = 384/424 (91%), Gaps = 1/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LATLY + REKKL+SQKLG
Sbjct  399   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYLIIREKKLASQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MA+FSIYTG IYNEFFSVPFELFG+SAY C DPSC DATT GLIK
Sbjct  459   DIMEMMFGGRYVIMMMAVFSIYTGLIYNEFFSVPFELFGKSAYECRDPSCSDATTDGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGIV+SYFN +FF+N +N+W
Sbjct  519   VRDAYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIVISYFNAKFFRNSLNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTD+L ENQ+F+GQK +
Sbjct  579   YQFIPQLIFLNSLFGYLSLLIIIKWCTGSKADLYHVMIYMFLSPTDELGENQLFSGQKTV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESE-TDNhghghgH  691
             Q++L+LLALV+VPWML PKP LLKKQH++RH+G  YA L   D++V +E  ++H   H H
Sbjct  639   QLVLLLLALVSVPWMLIPKPLLLKKQHQQRHQGHQYAMLQGTDESVGAELGEHHEDAHDH  698

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFYDKVLL A+G NN
Sbjct  699   EEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYDKVLLTALGLNN  758

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             I  LIIG IVF+ ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSFA I 
Sbjct  759   IFALIIGGIVFVFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALIR  818

Query  330   HQDE  319
              +++
Sbjct  819   EEED  822



>gb|KFK30491.1| hypothetical protein AALP_AA7G268500 [Arabis alpina]
Length=817

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/423 (79%), Positives = 378/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGIC+ LA+LY + REKK +SQKLG
Sbjct  397   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICILLASLYLIVREKKFASQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIM+MAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D +C +ATT GLIK
Sbjct  457   DIMDMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFAPSAYDCRDVACSEATTIGLIK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFG+DPVWHGTRSELPFLNSLKMKMSILLGV+QMNLGI++S+FN  FFK+ +NIW
Sbjct  517   VRDTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVSQMNLGIIMSFFNAIFFKSKVNIW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L EN++F  QK +
Sbjct  577   FQFVPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENELFPHQKIV  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALV+VP ML PKPF+LKKQHE RH+GQSYAPL   D+++  ET+     HGHE
Sbjct  637   QLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQSYAPLDETDESLHVETNG--GSHGHE  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NNI
Sbjct  695   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNI  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVF+ ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PF+F     
Sbjct  755   LILIVGIIVFVFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFVLTGT  814

Query  327   QDE  319
             +DE
Sbjct  815   EDE  817



>emb|CDP20651.1| unnamed protein product [Coffea canephora]
Length=820

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/424 (80%), Positives = 378/424 (89%), Gaps = 5/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL + TL+ + RE+K SS+KLG
Sbjct  401   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLVTTLFLIIRERKYSSEKLG  460

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVILLM+LFSIYTG IYNEFFS+PFELFGRSAYAC D SC +ATT GLIK
Sbjct  461   DIMEMTFGGRYVILLMSLFSIYTGLIYNEFFSLPFELFGRSAYACRDASCSEATTVGLIK  520

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDP WHGTRSELPFLNSLKMKMSIL+GVAQMNLGI+LS+ N  FF+N IN+W
Sbjct  521   ARDTYPFGVDPAWHGTRSELPFLNSLKMKMSILIGVAQMNLGIILSFCNALFFRNSINVW  580

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVP+MIFLN LFGYL++LII+KW+TGSQADLYHVMIYMFL PTDDL ENQ+F GQK  
Sbjct  581   CQFVPEMIFLNGLFGYLSILIIIKWWTGSQADLYHVMIYMFLGPTDDLGENQLFPGQKTT  640

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+LVLLAL++VPWML PKPFLLK +H +RH G SYAPL + ++++  ET+   HGHG  
Sbjct  641   QIVLVLLALISVPWMLIPKPFLLKLEH-DRHHGHSYAPLQDTEESLLVETNQDSHGHG--  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNN+
Sbjct  698   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNV  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  758   IILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFALL--  815

Query  327   QDEE  316
              DEE
Sbjct  816   NDEE  819



>ref|XP_009117405.1| PREDICTED: vacuolar proton ATPase a2 [Brassica rapa]
Length=821

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/423 (78%), Positives = 372/423 (88%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  401   IVDAYGVAKYQEANPTVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  460

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  461   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFAPSAYECRDASCSEATTIGLIK  520

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+ N +FFK+ +N+W
Sbjct  521   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFCNAKFFKSAVNVW  580

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  581   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKTV  640

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET      HGHE
Sbjct  641   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGQSYAQLDETDESLQVETTG--GSHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNNI
Sbjct  699   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              ILI+GI+VFI ATVGVLLVMETLSAFLHALRL  VE+QNKFYEGDGYKF+PF+F  + +
Sbjct  759   FILIVGILVFIFATVGVLLVMETLSAFLHALRLRCVEYQNKFYEGDGYKFAPFTFTLVGN  818

Query  327   QDE  319
             +DE
Sbjct  819   EDE  821



>ref|XP_002512965.1| vacuolar proton atpase, putative [Ricinus communis]
 gb|EEF49468.1| vacuolar proton atpase, putative [Ricinus communis]
Length=814

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/423 (82%), Positives = 384/423 (91%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVD+YGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LATL F+ REKKLSSQKLG
Sbjct  394   IVDSYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLVFIIREKKLSSQKLG  453

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVILLMALFSIYTG IYNEFFSVPFELFGRSAYAC D SCRDATT GLIK
Sbjct  454   DITEMTFGGRYVILLMALFSIYTGLIYNEFFSVPFELFGRSAYACRDLSCRDATTDGLIK  513

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             V  TYPFGVDPVWHGTRSELPFLNSLKMKMSIL+GVAQMNLGI+LSYFN  +F+N +N W
Sbjct  514   VGPTYPFGVDPVWHGTRSELPFLNSLKMKMSILIGVAQMNLGIILSYFNALYFRNSLNTW  573

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LIILKW TGSQADLYHVMIYMFLSPTD+LEENQ+F GQK  
Sbjct  574   FQFIPQMIFLNSLFGYLSLLIILKWSTGSQADLYHVMIYMFLSPTDELEENQLFPGQKTA  633

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKP LLKKQH++RH+GQ Y PL + +++++ E ++    HGHE
Sbjct  634   QLVLLLLALVSVPWMLLPKPLLLKKQHQDRHQGQLYTPLQSTEESLQVEVNH--DSHGHE  691

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNN+
Sbjct  692   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNV  751

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFA +  
Sbjct  752   IILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFALVDD  811

Query  327   QDE  319
             ++E
Sbjct  812   EEE  814



>ref|XP_009140276.1| PREDICTED: vacuolar proton ATPase a2-like [Brassica rapa]
Length=818

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/423 (78%), Positives = 373/423 (88%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL +AT+Y V REKKLSSQKLG
Sbjct  398   IVDAYGVAKYQEANPTVFTIVTFPFLFAVMFGDWGHGICLLIATMYLVLREKKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVIL+M+LFSIYTG IYNEFFS+PF LF  SAY C D SC +ATT GLIK
Sbjct  458   DIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSIPFPLFAPSAYECRDASCSEATTIGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+ N +FFK+ +NIW
Sbjct  518   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFCNAKFFKSAVNIW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+ LI++KW TGSQADLYHVMIYMFLSP +DL ENQ+F  QK +
Sbjct  578   FQFVPQMIFLNCLFGYLSALIVIKWCTGSQADLYHVMIYMFLSPMEDLGENQLFPHQKTV  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LAL++VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET+     HGHE
Sbjct  638   QLTFLFLALISVPWMLLPKPFILKKQHEARHQGQSYAQLEETDESLQVETNG--GAHGHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A GFNN 
Sbjct  696   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNF  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GI+VFI ATVGVLLVMETLSA L ALRLHWVE+Q+KFYEGDGYKF+PF+F  + +
Sbjct  756   LILIVGILVFIFATVGVLLVMETLSALLQALRLHWVEYQHKFYEGDGYKFAPFTFTLLGN  815

Query  327   QDE  319
             +DE
Sbjct  816   EDE  818



>ref|XP_007131786.1| hypothetical protein PHAVU_011G041500g [Phaseolus vulgaris]
 gb|ESW03780.1| hypothetical protein PHAVU_011G041500g [Phaseolus vulgaris]
Length=818

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/424 (79%), Positives = 380/424 (90%), Gaps = 4/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+D+YGVAKYQEANP V+T+VTFPFLFAVMFGDWGHGICL LA LYF+ REKKLSSQKL 
Sbjct  399   IIDSYGVAKYQEANPTVYTVVTFPFLFAVMFGDWGHGICLLLAALYFIIREKKLSSQKLD  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVIL+MALFSIYTGFIYNEFFSVPF LF  SAY C D SCRD+TT GLIK
Sbjct  459   DITEMTFGGRYVILMMALFSIYTGFIYNEFFSVPFALFAPSAYDCRDLSCRDSTTVGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIV+SY N  FF+N +N+W
Sbjct  519   VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVMSYCNAIFFRNRVNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL +LII+KW TGSQADLYH++IYMFLSPTDDL ENQ+F GQ+ L
Sbjct  579   FQFIPQMIFLNSLFGYLALLIIVKWSTGSQADLYHILIYMFLSPTDDLGENQLFVGQRNL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA+V+VPWML PKPF+LKKQHE RH  +SY PL + D++++ E+++    HGHE
Sbjct  639   QLVLLLLAVVSVPWMLVPKPFILKKQHEARHGVESYTPLESTDESLQVESNH--DSHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A G+NN+
Sbjct  697   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGYNNV  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+G+IVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF+ +  
Sbjct  757   IILIVGLIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFSLL--  814

Query  327   QDEE  316
              DEE
Sbjct  815   DDEE  818



>dbj|BAF98583.1| CM0216.490.nc [Lotus japonicus]
Length=815

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/424 (77%), Positives = 374/424 (88%), Gaps = 3/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+D+YGVAKYQEANP V+T+VTFPFLFAVMFGDWGHGICL LA LYF+ RE+KLSSQKL 
Sbjct  392   IIDSYGVAKYQEANPTVYTVVTFPFLFAVMFGDWGHGICLLLAALYFIIRERKLSSQKLD  451

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVILLM+LFSIYTG IYNEFFSVPFELFG SAY C D +C +ATT GLIK
Sbjct  452   DITEMTFGGRYVILLMSLFSIYTGLIYNEFFSVPFELFGPSAYECRDLACSEATTIGLIK  511

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R TYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN  FF+N +NIW
Sbjct  512   ARRTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAIFFRNSVNIW  571

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL EN++F GQK  
Sbjct  572   FQFIPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENELFAGQKSY  631

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA+VAVPWML PKPF+LKKQHE RH  +SYAPL + +++++ E+++    HGHE
Sbjct  632   QLVLLLLAVVAVPWMLLPKPFILKKQHEARHGAESYAPLPSTEESLQVESNH--DSHGHE  689

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+ N 
Sbjct  690   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYYNN  749

Query  507   viliigiivfIC-ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             VI++I  I+    ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF+ + 
Sbjct  750   VIILIVGILVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFFPFSFSLLD  809

Query  330   HQDE  319
              +DE
Sbjct  810   EEDE  813



>emb|CAE45587.1| vacuolar proton-ATPase subunit-like protein [Lotus japonicus]
Length=815

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/424 (77%), Positives = 374/424 (88%), Gaps = 3/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+D+YGVAKYQEANP V+T+VTFPFLFAVMFGDWGHGICL LA LYF+ RE+KLSSQKL 
Sbjct  392   IIDSYGVAKYQEANPTVYTVVTFPFLFAVMFGDWGHGICLLLAALYFIIRERKLSSQKLD  451

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVILLM+LFSIYTG IYNEFFSVPFELFG SAY C D +C +ATT GLIK
Sbjct  452   DITEMTFGGRYVILLMSLFSIYTGLIYNEFFSVPFELFGPSAYECRDLACSEATTIGLIK  511

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R TYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN  FF+N +NIW
Sbjct  512   ARRTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAIFFRNSVNIW  571

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL EN++F GQK  
Sbjct  572   FQFIPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENELFAGQKSY  631

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA+VAVPWML PKPF+LKKQHE RH  +SYAPL + +++++ E+++    HGHE
Sbjct  632   QLVLLLLAVVAVPWMLLPKPFILKKQHEARHGAESYAPLPSTEESLQVESNH--DSHGHE  689

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+ N 
Sbjct  690   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYYNN  749

Query  507   viliigiivfIC-ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             VI++I  I+    ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF+ + 
Sbjct  750   VIILIVGILVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFFPFSFSLLD  809

Query  330   HQDE  319
              +DE
Sbjct  810   EEDE  813



>ref|XP_010672374.1| PREDICTED: V-type proton ATPase subunit a3-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/423 (79%), Positives = 388/423 (92%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IV+AYGVAKYQEANPGV+TI+TFPF FAVMFGDWGHGICLFLATLY + REKK S+QKLG
Sbjct  396   IVNAYGVAKYQEANPGVYTIITFPFFFAVMFGDWGHGICLFLATLYLILREKKFSNQKLG  455

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIM+MAF GRY+IL+MALFSIYTG IYNEFFS+PFELFG SAYAC + SCRDA+T G+IK
Sbjct  456   DIMQMAFDGRYLILMMALFSIYTGLIYNEFFSLPFELFGSSAYACRELSCRDASTAGVIK  515

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHG+RSELPFLNSLKMKMSIL GVA MNLGI+LSYFN +FFKND+NIW
Sbjct  516   VRDTYPFGVDPVWHGSRSELPFLNSLKMKMSILFGVAHMNLGIILSYFNAKFFKNDLNIW  575

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW +GS+ADLYH++IYMFLSPTDDL ENQ+F GQK L
Sbjct  576   YQFVPQMIFLNSLFGYLSLLIIVKWCSGSKADLYHILIYMFLSPTDDLGENQLFFGQKLL  635

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+ LAL++VPWMLFPKPF+LKKQ+EERHRG++YA L +ADD+++ E ++  HGHG  
Sbjct  636   QILLLFLALISVPWMLFPKPFILKKQYEERHRGRTYALLDDADDSLDFEMEHDSHGHG--  693

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVF+HQLIH+IEFVLG+VSNTASYLRLWALSLAHSELSSVF+DKVLLL   +NNI
Sbjct  694   EFEFSEVFIHQLIHSIEFVLGAVSNTASYLRLWALSLAHSELSSVFFDKVLLLTWRYNNI  753

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              IL IG+IVFI ATVGVLL+ME+LSAFLHA+RLHWVEFQNKF+EGDGYKF P+SFAS+  
Sbjct  754   FILAIGVIVFISATVGVLLLMESLSAFLHAMRLHWVEFQNKFFEGDGYKFQPYSFASLDE  813

Query  327   QDE  319
             +DE
Sbjct  814   EDE  816



>ref|XP_004507485.1| PREDICTED: vacuolar proton ATPase a2-like [Cicer arietinum]
Length=821

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/423 (78%), Positives = 378/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+D+YGVAKYQEANP VFT+VTFPFLFAVMFGDWGHGICL LA LYF+ REKKLSSQKL 
Sbjct  399   IIDSYGVAKYQEANPTVFTVVTFPFLFAVMFGDWGHGICLLLAALYFIIREKKLSSQKLD  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI LM+LFSIYTG IYNEFFS+PFELFG SAY C D SC +ATT GLIK
Sbjct  459   DITEMTFGGRYVIFLMSLFSIYTGLIYNEFFSLPFELFGPSAYECRDLSCSEATTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGIV+SY N +FF+N++N+W
Sbjct  519   VRRTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIVMSYCNAKFFRNNVNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL +LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  579   FQFIPQVIFLNSLFGYLALLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFAGQKNL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+ L+LLA+VAVPWML PKPF+LKKQHE RH  +SYAPL N +++++ E+++    HGHE
Sbjct  639   QLTLLLLAVVAVPWMLLPKPFILKKQHEARHGDESYAPLPNTEESLQVESNH--DSHGHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLL+A G+NN 
Sbjct  697   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLMAWGYNNW  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+G+IVFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGYKF PFSF  +  
Sbjct  757   IILIVGLIVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYKFHPFSFTLLDE  816

Query  327   QDE  319
             ++E
Sbjct  817   EEE  819



>ref|XP_010690814.1| PREDICTED: V-type proton ATPase subunit a3 [Beta vulgaris subsp. 
vulgaris]
Length=814

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/423 (77%), Positives = 380/423 (90%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVD+YGVA+YQEANP VFT+VTFPFLFAVMFGDWGHGICL LAT Y V REKKL+SQKLG
Sbjct  394   IVDSYGVARYQEANPTVFTVVTFPFLFAVMFGDWGHGICLLLATAYLVLREKKLASQKLG  453

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVIL+MA+FSIYTGFIYNEFFSVPFELFG+SAY C DPSC+DATT GLIK
Sbjct  454   DIMEMMFGGRYVILMMAIFSIYTGFIYNEFFSVPFELFGKSAYECRDPSCKDATTDGLIK  513

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR  YPFG+DPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGI++S+FN +FF++ ++IW
Sbjct  514   VRSAYPFGLDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFRSCVDIW  573

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL+VLII+KW TGS+ADLYH+MIYMFLSPTD+L EN++F GQK  
Sbjct  574   FQFIPQVIFLNSLFGYLSVLIIMKWCTGSKADLYHIMIYMFLSPTDELGENELFAGQKTT  633

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLAL++VP ML PKPF+LK QH+ RH+G+SY PL  A+++++ E  + G    HE
Sbjct  634   QMVLLLLALISVPCMLLPKPFILKSQHQSRHQGESYVPLQ-AEESLQVEATH-GSHGDHE  691

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEV VHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFYDKVL+LA G+NN+
Sbjct  692   EFEFSEVLVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYDKVLMLAWGYNNV  751

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFY GDGYKF P+SF+ I  
Sbjct  752   LILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYFGDGYKFYPYSFSLIVE  811

Query  327   QDE  319
             +DE
Sbjct  812   EDE  814



>ref|XP_008653566.1| PREDICTED: vacuolar proton ATPase a3 [Zea mays]
 tpg|DAA44411.1| TPA: hypothetical protein ZEAMMB73_955022 [Zea mays]
Length=822

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/424 (79%), Positives = 384/424 (91%), Gaps = 1/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LATLY + REKKL+SQKLG
Sbjct  399   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYLIIREKKLASQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MA+FSIYTG IYNEFFSVPF LFG+SAYAC D SC DATT GL+K
Sbjct  459   DIMEMMFGGRYVIMMMAVFSIYTGLIYNEFFSVPFGLFGKSAYACRDSSCSDATTEGLLK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGIV+SYFN +FF+N IN+W
Sbjct  519   VRDAYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIVISYFNAKFFRNSINVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDDL ENQ+F+GQK +
Sbjct  579   YQFIPQLIFLNSLFGYLSLLIIIKWCTGSKADLYHVMIYMFLSPTDDLSENQLFSGQKTV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESE-TDNhghghgH  691
             Q++L+LLALV+VPWML PKP LLKKQH++RH+G  YA L   D++V +E  ++H   H H
Sbjct  639   QLVLLLLALVSVPWMLIPKPLLLKKQHQQRHQGHQYAMLQGIDESVGAELGEHHEDAHDH  698

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+FEF EVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVL+ A GFNN
Sbjct  699   EEFEFGEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLMTAYGFNN  758

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             + ILIIG+++FI AT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSFA I 
Sbjct  759   VFILIIGVVIFIFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALIR  818

Query  330   HQDE  319
              +++
Sbjct  819   EEED  822



>ref|XP_003607000.1| V-type proton ATPase 116 kDa subunit a isoform [Medicago truncatula]
 gb|AES89197.1| vacuolar proton ATPase a3-like protein [Medicago truncatula]
Length=822

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/423 (79%), Positives = 378/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+D+YGVAKYQEANP VFT+VTFPFLFAVMFGDWGHGICL LA LYF+ REKKLSSQKL 
Sbjct  400   IIDSYGVAKYQEANPTVFTVVTFPFLFAVMFGDWGHGICLLLAALYFIIREKKLSSQKLD  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI  M F GRYVI LM+LFSIYTG IYNEFFSVPFELFG SAY C D SCRD+TT GLIK
Sbjct  460   DITAMTFGGRYVIFLMSLFSIYTGLIYNEFFSVPFELFGPSAYVCRDDSCRDSTTIGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
                TYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++SY N +FFKN++N+W
Sbjct  520   AGPTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSYCNAKFFKNNVNVW  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK +
Sbjct  580   FQFIPQVIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFAGQKNV  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA VAVPWML PKPF+LKKQHE RH  +SYAPL N +++++ E+++  HGHG  
Sbjct  640   QLVLLLLAGVAVPWMLLPKPFILKKQHEARHGDESYAPLPNTEESLQVESNHDSHGHG--  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A G+NN+
Sbjct  698   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGYNNV  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VILI+G+IVFI ATVGVLLVMETLSAFLHALRLHWVE+QNKFYEGDGY F PFSF+ +  
Sbjct  758   VILIVGLIVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGDGYLFLPFSFSLLDE  817

Query  327   QDE  319
             +DE
Sbjct  818   EDE  820



>ref|XP_002306128.1| vacuolar proton ATPase family protein [Populus trichocarpa]
 gb|EEE86639.1| vacuolar proton ATPase family protein [Populus trichocarpa]
Length=821

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/423 (79%), Positives = 375/423 (89%), Gaps = 3/423 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LA L F+ REKKLS QKLG
Sbjct  402   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLAALVFIIREKKLSGQKLG  461

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVIL+MALFSIYTG IYNEFFSVPFELF  SAYAC D SCRDATT GLIK
Sbjct  462   DITEMTFGGRYVILMMALFSIYTGIIYNEFFSVPFELFAPSAYACRDLSCRDATTVGLIK  521

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R TYPFGVDPVWHG+RSELPFLNSLKMKMSIL+GV QMNLGI+LSYFN  +F+N +N+W
Sbjct  522   ARPTYPFGVDPVWHGSRSELPFLNSLKMKMSILIGVTQMNLGIILSYFNAAYFRNSLNVW  581

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL++LIILKW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  582   FQFIPQIIFLNSLFGYLSLLIILKWCTGSQADLYHVMIYMFLSPTDELGENQLFPQQKTV  641

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPFLLK QH+ R +G+SY PL + +++++ E ++    HGHE
Sbjct  642   QLVLLLLALVSVPWMLLPKPFLLKMQHQAR-QGESYMPLQSTEESLQLEANH--DSHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NNI
Sbjct  699   EFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +IL +G I+FI  TVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFAS+  
Sbjct  759   IILAVGAILFIFVTVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFASVND  818

Query  327   QDE  319
             + E
Sbjct  819   EVE  821



>gb|KHG13283.1| Vacuolar proton translocating ATPase subunit [Gossypium arboreum]
Length=820

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/422 (80%), Positives = 378/422 (90%), Gaps = 1/422 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LATL+F+ REKKLSSQKLG
Sbjct  399   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLFFIIREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++M+LFSIYTGFIYNE FSV F+LF  SAYAC D SCRDA + GLIK
Sbjct  459   DITEMTFGGRYVIMMMSLFSIYTGFIYNECFSVAFDLFAPSAYACRDLSCRDAYSIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LSY N  FF N +NIW
Sbjct  519   VRDTYPFGVDPAWHGTRSELPFLNSLKMKMSILLGVAQMNLGILLSYSNATFFGNSLNIW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYH+MIYMFLSPTD+L +NQ+F  QK +
Sbjct  579   FQFIPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHIMIYMFLSPTDELGDNQLFPYQKTV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPFLLKK+HE RH+GQSY  +   DDA+ SE ++  HGHGHE
Sbjct  639   QLVLLLLALVSVPWMLLPKPFLLKKRHENRHQGQSYTQVQGTDDAL-SEANHDSHGHGHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHS+LS VFY+KVLLLA G+NN+
Sbjct  698   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSQLSIVFYEKVLLLAWGYNNM  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VIL++GII+FI ATVGVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF  I  
Sbjct  758   VILVVGIIIFIFATVGVLLIMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFILIDD  817

Query  327   QD  322
             +D
Sbjct  818   ED  819



>ref|XP_011037174.1| PREDICTED: V-type proton ATPase subunit a3-like [Populus euphratica]
Length=821

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/423 (79%), Positives = 375/423 (89%), Gaps = 3/423 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LA L F+ REKKLS QKLG
Sbjct  402   IVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLAALVFIIREKKLSGQKLG  461

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVIL+MALFSIYTG IYNEFFSVPFELF  SAYAC D SCRDATT GLIK
Sbjct  462   DITEMTFGGRYVILMMALFSIYTGIIYNEFFSVPFELFAPSAYACRDLSCRDATTVGLIK  521

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R TYPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  +F+N +N+W
Sbjct  522   ARPTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAAYFRNSLNVW  581

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL++LIILKW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  582   FQFIPQIIFLNSLFGYLSLLIILKWCTGSQADLYHVMIYMFLSPTDELGENQLFPRQKTV  641

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPFLLK QH+   +G+SY PL + +++++ E ++    HGHE
Sbjct  642   QLVLLLLALVSVPWMLLPKPFLLKMQHQAM-QGESYMPLQSTEESLQLEANH--DSHGHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NNI
Sbjct  699   EFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +IL +G IVFI  TVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSFAS+  
Sbjct  759   IILAVGAIVFIFVTVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFASVND  818

Query  327   QDE  319
             + E
Sbjct  819   EVE  821



>emb|CAD27718.1| putative vacuolar ATPase subunit 100 kDa subunit [Mesembryanthemum 
crystallinum]
Length=816

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/423 (78%), Positives = 378/423 (89%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+A+YQEANP V+TIVTFPFLFAVMFGDWGHGIC+ LAT   + REKKLSSQKLG
Sbjct  396   IVDAYGIARYQEANPSVYTIVTFPFLFAVMFGDWGHGICILLATSILILREKKLSSQKLG  455

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI +MALFSIYTG IYNEFFSVPFELFG+SAY C DPSC+DAT  GLIK
Sbjct  456   DIMEMMFGGRYVIFMMALFSIYTGLIYNEFFSVPFELFGKSAYECRDPSCKDATVDGLIK  515

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFG+DPVWHG+RSELPFLNSLKMKMSILLGV+QMNLGI++S+FN +FF++ ++IW
Sbjct  516   VRDAYPFGLDPVWHGSRSELPFLNSLKMKMSILLGVSQMNLGIIMSFFNAKFFRSCVDIW  575

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL+VLII+KW TGS+ADLYHVMIYMFLSPTD+L EN++F GQK  
Sbjct  576   FQFIPQIIFLNSLFGYLSVLIIVKWCTGSKADLYHVMIYMFLSPTDELGENELFPGQKTA  635

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q +L+LLALVAVPWML PKPF++K QH+ RH+G+SY PL   +++++ ET +     GHE
Sbjct  636   QQVLLLLALVAVPWMLLPKPFIMKWQHQNRHQGESYEPLQ-GEESLQVETTH-DSHGGHE  693

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEV VHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA GFNN+
Sbjct  694   EFEFSEVLVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNV  753

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFY GDGYKF PFSF++I  
Sbjct  754   LILIVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYLGDGYKFYPFSFSTIGE  813

Query  327   QDE  319
             ++E
Sbjct  814   EEE  816



>ref|XP_008660336.1| PREDICTED: vacuolar proton ATPase a3-like [Zea mays]
Length=822

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/424 (80%), Positives = 386/424 (91%), Gaps = 1/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICL LATLY + REKKL+SQKLG
Sbjct  399   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYLIIREKKLASQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVI++MA+FSIYTG IYNEFFSVPF LFG+SAYAC D SC DATT GLIK
Sbjct  459   DIMEMMFGGRYVIMMMAVFSIYTGLIYNEFFSVPFGLFGKSAYACRDSSCSDATTEGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDPVWHG+RSELPFLNSLKMKMSILLGVAQMNLGIV+SYFN +FF+N +N+W
Sbjct  519   VRDAYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVAQMNLGIVISYFNAKFFRNSLNVW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTD++ ENQ+F+GQK +
Sbjct  579   YQFIPQLIFLNSLFGYLSLLIIIKWCTGSKADLYHVMIYMFLSPTDEIGENQLFSGQKTV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETD-NhghghgH  691
             Q++L+LLALV+VPWML PKP LLKKQH++RH+G  YA L   D++V +E   +H   H H
Sbjct  639   QLVLLLLALVSVPWMLIPKPLLLKKQHQQRHQGHQYAMLQGVDESVGAELGEHHEEAHDH  698

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFYDKVLL+A GFNN
Sbjct  699   EEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYDKVLLMAWGFNN  758

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             ++ILIIGIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSFA I 
Sbjct  759   VIILIIGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALIR  818

Query  330   HQDE  319
              +++
Sbjct  819   EEED  822



>ref|XP_010531458.1| PREDICTED: V-type proton ATPase subunit a2 [Tarenaya hassleriana]
Length=821

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/424 (80%), Positives = 377/424 (89%), Gaps = 3/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGV+TIVTFPFLFAVMFGDWGHGICL LATLYF+ REKKLSSQKLG
Sbjct  399   IVDAYGIAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIVREKKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI +M+LFSI+TG IYNEFFSVPF LF  SAY C D SC +ATT GLIK
Sbjct  459   DITEMTFGGRYVIFMMSLFSIFTGLIYNEFFSVPFPLFAPSAYDCRDTSCSEATTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++SYFN +FF   +NIW
Sbjct  519   VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSYFNAKFFGIGVNIW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F  QK +
Sbjct  579   FQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQVFPYQKTV  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADD-AVESETDNhghghgH  691
             Q++L+LLALV+VPWML PKPF+LKKQHE RH+G SYA L   DD +++ ET    H H  
Sbjct  639   QLVLLLLALVSVPWMLLPKPFILKKQHETRHQGHSYAQLEETDDNSLQVETSEESHEHEE  698

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
               FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA GFNN
Sbjct  699   --FEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNN  756

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             ++IL++GIIVFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFA ++
Sbjct  757   VIILVVGIIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALVS  816

Query  330   HQDE  319
              +D+
Sbjct  817   SEDD  820



>ref|XP_004290287.1| PREDICTED: vacuolar proton ATPase a3-like [Fragaria vesca subsp. 
vesca]
Length=812

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/424 (79%), Positives = 386/424 (91%), Gaps = 4/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TI+TFPFLFAVMFGDWGHG+CL LATLY + RE+K S++KLG
Sbjct  392   IVDAYGVAKYQEANPAVYTIITFPFLFAVMFGDWGHGLCLLLATLYLIVRERKFSNEKLG  451

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVILLM++FSIYTGFIYNEFFSVPFELFGRSAYAC D SCRDATT GLIK
Sbjct  452   DIMEMAFGGRYVILLMSIFSIYTGFIYNEFFSVPFELFGRSAYACRDLSCRDATTAGLIK  511

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             V  TYPFG+DPVWHG+RSELPFLNSLKMKMSILLGV QMNLGIV+SYFN +FF+N +N+W
Sbjct  512   VGPTYPFGLDPVWHGSRSELPFLNSLKMKMSILLGVVQMNLGIVISYFNAKFFQNGLNVW  571

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL+VLI++KW+TGS+ DLYHVMIYMFLSPTD+L ENQ+F+GQK +
Sbjct  572   FQFIPQLIFLNSLFGYLSVLIVMKWWTGSKVDLYHVMIYMFLSPTDELGENQLFSGQKTV  631

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+ LALVAVPWML PKPFL+KKQHE RH+GQSYA L N +++++  +++   GHGHE
Sbjct  632   QLVLLGLALVAVPWMLIPKPFLMKKQHEARHQGQSYALLENTEESLQVNSNH--DGHGHE  689

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLL+A GFNN 
Sbjct  690   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLMAFGFNNW  749

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I I+GI+VF+ ATVGVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF  + H
Sbjct  750   LIRIVGILVFVFATVGVLLLMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSF--VLH  807

Query  327   QDEE  316
              DE+
Sbjct  808   DDED  811



>emb|CAB38828.1| putative proton pump [Arabidopsis thaliana]
 emb|CAB80571.1| putative proton pump [Arabidopsis thaliana]
Length=843

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/445 (76%), Positives = 380/445 (85%), Gaps = 23/445 (5%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGIC+ LAT+Y + +EKKL+SQKLG
Sbjct  400   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICILLATMYLILKEKKLASQKLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVIL+M+LFSIYTG IYNEFFS+PF LF  SAY C D SC +ATT GLIK
Sbjct  460   DIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSIPFPLFAPSAYDCRDVSCSEATTIGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFF-------  1069
             VRDTYPFG+DPVWHG+RSELPFLNSLKMKMSILLGV+QMNLGI++SYFN RFF       
Sbjct  520   VRDTYPFGLDPVWHGSRSELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSRALS  579

Query  1068  -------KNDINIWH--------QFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMI  934
                    KN  +  H        QF+PQMIFLNSLFGYL+VLII+KW TGSQADLYHVMI
Sbjct  580   LSSSLNSKNQSSSQHLILRACRFQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADLYHVMI  639

Query  933   YMFLSPTDDLEENQIFTGQKYLQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAP  754
             YMFLSP D+L ENQ+F  QK LQ++L+ LALV+VP ML PKPF+LKKQHE RH+GQ+YAP
Sbjct  640   YMFLSPMDELGENQLFPHQKTLQLVLLFLALVSVPCMLLPKPFILKKQHEARHQGQAYAP  699

Query  753   LHNADDAVESETDNhghghgHEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLA  574
             L   D+++  ET N G  HGHE+FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLA
Sbjct  700   LDETDESLHVET-NGGGSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLA  758

Query  573   HSELSSVFYDKVLLLAMgfnniviliigiivfICATVGVLLVMETLSAFLHALRLHWVEF  394
             HSELSSVFY+KVLLLA G+NN +ILI+G++VFI ATVGVLLVMETLSAFLHALRLHWVEF
Sbjct  759   HSELSSVFYEKVLLLAWGYNNPLILIVGVLVFIFATVGVLLVMETLSAFLHALRLHWVEF  818

Query  393   QNKFYEGDGYKFSPFSFASIAHQDE  319
             QNKFYEGDGYKF+PF+F   A++DE
Sbjct  819   QNKFYEGDGYKFAPFTFIFTANEDE  843



>gb|EMT31646.1| Vacuolar proton translocating ATPase 100 kDa subunit [Aegilops 
tauschii]
Length=757

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/424 (74%), Positives = 359/424 (85%), Gaps = 29/424 (7%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGV+TI+TFPFLFAVMFGDWGHGIC+ LATLY + REKK +SQKLG
Sbjct  362   IVDAYGVAKYQEANPGVYTIITFPFLFAVMFGDWGHGICILLATLYLIIREKKFASQKLG  421

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRY+I++M++FSIYTG IYNEFFSVPFELF +SAYAC D SC D+TT GLIK
Sbjct  422   DIMEMMFGGRYIIMMMSIFSIYTGLIYNEFFSVPFELFAKSAYACRDSSCSDSTTEGLIK  481

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDPVWHG+RSELPFLNSLKMKMSILLGV+QMNLGI +SYFN +FF+N +NIW
Sbjct  482   VRDTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGVSQMNLGIFMSYFNAKFFRNSVNIW  541

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGS+ADLYHVMIYMFLSPTDD+ ENQ+F GQK L
Sbjct  542   YQFVPQLIFLNSLFGYLSMLIIIKWCTGSKADLYHVMIYMFLSPTDDMGENQLFPGQKTL  601

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESE-TDNhghghgH  691
             Q                            RH+G  YA L  AD++V +E  +++   + H
Sbjct  602   Q----------------------------RHQGHQYAMLEGADESVVAELGEHNEESNHH  633

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELS+VFYDKVLLL +G+NN
Sbjct  634   EEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYDKVLLLTLGYNN  693

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             I IL IG++VFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSFA I+
Sbjct  694   IFILAIGVVVFICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALIS  753

Query  330   HQDE  319
               +E
Sbjct  754   EDEE  757



>gb|EMT24018.1| Vacuolar proton translocating ATPase 100 kDa subunit [Aegilops 
tauschii]
Length=818

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/423 (74%), Positives = 367/423 (87%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+A YQE NPG+FTIVTFPFLFAVMFGDWGHGIC+FL  +Y + REKKL+SQKL 
Sbjct  397   IVDAYGIASYQEVNPGLFTIVTFPFLFAVMFGDWGHGICIFLTAMYLIIREKKLASQKLD  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI+E+ F+GRYVIL+M+LFSIYTG IYNEFFSVPFELFG+SAYAC DPSC DATT GL++
Sbjct  457   DIVEIMFAGRYVILMMSLFSIYTGLIYNEFFSVPFELFGKSAYACHDPSCGDATTEGLVR  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             V  TYPFGVDPVWHG+RSELPFLNSLKMKMSILLG+AQMNLGIVLS+FN ++FKN +N+W
Sbjct  517   VGQTYPFGVDPVWHGSRSELPFLNSLKMKMSILLGIAQMNLGIVLSFFNAKYFKNIVNVW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGS+ADLYH+MIYMFLSPTDD+ ENQ+F GQ+ +
Sbjct  577   YQFVPQLIFLNSLFGYLSLLIIIKWCTGSKADLYHIMIYMFLSPTDDIGENQLFPGQRIV  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWMLFPKP  LKKQHE+RH+GQ Y  L   D++V      H + H HE
Sbjct  637   QLVLLLLALVSVPWMLFPKPLFLKKQHEQRHQGQHYTMLQETDESVAQLGGQHENPHNHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEV VHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLL    N I
Sbjct  697   EFEFSEVLVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLDKYNNVI  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             ++++   +    AT+ VLL METLSAFLHALRLHWVEFQ KFY+G GYKF+PF+FASI  
Sbjct  757   ILVMGVTVFLF-ATIFVLLSMETLSAFLHALRLHWVEFQGKFYDGSGYKFAPFAFASIIE  815

Query  327   QDE  319
             +++
Sbjct  816   EED  818



>ref|XP_006828785.1| hypothetical protein AMTR_s00001p00110790 [Amborella trichopoda]
 gb|ERM96201.1| hypothetical protein AMTR_s00001p00110790 [Amborella trichopoda]
Length=819

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/424 (79%), Positives = 377/424 (89%), Gaps = 3/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANPGV+TIVTFPFLFAVMFGDWGHGICL LA L  VF+EKKLSSQKLG
Sbjct  398   IVDAYGVARYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLAALILVFKEKKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI+EM F GRYVIL+M+LFSIYTG IYNEFFSVPF LFGRSAY C +PSC DA T GLIK
Sbjct  458   DILEMTFGGRYVILMMSLFSIYTGLIYNEFFSVPFSLFGRSAYECREPSCSDAYTGGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP WHG+R+ELPFLNSLKMKMSILLGVAQMNLGIVLSYFN RFF N +N+W
Sbjct  518   VRDAYPFGVDPTWHGSRTELPFLNSLKMKMSILLGVAQMNLGIVLSYFNARFFGNYVNVW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL+VL+I+KW TGS ADLYH+MIYMFLSPTDDL ENQ+F GQK L
Sbjct  578   YQFVPQMIFLNSLFGYLSVLVIVKWCTGSTADLYHIMIYMFLSPTDDLGENQLFFGQKTL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNAD-DAVESETDNhghghgH  691
             Q++L+LLALV+VPWMLFPKPF+LKKQ+++RHRG SY  +   D D+ E E  +    HGH
Sbjct  638   QLVLLLLALVSVPWMLFPKPFILKKQYDDRHRGHSYDVIPTTDPDSFEMEAGH--DSHGH  695

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVL+LA G+NN
Sbjct  696   EEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLILAWGYNN  755

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             I ILIIG IVF  AT+GVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF PF+F+ + 
Sbjct  756   IFILIIGFIVFAFATIGVLLIMETLSAFLHALRLHWVEFQNKFYEGDGYKFLPFAFSLLG  815

Query  330   HQDE  319
              +D+
Sbjct  816   EEDD  819



>dbj|BAC41321.1| hypothetical protein [Lotus japonicus]
Length=702

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/423 (76%), Positives = 369/423 (87%), Gaps = 14/423 (3%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+D+YGVAKYQEANP V+T+VTFPFLFAVMFGDWGHGICL LA LYF+ RE+KLSSQKL 
Sbjct  292   IIDSYGVAKYQEANPTVYTVVTFPFLFAVMFGDWGHGICLLLAALYFIIRERKLSSQKLD  351

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVILLM+LFSIYTG IYNEFFSVPFELFG SAY C D +C +ATT GLIK
Sbjct  352   DITEMTFGGRYVILLMSLFSIYTGLIYNEFFSVPFELFGPSAYECRDLACSEATTIGLIK  411

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R TYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN  FF+N +NI 
Sbjct  412   ARRTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAIFFRNSVNI-  470

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
                         LFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL EN++F GQK L
Sbjct  471   -----------CLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENELFAGQKNL  519

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA+VAVPWML PKPF+LKKQHE RH  +SYAPL + +++++ E+++    HGHE
Sbjct  520   QLVLLLLAVVAVPWMLLPKPFILKKQHEARHGAESYAPLPSTEESLQVESNH--DSHGHE  577

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLLLA G+NN+
Sbjct  578   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNV  637

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +ILI+GI+VFI ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF+ +  
Sbjct  638   IILIVGILVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFFPFSFSLLDE  697

Query  327   QDE  319
             +DE
Sbjct  698   EDE  700



>dbj|BAJ94235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=801

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/423 (73%), Positives = 358/423 (85%), Gaps = 18/423 (4%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+A YQE NPG+FTIVTFPFLFAVMFGDWGHGIC+FL+ LY + REKKL+SQKL 
Sbjct  397   IVDAYGIASYQEINPGLFTIVTFPFLFAVMFGDWGHGICIFLSALYLIIREKKLASQKLD  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI+++ F GRYVIL+M+LFSIYTG IYNEFFSVPFELFG+SAYAC DPSC DATT GL+K
Sbjct  457   DIVQIMFDGRYVILMMSLFSIYTGLIYNEFFSVPFELFGKSAYACHDPSCGDATTEGLVK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR  YPFGVDPVWHG+RSELPFLNSLKMKMSILLG+AQMNLGIVLS+FN ++FKN +NIW
Sbjct  517   VRQAYPFGVDPVWHGSRSELPFLNSLKMKMSILLGIAQMNLGIVLSFFNAKYFKNTVNIW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             HQFVPQ+IFLNSLFGYL+ LII+KW TGS+ADLYH+MIYMFLSPTDD+ ENQ+F GQ+ +
Sbjct  577   HQFVPQLIFLNSLFGYLSFLIIIKWCTGSKADLYHIMIYMFLSPTDDIGENQLFPGQRIV  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q                  P  LKKQHE+RH+GQ Y  L   D++V      H + H HE
Sbjct  637   Q------------------PLFLKKQHEQRHQGQHYTMLQETDESVAQLIGQHENPHQHE  678

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +FEFSEV VHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA G+NN+
Sbjct  679   EFEFSEVLVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGYNNV  738

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +IL++G+IVF+ AT+ VLL METLSAFLHALRLHWVEFQ KFYEG GYKF+PFSFASI  
Sbjct  739   IILVVGVIVFLFATIIVLLSMETLSAFLHALRLHWVEFQGKFYEGGGYKFAPFSFASIIE  798

Query  327   QDE  319
             +++
Sbjct  799   EED  801



>ref|XP_006594994.1| PREDICTED: vacuolar proton ATPase a1-like isoform X1 [Glycine 
max]
 gb|KHN30237.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Glycine soja]
Length=820

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/423 (73%), Positives = 358/423 (85%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T V FPFLFA+MFGDWGHGICL L  L  + RE KLS+QKLG
Sbjct  399   IVDAYGVARYQEANPAVYTTVIFPFLFALMFGDWGHGICLLLGALVLIARENKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLMALFSIY G IYNEFFSVPF +FG SAY C D SCRDA T GLIK
Sbjct  459   SFMEMLFGGRYVLLLMALFSIYCGLIYNEFFSVPFHIFGASAYKCRDSSCRDAHTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +D YPFGVDP W G+RSELPFLNSLKMKMSIL GVA MNLGIVLSYFN  FF+N ++I 
Sbjct  519   YQDPYPFGVDPSWRGSRSELPFLNSLKMKMSILFGVAHMNLGIVLSYFNAHFFRNSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQ+ L
Sbjct  579   YQFVPQMIFLNSLFGYLSLLIVIKWCTGSQADLYHVMIYMFLSPTDNLGENQLFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLA++AVPWMLFPKPF+LKK H ER +G+SY  L+ ++  +E+E D+    H HE
Sbjct  639   QIVLLLLAVIAVPWMLFPKPFILKKLHTERFQGRSYGILNTSEVDLEAEPDS-ARQHHHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  698   EFNFSEVFVHQMIHAIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+ME+LSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  758   VIRLVGLTVFAFATAFILLMMESLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFASLTE  817

Query  327   QDE  319
              D+
Sbjct  818   DDD  820



>ref|XP_007015509.1| Vacuolar proton ATPase A1 isoform 3 [Theobroma cacao]
 gb|EOY33128.1| Vacuolar proton ATPase A1 isoform 3 [Theobroma cacao]
Length=820

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/423 (73%), Positives = 360/423 (85%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQE+NP V+T++TFPFLFAVMFGDWGHGICL L  L  + RE +LS+QKLG
Sbjct  400   IVDAYGVARYQESNPAVYTVITFPFLFAVMFGDWGHGICLLLGALVLIARESRLSTQKLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +CRDA + GLIK
Sbjct  460   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDATCRDAQSAGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF+N ++I 
Sbjct  520   FRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFRNSLDIR  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL +N++F GQ+ L
Sbjct  580   YQFVPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGDNELFWGQRPL  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLALVAVPWMLFPKPF+LKK H ER +G++Y  L  ++  ++ E D+      HE
Sbjct  640   QIVLLLLALVAVPWMLFPKPFILKKLHSERFQGRTYGMLGTSEFDLDVEPDS--ARQHHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  698   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PF+FA I  
Sbjct  758   VIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPFAFALITE  817

Query  327   QDE  319
              D+
Sbjct  818   DDD  820



>ref|XP_007150235.1| hypothetical protein PHAVU_005G137800g [Phaseolus vulgaris]
 ref|XP_007150236.1| hypothetical protein PHAVU_005G137800g [Phaseolus vulgaris]
 gb|ESW22229.1| hypothetical protein PHAVU_005G137800g [Phaseolus vulgaris]
 gb|ESW22230.1| hypothetical protein PHAVU_005G137800g [Phaseolus vulgaris]
Length=820

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/423 (73%), Positives = 358/423 (85%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T + FPFLFA+MFGDWGHGICL L  L  + RE KLS+QKLG
Sbjct  399   IVDAYGVARYQEANPAVYTTIIFPFLFALMFGDWGHGICLLLGALVLIARENKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLMALFSIY G IYNEFFSVPF +FG SAY C D SCRDA T GL+K
Sbjct  459   SFMEMLFGGRYVLLLMALFSIYCGLIYNEFFSVPFHIFGASAYKCRDSSCRDAHTIGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +D YPFGVDP W G+RSELPFLNSLKMKMSIL GVA MNLGI+LSYFN RFF + ++I 
Sbjct  519   YQDPYPFGVDPSWRGSRSELPFLNSLKMKMSILFGVAHMNLGIILSYFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQK L
Sbjct  579   YQFVPQIIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDNLGENQLFWGQKPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLA++AVPWMLFPKPF+LKK H ER +G++Y  L+ ++  +E+E D+    H HE
Sbjct  639   QIVLLLLAVIAVPWMLFPKPFILKKLHTERFQGRNYGLLNTSEVDIEAEPDS-ARQHHHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  698   EFNFSEVFVHQMIHAIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+ME+LSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  758   VIRLVGLTVFSFATAFILLMMESLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFASLTE  817

Query  327   QDE  319
              D+
Sbjct  818   DDD  820



>ref|XP_003547511.1| PREDICTED: vacuolar proton ATPase a1-like [Glycine max]
Length=822

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/423 (73%), Positives = 356/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T + FPFLFA+MFGDWGHGICL L  L  + R+ KLS+QKLG
Sbjct  402   IVDAYGVARYQEANPAVYTTIIFPFLFALMFGDWGHGICLLLGALVLIARQNKLSTQKLG  461

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLMALFSIY G IYNEFFSVPF +FG SAY C D SCRDA T GLIK
Sbjct  462   SFMEMLFGGRYVLLLMALFSIYCGLIYNEFFSVPFHIFGASAYKCRDSSCRDAHTIGLIK  521

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +D YPFGVDP W G+RSEL FLNSLKMKMSIL GVA MNLGI+LSYFN  FF+N ++I 
Sbjct  522   YQDPYPFGVDPSWRGSRSELSFLNSLKMKMSILFGVAHMNLGIILSYFNAHFFQNSLDIR  581

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL+VLI++KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQ+ L
Sbjct  582   YQFVPQMIFLNSLFGYLSVLIVIKWCTGSQADLYHVMIYMFLSPTDNLGENQLFWGQRPL  641

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLA++AVPWMLFPKPF+LKK H ER +G+SY  L+ ++  +E+E D+      HE
Sbjct  642   QIVLLLLAVIAVPWMLFPKPFILKKLHTERFQGRSYGILNTSEVDLEAEPDS--ARQHHE  699

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  700   EFNFSEVFVHQMIHAIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  759

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI +IG+ VF  AT  +LL+ME+LSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  760   VIRLIGLTVFAFATAFILLMMESLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFASLTE  819

Query  327   QDE  319
              D+
Sbjct  820   DDD  822



>ref|XP_004294683.1| PREDICTED: vacuolar proton ATPase a1-like [Fragaria vesca subsp. 
vesca]
Length=820

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/424 (71%), Positives = 360/424 (85%), Gaps = 2/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T++TFPFLFAVMFGDWGHGICL +  L  + RE+KL++QKLG
Sbjct  399   IVDAYGVARYQEANPAVYTVITFPFLFAVMFGDWGHGICLLMGALVLIARERKLAAQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C DA T GLIK
Sbjct  459   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDATCSDAHTVGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMK+SILLGV QMN+GI+LSYFN RFF + I+I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPFLNSLKMKLSILLGVVQMNVGIMLSYFNARFFNSSIDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++L+++KW TGS+ADLYHVMIYMFLSPTDDL  NQ+F GQ+ L
Sbjct  579   YQFVPQMIFLNSLFGYLSLLVVIKWCTGSKADLYHVMIYMFLSPTDDLGVNQLFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L++LAL+AVPWMLFPKPF+L+K H ER +G++Y  L  ++  ++ ETD       HE
Sbjct  639   QIILLVLALIAVPWMLFPKPFILRKLHTERFQGRTYGMLGTSEMDLDVETD--PVRQHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+++ 
Sbjct  697   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDSF  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+A 
Sbjct  757   IIRLIGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYLGDGYKFKPFSFASLAT  816

Query  327   QDEE  316
             +DE+
Sbjct  817   EDED  820



>gb|KHN33443.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Glycine soja]
Length=822

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/423 (73%), Positives = 356/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T + FPFLFA+MFGDWGHGICL L  L  + R+ KLS+QKLG
Sbjct  402   IVDAYGVARYQEANPAVYTTIIFPFLFALMFGDWGHGICLLLGALVLIARQNKLSTQKLG  461

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLMALFSIY G IYNEFFSVPF +FG SAY C D SCRDA T GLIK
Sbjct  462   SFMEMLFGGRYVLLLMALFSIYCGLIYNEFFSVPFHIFGASAYKCRDSSCRDAHTIGLIK  521

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +D YPFGVDP W G+RSEL FLNSLKMKMSIL GVA MNLGI+LSYFN  FF+N ++I 
Sbjct  522   YQDPYPFGVDPSWRGSRSELSFLNSLKMKMSILFGVAHMNLGIILSYFNAHFFQNSLDIR  581

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL+VLI++KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQ+ L
Sbjct  582   YQFVPQMIFLNSLFGYLSVLIVIKWCTGSQADLYHVMIYMFLSPTDNLGENQLFWGQRPL  641

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLA++AVPWMLFPKPF+LKK H ER +G+SY  L+ ++  +E+E D+      HE
Sbjct  642   QIVLLLLAVIAVPWMLFPKPFILKKLHTERFQGRSYGILNTSEVDLEAEPDS--ARQHHE  699

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  700   EFNFSEVFVHQMIHAIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  759

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI +IG+ VF  AT  +LL+ME+LSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  760   VIRLIGLTVFAFATAFILLMMESLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFASLTE  819

Query  327   QDE  319
              D+
Sbjct  820   DDD  822



>ref|XP_010253515.1| PREDICTED: V-type proton ATPase subunit a1-like [Nelumbo nucifera]
Length=818

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/423 (72%), Positives = 360/423 (85%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T++TFPFLFAVMFGDWGHGICL L  +  + RE KL SQKLG
Sbjct  398   IVDAYGVARYQEANPAVYTVITFPFLFAVMFGDWGHGICLLLGAIILIARENKLGSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYVILLM+LFSIY G IYNEFFSVP+ +FG +AY C D +CRDA T GL+K
Sbjct  458   SFMEMAFGGRYVILLMSLFSIYCGLIYNEFFSVPYHIFGGTAYKCRDTTCRDAHTAGLVK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGV+QMNLGI+LSYFN RFF + ++I 
Sbjct  518   YRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVSQMNLGIILSYFNARFFGSSLDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LI++KWYTGSQADLYHVMIYMFLSPTD+L ENQ+F GQ+ L
Sbjct  578   YQFVPQMIFLNSLFGYLSLLIVIKWYTGSQADLYHVMIYMFLSPTDNLGENQLFWGQRPL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLA+VAVPWML PKPF+L+KQH ER +G++Y  L  ++   + E D+       E
Sbjct  638   QILLLLLAIVAVPWMLLPKPFILRKQHLERFQGRTYRMLGTSEMDPDGEPDS--ARQHLE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  696   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG++VF  AT  +LL+METLSAFLHALRLHWVEFQ+KFY GDGYKF PFSFAS+  
Sbjct  756   LIRLIGLVVFAFATAFILLMMETLSAFLHALRLHWVEFQSKFYHGDGYKFKPFSFASLPD  815

Query  327   QDE  319
              D+
Sbjct  816   DDD  818



>ref|XP_007017676.1| Vacuolar proton ATPase A3 isoform 4 [Theobroma cacao]
 gb|EOY14901.1| Vacuolar proton ATPase A3 isoform 4 [Theobroma cacao]
Length=751

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/354 (83%), Positives = 320/354 (90%), Gaps = 1/354 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANP VFTI+TFPFLFAVMFGDWGHGICL LAT YF+ REKK SSQKLG
Sbjct  397   IVDAYGIAKYQEANPAVFTIITFPFLFAVMFGDWGHGICLCLATSYFIIREKKFSSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++MALFSIYTG IYNEFFSVPFELFG SAY C DPSC DA+T GL+K
Sbjct  457   DITEMIFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGPSAYGCHDPSCSDASTAGLVK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHGTRSELPFLNSLKMKMSIL+GVAQMNLGI+LSYFN +FFKN+INIW
Sbjct  517   VRATYPFGVDPKWHGTRSELPFLNSLKMKMSILIGVAQMNLGIILSYFNAKFFKNEINIW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK+L
Sbjct  577   YQFVPQLIFLNSLFGYLSLLIVVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFFGQKFL  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+L ALV+VPWMLFPKPFLLKKQHEERHRGQSYA L ++DD    E + H     HE
Sbjct  637   QIVLLLAALVSVPWMLFPKPFLLKKQHEERHRGQSYALLDSSDDD-PLEMELHHGSGSHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLA  526
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA
Sbjct  696   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLA  749



>ref|XP_007017675.1| Vacuolar proton ATPase A3 isoform 3 [Theobroma cacao]
 gb|EOY14900.1| Vacuolar proton ATPase A3 isoform 3 [Theobroma cacao]
Length=753

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/354 (83%), Positives = 320/354 (90%), Gaps = 1/354 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANP VFTI+TFPFLFAVMFGDWGHGICL LAT YF+ REKK SSQKLG
Sbjct  397   IVDAYGIAKYQEANPAVFTIITFPFLFAVMFGDWGHGICLCLATSYFIIREKKFSSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVI++MALFSIYTG IYNEFFSVPFELFG SAY C DPSC DA+T GL+K
Sbjct  457   DITEMIFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGPSAYGCHDPSCSDASTAGLVK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP WHGTRSELPFLNSLKMKMSIL+GVAQMNLGI+LSYFN +FFKN+INIW
Sbjct  517   VRATYPFGVDPKWHGTRSELPFLNSLKMKMSILIGVAQMNLGIILSYFNAKFFKNEINIW  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK+L
Sbjct  577   YQFVPQLIFLNSLFGYLSLLIVVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFFGQKFL  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+L ALV+VPWMLFPKPFLLKKQHEERHRGQSYA L ++DD    E + H     HE
Sbjct  637   QIVLLLAALVSVPWMLFPKPFLLKKQHEERHRGQSYALLDSSDDD-PLEMELHHGSGSHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLA  526
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLLLA
Sbjct  696   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLLA  749



>ref|XP_007015511.1| Vacuolar proton ATPase A1 isoform 5 [Theobroma cacao]
 gb|EOY33130.1| Vacuolar proton ATPase A1 isoform 5 [Theobroma cacao]
Length=821

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/424 (73%), Positives = 360/424 (85%), Gaps = 3/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQE+NP V+T++TFPFLFAVMFGDWGHGICL L  L  + RE +LS+QKLG
Sbjct  400   IVDAYGVARYQESNPAVYTVITFPFLFAVMFGDWGHGICLLLGALVLIARESRLSTQKLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +CRDA + GLIK
Sbjct  460   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDATCRDAQSAGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF+N ++I 
Sbjct  520   FRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFRNSLDIR  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL +N++F GQ+ L
Sbjct  580   YQFVPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGDNELFWGQRPL  639

Query  867   -QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgH  691
              QI+L+LLALVAVPWMLFPKPF+LKK H ER +G++Y  L  ++  ++ E D+      H
Sbjct  640   QQIVLLLLALVAVPWMLFPKPFILKKLHSERFQGRTYGMLGTSEFDLDVEPDS--ARQHH  697

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N
Sbjct  698   EEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDN  757

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             IVI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PF+FA I 
Sbjct  758   IVIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPFAFALIT  817

Query  330   HQDE  319
               D+
Sbjct  818   EDDD  821



>ref|XP_011089368.1| PREDICTED: V-type proton ATPase subunit a1-like isoform X1 [Sesamum 
indicum]
Length=819

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/424 (71%), Positives = 359/424 (85%), Gaps = 2/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TI+TFPFLFAVMFGDWGHGICL L  L+ + REKKL SQKLG
Sbjct  398   IVDAYGVAKYQEANPAVYTIITFPFLFAVMFGDWGHGICLLLGALFLIAREKKLGSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C D+ + GL+K
Sbjct  458   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGNSAYRCRDTTCSDSRSVGLVK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +DTYPFGVDP W G+RSELPFLNSLKMKMSIL G+AQMNLGI+LSYFN R+F N ++I 
Sbjct  518   YQDTYPFGVDPSWRGSRSELPFLNSLKMKMSILFGIAQMNLGIILSYFNARYFGNSLDIK  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW +GSQADLYHVMIYMFLSP +DL EN++F GQ  L
Sbjct  578   YQFVPQMIFLNSLFGYLSLLIIIKWCSGSQADLYHVMIYMFLSPFEDLGENKLFWGQNVL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA++AVPWMLFPKPF+LK+ H ER +G+SY  L  +D   + E D+       E
Sbjct  638   QVILLLLAVIAVPWMLFPKPFILKRLHTERFQGRSYTALGTSDIYDDEEPDS-AREPHLE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  697   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA++ +
Sbjct  757   VIRLVGLAVFSFATAFILLMMETLSAFLHALRLHWVEFQNKFYSGDGYKFRPFSFAAL-N  815

Query  327   QDEE  316
             +DE+
Sbjct  816   EDED  819



>ref|XP_010691625.1| PREDICTED: V-type proton ATPase subunit a1 [Beta vulgaris subsp. 
vulgaris]
Length=817

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/423 (71%), Positives = 362/423 (86%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGV++YQEANP V+T+VTFPFLFAVMFGDWGHGICL +  L+ + RE KLSSQ+LG
Sbjct  396   IVDAYGVSRYQEANPAVYTVVTFPFLFAVMFGDWGHGICLLMLALFLIAREGKLSSQRLG  455

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRY++LLMALFSIY G IYNEFFSVPF +FG+SAY C D +C D+ T GL+K
Sbjct  456   SFMEMLFGGRYIVLLMALFSIYCGLIYNEFFSVPFHIFGQSAYKCRDATCSDSYTAGLVK  515

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN R+F N ++I 
Sbjct  516   FRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIMLSYFNARYFSNSLDIR  575

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++L+I+KW TGS+ADLYHVMIYMFLSP +DL EN++F GQ+ L
Sbjct  576   YQFLPQMIFLNSLFGYLSLLVIIKWCTGSRADLYHVMIYMFLSPFEDLGENELFWGQRPL  635

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLA++AVPWMLFPKPF+LKK H ER +G++Y  LH+++  +  E D+    H HE
Sbjct  636   QILLLLLAMIAVPWMLFPKPFILKKLHSERFQGRTYGILHSSEMDLVGEPDS-ARQHHHE  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSE+FVHQLIH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  695   DFNFSEIFVHQLIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             V+ ++G+ VF  AT  +LL+ME+LSAFLHALRLHWVE+QNKFY GDGYKF PFSFA +  
Sbjct  755   VVRLVGLAVFAFATAFILLMMESLSAFLHALRLHWVEYQNKFYHGDGYKFRPFSFAILTD  814

Query  327   QDE  319
             +D+
Sbjct  815   EDD  817



>gb|KDO73121.1| hypothetical protein CISIN_1g003454mg [Citrus sinensis]
Length=684

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/424 (72%), Positives = 356/424 (84%), Gaps = 4/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+ ++TFPFLFAVMFGDWGHGICL L  L  + RE+KL +QKLG
Sbjct  264   IVDAYGVARYQEANPAVYAVITFPFLFAVMFGDWGHGICLLLGALVLIARERKLGNQKLG  323

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVP+ +FG SAY C D +C DA T GL+K
Sbjct  324   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPYHIFGGSAYRCRDTTCSDAYTAGLVK  383

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R+ YPFGVDP W G+RSELPFLNSLKMKMSILLGV QMNLGI+LSYF+ RFF + ++I 
Sbjct  384   YREPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVTQMNLGIILSYFDARFFGSSLDIR  443

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL EN++F GQ+ L
Sbjct  444   YQFVPQLIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGENELFWGQRPL  503

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLA VAVPWMLFPKPF+L+K H ER +G++Y  L  ++  +E E D+      HE
Sbjct  504   QILLLLLATVAVPWMLFPKPFILRKLHTERFQGRTYGILGTSEMDLEVEPDS--ARQHHE  561

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSE+FVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  562   DFNFSEIFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  621

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA I  
Sbjct  622   VIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFALI--  679

Query  327   QDEE  316
              DEE
Sbjct  680   NDEE  683



>ref|XP_010032049.1| PREDICTED: V-type proton ATPase subunit a1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW51435.1| hypothetical protein EUGRSUZ_J00960 [Eucalyptus grandis]
Length=820

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/423 (72%), Positives = 359/423 (85%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGV +YQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L  + RE KL ++KLG
Sbjct  398   IVDAYGVGRYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLIARESKLGNKKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRY++LLM+LFSIY G IYNEFFSVPF +FGRSAY C D +C DA + GLIK
Sbjct  458   SFMEMLFGGRYILLLMSLFSIYCGLIYNEFFSVPFHIFGRSAYKCRDTTCSDAYSVGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN R+F++ ++I 
Sbjct  518   YRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARYFESSLDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQ+ L
Sbjct  578   YQFVPQIIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDNLGENQLFWGQRPL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLAL+AVPWMLFPKPF+LK+ H ER +G++Y  L  ++  VE+E D+      HE
Sbjct  638   QILLLLLALIAVPWMLFPKPFILKRLHIERFQGRTYGVLGISEMDVEAEPDSARAQQHHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FS+VFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  698   DFNFSKVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNV  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA +  
Sbjct  758   IIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFALLND  817

Query  327   QDE  319
              DE
Sbjct  818   DDE  820



>ref|XP_010043693.1| PREDICTED: V-type proton ATPase subunit a1 isoform X2 [Eucalyptus 
grandis]
Length=752

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/423 (72%), Positives = 358/423 (85%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T+VTFPFLFAVMFGDWGHGICL L  L  + +E+KL+ QKLG
Sbjct  330   IVDAYGVARYQEANPAVYTVVTFPFLFAVMFGDWGHGICLLLGALVLIAQERKLTGQKLG  389

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D SC DA + GLIK
Sbjct  390   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFNIFGESAYKCRDTSCSDARSVGLIK  449

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +D YPFGVDP W G+RSELPFLNSLKMKMSILLGV QMNLGI+LSYFN RFFK+ ++I 
Sbjct  450   YQDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVQMNLGIILSYFNARFFKSTLDIR  509

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  510   FQFVPQVIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGENQLFWGQKPL  569

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLAL+AVPWMLFPKPF+LKK H ER +G++Y  L  ++  ++ +T+       HE
Sbjct  570   QIILLLLALIAVPWMLFPKPFILKKLHSERFQGRTYQMLGTSEMDIDGDTEPDSARQHHE  629

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  630   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  689

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSF+ +  
Sbjct  690   IIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFSLLTE  749

Query  327   QDE  319
             +++
Sbjct  750   EED  752



>ref|XP_010032050.1| PREDICTED: V-type proton ATPase subunit a1-like isoform X2 [Eucalyptus 
grandis]
Length=818

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/423 (72%), Positives = 359/423 (85%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGV +YQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L  + RE KL ++KLG
Sbjct  396   IVDAYGVGRYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLIARESKLGNKKLG  455

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRY++LLM+LFSIY G IYNEFFSVPF +FGRSAY C D +C DA + GLIK
Sbjct  456   SFMEMLFGGRYILLLMSLFSIYCGLIYNEFFSVPFHIFGRSAYKCRDTTCSDAYSVGLIK  515

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN R+F++ ++I 
Sbjct  516   YRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARYFESSLDIR  575

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQ+ L
Sbjct  576   YQFVPQIIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDNLGENQLFWGQRPL  635

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLAL+AVPWMLFPKPF+LK+ H ER +G++Y  L  ++  VE+E D+      HE
Sbjct  636   QILLLLLALIAVPWMLFPKPFILKRLHIERFQGRTYGVLGISEMDVEAEPDSARAQQHHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FS+VFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  696   DFNFSKVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNV  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA +  
Sbjct  756   IIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFALLND  815

Query  327   QDE  319
              DE
Sbjct  816   DDE  818



>ref|XP_008358210.1| PREDICTED: vacuolar proton ATPase a1 [Malus domestica]
Length=819

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/423 (72%), Positives = 357/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T++TFPFLFAVMFGDWGHGICL L  L  + RE KLS+QKLG
Sbjct  399   IVDAYGVARYQEANPAVYTVITFPFLFAVMFGDWGHGICLLLGALVLIARESKLSAQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C +  T GLIK
Sbjct  459   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTACSEVHTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGV QMNLGI+LSYFN RFF + ++IW
Sbjct  519   YRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVQMNLGILLSYFNARFFSSSLDIW  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++L+++KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQ+ L
Sbjct  579   YQFVPQMIFLNSLFGYLSLLVVIKWCTGSQADLYHVMIYMFLSPTDDLGENQLFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLAL+AVPWMLFPKPF+LKK H ER +G++Y  L  ++  +E E D+      HE
Sbjct  639   QIILLLLALIAVPWMLFPKPFILKKLHTERFQGRAYGMLGTSEMDLEVEPDS--ARQHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+++ 
Sbjct  697   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDSF  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG+ VF  AT  +LL+METLSAFLHALRLHWVE+QNKFY GDGYKF PFSFASI  
Sbjct  757   IIRLIGLSVFAFATAFILLMMETLSAFLHALRLHWVEYQNKFYHGDGYKFKPFSFASITE  816

Query  327   QDE  319
              ++
Sbjct  817   DED  819



>ref|XP_010244988.1| PREDICTED: V-type proton ATPase subunit a1-like [Nelumbo nucifera]
 ref|XP_010244989.1| PREDICTED: V-type proton ATPase subunit a1-like [Nelumbo nucifera]
 ref|XP_010244991.1| PREDICTED: V-type proton ATPase subunit a1-like [Nelumbo nucifera]
Length=818

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/423 (72%), Positives = 357/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA YQEANP V+T++TFPFLFAVMFGDWGHGICL L  +  +  E +L S+KLG
Sbjct  398   IVDAYGVAGYQEANPAVYTVITFPFLFAVMFGDWGHGICLLLGAIILIACESRLGSRKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYVILLMALFSIY G IYNEFFSVP+ +FG SAY C D +CRDA T GLIK
Sbjct  458   SFMEMAFGGRYVILLMALFSIYCGLIYNEFFSVPYHIFGGSAYKCRDATCRDAHTAGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF + ++IW
Sbjct  518   YRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFGSSLDIW  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSPT+DL ENQ+F GQK L
Sbjct  578   YQFVPQMIFLNSLFGYLSLLIVIKWCTGSQADLYHVMIYMFLSPTEDLGENQLFWGQKPL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+LL+LLA+VAVPWMLFPKPF+L+K H ER +G++Y  L  +D  ++ E D+    H  +
Sbjct  638   QMLLLLLAVVAVPWMLFPKPFILRKLHLERFQGRTYGILDTSDMDLDVEPDS--ARHHVD  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVL +VSNTASYLRLWALSLAHSELS+VFY+KVLLLA GF++I
Sbjct  696   EFNFSEVFVHQMIHSIEFVLEAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGFDSI  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF P SFAS+  
Sbjct  756   LIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFRPLSFASLPD  815

Query  327   QDE  319
              ++
Sbjct  816   DED  818



>ref|XP_002456592.1| hypothetical protein SORBIDRAFT_03g038990 [Sorghum bicolor]
 gb|EES01712.1| hypothetical protein SORBIDRAFT_03g038990 [Sorghum bicolor]
Length=799

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/423 (73%), Positives = 356/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+++VTFPFLFAVMFGDWGHGICL L  L  + REK+LSSQKL 
Sbjct  379   IVDAYGVARYQEANPAVYSVVTFPFLFAVMFGDWGHGICLLLGALVLIVREKRLSSQKLS  438

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               ME+AF GRYVILLMA+FSIY G IYNEFFSVPF +FG+SAY C D SC DA T GLIK
Sbjct  439   SFMELAFGGRYVILLMAIFSIYCGLIYNEFFSVPFHIFGKSAYECRDKSCSDAHTIGLIK  498

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP W G+RSELPFLNSLKMKMSIL+GVAQMNLGIVLSYF+ RF  N ++I 
Sbjct  499   VRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILMGVAQMNLGIVLSYFDARFHGNALDIR  558

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL +LI++KW TGSQADLYHVMIYMFL P  DL ENQ+F GQK L
Sbjct  559   YQFIPQMIFLNSLFGYLALLILIKWCTGSQADLYHVMIYMFLDPAGDLGENQLFWGQKEL  618

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLALVAVPWMLFPKPF+LKK H+ER +G +Y  L  ++   +SE D+      H+
Sbjct  619   QILLLLLALVAVPWMLFPKPFILKKLHKERFQGHTYRFLGTSEMDPDSEPDS--ARARHD  676

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LLLA G++N+
Sbjct  677   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKLLLLAWGYDNL  736

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             ++ + G+IVF  AT  +LL+METLSAFLHALRLHWVEF NKFY GDGYKF PFSFA +A 
Sbjct  737   IVKLGGLIVFAFATAFILLMMETLSAFLHALRLHWVEFMNKFYHGDGYKFKPFSFALLAD  796

Query  327   QDE  319
              ++
Sbjct  797   DED  799



>ref|XP_008463888.1| PREDICTED: vacuolar proton ATPase a1 [Cucumis melo]
Length=819

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/424 (71%), Positives = 357/424 (84%), Gaps = 3/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T++TFPFLFAVMFGDWGHGICL L  L  + RE KL++QKLG
Sbjct  399   IVDAYGVARYQEANPAVYTVITFPFLFAVMFGDWGHGICLLLGALVLIARESKLNNQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVP+ +FG SAY C D SC DA T GL+K
Sbjct  459   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPYHIFGASAYKCRDNSCSDAHTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLG+AQMNLGI+LSYFN RF  + I+I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGIAQMNLGIILSYFNARFTGSSIDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSP +DL EN++F GQ+ L
Sbjct  579   YQFVPQVIFLNSLFGYLSLLIVIKWCTGSQADLYHVMIYMFLSPFEDLGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L++LA+VAVPWMLFPKPF+LKK H ER +G++Y  L  ++  +E E D+       E
Sbjct  639   QIILLMLAIVAVPWMLFPKPFILKKMHTERFQGRTYGMLGTSEIDLEVEPDS--ARQHQE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSE+FVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+++ 
Sbjct  697   DFNFSEIFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDSF  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             V+ +IG+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDG+KF PFSFASI  
Sbjct  757   VVRLIGLAVFSFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGHKFKPFSFASI-D  815

Query  327   QDEE  316
             +DE+
Sbjct  816   EDED  819



>ref|XP_004487144.1| PREDICTED: vacuolar proton ATPase a1-like [Cicer arietinum]
Length=825

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/423 (73%), Positives = 357/423 (84%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T + FPFLFA+MFGDWGHGICL L  L  + RE KLS+QKLG
Sbjct  404   IVDAYGVARYQEANPAVYTTIIFPFLFALMFGDWGHGICLLLGALVLIARENKLSTQKLG  463

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLM+LFSIY G IYNEFFSVPF +FG SAY C D SCRDA T GLIK
Sbjct  464   SFMEMLFGGRYVILLMSLFSIYCGLIYNEFFSVPFHIFGASAYQCRDSSCRDAYTIGLIK  523

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R+ YPFGVDP W G+RSEL FLNS+KMKMSIL GVA MNLGI+LSYFN RFF + ++I 
Sbjct  524   YREPYPFGVDPSWRGSRSELSFLNSMKMKMSILFGVAHMNLGIILSYFNARFFGSSLDIR  583

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD L ENQ+F GQ+ L
Sbjct  584   YQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDSLGENQLFWGQRPL  643

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLA+VAVPWMLFPKPF+LKK H ER +G++Y  L+ ++  +E+E D+    H HE
Sbjct  644   QIVLLLLAVVAVPWMLFPKPFILKKLHTERFQGRNYGILNTSEMDLEAEPDS-ARQHHHE  702

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  703   EFNFSEVFVHQMIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  762

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+ME+LSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  763   VIRLVGLTVFAFATAFILLMMESLSAFLHALRLHWVEFQNKFYFGDGYKFKPFSFASLTE  822

Query  327   QDE  319
              D+
Sbjct  823   DDD  825



>ref|XP_006843249.1| hypothetical protein AMTR_s00080p00100430 [Amborella trichopoda]
 gb|ERN04924.1| hypothetical protein AMTR_s00080p00100430 [Amborella trichopoda]
Length=821

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/423 (73%), Positives = 363/423 (86%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANPGV+T++TFPFLFAVMFGDWGHGICL L +L  + REK+L SQKLG
Sbjct  399   IVDAYGVARYQEANPGVYTVITFPFLFAVMFGDWGHGICLLLGSLILIIREKRLGSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             + MEMAF GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA+  GLIK
Sbjct  459   NFMEMAFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGHSAYRCRDLTCSDASRMGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R  YPFGVDP W G+RSELPFLNSLKMKMSILLGV QMNLGI+LSYFNG+FF + I+I 
Sbjct  519   YRGPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVQMNLGIILSYFNGKFFGSSIDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL +LII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F GQ+ L
Sbjct  579   YQFVPQMIFLNSLFGYLALLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L+A+VAVPWMLFPKP +L+K H ER +G++Y  L  ++   +SE D+      HE
Sbjct  639   QILLLLMAIVAVPWMLFPKPLILRKLHTERFQGRTYGILGTSELDFDSEPDSARSVRQHE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVL+L+ GF++I
Sbjct  699   DFNFSEVFVHQMIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLVLSWGFDSI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI IIG+ VF  AT  +LL+ME+LSAFLHALRLHWVEFQNKFY+GDG+KF PFSFA++A+
Sbjct  759   VIRIIGLGVFAFATAFILLMMESLSAFLHALRLHWVEFQNKFYQGDGHKFKPFSFAALAN  818

Query  327   QDE  319
             +++
Sbjct  819   EED  821



>gb|EPS62244.1| hypothetical protein M569_12548, partial [Genlisea aurea]
Length=757

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/415 (71%), Positives = 348/415 (84%), Gaps = 0/415 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L+ + REK+L+SQKLG
Sbjct  337   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALFIIAREKRLASQKLG  396

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM + GRYV+LLM+LFSIY G IYNEFFSVPF +FGRSAY C D +C DA + GLIK
Sbjct  397   SFMEMLYGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGRSAYKCRDTTCSDARSVGLIK  456

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDP W G+RSELPFLNSLKMKMSIL GV QMNLGIVLS+FN R+F N ++I 
Sbjct  457   YRDTYPFGVDPSWRGSRSELPFLNSLKMKMSILFGVVQMNLGIVLSFFNARYFSNSLDIR  516

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSP +DL EN++F GQ  L
Sbjct  517   YQFIPQIIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPFEDLGENELFRGQGVL  576

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA VAVPWMLFPKP +LKK H ER +G++Y  L  ++   + E D+  H    E
Sbjct  577   QVILLLLAAVAVPWMLFPKPLILKKLHTERFQGRTYGILGTSEMNPDEEPDSARHPRSGE  636

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG++SNTASYLRLWALSLAHSELS+VFY++VLLL   ++N+
Sbjct  637   DFNFSEVFVHQMIHSIEFVLGAISNTASYLRLWALSLAHSELSTVFYERVLLLCWSYDNL  696

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSF  343
              + + GI VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDG+KF+PFSF
Sbjct  697   AVRLGGIAVFCFATAFILLMMETLSAFLHALRLHWVEFQNKFYGGDGHKFTPFSF  751



>ref|XP_010043691.1| PREDICTED: V-type proton ATPase subunit a1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW85678.1| hypothetical protein EUGRSUZ_B02458 [Eucalyptus grandis]
Length=820

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/423 (72%), Positives = 358/423 (85%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T+VTFPFLFAVMFGDWGHGICL L  L  + +E+KL+ QKLG
Sbjct  398   IVDAYGVARYQEANPAVYTVVTFPFLFAVMFGDWGHGICLLLGALVLIAQERKLTGQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D SC DA + GLIK
Sbjct  458   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFNIFGESAYKCRDTSCSDARSVGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +D YPFGVDP W G+RSELPFLNSLKMKMSILLGV QMNLGI+LSYFN RFFK+ ++I 
Sbjct  518   YQDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVQMNLGIILSYFNARFFKSTLDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  578   FQFVPQVIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGENQLFWGQKPL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLAL+AVPWMLFPKPF+LKK H ER +G++Y  L  ++  ++ +T+       HE
Sbjct  638   QIILLLLALIAVPWMLFPKPFILKKLHSERFQGRTYQMLGTSEMDIDGDTEPDSARQHHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  698   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSF+ +  
Sbjct  758   IIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFSLLTE  817

Query  327   QDE  319
             +++
Sbjct  818   EED  820



>dbj|BAD73786.1| putative vacuolar-type H(+)-ATPase [Oryza sativa Japonica Group]
Length=584

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/423 (70%), Positives = 356/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+A+Y+EANP V++++TFPFLFAVMFGDWGHGICL L     + REKKLSSQKLG
Sbjct  164   IVDAYGIARYEEANPAVYSVITFPFLFAVMFGDWGHGICLLLGACVLILREKKLSSQKLG  223

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYVILLMALFSIY G IYNEFFSVPF +FG+SAY C + +C DA T GLIK
Sbjct  224   SFMEMAFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGKSAYECREKTCSDAHTAGLIK  283

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP W G+RSELPFLNSLKMKMSIL+GV QMNLGIVLSYF+ +F  N ++I 
Sbjct  284   VRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILMGVTQMNLGIVLSYFDAKFHGNALDIR  343

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL +LI++KW TGSQADLYHVMIYMFL P+ +L ENQ+F GQK L
Sbjct  344   YQFIPQMIFLNSLFGYLALLILIKWCTGSQADLYHVMIYMFLDPSGNLGENQLFWGQKEL  403

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L+A+VAVPWMLFPKPF+LKK H+ER +G +Y  L  ++   +SE D+      H+
Sbjct  404   QILLLLMAIVAVPWMLFPKPFILKKLHKERFQGHTYRFLGTSEMDPDSEPDS--ARSRHD  461

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+L+LA G++N+
Sbjct  462   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKLLVLAWGYDNL  521

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             V+ ++G+++F  AT  +LL ME+LSAFLHALRLHWVEF NKFY GDGYKF PFSFA +A 
Sbjct  522   VVKLVGLVIFSFATAFILLGMESLSAFLHALRLHWVEFMNKFYHGDGYKFRPFSFALLAD  581

Query  327   QDE  319
              ++
Sbjct  582   DED  584



>ref|XP_004149561.1| PREDICTED: vacuolar proton ATPase a1-like [Cucumis sativus]
 ref|XP_004168233.1| PREDICTED: vacuolar proton ATPase a1-like [Cucumis sativus]
 gb|KGN47288.1| hypothetical protein Csa_6G288220 [Cucumis sativus]
Length=819

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/424 (71%), Positives = 357/424 (84%), Gaps = 3/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T++TFPFLFAVMFGDWGHGICL L  L  + RE KL++QKLG
Sbjct  399   IVDAYGVARYQEANPAVYTVITFPFLFAVMFGDWGHGICLLLGALVLIARESKLNNQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVP+ +FG SAY C D SC DA T GL+K
Sbjct  459   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPYHIFGASAYKCRDNSCSDAHTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLG+AQMNLGI+LSYFN RF  + I+I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGIAQMNLGIILSYFNARFTGSSIDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSP +DL EN++F GQ+ L
Sbjct  579   YQFIPQVIFLNSLFGYLSLLIVIKWCTGSQADLYHVMIYMFLSPFEDLGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L++LA+VAVPWMLFPKPF+LKK H ER +G++Y  L  ++  +E E D+       E
Sbjct  639   QIILLMLAIVAVPWMLFPKPFILKKMHTERFQGRTYGMLGTSEIDLEVEPDS--ARQHQE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSE+FVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+++ 
Sbjct  697   DFNFSEIFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDSF  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI +IG+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDG+KF PFSFASI  
Sbjct  757   VIRLIGLAVFSFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGHKFKPFSFASI-D  815

Query  327   QDEE  316
             +DE+
Sbjct  816   EDED  819



>ref|XP_006424665.1| hypothetical protein CICLE_v10027830mg [Citrus clementina]
 ref|XP_006488191.1| PREDICTED: vacuolar proton ATPase a1-like [Citrus sinensis]
 gb|ESR37905.1| hypothetical protein CICLE_v10027830mg [Citrus clementina]
 gb|KDO73120.1| hypothetical protein CISIN_1g003454mg [Citrus sinensis]
Length=819

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/424 (72%), Positives = 356/424 (84%), Gaps = 4/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+ ++TFPFLFAVMFGDWGHGICL L  L  + RE+KL +QKLG
Sbjct  399   IVDAYGVARYQEANPAVYAVITFPFLFAVMFGDWGHGICLLLGALVLIARERKLGNQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVP+ +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPYHIFGGSAYRCRDTTCSDAYTAGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R+ YPFGVDP W G+RSELPFLNSLKMKMSILLGV QMNLGI+LSYF+ RFF + ++I 
Sbjct  519   YREPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVTQMNLGIILSYFDARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL EN++F GQ+ L
Sbjct  579   YQFVPQLIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLA VAVPWMLFPKPF+L+K H ER +G++Y  L  ++  +E E D+      HE
Sbjct  639   QILLLLLATVAVPWMLFPKPFILRKLHTERFQGRTYGILGTSEMDLEVEPDS--ARQHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSE+FVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  697   DFNFSEIFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA I  
Sbjct  757   VIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFALI--  814

Query  327   QDEE  316
              DEE
Sbjct  815   NDEE  818



>ref|XP_003539739.1| PREDICTED: vacuolar proton ATPase a1-like [Glycine max]
Length=818

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/422 (71%), Positives = 355/422 (84%), Gaps = 2/422 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T + FPFLFAVMFGDWGHGICL L  L  + R+ KLS+Q+LG
Sbjct  398   IVDAYGVARYQEANPAVYTTIIFPFLFAVMFGDWGHGICLLLGALVLIARQSKLSTQRLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVP+ +FG SAY C D SCRDA T GL+K
Sbjct  458   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPYHIFGPSAYKCRDNSCRDAHTIGLVK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R+ YPFGVDP W G+RSELPFLNSLKMKMSILLGV  MNLGI+LSYFN RFF N ++I 
Sbjct  518   YREPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVHMNLGILLSYFNARFFGNSLDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLN LFGYL++LI++KW TGSQADLYHVMIYMFLSP D+L ENQ+F GQ+ L
Sbjct  578   YQFVPQMIFLNCLFGYLSLLIVVKWCTGSQADLYHVMIYMFLSPFDNLGENQLFWGQRPL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA++AVPWMLFPKPF+LKK H ER +G++Y  L+N++  +E E D+      HE
Sbjct  638   QVVLLLLAVIAVPWMLFPKPFILKKLHNERFQGRTYGVLNNSEVDLELEPDS--ARQHHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  696   EFNFSEVFVHQMIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  756   VIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYSGDGYKFKPFSFASLTE  815

Query  327   QD  322
              +
Sbjct  816   DE  817



>ref|XP_002282009.1| PREDICTED: V-type proton ATPase subunit a1 [Vitis vinifera]
 emb|CBI16252.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/423 (72%), Positives = 358/423 (85%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T++TFPFLFAVMFGDWGHGICL L  L  + RE KLSSQKLG
Sbjct  398   IVDAYGVARYQEANPAVYTVITFPFLFAVMFGDWGHGICLLLGALVLIARESKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM++FSIY G IYNEFFSVP+ +FG SAY C D +C ++ T GLIK
Sbjct  458   SFMEMLFGGRYVLLLMSIFSIYCGLIYNEFFSVPYHIFGGSAYKCRDATCSNSNTVGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +DTYPFGVDP W G+RSELPFLNSLKMKMSILLGV QMNLGIVLSYFN RFF + ++I 
Sbjct  518   YQDTYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVTQMNLGIVLSYFNARFFGSSLDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQ+ L
Sbjct  578   YQFVPQVIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDNLGENQLFWGQRPL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLAL+AVPWMLFPKPF+LKK H ER +G++Y  L  ++  +E E D+      HE
Sbjct  638   QIILLLLALIAVPWMLFPKPFILKKLHSERFQGRAYGILGTSEMDLEVEPDS--ARQHHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+NN 
Sbjct  696   EFNFSEIFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNF  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  756   VIRMVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFASLID  815

Query  327   QDE  319
              ++
Sbjct  816   DED  818



>ref|XP_009358259.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
Length=819

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/423 (72%), Positives = 356/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T++TFPFLFAVMFGDWGHGICL L  L  + RE KLS+QKLG
Sbjct  399   IVDAYGVARYQEANPAVYTVITFPFLFAVMFGDWGHGICLLLGALVLIARESKLSAQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C +  T GLIK
Sbjct  459   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTACSEVHTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGV QMNLGI+LSYFN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVQMNLGILLSYFNARFFSSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++L+++KW TGSQADLYH+MIYMFLSPTDDL ENQ+F GQ+ L
Sbjct  579   YQFVPQMIFLNSLFGYLSLLVVIKWCTGSQADLYHIMIYMFLSPTDDLGENQLFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLAL+AVPWMLFPKPF+LKK H ER +G++Y  L  ++  +E E D+      HE
Sbjct  639   QIILLLLALIAVPWMLFPKPFILKKLHTERFQGRAYGMLGTSEMDLEVEPDS--ARQRHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+++ 
Sbjct  697   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDSF  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG+ VF  AT  +LL+METLSAFLHALRLHWVE+QNKFY GDGYKF PFSFASI  
Sbjct  757   IIRLIGLSVFAFATAFILLMMETLSAFLHALRLHWVEYQNKFYHGDGYKFKPFSFASITE  816

Query  327   QDE  319
              ++
Sbjct  817   DED  819



>gb|KHN05709.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Glycine soja]
Length=818

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/422 (71%), Positives = 355/422 (84%), Gaps = 2/422 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T + FPFLFAVMFGDWGHGICL L  L  + R+ KLS+Q+LG
Sbjct  398   IVDAYGVARYQEANPAVYTTIIFPFLFAVMFGDWGHGICLLLGALVLIARQSKLSTQRLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVP+ +FG SAY C D SCRDA T GL+K
Sbjct  458   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPYHIFGPSAYKCRDNSCRDAHTIGLVK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R+ YPFGVDP W G+RSELPFLNSLKMKMSILLGV  MNLGI+LSYFN RFF N ++I 
Sbjct  518   YREPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVHMNLGILLSYFNARFFGNSLDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLN LFGYL++LI++KW TGSQADLYHVMIYMFLSP D+L ENQ+F GQ+ L
Sbjct  578   YQFVPQMIFLNCLFGYLSLLIVVKWCTGSQADLYHVMIYMFLSPFDNLGENQLFWGQRPL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA++AVPWMLFPKPF+LKK H ER +G++Y  L+N++  +E E D+      HE
Sbjct  638   QVVLLLLAVIAVPWMLFPKPFILKKLHNERFQGRTYGVLNNSEVDLELEPDS--ARQHHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  696   EFNFSEVFVHQMIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+  
Sbjct  756   VIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYSGDGYKFKPFSFASLTE  815

Query  327   QD  322
              +
Sbjct  816   DE  817



>ref|XP_010922514.1| PREDICTED: V-type proton ATPase subunit a1 [Elaeis guineensis]
Length=819

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/423 (71%), Positives = 355/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V++++TFPFLFAVMFGDWGHGICL L +   + REKKL SQKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVITFPFLFAVMFGDWGHGICLLLGSFLLIVREKKLGSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYV+LLMALFSIY G IYNEFFSVPF +FG SAY C D SC DA T GL+K
Sbjct  459   SFMEMAFGGRYVLLLMALFSIYCGLIYNEFFSVPFHIFGESAYKCRDTSCSDARTAGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGV+QMNLGI+LSYF+ +F  N +++ 
Sbjct  519   YRDPYPFGVDPRWRGSRSELPFLNSLKMKMSILLGVSQMNLGIILSYFDAKFHGNSLDVR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++L+++KW TGSQADLYHVMIYMFL PT DL ENQ+F GQK L
Sbjct  579   YQFIPQMIFLNSLFGYLSLLVLIKWCTGSQADLYHVMIYMFLDPTGDLGENQLFWGQKPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLA+VAVPWMLFPKPF+L+K   ER +G++Y  L  ++  ++ E D+      H+
Sbjct  639   QILLLLLAIVAVPWMLFPKPFILRKLDMERFQGRTYGILRTSEMDLDHEPDS--ARQRHD  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LLLA G++N 
Sbjct  697   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKILLLAWGYDNP  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I I G+ VF  AT  +LL+METLSAFLHALRLHWVEF NKFY GDGYKF PFSFAS+A 
Sbjct  757   IIRIAGLAVFAFATAFILLMMETLSAFLHALRLHWVEFMNKFYHGDGYKFRPFSFASLAD  816

Query  327   QDE  319
             +++
Sbjct  817   EED  819



>ref|XP_004241262.1| PREDICTED: V-type proton ATPase subunit a1-like [Solanum lycopersicum]
Length=818

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/423 (72%), Positives = 354/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L  + RE KLSSQKLG
Sbjct  398   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLIARESKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM++FSIY G IYNEFFSVPF +FG SAY C D +C DA T GLIK
Sbjct  458   SFMEMVFGGRYVLLLMSIFSIYCGLIYNEFFSVPFHIFGDSAYRCRDATCSDAQTVGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +D YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF + I+I 
Sbjct  518   YKDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFSSSIDIK  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSP + L EN++F GQ  L
Sbjct  578   YQFIPQIIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPFEALGENRLFWGQSVL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLAL+AVPWMLFPKPF+LK+ H ER +G++Y  L  ++  ++ + D+       E
Sbjct  638   QVILLLLALIAVPWMLFPKPFILKRLHMERFQGRTYGILGTSEMGIDDQPDS--ARERAE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ NI
Sbjct  696   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENI  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA +A 
Sbjct  756   IIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFMPFSFALLAD  815

Query  327   QDE  319
              D+
Sbjct  816   DDD  818



>ref|XP_009759133.1| PREDICTED: V-type proton ATPase subunit a1-like isoform X2 [Nicotiana 
sylvestris]
Length=665

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/423 (72%), Positives = 352/423 (83%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L  + RE KLSSQKLG
Sbjct  245   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLIARESKLSSQKLG  304

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM++FSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  305   SFMEMLFGGRYVLLLMSIFSIYCGLIYNEFFSVPFHIFGDSAYKCRDATCSDARTVGLVK  364

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
               D YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF + I+I 
Sbjct  365   YNDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFSSSIDIK  424

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSP + L EN++F GQ  L
Sbjct  425   YQFIPQIIFLNSLFGYLSLLILVKWCTGSQADLYHVMIYMFLSPFEALGENRLFWGQSVL  484

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWMLFPKPF+LK  H ER +G++Y  L  ++  ++ E  +       E
Sbjct  485   QVILLLLALVAVPWMLFPKPFILKSLHMERFQGRTYGILGTSEMVIDEEPGS--ASQHAE  542

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  543   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  602

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA +A 
Sbjct  603   VIRLVGLAVFAFATTFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFALLAD  662

Query  327   QDE  319
              D+
Sbjct  663   DDD  665



>ref|XP_004970481.1| PREDICTED: vacuolar proton ATPase a1-like [Setaria italica]
Length=818

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/423 (72%), Positives = 358/423 (85%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+++VTFPFLFAVMFGDWGHGICL L  L  + REKKLSSQKLG
Sbjct  398   IVDAYGVARYQEANPAVYSVVTFPFLFAVMFGDWGHGICLLLGALVLILREKKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYVILLMA+FSIY G IYNEFFSVPF +FG+SAY C + SC DA T GLIK
Sbjct  458   SFMEMAFGGRYVILLMAIFSIYCGLIYNEFFSVPFHIFGKSAYECREKSCSDAHTAGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP W G+RSELPFLNSLKMKMSIL+GVAQMNLGIVLSYF+ RF  N ++I 
Sbjct  518   VRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILMGVAQMNLGIVLSYFDARFHGNALDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL +LI++KW TGS+ADLYHVMIYMFL P  DL ENQ+F GQK L
Sbjct  578   YQFIPQMIFLNSLFGYLALLILIKWCTGSKADLYHVMIYMFLDPAGDLGENQLFWGQKEL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLALVAVPWMLFPKPF+LKK H+ER +G +Y  L  ++   +SE D+      H+
Sbjct  638   QILLLLLALVAVPWMLFPKPFILKKLHKERFQGHTYRFLGTSEMDPDSEPDS--ARARHD  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LLLA G++++
Sbjct  696   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKLLLLAWGYDSL  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             ++ ++G++VF  AT  +LL+METLSAFLHALRLHWVEF NKFY GDGYKF PFSFA +A 
Sbjct  756   IVKLVGLVVFAFATAFILLMMETLSAFLHALRLHWVEFMNKFYHGDGYKFKPFSFALLAD  815

Query  327   QDE  319
              ++
Sbjct  816   DED  818



>gb|EYU18884.1| hypothetical protein MIMGU_mgv1a001442mg [Erythranthe guttata]
Length=819

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/423 (70%), Positives = 349/423 (83%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL L  LY +  EKK  SQKLG
Sbjct  398   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALYLIAHEKKFGSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM + GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C D+ + GLIK
Sbjct  458   SFMEMLYGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGSSAYQCRDATCSDSRSVGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSIL G+ QMNLGI+LSY N R+F N ++I 
Sbjct  518   YRDAYPFGVDPSWRGSRSELPFLNSLKMKMSILFGIVQMNLGIILSYLNARYFGNSLDIK  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII KW TGSQADLYHVMIYMFLSP +DL ENQ+F GQ  L
Sbjct  578   YQFVPQIIFLNSLFGYLSLLIITKWCTGSQADLYHVMIYMFLSPFEDLGENQLFWGQGVL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L++LA++AVPWMLFPKPF+LKK H ER +G++Y  L    D+ + E  +       +
Sbjct  638   QVVLLILAIIAVPWMLFPKPFILKKLHTERFQGRTYGIL-GTSDSYDDEVPDSVRQPQPD  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVL+LA G++N+
Sbjct  697   EFNFSEVFVHQMIHAIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLVLAWGYDNL  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA++  
Sbjct  757   IIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYSGDGYKFVPFSFAALNE  816

Query  327   QDE  319
             +++
Sbjct  817   EED  819



>ref|XP_006644966.1| PREDICTED: vacuolar proton ATPase a1-like [Oryza brachyantha]
Length=818

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/423 (71%), Positives = 356/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+Y+E NP V++++TFPFLFAVMFGDWGHGICL L     + REKKLSSQKLG
Sbjct  398   IVDAYGVARYEEINPAVYSVITFPFLFAVMFGDWGHGICLLLGACVLILREKKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYVILLMALFSIY G IYNEFFSVPF +FG+SAY C + +C DA T GLIK
Sbjct  458   SFMEMAFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGKSAYECREKTCSDAYTAGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP W G+RSELPFLNSLKMKMSIL+GV QMNLGIVLSYF+ +F  N ++I 
Sbjct  518   VRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILMGVTQMNLGIVLSYFDAKFHGNALDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL +LI++KW +GSQADLYHVMIYMFL P  DL ENQ+F GQK L
Sbjct  578   YQFIPQMIFLNSLFGYLALLILIKWCSGSQADLYHVMIYMFLDPAGDLGENQLFWGQKEL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L+A+VAVPWMLFPKPF+LKK+H+ER +G +Y  L  ++   +SE D+      H+
Sbjct  638   QILLLLMAIVAVPWMLFPKPFILKKRHKERFQGHTYRFLGTSEMDPDSEPDS--ARSHHD  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LLLA G++N+
Sbjct  696   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKLLLLAWGYDNL  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             V+ ++G++VF  AT  +LL+ME+LSAFLHALRLHWVEF NKF+ GDGYKF PFSFA +A 
Sbjct  756   VVRLVGLVVFAFATAFILLMMESLSAFLHALRLHWVEFMNKFFHGDGYKFMPFSFALLAD  815

Query  327   QDE  319
              +E
Sbjct  816   DEE  818



>gb|KHG00921.1| Vacuolar proton translocating ATPase subunit [Gossypium arboreum]
Length=824

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/430 (71%), Positives = 357/430 (83%), Gaps = 9/430 (2%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQ---  1417
             IVDAYG+A+YQEANP V+T+VTFPFLFAVMFGDWGHGICL L  +  + RE +LS+Q   
Sbjct  397   IVDAYGIARYQEANPAVYTVVTFPFLFAVMFGDWGHGICLLLGAVVLIARESRLSTQACV  456

Query  1416  ----KLGDIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDA  1249
                 KLG  M M F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C DA
Sbjct  457   RAYHKLGSFMAMLFEGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDATCSDA  516

Query  1248  TTTGLIKVRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFF  1069
              + GLIK RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF
Sbjct  517   HSAGLIKFRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFF  576

Query  1068  KNDINIWHQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQI  889
              + ++  +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL EN++
Sbjct  577   HSSLDTRYQFVPQLIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGENEL  636

Query  888   FTGQKYLQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNh  709
             F GQ+ LQI+L+LLALVAVPWMLFPKPF+LKK H ER +G++Y  L +++   + E D+ 
Sbjct  637   FWGQRPLQIVLLLLALVAVPWMLFPKPFILKKLHSERFQGRNYGMLVSSEFDPDVEPDS-  695

Query  708   ghghgHEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLL  529
                  HE+F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LLL
Sbjct  696   -ARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKILLL  754

Query  528   AMgfnniviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPF  349
             A G++N+VI +IG+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PF
Sbjct  755   AWGYDNVVIRLIGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPF  814

Query  348   SFASIAHQDE  319
             SFA IA  D+
Sbjct  815   SFALIAEDDD  824



>emb|CDP08938.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/430 (70%), Positives = 350/430 (81%), Gaps = 9/430 (2%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA YQEANP V+T+VTFPFLFAVMFGDWGHGICL L  L  + RE+KL SQKLG
Sbjct  398   IVDAYGVANYQEANPAVYTVVTFPFLFAVMFGDWGHGICLLLGALVLIARERKLGSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM++FSIY G IYNEFFSVPF +FG SAY C D SC DA + GLIK
Sbjct  458   SFMEMLFGGRYVLLLMSIFSIYCGLIYNEFFSVPFHIFGESAYKCRDSSCSDARSIGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+R+ELPFLNSLKMK+SILLGV QMNLGI+LSYFN RFF N ++I 
Sbjct  518   SRDPYPFGVDPSWRGSRTELPFLNSLKMKLSILLGVVQMNLGIILSYFNARFFGNSLDIK  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLN LFGYL++LI++KW +GSQADLYHVMIYMFLSP +DL EN++F GQ  L
Sbjct  578   YQFVPQMIFLNCLFGYLSLLIVIKWCSGSQADLYHVMIYMFLSPFEDLGENKLFWGQGVL  637

Query  867   Q-------IllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNh  709
             Q       ++L+L A+VAVPWMLFPKPF+LK+ H ER +G++Y  L  +D  ++ E D+ 
Sbjct  638   QAQSLIFSVILLLCAVVAVPWMLFPKPFILKRLHTERFQGRTYGLLGTSDMNIDDEPDS-  696

Query  708   ghghgHEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLL  529
                   EDF FSE FVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLL
Sbjct  697   -ARQHQEDFNFSEEFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLL  755

Query  528   AMgfnniviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPF  349
             A G+ NI+I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PF
Sbjct  756   AWGYENIIIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFRPF  815

Query  348   SFASIAHQDE  319
             SFAS+   D+
Sbjct  816   SFASLTDDDD  825



>ref|NP_001044718.2| Os01g0834200 [Oryza sativa Japonica Group]
 dbj|BAD73785.1| putative vacuolar-type H(+)-ATPase [Oryza sativa Japonica Group]
 dbj|BAG94648.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06632.2| Os01g0834200 [Oryza sativa Japonica Group]
Length=818

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/423 (70%), Positives = 356/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+A+Y+EANP V++++TFPFLFAVMFGDWGHGICL L     + REKKLSSQKLG
Sbjct  398   IVDAYGIARYEEANPAVYSVITFPFLFAVMFGDWGHGICLLLGACVLILREKKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYVILLMALFSIY G IYNEFFSVPF +FG+SAY C + +C DA T GLIK
Sbjct  458   SFMEMAFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGKSAYECREKTCSDAHTAGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP W G+RSELPFLNSLKMKMSIL+GV QMNLGIVLSYF+ +F  N ++I 
Sbjct  518   VRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILMGVTQMNLGIVLSYFDAKFHGNALDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL +LI++KW TGSQADLYHVMIYMFL P+ +L ENQ+F GQK L
Sbjct  578   YQFIPQMIFLNSLFGYLALLILIKWCTGSQADLYHVMIYMFLDPSGNLGENQLFWGQKEL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L+A+VAVPWMLFPKPF+LKK H+ER +G +Y  L  ++   +SE D+      H+
Sbjct  638   QILLLLMAIVAVPWMLFPKPFILKKLHKERFQGHTYRFLGTSEMDPDSEPDS--ARSRHD  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+L+LA G++N+
Sbjct  696   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKLLVLAWGYDNL  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             V+ ++G+++F  AT  +LL ME+LSAFLHALRLHWVEF NKFY GDGYKF PFSFA +A 
Sbjct  756   VVKLVGLVIFSFATAFILLGMESLSAFLHALRLHWVEFMNKFYHGDGYKFRPFSFALLAD  815

Query  327   QDE  319
              ++
Sbjct  816   DED  818



>gb|KHN22033.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Glycine soja]
Length=749

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/422 (70%), Positives = 354/422 (84%), Gaps = 2/422 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T + FPFLFAVMFGDWGHGICL L  L  + R+ KLS+Q+LG
Sbjct  329   IVDAYGVARYQEANPAVYTTIIFPFLFAVMFGDWGHGICLLLGALVLIARQSKLSTQRLG  388

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVP+ +FG SAY C D SCRDA T GL+K
Sbjct  389   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPYHIFGASAYKCQDSSCRDAHTIGLVK  448

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R+ YPFGVDP W G+RSELPFLNSLKMKMSILLGV  MNLGI+LSYFN RFF N ++I 
Sbjct  449   YREPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVHMNLGILLSYFNARFFGNSLDIR  508

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLN LFGYL++LI++KW TGSQADLYHVMIYMFLSP D+L ENQ+F GQ+ L
Sbjct  509   YQFVPQIIFLNCLFGYLSLLIVVKWCTGSQADLYHVMIYMFLSPFDNLGENQLFWGQRPL  568

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA++AVPWMLFPKPF+LKK + ER +G++Y  L+ ++  +E E D+      HE
Sbjct  569   QVVLLLLAVIAVPWMLFPKPFILKKLYNERFQGRTYGVLNTSEVDLELEPDS--ARQYHE  626

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  627   EFNFSEVFVHQMIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  686

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSF S+  
Sbjct  687   VIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYSGDGYKFKPFSFVSLTE  746

Query  327   QD  322
             ++
Sbjct  747   EE  748



>ref|XP_004505946.1| PREDICTED: vacuolar proton ATPase a1-like [Cicer arietinum]
Length=820

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/422 (70%), Positives = 353/422 (84%), Gaps = 2/422 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQE NP V+T + FPFLFAVMFGDWGHGICL L  L  +  E KLS+Q+LG
Sbjct  400   IVDAYGVARYQEVNPAVYTTIIFPFLFAVMFGDWGHGICLLLGALVLIAHESKLSNQRLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLM+LFS+Y G IYNEFFSVPF +FG SAY C D SCRDA TTGL+K
Sbjct  460   SFMEMLFGGRYVILLMSLFSMYCGLIYNEFFSVPFHIFGASAYKCRDISCRDAHTTGLVK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R+ YPFGVDP W G+RSELPFLNSLKMKMSIL GV  MNLGI+LSYFN RFF + ++I 
Sbjct  520   YREPYPFGVDPSWRGSRSELPFLNSLKMKMSILFGVVHMNLGIMLSYFNARFFGSSLDIR  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LI+LKW TGSQADLYH+MIYMFLSP D+L EN++F GQ+ L
Sbjct  580   YQFVPQMIFLNSLFGYLSLLIVLKWCTGSQADLYHIMIYMFLSPFDNLGENELFWGQRPL  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+LL+LLA++AVPWMLFPKPF+LKK H ER +G++Y  L+ ++  +E E D+       E
Sbjct  640   QVLLLLLAVIAVPWMLFPKPFILKKLHNERFQGRTYGMLNTSEADLEVEPDS--ARQHRE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  698   EFNFSEVFVHQMIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G++VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA++  
Sbjct  758   IIRLVGLVVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFATLTE  817

Query  327   QD  322
              +
Sbjct  818   DE  819



>ref|XP_002532256.1| vacuolar proton atpase, putative [Ricinus communis]
 gb|EEF30122.1| vacuolar proton atpase, putative [Ricinus communis]
Length=822

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/423 (70%), Positives = 352/423 (83%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T++TFPFLFAVMFGDWGHGICL +  L  + RE KL SQKLG
Sbjct  402   IVDAYGVARYQEANPAVYTVITFPFLFAVMFGDWGHGICLLIGALVLIARESKLGSQKLG  461

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLMA FSIY G IYNEFFSVPF +FG SAY C D +C DA T GLIK
Sbjct  462   SFMEMLFGGRYVLLLMAFFSIYCGLIYNEFFSVPFHIFGGSAYRCRDTTCSDAHTVGLIK  521

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +D YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMN+GI+LSYFN RFF + ++I 
Sbjct  522   YQDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNVGILLSYFNARFFGSSLDIR  581

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLN LFGYL++LII+KW +GSQADLYHVMIYMFLSPTDDL ENQ+F GQ+ L
Sbjct  582   YQFVPQIIFLNCLFGYLSLLIIIKWCSGSQADLYHVMIYMFLSPTDDLGENQLFWGQRPL  641

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLA+VAVPWMLFPKPF+LKK + ER +G++Y  L  ++  V+ + +       H+
Sbjct  642   QIILLLLAVVAVPWMLFPKPFILKKLNTERFQGRTYGLLGTSE--VDLDMEPGSARSHHD  699

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++ +
Sbjct  700   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDIL  759

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              + ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSF+ I  
Sbjct  760   AVRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYYGDGYKFKPFSFSMITD  819

Query  327   QDE  319
              ++
Sbjct  820   DED  822



>ref|XP_009352397.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
 ref|XP_009352398.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
 ref|XP_009352408.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
 ref|XP_009352409.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
 ref|XP_009352410.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
Length=819

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/423 (71%), Positives = 356/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T +TFPFLFAVMFGDWGHGICL +  L  + RE KLS+QKLG
Sbjct  399   IVDAYGVARYQEANPAVYTCITFPFLFAVMFGDWGHGICLLVGALVLIARESKLSAQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C +A T GLIK
Sbjct  459   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDAACSEAYTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGV QMNLGI+LSYFN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVQMNLGILLSYFNARFFSSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++L+++KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQ+ L
Sbjct  579   YQFVPQMIFLNSLFGYLSLLVVIKWCTGSQADLYHVMIYMFLSPTDDLGENQLFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLAL+AVPWMLFPKPF+L+K + ER +G++Y  L  ++  +E E D+      HE
Sbjct  639   QIILLLLALIAVPWMLFPKPFILRKLNTERFQGRAYGMLGTSEMDLEVEPDS--ARQHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+++ 
Sbjct  697   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDSF  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG+ VF  AT  +LL+METLSAFLHALRLHWVE+QNKFY GDGYKF PFSFASI  
Sbjct  757   IIRLIGLSVFAFATAFILLMMETLSAFLHALRLHWVEYQNKFYHGDGYKFKPFSFASITE  816

Query  327   QDE  319
              ++
Sbjct  817   DED  819



>gb|AFW88967.1| hypothetical protein ZEAMMB73_558595 [Zea mays]
 gb|AFW88968.1| hypothetical protein ZEAMMB73_558595 [Zea mays]
Length=395

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/395 (79%), Positives = 357/395 (90%), Gaps = 1/395 (0%)
 Frame = -2

Query  1500  MFGDWGHGICLFLATLYFVFREKKLSSQKLGDIMEMAFSGRYVILLMALFSIYTGFIYNE  1321
             MFGDWGHGICL LATLY + REKKL+SQKLGDIMEM F GRYVI++MA+FSIYTG IYNE
Sbjct  1     MFGDWGHGICLLLATLYLIIREKKLASQKLGDIMEMMFGGRYVIMMMAVFSIYTGLIYNE  60

Query  1320  FFSVPFELFGRSAYACSDPSCRDATTTGLIKVRDTYPFGVDPVWHGTRSELPFLNSLKMK  1141
             FFSVPF LFG+SAYAC D SC DATT GLIKVRD YPFGVDPVWHG+RSELPFLNSLKMK
Sbjct  61    FFSVPFGLFGKSAYACRDSSCSDATTEGLIKVRDAYPFGVDPVWHGSRSELPFLNSLKMK  120

Query  1140  MSILLGVAQMNLGIVLSYFNGRFFKNDINIWHQFVPQMIFLNSLFGYLTVLIILKWYTGS  961
             MSILLGVAQMNLGIV+SYFN +FF+N +N+W+QF+PQ+IFLNSLFGYL++LII+KW TGS
Sbjct  121   MSILLGVAQMNLGIVISYFNAKFFRNSLNVWYQFIPQLIFLNSLFGYLSLLIIIKWCTGS  180

Query  960   QADLYHVMIYMFLSPTDDLEENQIFTGQKYLQIllvllalvaVPWMLFPKPFLLKKQHEE  781
             +ADLYHVMIYMFLSPTD++ ENQ+F+GQK +Q++L+LLALV+VPWML PKP LLKKQH++
Sbjct  181   KADLYHVMIYMFLSPTDEIGENQLFSGQKTVQLVLLLLALVSVPWMLIPKPLLLKKQHQQ  240

Query  780   RHRGQSYAPLHNADDAVESETD-NhghghgHEDFEFSEVFVHQLIHTIEFVLGSVSNTAS  604
             RH+G  YA L   D++V +E   +H   H HE+FEFSEVFVHQLIHTIEFVLG+VSNTAS
Sbjct  241   RHQGHQYAMLQGVDESVGAELGEHHEEAHDHEEFEFSEVFVHQLIHTIEFVLGAVSNTAS  300

Query  603   YLRLWALSLAHSELSSVFYDKVLLLAMgfnniviliigiivfICATVGVLLVMETLSAFL  424
             YLRLWALSLAHSELS+VFYDKVLL+A GFNN++ILIIGIIVFI ATVGVLLVMETLSAFL
Sbjct  301   YLRLWALSLAHSELSTVFYDKVLLMAWGFNNVIILIIGIIVFIFATVGVLLVMETLSAFL  360

Query  423   HALRLHWVEFQNKFYEGDGYKFSPFSFASIAHQDE  319
             HALRLHWVEFQNKFYEGDGYKF+PFSFA I  +++
Sbjct  361   HALRLHWVEFQNKFYEGDGYKFAPFSFALIREEED  395



>ref|XP_011089858.1| PREDICTED: V-type proton ATPase subunit a1 isoform X1 [Sesamum 
indicum]
Length=820

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/425 (71%), Positives = 355/425 (84%), Gaps = 2/425 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L  + REK+L SQKLG
Sbjct  396   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALILIAREKRLGSQKLG  455

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+L+M+LFSIY G IYNEFFSVPF +FG SAY C D +C DA + GL+K
Sbjct  456   SFMEMLFGGRYVLLMMSLFSIYCGLIYNEFFSVPFHIFGTSAYKCRDATCSDARSVGLVK  515

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDP W G+RSELPFLNSLKMKMSIL GVAQMNLGIVLSYFN R+F + ++I 
Sbjct  516   YRDTYPFGVDPSWRGSRSELPFLNSLKMKMSILFGVAQMNLGIVLSYFNARYFSSSLDIK  575

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSP + L EN++F GQ  L
Sbjct  576   YQFVPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPFEGLGENKLFWGQSVL  635

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhg--hghg  694
             Q++L+LLA++AVPWMLFPKPF+LK+ H ER +G++Y  L  +D   + E D+    H   
Sbjct  636   QVILLLLAVIAVPWMLFPKPFILKRLHTERFQGRAYGILGTSDIYNDEEPDSARHPHESH  695

Query  693   HEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfn  514
             +E+F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++
Sbjct  696   NEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYD  755

Query  513   niviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASI  334
             N +I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFAS+
Sbjct  756   NFIIRLVGLAVFSFATAFILLMMETLSAFLHALRLHWVEFQNKFYSGDGYKFRPFSFASL  815

Query  333   AHQDE  319
                D+
Sbjct  816   TDDDD  820



>ref|XP_009606446.1| PREDICTED: V-type proton ATPase subunit a1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=667

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/423 (71%), Positives = 353/423 (83%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L  + RE KLSSQKLG
Sbjct  247   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLIARESKLSSQKLG  306

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV++LM++FSIY G +YNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  307   SFMEMLFGGRYVLVLMSIFSIYCGLLYNEFFSVPFHIFGESAYKCRDATCSDARTVGLVK  366

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +D YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  FF + I+I 
Sbjct  367   YKDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAHFFSSSIDIK  426

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSP + L EN++F GQ  L
Sbjct  427   YQFIPQVIFLNSLFGYLSLLILVKWCTGSQADLYHVMIYMFLSPFEALGENRLFWGQSVL  486

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWMLFPKPF+LK+ H ER +G++Y  L  ++  ++ E  +       E
Sbjct  487   QVILLLLALVAVPWMLFPKPFILKRLHMERFQGRTYGILGTSEMGIDEEPGS--ARQHAE  544

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  545   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  604

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA +A 
Sbjct  605   VIRLVGLAVFAFATTFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFALLAD  664

Query  327   QDE  319
              D+
Sbjct  665   DDD  667



>gb|KDP44125.1| hypothetical protein JCGZ_05592 [Jatropha curcas]
Length=824

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/423 (71%), Positives = 354/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+Y+EANP V+T++TFPFLFAVMFGDWGHGICL +  L  + RE KLSSQKLG
Sbjct  404   IVDAYGVARYEEANPAVYTVITFPFLFAVMFGDWGHGICLLVGALVLIVRESKLSSQKLG  463

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GLIK
Sbjct  464   SFMEMLFGGRYVLLLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAQTAGLIK  523

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSIL GVAQMNLGI+LSYFN RFF + ++I 
Sbjct  524   FRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILFGVAQMNLGIILSYFNARFFGSSLDIR  583

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLN LFGYL++LII+KW +GSQADLYHVMIYMFLSPT+ L +NQ+F GQ+ L
Sbjct  584   YQFVPQMIFLNCLFGYLSLLIIIKWCSGSQADLYHVMIYMFLSPTEALGDNQLFWGQRPL  643

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLA++AVPWMLFPKPF+LKK H ER +G++Y  L  ++  ++ + +       H+
Sbjct  644   QILLLLLAVIAVPWMLFPKPFILKKLHTERFQGRTYGILGTSE--IDLDMEPGSARPHHD  701

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  702   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  761

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+ME+LSAFLHALRLHWVEFQNKFY GDG KF PFSFA I  
Sbjct  762   IIRLVGLSVFAFATAFILLMMESLSAFLHALRLHWVEFQNKFYNGDGCKFRPFSFALITE  821

Query  327   QDE  319
             +D+
Sbjct  822   EDD  824



>gb|KEH39308.1| vacuolar proton ATPase a3-like protein [Medicago truncatula]
Length=778

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/423 (71%), Positives = 354/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T V FPFLFA+MFGDWGHGICL L  L  +  E KLS+QKLG
Sbjct  358   IVDAYGVARYQEANPAVYTTVVFPFLFAMMFGDWGHGICLLLGALILIAHENKLSTQKLG  417

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLM+LFSIY G IYNEFFSVPF +FG SA+ C D SC DA T GL+K
Sbjct  418   SFMEMLFGGRYVILLMSLFSIYCGLIYNEFFSVPFHIFGPSAFRCRDTSCSDAHTIGLVK  477

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSEL FLNS+KMKMSIL GVA MNLGI+LSYFN RFF + ++I 
Sbjct  478   YRDPYPFGVDPSWRGSRSELAFLNSMKMKMSILFGVAHMNLGIILSYFNARFFGSSLDIR  537

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQ+ L
Sbjct  538   YQFVPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFWGQRPL  597

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLA++AVPWMLFPKPF+LKK H ER +G+SY  L+ ++  +E E D+      HE
Sbjct  598   QIVLLLLAIIAVPWMLFPKPFILKKLHTERFQGRSYGILNTSEMDLEVEPDS--AREHHE  655

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSE+FVHQ+IH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  656   DFNFSEIFVHQMIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  715

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+ME+LSAFLHALRLHWVEFQNKFY GDGYKF PFSFA++  
Sbjct  716   IIRLVGLTVFAFATAFILLMMESLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFAALTE  775

Query  327   QDE  319
              D+
Sbjct  776   DDD  778



>ref|XP_003538035.1| PREDICTED: vacuolar proton ATPase a1-like [Glycine max]
Length=818

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/422 (70%), Positives = 354/422 (84%), Gaps = 2/422 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T + FPFLFAVMFGDWGHGICL L  L  + R+ KLS+Q+LG
Sbjct  398   IVDAYGVARYQEANPAVYTTIIFPFLFAVMFGDWGHGICLLLGALVLIARQSKLSTQRLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVP+ +FG SAY C D SCRDA T GL+K
Sbjct  458   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPYHIFGASAYKCQDSSCRDAHTIGLVK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R+ YPFGVDP W G+RSELPFLNSLKMKMSILLGV  MNLGI+LSYFN RFF N ++I 
Sbjct  518   YREPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVHMNLGILLSYFNARFFGNSLDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLN LFGYL++LI++KW TGSQADLYHVMIYMFLSP D+L ENQ+F GQ+ L
Sbjct  578   YQFVPQIIFLNCLFGYLSLLIVVKWCTGSQADLYHVMIYMFLSPFDNLGENQLFWGQRPL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA++AVPWMLFPKPF+LKK + ER +G++Y  L+ ++  +E E D+      HE
Sbjct  638   QVVLLLLAVIAVPWMLFPKPFILKKLYNERFQGRTYGVLNTSEVDLELEPDS--ARQYHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  696   EFNFSEVFVHQMIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSF S+  
Sbjct  756   VIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYSGDGYKFKPFSFVSLTE  815

Query  327   QD  322
             ++
Sbjct  816   EE  817



>gb|AES67400.2| vacuolar proton ATPase a3-like protein [Medicago truncatula]
Length=818

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/423 (71%), Positives = 354/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T V FPFLFA+MFGDWGHGICL L  L  +  E KLS+QKLG
Sbjct  398   IVDAYGVARYQEANPAVYTTVVFPFLFAMMFGDWGHGICLLLGALILIAHENKLSTQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLM+LFSIY G IYNEFFSVPF +FG SA+ C D SC DA T GL+K
Sbjct  458   SFMEMLFGGRYVILLMSLFSIYCGLIYNEFFSVPFHIFGPSAFRCRDTSCSDAHTIGLVK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSEL FLNS+KMKMSIL GVA MNLGI+LSYFN RFF + ++I 
Sbjct  518   YRDPYPFGVDPSWRGSRSELAFLNSMKMKMSILFGVAHMNLGIILSYFNARFFGSSLDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQ+ L
Sbjct  578   YQFVPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFWGQRPL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLA++AVPWMLFPKPF+LKK H ER +G+SY  L+ ++  +E E D+      HE
Sbjct  638   QIVLLLLAIIAVPWMLFPKPFILKKLHTERFQGRSYGILNTSEMDLEVEPDS--AREHHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSE+FVHQ+IH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  696   DFNFSEIFVHQMIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+ME+LSAFLHALRLHWVEFQNKFY GDGYKF PFSFA++  
Sbjct  756   IIRLVGLTVFAFATAFILLMMESLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFAALTE  815

Query  327   QDE  319
              D+
Sbjct  816   DDD  818



>ref|XP_008783709.1| PREDICTED: vacuolar proton ATPase a1-like isoform X3 [Phoenix 
dactylifera]
Length=723

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/424 (70%), Positives = 355/424 (84%), Gaps = 4/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V++++TFPFLFAVMFGDWGHGICL L + + + REKK  SQKLG
Sbjct  303   IIDAYGVARYQEANPAVYSVITFPFLFAVMFGDWGHGICLLLGSFFLIVREKKFGSQKLG  362

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYV+LLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  363   SFMEMAFGGRYVLLLMALFSIYCGLIYNEFFSVPFRIFGESAYKCRDTTCSDARTAGLVK  422

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD Y FGVDP W G+RSELPFLNSLKMKMSILLGV+QMNLGI+LSYF+ +F  + ++I 
Sbjct  423   YRDPYAFGVDPRWRGSRSELPFLNSLKMKMSILLGVSQMNLGIILSYFDAKFHGSSLDIR  482

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LI++KW TGSQADLYHVMIYMFL PT DL EN++F GQK L
Sbjct  483   YQFIPQMIFLNSLFGYLSLLILIKWCTGSQADLYHVMIYMFLDPTGDLGENRLFWGQKPL  542

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLA+VAVPWMLFPKPF+L+K + ER +G++Y  L  ++  ++ E D+      H+
Sbjct  543   QILLLLLAIVAVPWMLFPKPFILRKLNTERFQGRTYGILGTSEMDLDHEPDS--ARQRHD  600

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LLLA G++N 
Sbjct  601   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKILLLAWGYDNP  660

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I I G+ VF  AT  +LL+METLSAFLHALRLHWVEF +KFY GDGYKF PFSFAS+A 
Sbjct  661   IIRIAGLTVFAFATAFILLMMETLSAFLHALRLHWVEFMSKFYHGDGYKFRPFSFASLA-  719

Query  327   QDEE  316
              DEE
Sbjct  720   -DEE  722



>ref|XP_009346583.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
Length=819

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/423 (71%), Positives = 355/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T +TFPFLFAVMFGDWGHGICL +  L  + RE KLS+QKLG
Sbjct  399   IVDAYGVARYQEANPAVYTCITFPFLFAVMFGDWGHGICLLVGALVLIARESKLSAQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C +A T GLIK
Sbjct  459   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDAACSEAYTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGV QMNLGI+LSYFN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVQMNLGILLSYFNARFFSSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++L+++KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQ+ L
Sbjct  579   YQFVPQMIFLNSLFGYLSLLVVIKWCTGSQADLYHVMIYMFLSPTDDLGENQLFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLAL+AVPWMLFPKPF+L+K + ER +G++Y  L  ++  +E E D+      HE
Sbjct  639   QIILLLLALIAVPWMLFPKPFILRKLNTERFQGRAYGMLGTSEMDLEVEPDS--ARQHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VF +KVLLLA G+++ 
Sbjct  697   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFCEKVLLLAWGYDSF  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG+ VF  AT  +LL+METLSAFLHALRLHWVE+QNKFY GDGYKF PFSFASI  
Sbjct  757   IIRLIGLSVFAFATAFILLMMETLSAFLHALRLHWVEYQNKFYHGDGYKFKPFSFASITE  816

Query  327   QDE  319
              ++
Sbjct  817   DED  819



>ref|XP_008783708.1| PREDICTED: vacuolar proton ATPase a1-like isoform X2 [Phoenix 
dactylifera]
Length=750

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/424 (70%), Positives = 355/424 (84%), Gaps = 4/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V++++TFPFLFAVMFGDWGHGICL L + + + REKK  SQKLG
Sbjct  330   IIDAYGVARYQEANPAVYSVITFPFLFAVMFGDWGHGICLLLGSFFLIVREKKFGSQKLG  389

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYV+LLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  390   SFMEMAFGGRYVLLLMALFSIYCGLIYNEFFSVPFRIFGESAYKCRDTTCSDARTAGLVK  449

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD Y FGVDP W G+RSELPFLNSLKMKMSILLGV+QMNLGI+LSYF+ +F  + ++I 
Sbjct  450   YRDPYAFGVDPRWRGSRSELPFLNSLKMKMSILLGVSQMNLGIILSYFDAKFHGSSLDIR  509

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LI++KW TGSQADLYHVMIYMFL PT DL EN++F GQK L
Sbjct  510   YQFIPQMIFLNSLFGYLSLLILIKWCTGSQADLYHVMIYMFLDPTGDLGENRLFWGQKPL  569

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLA+VAVPWMLFPKPF+L+K + ER +G++Y  L  ++  ++ E D+      H+
Sbjct  570   QILLLLLAIVAVPWMLFPKPFILRKLNTERFQGRTYGILGTSEMDLDHEPDS--ARQRHD  627

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LLLA G++N 
Sbjct  628   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKILLLAWGYDNP  687

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I I G+ VF  AT  +LL+METLSAFLHALRLHWVEF +KFY GDGYKF PFSFAS+A 
Sbjct  688   IIRIAGLTVFAFATAFILLMMETLSAFLHALRLHWVEFMSKFYHGDGYKFRPFSFASLA-  746

Query  327   QDEE  316
              DEE
Sbjct  747   -DEE  749



>ref|XP_006365749.1| PREDICTED: vacuolar proton ATPase a1-like isoform X1 [Solanum 
tuberosum]
Length=818

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/423 (71%), Positives = 353/423 (83%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L  + RE KLSSQKLG
Sbjct  398   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLIARESKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM++FSIY G IYNEFFSVPF +FG SAY C D +C DA T GLIK
Sbjct  458   SFMEMLFGGRYVLLLMSIFSIYCGLIYNEFFSVPFHIFGDSAYKCRDATCSDAQTVGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +D YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF + ++I 
Sbjct  518   YKDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFSSSLDIK  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++L+++KW TGSQADLYHVMIYMFLSP + L EN++F GQ  L
Sbjct  578   YQFIPQIIFLNSLFGYLSLLVVVKWCTGSQADLYHVMIYMFLSPFEALGENRLFWGQSVL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLAL+AVPWMLFPKPF+LK+ H ER +G++Y  L  ++   + + D+       E
Sbjct  638   QVILLLLALIAVPWMLFPKPFILKRLHMERFQGRTYGMLGTSEMGSDDQPDS--ARERAE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ NI
Sbjct  696   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENI  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA +A 
Sbjct  756   IIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFMPFSFALLAD  815

Query  327   QDE  319
              ++
Sbjct  816   DED  818



>ref|XP_009759132.1| PREDICTED: V-type proton ATPase subunit a1-like isoform X1 [Nicotiana 
sylvestris]
Length=817

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/423 (72%), Positives = 352/423 (83%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L  + RE KLSSQKLG
Sbjct  397   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLIARESKLSSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM++FSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  457   SFMEMLFGGRYVLLLMSIFSIYCGLIYNEFFSVPFHIFGDSAYKCRDATCSDARTVGLVK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
               D YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF + I+I 
Sbjct  517   YNDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFSSSIDIK  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSP + L EN++F GQ  L
Sbjct  577   YQFIPQIIFLNSLFGYLSLLILVKWCTGSQADLYHVMIYMFLSPFEALGENRLFWGQSVL  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWMLFPKPF+LK  H ER +G++Y  L  ++  ++ E  +       E
Sbjct  637   QVILLLLALVAVPWMLFPKPFILKSLHMERFQGRTYGILGTSEMVIDEEPGS--ASQHAE  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  695   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA +A 
Sbjct  755   VIRLVGLAVFAFATTFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFALLAD  814

Query  327   QDE  319
              D+
Sbjct  815   DDD  817



>gb|KHG14971.1| vatM [Gossypium arboreum]
Length=808

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/423 (72%), Positives = 352/423 (83%), Gaps = 14/423 (3%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T+VTFPFLFAVMFGDWGHGICL L  L            KLG
Sbjct  400   IVDAYGVARYQEANPAVYTVVTFPFLFAVMFGDWGHGICLLLGAL------------KLG  447

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C DA + GLIK
Sbjct  448   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDVTCSDAKSAGLIK  507

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF++ ++I 
Sbjct  508   FRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFRSSLDIR  567

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL EN++F GQ+ L
Sbjct  568   YQFVPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGENELFWGQRPL  627

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLALVAVPWMLFPKPF+LKK H ER +G++Y  L +++  ++ E D+      HE
Sbjct  628   QIVLLLLALVAVPWMLFPKPFILKKLHSERFQGRTYGLLGSSEFDLDVEPDS--ARDHHE  685

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  686   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  745

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI +IG+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA I  
Sbjct  746   VIRLIGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFALITD  805

Query  327   QDE  319
              D+
Sbjct  806   DDD  808



>ref|XP_006366398.1| PREDICTED: vacuolar proton ATPase a1-like [Solanum tuberosum]
Length=819

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/423 (72%), Positives = 354/423 (84%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQE NP V+TIVTFPFLFAVMFGDWGHGICL L  L  + +E KLSSQKLG
Sbjct  398   IVDAYGVAKYQEVNPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLISKESKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM++FSIY G IYNEFFSVPF +FG SAY C D SC DA T GLIK
Sbjct  458   SFMEMLFGGRYVLLLMSIFSIYCGLIYNEFFSVPFHIFGGSAYKCRDASCSDAQTVGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
               D YPFGVDP W G+RSELPFLNSLKMKMSILLGV QMNLGI+LSYFN RFF + ++I 
Sbjct  518   YSDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVQMNLGIILSYFNARFFNSSLDIK  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++L+++KW TGSQADLYHVMIYMFLSP + L ENQ+F GQ  L
Sbjct  578   YQFVPQVIFLNSLFGYLSLLVVVKWCTGSQADLYHVMIYMFLSPFEPLGENQLFWGQSVL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWMLFPKPF+LK+ H ER +G +Y  L  ++  +  E D+    H HE
Sbjct  638   QVILLLLALVAVPWMLFPKPFILKRLHTERFQGGTYGLLGTSEVDIYEEPDS-ARQHHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++++
Sbjct  697   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDSL  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI +IG+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF+PFSFAS+A 
Sbjct  757   VIRLIGLSVFAFATTFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFNPFSFASLAD  816

Query  327   QDE  319
              D+
Sbjct  817   DDD  819



>ref|XP_004251275.1| PREDICTED: V-type proton ATPase subunit a1 [Solanum lycopersicum]
Length=819

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/423 (72%), Positives = 354/423 (84%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQE NP V+TIVTFPFLFAVMFGDWGHGICL L  L  + +E KLSSQKLG
Sbjct  398   IVDAYGVAKYQEVNPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLISKESKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM++FSIY G IYNEFFSVPF +FG SAY C D SC DA T GLIK
Sbjct  458   SFMEMLFGGRYVLLLMSIFSIYCGLIYNEFFSVPFHIFGGSAYKCRDASCSDAQTVGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
               D YPFGVDP W G+RSELPFLNSLKMKMSILLGV QMNLGI+LSYFN RFF + ++I 
Sbjct  518   YSDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVVQMNLGIILSYFNARFFNSSLDIK  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++L+++KW TGSQADLYHVMIYMFLSP + L ENQ+F GQ  L
Sbjct  578   YQFVPQVIFLNSLFGYLSLLVVVKWCTGSQADLYHVMIYMFLSPFEALGENQLFWGQSVL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWMLFPKPF+LK+ H ER +G +Y  L  ++  +  E D+    H HE
Sbjct  638   QVILLLLALVAVPWMLFPKPFILKRLHTERFQGGTYGLLGTSELDIYEEPDS-ARQHHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++++
Sbjct  697   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDSL  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI +IG+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF+PFSFAS+A 
Sbjct  757   VIRLIGLSVFAFATTFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFNPFSFASLAD  816

Query  327   QDE  319
              D+
Sbjct  817   DDD  819



>ref|XP_010472136.1| PREDICTED: V-type proton ATPase subunit a2 isoform X5 [Camelina 
sativa]
Length=717

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/354 (79%), Positives = 314/354 (89%), Gaps = 2/354 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  336   IVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  395

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  396   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIK  455

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN +FFK+ +N+W
Sbjct  456   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVW  515

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  516   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIV  575

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET+    GHGHE
Sbjct  576   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGQSYAQLDETDESLQVETNG--GGHGHE  633

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLA  526
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A
Sbjct  634   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMA  687



>ref|XP_010472134.1| PREDICTED: V-type proton ATPase subunit a2 isoform X4 [Camelina 
sativa]
Length=719

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/354 (79%), Positives = 314/354 (89%), Gaps = 2/354 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  336   IVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  395

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  396   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIK  455

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN +FFK+ +N+W
Sbjct  456   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVW  515

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  516   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIV  575

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET+    GHGHE
Sbjct  576   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGQSYAQLDETDESLQVETNG--GGHGHE  633

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLA  526
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A
Sbjct  634   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMA  687



>ref|XP_009617904.1| PREDICTED: V-type proton ATPase subunit a1-like [Nicotiana tomentosiformis]
Length=819

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/423 (72%), Positives = 354/423 (84%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L  + +E KLSSQKLG
Sbjct  398   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLISKESKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM++FSIY G IYNEFFSVPF +FG SAY C D SC DA T GLIK
Sbjct  458   SFMEMLFGGRYVLLLMSIFSIYCGLIYNEFFSVPFRIFGGSAYKCRDASCSDAYTVGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
               D YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF N ++I 
Sbjct  518   YSDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFNNTLDIK  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSP + L ENQ+F GQ  L
Sbjct  578   YQFVPQVIFLNSLFGYLSLLIVVKWCTGSQADLYHVMIYMFLSPFEALGENQLFWGQSVL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWMLFPKPF+LK+ + ER +G +Y  L  ++     E D+    H HE
Sbjct  638   QVVLLLLALVAVPWMLFPKPFILKRLYTERFQGGTYGLLGTSEVDTYEEPDS-ARQHHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++++
Sbjct  697   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDSL  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA++A 
Sbjct  757   IIRLIGLAVFAFATTFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFAALAD  816

Query  327   QDE  319
              ++
Sbjct  817   DED  819



>ref|XP_007204941.1| hypothetical protein PRUPE_ppa001470mg [Prunus persica]
 gb|EMJ06140.1| hypothetical protein PRUPE_ppa001470mg [Prunus persica]
Length=819

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/423 (73%), Positives = 357/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T +TFPFLFAVMFGDWGHGICL L  L  + RE KLS+QKLG
Sbjct  399   IVDAYGVARYQEANPAVYTCITFPFLFAVMFGDWGHGICLLLGALILIARESKLSAQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C +A T GLIK
Sbjct  459   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTACSEAYTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF + I+I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGILLSYFNARFFSSSIDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSPTDDL EN++F GQ+ L
Sbjct  579   YQFVPQVIFLNSLFGYLSLLIVIKWCTGSQADLYHVMIYMFLSPTDDLGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLAL+AVPWMLFPKPF+LKK H ER +G++Y  L  ++  ++ E D+      HE
Sbjct  639   QIILLLLALIAVPWMLFPKPFILKKLHTERFQGRAYGMLGTSEMDLDVEPDS--ARQHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N 
Sbjct  697   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNF  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI +IG+ VF  AT  +LL+METLSAFLHALRLHWVE+QNKFY GDGYKF PFSFASI  
Sbjct  757   VIRLIGLAVFAFATAFILLMMETLSAFLHALRLHWVEYQNKFYYGDGYKFKPFSFASITE  816

Query  327   QDE  319
              ++
Sbjct  817   DED  819



>gb|KHN45895.1| Vacuolar proton translocating ATPase 100 kDa subunit [Glycine 
soja]
Length=628

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/423 (73%), Positives = 351/423 (83%), Gaps = 34/423 (8%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+AKYQEANPGV+T+VTFPFLFAVMFGDWGHGICL LA LY + RE+K +SQ   
Sbjct  239   IVDAYGIAKYQEANPGVYTVVTFPFLFAVMFGDWGHGICLLLAALYLMIRERKFASQ---  295

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
                                        NEFFSVPFELFG SAY C DPSCRDA+TTG IK
Sbjct  296   ---------------------------NEFFSVPFELFGPSAYGCRDPSCRDASTTGFIK  328

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR TYPFGVDP  HGT SELPFLNSLKMKMSILLGV+QMNLGI+ SYFN ++FKN+INIW
Sbjct  329   VRSTYPFGVDPKCHGTGSELPFLNSLKMKMSILLGVSQMNLGIITSYFNSKYFKNNINIW  388

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LII+KW TGSQADLYH+MIY FLSPTDDL ENQ+F GQK L
Sbjct  389   YQFVPQIIFLNSLFGYLSLLIIIKWSTGSQADLYHLMIYTFLSPTDDLGENQLFVGQKLL  448

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLA+VAVPWML PKPFLLKKQH+ERH+GQSY  L+  DD +ESE+ +    H H+
Sbjct  449   QLVLLLLAVVAVPWMLLPKPFLLKKQHQERHQGQSYDLLYGTDDTLESESQS--IAHDHD  506

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F+FSE+FVHQLIHTIEFVLG+VSNTAS LRLWAL+  HSELSSVFYDKVLLLA G+NN 
Sbjct  507   EFDFSEIFVHQLIHTIEFVLGAVSNTASSLRLWALT--HSELSSVFYDKVLLLAWGYNNT  564

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             ++LIIGI VFICATVGVLL+ME+LSAFLHALRLHWVE++NKFYEGDGYKF PFSFA +  
Sbjct  565   IVLIIGIFVFICATVGVLLLMESLSAFLHALRLHWVEYRNKFYEGDGYKFFPFSFALLTD  624

Query  327   QDE  319
             +DE
Sbjct  625   EDE  627



>ref|XP_010472133.1| PREDICTED: V-type proton ATPase subunit a2 isoform X3 [Camelina 
sativa]
Length=721

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/354 (79%), Positives = 314/354 (89%), Gaps = 2/354 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  336   IVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  395

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  396   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIK  455

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN +FFK+ +N+W
Sbjct  456   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVW  515

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  516   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIV  575

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET+    GHGHE
Sbjct  576   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGQSYAQLDETDESLQVETNG--GGHGHE  633

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLA  526
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A
Sbjct  634   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMA  687



>ref|XP_008783707.1| PREDICTED: vacuolar proton ATPase a1-like isoform X1 [Phoenix 
dactylifera]
Length=819

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/424 (70%), Positives = 355/424 (84%), Gaps = 4/424 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V++++TFPFLFAVMFGDWGHGICL L + + + REKK  SQKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVITFPFLFAVMFGDWGHGICLLLGSFFLIVREKKFGSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYV+LLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMAFGGRYVLLLMALFSIYCGLIYNEFFSVPFRIFGESAYKCRDTTCSDARTAGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD Y FGVDP W G+RSELPFLNSLKMKMSILLGV+QMNLGI+LSYF+ +F  + ++I 
Sbjct  519   YRDPYAFGVDPRWRGSRSELPFLNSLKMKMSILLGVSQMNLGIILSYFDAKFHGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LI++KW TGSQADLYHVMIYMFL PT DL EN++F GQK L
Sbjct  579   YQFIPQMIFLNSLFGYLSLLILIKWCTGSQADLYHVMIYMFLDPTGDLGENRLFWGQKPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLA+VAVPWMLFPKPF+L+K + ER +G++Y  L  ++  ++ E D+      H+
Sbjct  639   QILLLLLAIVAVPWMLFPKPFILRKLNTERFQGRTYGILGTSEMDLDHEPDS--ARQRHD  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LLLA G++N 
Sbjct  697   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKILLLAWGYDNP  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I I G+ VF  AT  +LL+METLSAFLHALRLHWVEF +KFY GDGYKF PFSFAS+A 
Sbjct  757   IIRIAGLTVFAFATAFILLMMETLSAFLHALRLHWVEFMSKFYHGDGYKFRPFSFASLA-  815

Query  327   QDEE  316
              DEE
Sbjct  816   -DEE  818



>ref|XP_008224871.1| PREDICTED: vacuolar proton ATPase a1-like [Prunus mume]
Length=819

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/423 (73%), Positives = 357/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T +TFPFLFAVMFGDWGHGICL L  L  + RE KLS+QKLG
Sbjct  399   IVDAYGVARYQEANPAVYTCITFPFLFAVMFGDWGHGICLLLGALILIARETKLSAQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C +A T GLIK
Sbjct  459   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTACSEAYTIGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF + I+I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGILLSYFNARFFSSSIDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSPTDDL EN++F GQ+ L
Sbjct  579   YQFVPQVIFLNSLFGYLSLLIVIKWCTGSQADLYHVMIYMFLSPTDDLGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLAL+AVPWMLFPKPF+LKK H ER +G++Y  L  ++  ++ E D+      HE
Sbjct  639   QIILLLLALIAVPWMLFPKPFILKKLHTERFQGRAYGMLGTSEMDLDVEPDS--ARQHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N 
Sbjct  697   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNF  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI +IG+ VF  AT  +LL+METLSAFLHALRLHWVE+QNKFY GDGYKF PFSFASI  
Sbjct  757   VIRLIGLAVFAFATAFILLMMETLSAFLHALRLHWVEYQNKFYYGDGYKFKPFSFASITE  816

Query  327   QDE  319
              ++
Sbjct  817   DED  819



>ref|XP_009606445.1| PREDICTED: V-type proton ATPase subunit a1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=817

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/423 (71%), Positives = 353/423 (83%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L  + RE KLSSQKLG
Sbjct  397   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLIARESKLSSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV++LM++FSIY G +YNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  457   SFMEMLFGGRYVLVLMSIFSIYCGLLYNEFFSVPFHIFGESAYKCRDATCSDARTVGLVK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +D YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  FF + I+I 
Sbjct  517   YKDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNAHFFSSSIDIK  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSP + L EN++F GQ  L
Sbjct  577   YQFIPQVIFLNSLFGYLSLLILVKWCTGSQADLYHVMIYMFLSPFEALGENRLFWGQSVL  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWMLFPKPF+LK+ H ER +G++Y  L  ++  ++ E  +       E
Sbjct  637   QVILLLLALVAVPWMLFPKPFILKRLHMERFQGRTYGILGTSEMGIDEEPGS--ARQHAE  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  695   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA +A 
Sbjct  755   VIRLVGLAVFAFATTFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFALLAD  814

Query  327   QDE  319
              D+
Sbjct  815   DDD  817



>ref|XP_009795362.1| PREDICTED: V-type proton ATPase subunit a1-like [Nicotiana sylvestris]
Length=819

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/423 (72%), Positives = 354/423 (84%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L  + +E KLSSQKLG
Sbjct  398   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLISKESKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM++FSIY G IYNEFFSVPF +FG SAY C D SC DA T GLIK
Sbjct  458   SFMEMLFGGRYVLLLMSIFSIYCGLIYNEFFSVPFHIFGGSAYKCRDASCSDAYTVGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
               D YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF N ++I 
Sbjct  518   YSDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFNNTLDIK  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQ+IFLNSLFGYL++LI++KW TGSQADLYHVMIYMFLSP + L ENQ+F GQ  L
Sbjct  578   YQFVPQVIFLNSLFGYLSLLIVVKWCTGSQADLYHVMIYMFLSPFEPLGENQLFWGQSVL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALVAVPWMLFPKPF+LK+ + ER +G +Y  L  ++     E D+    H HE
Sbjct  638   QVVLLLLALVAVPWMLFPKPFILKRLYTERFQGGTYGLLGTSEVDTYEEPDS-ARQHHHE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  697   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA++A 
Sbjct  757   IIRLIGLAVFAFATTFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFAALAD  816

Query  327   QDE  319
              ++
Sbjct  817   DED  819



>ref|XP_010472131.1| PREDICTED: V-type proton ATPase subunit a2 isoform X1 [Camelina 
sativa]
Length=757

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/354 (79%), Positives = 314/354 (89%), Gaps = 2/354 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICL LAT+Y + REKKLSSQKLG
Sbjct  336   IVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLG  395

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF GRYVI +M+LFSIYTG IYNEFFS+P+ LF  SAY C D SC +ATT GLIK
Sbjct  396   DIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIK  455

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI++S+FN +FFK+ +N+W
Sbjct  456   TRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVW  515

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QFVPQMIFLN LFGYL+VLII+KW TGSQADLYHVMIYMFLSP DDL ENQ+F  QK +
Sbjct  516   FQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIV  575

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+  + LALV+VPWML PKPF+LKKQHE RH+GQSYA L   D++++ ET+    GHGHE
Sbjct  576   QLTFLFLALVSVPWMLLPKPFILKKQHEARHQGQSYAQLDETDESLQVETNG--GGHGHE  633

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLA  526
             +FEFSE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFY+KVLL+A
Sbjct  634   EFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLMA  687



>ref|XP_010542602.1| PREDICTED: V-type proton ATPase subunit a1 [Tarenaya hassleriana]
Length=821

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/424 (71%), Positives = 354/424 (83%), Gaps = 1/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHGICL L  LY + RE+KL +QKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGICLLLGALYLLARERKLRTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD Y FGVDP W G+RSELPFLNSLKMKMSILLG+AQMNLGI+LS+FN RFF   ++I 
Sbjct  519   YRDAYSFGVDPSWRGSRSELPFLNSLKMKMSILLGIAQMNLGIILSFFNARFFGCSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQ+ L
Sbjct  579   YQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+L ALVAVPWMLFPKPF L+K + ER +G++Y  L  ++  ++ + D+    H  E
Sbjct  639   QIVLLLSALVAVPWMLFPKPFALRKMYMERFQGRAYGILGTSEVDLDVQPDSARDQHHDE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
              F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  699   -FNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              + ++G++VF  AT  +LL+METLSAFLHALRLHWVEF NKFY GDGYKF PFSFA I  
Sbjct  758   FVRLLGLVVFAFATAFILLMMETLSAFLHALRLHWVEFMNKFYSGDGYKFRPFSFALITA  817

Query  327   QDEE  316
              D+E
Sbjct  818   ADDE  821



>ref|XP_010521779.1| PREDICTED: V-type proton ATPase subunit a1 [Tarenaya hassleriana]
Length=822

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/424 (71%), Positives = 358/424 (84%), Gaps = 1/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V++++T+PFLFAVMFGDWGHGICL L  LY + RE+KLS+QKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVITYPFLFAVMFGDWGHGICLLLGALYLLARERKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVLLLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAHTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
               +TYPFGVDP W G+RSELPFLNSLKMKMSILLG++QMNLGI+LS+FN RFF + ++I 
Sbjct  519   YHNTYPFGVDPSWRGSRSELPFLNSLKMKMSILLGISQMNLGIILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLN LFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQ+ L
Sbjct  579   YQFVPQMIFLNGLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L++LAL+AVPWMLFPKPF L+  + ER +G+SY  L  ++  ++ E+D     H HE
Sbjct  639   QIVLLILALIAVPWMLFPKPFALRNMYMERFQGRSYGLLGTSEADLDVESD-PARDHHHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  698   EFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNV  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              I +IG+ VF  AT  +LL+METLSAFLHALRLHWVEF NKFY GDGYKF PFSFA I+ 
Sbjct  758   FIRLIGLAVFAFATAFILLMMETLSAFLHALRLHWVEFMNKFYSGDGYKFRPFSFALISD  817

Query  327   QDEE  316
              +++
Sbjct  818   NNDD  821



>ref|XP_010112349.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Morus notabilis]
 gb|EXC33238.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Morus notabilis]
Length=796

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/423 (69%), Positives = 338/423 (80%), Gaps = 25/423 (6%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP VFT++TFPFLFAVMFGDWGHGICL L  L  + RE KLS+QKLG
Sbjct  399   IVDAYGVARYQEANPAVFTVITFPFLFAVMFGDWGHGICLLLGALVLIARESKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
              +MEM F GRY++LLM+LFSIY G IYNEFFSVP+ +FG SAY C D +C DA T GL+K
Sbjct  459   SMMEMLFGGRYILLLMSLFSIYCGLIYNEFFSVPYHIFGGSAYKCRDATCSDAHTAGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGIV+SYFN  FF++ I+I 
Sbjct  519   FRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIVISYFNACFFRSSIDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL            
Sbjct  579   YQFVPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDL------------  626

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
                        VPWMLFPKPF+LKK H ER +G++Y  L  ++  ++ E D+      HE
Sbjct  627   -----------VPWMLFPKPFILKKLHTERFQGRTYGILGTSEMDLDVEPDS--ARQQHE  673

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ N 
Sbjct  674   EFNFSEIFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENF  733

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
              I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA++A 
Sbjct  734   AIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFATLAE  793

Query  327   QDE  319
              ++
Sbjct  794   DED  796



>ref|XP_002986306.1| hypothetical protein SELMODRAFT_182335 [Selaginella moellendorffii]
 gb|EFJ12515.1| hypothetical protein SELMODRAFT_182335 [Selaginella moellendorffii]
Length=800

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/424 (72%), Positives = 353/424 (83%), Gaps = 13/424 (3%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGV +YQEANPGVFTIVTFPFLFAVMFGDWGHGI L LATL+ +  E++L SQKLG
Sbjct  388   IVDAYGVGRYQEANPGVFTIVTFPFLFAVMFGDWGHGIVLLLATLWLLVNERRLGSQKLG  447

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF+GRYV+LLM+LFSIYTGFIYNEFFSVPFE+FGRSAY C  PSC ++TT GL+K
Sbjct  448   DIMEMAFAGRYVLLLMSLFSIYTGFIYNEFFSVPFEIFGRSAYKCETPSCSESTTVGLVK  507

Query  1227  VRDT-YPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINI  1051
              RD  Y FGVDPVWHG+RSELPFLNSLKMKMSI+LGVAQM LGIVLS FN  +F   ++I
Sbjct  508   YRDRPYAFGVDPVWHGSRSELPFLNSLKMKMSIILGVAQMLLGIVLSLFNAVYFAQPLDI  567

Query  1050  WHQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKY  871
             W QF+PQ++FL+SLFGYL+ LIILKW TGSQADLYHVMIYMFL PTDDL+ NQ+F GQKY
Sbjct  568   WFQFIPQILFLSSLFGYLSFLIILKWITGSQADLYHVMIYMFLGPTDDLDGNQLFAGQKY  627

Query  870   LQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgH  691
              Q+ L+ +AL++VPWML PKP +L+KQH E+ +G+ YA L    D    E +        
Sbjct  628   FQLALLFIALISVPWMLLPKPLILRKQHLEKTQGEGYAGLEEHPDEEHEEFEF-------  680

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
                  SE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAH+ELS+VFY+KVLLLA G+ N
Sbjct  681   -----SEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHAELSAVFYEKVLLLAWGYQN  735

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             I I++IG IVF+CATVGVLLVMETLSAFLHALRLHWVEF NKFY GDGYKF P SF ++ 
Sbjct  736   IFIILIGFIVFVCATVGVLLVMETLSAFLHALRLHWVEFMNKFYVGDGYKFQPLSFVNLG  795

Query  330   HQDE  319
              +DE
Sbjct  796   KEDE  799



>ref|XP_007132168.1| hypothetical protein PHAVU_011G071600g [Phaseolus vulgaris]
 gb|ESW04162.1| hypothetical protein PHAVU_011G071600g [Phaseolus vulgaris]
Length=818

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/422 (69%), Positives = 350/422 (83%), Gaps = 2/422 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T + FPFLFAVMFGDWGHGICL L  L  + RE KLS+Q+LG
Sbjct  398   IVDAYGVARYQEANPAVYTTIIFPFLFAVMFGDWGHGICLLLGALVLIARENKLSTQRLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVP+ +FG SAY C D +CRDA TTGL+K
Sbjct  458   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPYHIFGASAYKCRDNTCRDAHTTGLVK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R+ YPFGVDP W G+RSELPFLNSLKMKMSIL GV  MNLGI+LSYFN  FF + ++I 
Sbjct  518   YREPYPFGVDPSWRGSRSELPFLNSLKMKMSILFGVVHMNLGIILSYFNAHFFGSLLDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLN LFGYL++LII+KW TGSQADLYHVMIYMFLSP ++L +NQ+F GQ+ L
Sbjct  578   YQFVPQMIFLNCLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPFENLGDNQLFWGQRPL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+LL+LL+++AVPWMLFPKPF+LKK H ER +G++Y  LH ++  V+ E +        +
Sbjct  638   QVLLLLLSVIAVPWMLFPKPFMLKKLHNERFQGRTYGVLHTSE--VDLELEPGSARQHDD  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF F+EVFVHQ+IH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  696   DFNFTEVFVHQMIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             V+ ++G+ VF  AT  +LL+ME+LSAFLHALRLHWVEFQNKFY GDG KF PFSFAS+  
Sbjct  756   VVRLVGLAVFSFATAFILLMMESLSAFLHALRLHWVEFQNKFYHGDGCKFRPFSFASLTE  815

Query  327   QD  322
              +
Sbjct  816   DE  817



>ref|XP_002988745.1| hypothetical protein SELMODRAFT_184043 [Selaginella moellendorffii]
 gb|EFJ10256.1| hypothetical protein SELMODRAFT_184043 [Selaginella moellendorffii]
Length=800

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/424 (72%), Positives = 353/424 (83%), Gaps = 13/424 (3%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGV +YQEANPGVFTIVTFPFLFAVMFGDWGHGI L LATL+ +  E++L SQKLG
Sbjct  388   IVDAYGVGRYQEANPGVFTIVTFPFLFAVMFGDWGHGIVLLLATLWLLVNERRLGSQKLG  447

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEMAF+GRYV+LLM+LFSIYTGFIYNEFFSVPFE+FGRSAY C  PSC ++TT GL+K
Sbjct  448   DIMEMAFAGRYVLLLMSLFSIYTGFIYNEFFSVPFEIFGRSAYKCETPSCSESTTVGLVK  507

Query  1227  VRDT-YPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINI  1051
              RD  Y FGVDPVWHG+RSELPFLNSLKMKMSI+LGVAQM LGIVLS FN  +F   ++I
Sbjct  508   YRDKPYAFGVDPVWHGSRSELPFLNSLKMKMSIILGVAQMLLGIVLSLFNAVYFAQPLDI  567

Query  1050  WHQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKY  871
             W QF+PQ++FL+SLFGYL+ LIILKW TGSQADLYHVMIYMFL PTDDL+ NQ+F GQKY
Sbjct  568   WFQFLPQILFLSSLFGYLSFLIILKWITGSQADLYHVMIYMFLGPTDDLDGNQLFAGQKY  627

Query  870   LQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgH  691
              Q+ L+ +AL++VPWML PKP +L+KQH E+ +G+ YA L    D    E +        
Sbjct  628   FQLALLFIALISVPWMLLPKPLILRKQHLEKTQGEGYAGLEEHPDEEHEEFEF-------  680

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
                  SE+FVHQLIHTIEFVLG+VSNTASYLRLWALSLAH+ELS+VFY+KVLLLA G+ N
Sbjct  681   -----SEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHAELSAVFYEKVLLLAWGYQN  735

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             I I++IG IVF+CATVGVLLVMETLSAFLHALRLHWVEF NKFY GDGYKF P SF ++ 
Sbjct  736   IFIILIGFIVFVCATVGVLLVMETLSAFLHALRLHWVEFMNKFYVGDGYKFQPLSFVNLG  795

Query  330   HQDE  319
              +DE
Sbjct  796   KEDE  799



>ref|XP_007015507.1| Vacuolar proton ATPase A1 isoform 1 [Theobroma cacao]
 gb|EOY33126.1| Vacuolar proton ATPase A1 isoform 1 [Theobroma cacao]
Length=802

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/403 (73%), Positives = 346/403 (86%), Gaps = 2/403 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQE+NP V+T++TFPFLFAVMFGDWGHGICL L  L  + RE +LS+QKLG
Sbjct  400   IVDAYGVARYQESNPAVYTVITFPFLFAVMFGDWGHGICLLLGALVLIARESRLSTQKLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +CRDA + GLIK
Sbjct  460   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDATCRDAQSAGLIK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF+N ++I 
Sbjct  520   FRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFRNSLDIR  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL +N++F GQ+ L
Sbjct  580   YQFVPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGDNELFWGQRPL  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLALVAVPWMLFPKPF+LKK H ER +G++Y  L  ++  ++ E D+      HE
Sbjct  640   QIVLLLLALVAVPWMLFPKPFILKKLHSERFQGRTYGMLGTSEFDLDVEPDS--ARQHHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  698   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFY  379
             VI ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY
Sbjct  758   VIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFY  800



>gb|AES88702.2| vacuolar proton ATPase a3-like protein [Medicago truncatula]
Length=820

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/422 (70%), Positives = 354/422 (84%), Gaps = 2/422 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T + FPFLFAVMFGDWGHGICL L  L  +  E+KLS+Q+LG
Sbjct  400   IVDAYGVARYQEANPAVYTTIIFPFLFAVMFGDWGHGICLLLGALVLIAHERKLSNQRLG  459

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFS+Y G IYNEFFSVPF +FG SAY C D SCRDA TTGL+K
Sbjct  460   SFMEMLFGGRYVLLLMSLFSMYCGLIYNEFFSVPFHIFGASAYKCRDSSCRDAHTTGLVK  519

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              R+ YPFGVDP W G+RSELPFLNSLKMKMSIL GV  MNLGI+LSYFN  FF + ++I 
Sbjct  520   YREPYPFGVDPSWRGSRSELPFLNSLKMKMSILFGVVHMNLGILLSYFNAHFFGSSLDIR  579

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LI++KW TGSQADLYH+MIYMFLSP D+L EN++F GQ+ L
Sbjct  580   YQFVPQMIFLNSLFGYLSLLIVVKWCTGSQADLYHIMIYMFLSPFDNLGENELFWGQRPL  639

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLAL+AVPWMLFPKPF+LKK H ER +G++Y  L+  +  +E E D+      HE
Sbjct  640   QILLLLLALIAVPWMLFPKPFILKKLHNERFQGRNYGVLNTFEADLEVEPDS--ARQHHE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F F+EVFVHQ+IH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++N+
Sbjct  698   EFNFNEVFVHQMIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNL  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G++VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA++  
Sbjct  758   IIRLVGLVVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFATLTE  817

Query  327   QD  322
              +
Sbjct  818   DE  819



>ref|XP_008657093.1| PREDICTED: vacuolar proton ATPase a1 [Zea mays]
Length=818

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/423 (72%), Positives = 356/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+++VTFPFLFAVMFGDWGHGICL L  L  + REK+ SSQKLG
Sbjct  398   IVDAYGVARYQEANPAVYSVVTFPFLFAVMFGDWGHGICLLLGALVLILREKRFSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               ME+AF GRYVILLMA+FSIY G IYNEFFSVPF +FG+SAY C D SC DA T GLIK
Sbjct  458   SFMELAFGGRYVILLMAIFSIYCGLIYNEFFSVPFHIFGKSAYECRDKSCSDAHTFGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR+ YPFGVDP W G+RSELPFLNSLKMKMSIL+GVAQMNLGIVLSYF+ R+  N ++I 
Sbjct  518   VREPYPFGVDPSWRGSRSELPFLNSLKMKMSILMGVAQMNLGIVLSYFDARYHGNALDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL +LI++KW TGSQADLYHVMIYMFL P  DL ENQ+F GQK L
Sbjct  578   YQFIPQMIFLNSLFGYLALLILIKWCTGSQADLYHVMIYMFLDPAGDLGENQLFWGQKEL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLAL+AVPWMLFPKPF+LKK H+ER +G +Y  L  ++   +SE D+      H+
Sbjct  638   QILLLLLALIAVPWMLFPKPFILKKLHKERFQGHTYRFLGTSEMDPDSEPDS--ARARHD  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LLLA G++++
Sbjct  696   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKLLLLAWGYDSL  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             ++  +G+IVF  AT  +LL+METLSAFLHALRLHWVEF NKFY GDGYKF PFSFA +A 
Sbjct  756   IVKFVGLIVFSFATAFILLMMETLSAFLHALRLHWVEFMNKFYHGDGYKFKPFSFALLAD  815

Query  327   QDE  319
              ++
Sbjct  816   DED  818



>ref|XP_002970298.1| hypothetical protein SELMODRAFT_93837 [Selaginella moellendorffii]
 gb|EFJ28428.1| hypothetical protein SELMODRAFT_93837 [Selaginella moellendorffii]
Length=811

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/424 (72%), Positives = 354/424 (83%), Gaps = 2/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+Y+EANP V+TIVTFPFLFAVMFGDWGHGI L LATLY +  E KL SQKLG
Sbjct  388   IVDAYGVARYKEANPAVYTIVTFPFLFAVMFGDWGHGIVLLLATLYLILNEGKLGSQKLG  447

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIM MAF GRYVILLM++FSIYTGFIYNEFFSVPF +FG SAY C DPSC+D+ T GLIK
Sbjct  448   DIMGMAFGGRYVILLMSIFSIYTGFIYNEFFSVPFRIFGESAYVCRDPSCKDSRTAGLIK  507

Query  1227  VRD-TYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINI  1051
                 TYPFG DPVWHG+RSELPFLNS+KMKMSILLGV  MNLG+ LSY+N  +F   ++I
Sbjct  508   RPGYTYPFGFDPVWHGSRSELPFLNSVKMKMSILLGVVHMNLGLALSYYNASYFNEPLDI  567

Query  1050  WHQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKY  871
             W+QFVPQ++FL SLFGYL++LII+KW +GSQADLYHVMIYMFLSPTDDL  NQ+F+GQ  
Sbjct  568   WYQFVPQILFLGSLFGYLSLLIIIKWCSGSQADLYHVMIYMFLSPTDDLGPNQLFSGQTE  627

Query  870   LQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgH  691
             +Q  L+L+A+VAVP ML PKP  LKK+HEER  G+SY  L+   D  ES  + H H HG 
Sbjct  628   VQCFLLLIAVVAVPTMLLPKPLALKKRHEERTHGRSYGILNAGSDG-ESVDNEHDHHHGE  686

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+F+F E FVHQ+I TIEFVLG+VSNTASYLRLWALSLAH++LS+VFYDKVL+LA  ++N
Sbjct  687   EEFDFGETFVHQMIETIEFVLGAVSNTASYLRLWALSLAHAQLSAVFYDKVLILAWSYHN  746

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
              +ILIIG  VFICATVGVLL+METLSAFLHALRLHWVEFQ KFY GDGY+F PFSFA++ 
Sbjct  747   TMILIIGGFVFICATVGVLLIMETLSAFLHALRLHWVEFQGKFYGGDGYQFEPFSFATLE  806

Query  330   HQDE  319
               D+
Sbjct  807   EDDQ  810



>emb|CDM85023.1| unnamed protein product [Triticum aestivum]
Length=817

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/423 (70%), Positives = 355/423 (84%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGV +Y+E NP V++++TFPFLFAVMFGDWGHGICL L  L+ + REKKLSSQKL 
Sbjct  397   IVDAYGVGRYEEINPAVYSVITFPFLFAVMFGDWGHGICLLLGALFLILREKKLSSQKLD  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
                EMAF GRYVILLMALFSIY G IYNEFFSVPF +FG+SAYAC + SC DA T GL+K
Sbjct  457   SFTEMAFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGKSAYACRENSCSDAYTAGLVK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP W G+RSELPFLNSLKMKMSIL+GV+QMNLGI+LSYF+ +F KN ++I 
Sbjct  517   VRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILMGVSQMNLGILLSYFDAKFHKNALDIR  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++LI++KW TGS+ADLYHVMIYMFL P  DL ENQ+F GQK L
Sbjct  577   YQFIPQLIFLNSLFGYLSLLILIKWCTGSKADLYHVMIYMFLDPAGDLGENQLFWGQKEL  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLALVAVPWMLFPKPF+LKK H+ER +G SY  L  ++   +SE D+      H+
Sbjct  637   QILLLLLALVAVPWMLFPKPFILKKLHKERFQGHSYRFLGTSEMDPDSEPDS--ARSRHD  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF F EVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LL A G++++
Sbjct  695   DFNFGEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKLLLFAWGYDSL  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +  ++G+IVF  AT  +LL ME+LSAFLHALRLHWVEF NKFY GDGYKF PFSFA++A 
Sbjct  755   IFKLVGLIVFAFATAFILLGMESLSAFLHALRLHWVEFMNKFYHGDGYKFKPFSFATLAD  814

Query  327   QDE  319
              +E
Sbjct  815   DEE  817



>ref|XP_002978460.1| hypothetical protein SELMODRAFT_109102 [Selaginella moellendorffii]
 gb|EFJ20446.1| hypothetical protein SELMODRAFT_109102 [Selaginella moellendorffii]
Length=811

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/424 (72%), Positives = 354/424 (83%), Gaps = 2/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+Y+EANP V+TIVTFPFLFAVMFGDWGHGI L LATLY +  E KL SQKLG
Sbjct  388   IVDAYGVARYKEANPAVYTIVTFPFLFAVMFGDWGHGIVLLLATLYLILNEGKLGSQKLG  447

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIM MAF GRYVILLM++FSIYTGFIYNEFFSVPF +FG SAY C DPSC+D+ T GLIK
Sbjct  448   DIMGMAFGGRYVILLMSIFSIYTGFIYNEFFSVPFRIFGESAYVCRDPSCKDSRTAGLIK  507

Query  1227  VRD-TYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINI  1051
                 TYPFG DPVWHG+RSELPFLNS+KMKMSILLGV  MNLG+ LSY+N  +F   ++I
Sbjct  508   GPGYTYPFGFDPVWHGSRSELPFLNSVKMKMSILLGVVHMNLGLALSYYNASYFNEPLDI  567

Query  1050  WHQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKY  871
             W+QFVPQ++FL SLFGYL++LII+KW +GSQADLYHVMIYMFLSPTDDL  NQ+F+GQ  
Sbjct  568   WYQFVPQILFLGSLFGYLSLLIIIKWCSGSQADLYHVMIYMFLSPTDDLGPNQLFSGQTE  627

Query  870   LQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgH  691
             +Q  L+L+A+VAVP ML PKP  LKK+HEER  G+SY  L+   D  ES  + H H HG 
Sbjct  628   VQCFLLLIAVVAVPTMLLPKPLALKKRHEERTHGRSYGILNAGSDG-ESVDNEHDHHHGE  686

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+F+F E FVHQ+I TIEFVLG+VSNTASYLRLWALSLAH++LS+VFYDKVL+LA  ++N
Sbjct  687   EEFDFGETFVHQMIETIEFVLGAVSNTASYLRLWALSLAHAQLSAVFYDKVLILAWSYHN  746

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
              +ILIIG  VFICATVGVLL+METLSAFLHALRLHWVEFQ KFY GDGY+F PFSFA++ 
Sbjct  747   TMILIIGGFVFICATVGVLLIMETLSAFLHALRLHWVEFQGKFYGGDGYQFEPFSFATLE  806

Query  330   HQDE  319
               D+
Sbjct  807   EDDQ  810



>ref|XP_010414511.1| PREDICTED: V-type proton ATPase subunit a1 [Camelina sativa]
 ref|XP_010470069.1| PREDICTED: V-type proton ATPase subunit a1 [Camelina sativa]
Length=821

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/423 (71%), Positives = 358/423 (85%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLS+QKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLM+LFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVILLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W+G+RSELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWYGSRSELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ+ L
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L A +AVPWMLFPKPF L+K H ER +G++Y  L +++  ++ E D+   GH  E
Sbjct  639   QILLLLSAFIAVPWMLFPKPFALRKIHMERFQGRTYGVLGSSEVDLDVEPDSARGGHHEE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ NI
Sbjct  699   EFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG+ VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA I+ 
Sbjct  759   LIRLIGVAVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFHGDGYKFKPFSFALISD  818

Query  327   QDE  319
              DE
Sbjct  819   DDE  821



>ref|XP_010510601.1| PREDICTED: V-type proton ATPase subunit a1-like [Camelina sativa]
Length=821

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/423 (71%), Positives = 359/423 (85%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLS+QKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLM+LFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVILLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W+G+RSELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWYGSRSELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ+ L
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L A +AVPWMLFPKPF L+K H ER +G++Y  L +++  ++ E D+   GH  E
Sbjct  639   QILLLLSAFIAVPWMLFPKPFALRKIHMERFQGRTYGVLGSSEVDLDVEPDSARGGHHEE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  699   EFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG+ VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA I+ 
Sbjct  759   LIRLIGVAVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFHGDGYKFKPFSFALISD  818

Query  327   QDE  319
              DE
Sbjct  819   DDE  821



>dbj|BAF01786.1| vacuolar proton-ATPase subunit -like [Arabidopsis thaliana]
Length=416

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/416 (71%), Positives = 352/416 (85%), Gaps = 1/416 (0%)
 Frame = -2

Query  1578  AYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLGDIM  1399
             AYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLS+QKLG  M
Sbjct  1     AYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSTQKLGSFM  60

Query  1398  EMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIKVRD  1219
             EM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GLIK RD
Sbjct  61    EMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTVGLIKYRD  120

Query  1218  TYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIWHQF  1039
              YPFGVDP W G+R+ELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I +QF
Sbjct  121   PYPFGVDPSWRGSRTELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIRYQF  180

Query  1038  VPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYLQIl  859
             +PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ+ LQI+
Sbjct  181   IPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQRPLQIV  240

Query  858   lvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhg-hghgHEDF  682
             L+LLA +AVPWMLFPKPF L+K H ER +G++Y  L +++  ++ E D+    GH  E+F
Sbjct  241   LLLLAFIAVPWMLFPKPFALRKIHMERFQGRTYGVLVSSEVDLDVEPDSARGGGHHEEEF  300

Query  681   EFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnnivi  502
              FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ NI+I
Sbjct  301   NFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENILI  360

Query  501   liigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASI  334
              +IG+ VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA I
Sbjct  361   RLIGVAVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFNGDGYKFKPFSFALI  416



>ref|XP_009410597.1| PREDICTED: vacuolar proton ATPase a1 [Musa acuminata subsp. malaccensis]
Length=818

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/423 (70%), Positives = 357/423 (84%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V++++TFPFLFAVMFGDWGHG+CL L +L  + REKKL SQKLG
Sbjct  397   IVDAYGVARYQEANPAVYSVITFPFLFAVMFGDWGHGLCLLLGSLILILREKKLGSQKLG  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYV+LLMALFSIY G IYNEFFSVPF++FG+SAY C D SC DA T GLIK
Sbjct  457   SFMEMAFGGRYVVLLMALFSIYCGLIYNEFFSVPFQIFGKSAYKCRDSSCSDAHTAGLIK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGV+QMNLGI+LSYF+ +F  + +++ 
Sbjct  517   YRDPYPFGVDPRWRGSRSELPFLNSLKMKMSILLGVSQMNLGIILSYFDAKFHGSSLDVR  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL +LI++KW TGSQADLYHVMIYMFL+PT DL EN++F GQK L
Sbjct  577   YQFMPQMIFLNSLFGYLALLIVIKWCTGSQADLYHVMIYMFLNPTGDLGENKLFWGQKEL  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L+A+VAVPWMLFPKPF+L+K H ER +G++Y  L  ++  V+ + D+      HE
Sbjct  637   QILLLLMAIVAVPWMLFPKPFILRKLHTERFQGRTYGILGTSEMDVDHDPDS-ARRQHHE  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LLLA G++++
Sbjct  696   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKLLLLAWGYDSV  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I I G+ VF  AT  +LL+METLSAFLHALRLHWVEF  KFY GDGYKF PFSF  +A 
Sbjct  756   IIRIAGLAVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFYHGDGYKFKPFSFKLLAD  815

Query  327   QDE  319
             +++
Sbjct  816   EED  818



>ref|XP_003564548.1| PREDICTED: V-type proton ATPase subunit a1 [Brachypodium distachyon]
Length=817

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/423 (70%), Positives = 358/423 (85%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+Y+EANP V++++TFPFLFAVMFGDWGHGICL L  L+ + REKKLSSQKL 
Sbjct  397   IVDAYGVARYEEANPAVYSVITFPFLFAVMFGDWGHGICLLLGALFLILREKKLSSQKLD  456

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
                EMAF GRYVILLMALFSIY G IYNEFFSVPF +FG+SAYAC + SC DA T GL+K
Sbjct  457   SFTEMAFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGKSAYACRENSCSDAHTAGLLK  516

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP W G+RSELPFLNSLKMKMSIL+GV+QMNLGI+LSYF+ ++  N ++I 
Sbjct  517   VRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILMGVSQMNLGILLSYFDAKYHGNVLDIR  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL +LI++KW TGS++DLYHVMIYMFL P  DL ENQ+F GQK L
Sbjct  577   YQFIPQMIFLNSLFGYLALLILIKWCTGSKSDLYHVMIYMFLDPAGDLGENQLFWGQKEL  636

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLA+VAVPWMLFPKPF+LKK H+ER +G +Y  L  ++   +SE D+      H+
Sbjct  637   QILLLLLAIVAVPWMLFPKPFILKKLHKERFQGHTYRFLGTSEMDPDSEPDS--ARARHD  694

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LLLA G++++
Sbjct  695   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKLLLLAWGYDSL  754

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             ++ ++G+ VF  AT  +LL+ME+LSAFLHALRLHWVEF NKFY GDGYKF PFSFA +A 
Sbjct  755   IVKLVGLTVFAFATAFILLMMESLSAFLHALRLHWVEFMNKFYHGDGYKFKPFSFALLAD  814

Query  327   QDE  319
             +++
Sbjct  815   EED  817



>ref|XP_003597149.1| V-type proton ATPase 116 kDa subunit a isoform [Medicago truncatula]
Length=824

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/429 (70%), Positives = 352/429 (82%), Gaps = 8/429 (2%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T V FPFLFA+MFGDWGHGICL L  L  +  E KLS+QKLG
Sbjct  398   IVDAYGVARYQEANPAVYTTVVFPFLFAMMFGDWGHGICLLLGALILIAHENKLSTQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLM+LFSIY G IYNEFFSVPF +FG SA+ C D SC DA T GL+K
Sbjct  458   SFMEMLFGGRYVILLMSLFSIYCGLIYNEFFSVPFHIFGPSAFRCRDTSCSDAHTIGLVK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSEL FLNS+KMKMSIL GVA MNLGI+LSYFN RFF + ++I 
Sbjct  518   YRDPYPFGVDPSWRGSRSELAFLNSMKMKMSILFGVAHMNLGIILSYFNARFFGSSLDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQ+ L
Sbjct  578   YQFVPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFWGQRPL  637

Query  867   QIl---lvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghgh  697
             Q+    L+LLA++AVPWMLFPKPF+LKK H ER +G+SY  L+ ++  +E E D+     
Sbjct  638   QVSLIVLLLLAIIAVPWMLFPKPFILKKLHTERFQGRSYGILNTSEMDLEVEPDS--ARE  695

Query  696   gHEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALS---LAHSELSSVFYDKVLLLA  526
              HEDF FSE+FVHQ+IH+IEFVLGSVSNTASYLRLWAL    LAHSELS+VFY+KVLLLA
Sbjct  696   HHEDFNFSEIFVHQMIHSIEFVLGSVSNTASYLRLWALRFAHLAHSELSTVFYEKVLLLA  755

Query  525   MgfnniviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFS  346
              G++N++I ++G+ VF  AT  +LL+ME+LSAFLHALRLHWVEFQNKFY GDGYKF PFS
Sbjct  756   WGYDNLIIRLVGLTVFAFATAFILLMMESLSAFLHALRLHWVEFQNKFYHGDGYKFKPFS  815

Query  345   FASIAHQDE  319
             FA++   D+
Sbjct  816   FAALTEDDD  824



>ref|XP_001763380.1| predicted protein [Physcomitrella patens]
 gb|EDQ71910.1| predicted protein [Physcomitrella patens]
Length=818

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/430 (69%), Positives = 359/430 (83%), Gaps = 10/430 (2%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IV+AYGV +YQEANPG FTI+TFPFLFAVMFGDWGHGICL L  LY V  EK L  QKLG
Sbjct  391   IVEAYGVGRYQEANPGCFTIITFPFLFAVMFGDWGHGICLLLGALYLVLNEKNLGKQKLG  450

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDP-----SCRDATT  1243
             DIMEMA+ GRYVILLMA+FSIYTGFIYNEFFSVPF  FG SAY C DP     +C  ATT
Sbjct  451   DIMEMAYGGRYVILLMAIFSIYTGFIYNEFFSVPFGFFGGSAYRCPDPQFSIENCPSATT  510

Query  1242  TGLIK-VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFK  1066
             +G+ K   + Y FGVDP+WHG+RSELPF NSLKMKMSILLG++QMNLGI+LSYFN ++F 
Sbjct  511   SGVEKWSYEPYAFGVDPIWHGSRSELPFTNSLKMKMSILLGISQMNLGILLSYFNAKYFC  570

Query  1065  NDINIWHQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIF  886
             + +++W+QF+PQ++FLN+LFGYL+ LI+LKW  GS+ DLYHVMIYMFLSPT+DL ENQ+F
Sbjct  571   SALDVWYQFIPQLLFLNALFGYLSFLIVLKWCQGSKPDLYHVMIYMFLSPTEDLGENQLF  630

Query  885   TGQKYLQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNAD-DAVESETDNh  709
             +GQ Y+QI+L+L+ALVAVPWMLFPKP +L+ QH ++ RG +Y  L  +D  A E+E D+ 
Sbjct  631   SGQTYVQIILLLIALVAVPWMLFPKPLILRNQHIQKMRGATYGALRRSDSSASEAEVDS-  689

Query  708   ghghgHEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLL  529
                H  E+FEFSEV VHQ+IHTIEFVLG+VSNTASYLRLWALSLAH++LS+VFY++VL+ 
Sbjct  690   --DHDEEEFEFSEVLVHQMIHTIEFVLGAVSNTASYLRLWALSLAHAQLSAVFYERVLMF  747

Query  528   AMgfnniviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPF  349
             A G++N VI +IG+IVF   T GVLL+METLSAFLHALRLHWVEFQNKFY+GDGYKF PF
Sbjct  748   AWGYSNPVIRLIGLIVFTFVTFGVLLLMETLSAFLHALRLHWVEFQNKFYQGDGYKFKPF  807

Query  348   SFASIAHQDE  319
             +F S++ +D+
Sbjct  808   AFNSLSEEDD  817



>ref|XP_006409880.1| hypothetical protein EUTSA_v10016255mg [Eutrema salsugineum]
 gb|ESQ51333.1| hypothetical protein EUTSA_v10016255mg [Eutrema salsugineum]
Length=820

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/423 (71%), Positives = 357/423 (84%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLS+QKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L +N++F GQ+ L
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGDNELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L+A +AVPWMLFPKPF L+K H ER +G++Y  L  ++  ++ E D+   GH  E
Sbjct  639   QILLLLMAFIAVPWMLFPKPFALRKIHMERFQGRTYGVLGTSEVDLDVEPDS-ARGHQEE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ NI
Sbjct  698   EFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENI  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG+ VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA I+ 
Sbjct  758   LIRLIGVAVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFNGDGYKFKPFSFALISD  817

Query  327   QDE  319
              DE
Sbjct  818   DDE  820



>ref|XP_002879161.1| VHA-A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55420.1| VHA-A1 [Arabidopsis lyrata subsp. lyrata]
Length=822

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/424 (70%), Positives = 357/424 (84%), Gaps = 1/424 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLS+QKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+R+ELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRTELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ+ L
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQRSL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhg-hghgH  691
             QI+L+LLA +AVPWMLFPKPF L+K H ER +G++Y  L  ++  ++ E D+    GH  
Sbjct  639   QIMLLLLAFIAVPWMLFPKPFALRKIHMERFQGRTYGVLGTSEVDLDVEPDSARGGGHHE  698

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVL+LA G+ N
Sbjct  699   EEFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLILAWGYEN  758

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIA  331
             I+I +IG+ VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA I+
Sbjct  759   ILIRLIGVAVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFNGDGYKFKPFSFALIS  818

Query  330   HQDE  319
               DE
Sbjct  819   DDDE  822



>ref|XP_009140911.1| PREDICTED: vacuolar proton ATPase a1 [Brassica rapa]
Length=820

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/423 (70%), Positives = 358/423 (85%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQ+ANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLS+QKLG
Sbjct  399   IIDAYGVARYQQANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDATCSDAYTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+R+ELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRTELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ+ L
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L+A +AVPWMLFPKPF L+K H ER +G++Y  L  ++  ++ E D+   GH  E
Sbjct  639   QILLLLMAFIAVPWMLFPKPFALRKIHMERFQGRTYGVLGTSEVDLDVEPDS-ARGHQEE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ NI
Sbjct  698   EFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENI  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG++VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA I+ 
Sbjct  758   LIRLIGVVVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFHGDGYKFKPFSFALISD  817

Query  327   QDE  319
              DE
Sbjct  818   DDE  820



>ref|XP_009133874.1| PREDICTED: vacuolar proton ATPase a1-like [Brassica rapa]
Length=819

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/423 (70%), Positives = 355/423 (84%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLS QKLG
Sbjct  398   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSKQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  458   SFMEMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTAGLVK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  518   YRDPYPFGVDPSWRGSRSELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ+ L
Sbjct  578   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQRPL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLA +AVPWMLFPKPF L+K H ER +G++Y  L  ++  ++ + D+    H  E
Sbjct  638   QILLLLLAFIAVPWMLFPKPFALRKIHMERFQGRTYGLLGTSEVDLDVDPDS-ARSHQEE  696

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ NI
Sbjct  697   EFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENI  756

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG++VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSF  I+ 
Sbjct  757   LIRLIGVVVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFHGDGYKFKPFSFTLISD  816

Query  327   QDE  319
              DE
Sbjct  817   DDE  819



>ref|XP_008805029.1| PREDICTED: vacuolar proton ATPase a1-like [Phoenix dactylifera]
Length=818

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/423 (70%), Positives = 350/423 (83%), Gaps = 2/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V++++TFPFLFAVMFGDWGHGICL L +L  + REK+L SQKLG
Sbjct  398   IIDAYGVARYQEANPAVYSVITFPFLFAVMFGDWGHGICLLLGSLLLIIREKRLGSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               M MAF GRYV+LLMALFSIY G IYNEFFSVPF +FG SAY C + SC DA TTGL+K
Sbjct  458   SFMGMAFGGRYVLLLMALFSIYCGLIYNEFFSVPFHIFGESAYKCREISCSDARTTGLVK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
               D YPFGVDP W G+ SELPFLNSLKMKMSIL GV+QMNLGI+L YFN +F  + ++I 
Sbjct  518   YHDPYPFGVDPRWRGSLSELPFLNSLKMKMSILFGVSQMNLGIILGYFNAKFRGSSLDIR  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LI++KW TGSQADLYHVMIYMFL PT DL ENQ+F GQK L
Sbjct  578   YQFMPQMIFLNSLFGYLSLLILIKWCTGSQADLYHVMIYMFLDPTSDLGENQLFWGQKPL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLA+VAVPWMLFPKPF+L+K + ER +G++Y  L  ++   + E D+       +
Sbjct  638   QILLLLLAIVAVPWMLFPKPFILRKLNMERFQGRTYGILGTSEMDFDLEPDS--GRQHLD  695

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF F EVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LLLA G++N 
Sbjct  696   DFNFGEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKILLLAWGYDNP  755

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I I G+ VF  AT  +LL+METLSAFLHALRLHWVEF NKFY GDGYKF PFSFAS+A 
Sbjct  756   IIRIAGLAVFAFATAFILLMMETLSAFLHALRLHWVEFMNKFYHGDGYKFRPFSFASLAD  815

Query  327   QDE  319
             +++
Sbjct  816   EED  818



>ref|XP_009103695.1| PREDICTED: vacuolar proton ATPase a1-like [Brassica rapa]
Length=820

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/423 (70%), Positives = 357/423 (84%), Gaps = 1/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLSSQKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ+ L
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L+A +AVPWMLFPKPF L+K H ER +G++Y  L  ++  ++ E  +   GH  E
Sbjct  639   QILLLLMAFIAVPWMLFPKPFALRKIHMERFQGRTYGVLGTSEVDLDVEPGS-ARGHQEE  697

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQLIH++EFVLGSVSNT SYLRLWALSLAHSELS+VFY+KVLLLA G+ NI
Sbjct  698   EFNFSEIFVHQLIHSLEFVLGSVSNTESYLRLWALSLAHSELSTVFYEKVLLLAWGYENI  757

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG++VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA I++
Sbjct  758   LIRLIGLVVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFHGDGYKFKPFSFALISN  817

Query  327   QDE  319
              DE
Sbjct  818   DDE  820



>ref|XP_001768891.1| predicted protein [Physcomitrella patens]
 gb|EDQ66245.1| predicted protein [Physcomitrella patens]
Length=820

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/430 (68%), Positives = 358/430 (83%), Gaps = 10/430 (2%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IV+AYGV +YQEANPG FTI+TFPFLFAVMFGDWGHGICL L  LY V  EKKL S+KLG
Sbjct  393   IVEAYGVGRYQEANPGCFTIITFPFLFAVMFGDWGHGICLLLGALYLVLNEKKLGSKKLG  452

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDP-----SCRDATT  1243
             DIMEMA+ GRYVILLMA+FSIYTGFIYNEFFSVPF  FG SAY C D      SC  ATT
Sbjct  453   DIMEMAYGGRYVILLMAIFSIYTGFIYNEFFSVPFGFFGGSAYRCPDSQYSIESCPMATT  512

Query  1242  TGLIK-VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFK  1066
             +G+ K   + Y FGVDP+WHG+RSELPF NSLKMKMSILLG+AQMNLGI+LSYFN R+F+
Sbjct  513   SGMEKWSYEPYAFGVDPIWHGSRSELPFTNSLKMKMSILLGIAQMNLGILLSYFNARYFR  572

Query  1065  NDINIWHQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIF  886
             + +++W+QF+PQ++FLN+LFGYL+ LI+LKW  GS+ DLYHVMIYMFLSPT+DL ENQ+F
Sbjct  573   SALDVWYQFIPQLLFLNALFGYLSFLIVLKWCQGSKPDLYHVMIYMFLSPTEDLGENQLF  632

Query  885   TGQKYLQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNAD-DAVESETDNh  709
              GQ ++QI+L+L+ALVAVPWMLFPKP +L+K+H ++ +G++Y  L  +D ++ + E D  
Sbjct  633   MGQTFVQIVLLLVALVAVPWMLFPKPLILRKRHVQKMQGRAYGMLRESDTESTDLEIDG-  691

Query  708   ghghgHEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLL  529
                H  E+FEF EV VHQ+IHTIEFVLG+VSNTASYLRLWALSLAH++LS+VFYD+VL+ 
Sbjct  692   --EHDEEEFEFGEVLVHQMIHTIEFVLGAVSNTASYLRLWALSLAHAQLSAVFYDRVLMF  749

Query  528   AMgfnniviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPF  349
             A G+ N +I +IG+IVF   T GVLL+METLSAFLHALRLHWVEFQNKFY GDGYKF PF
Sbjct  750   AWGYTNPIIRLIGLIVFASVTFGVLLLMETLSAFLHALRLHWVEFQNKFYLGDGYKFQPF  809

Query  348   SFASIAHQDE  319
             SF +++ +D+
Sbjct  810   SFRTLSEEDD  819



>ref|XP_008382347.1| PREDICTED: vacuolar proton ATPase a3 [Malus domestica]
Length=540

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/366 (79%), Positives = 335/366 (92%), Gaps = 2/366 (1%)
 Frame = -2

Query  1416  KLGDIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTG  1237
             KLGDIMEMAF GRYVILLMA+FSIYTGFIYNEFFSVPFELFG SAYAC D SCRDATT G
Sbjct  177   KLGDIMEMAFGGRYVILLMAIFSIYTGFIYNEFFSVPFELFGPSAYACRDLSCRDATTAG  236

Query  1236  LIKVRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDI  1057
             LIKVR TYPFG+DPVWHG+RSELPFLNSLKMKMSI++GV QMNLGI++SYFN RFF++++
Sbjct  237   LIKVRPTYPFGLDPVWHGSRSELPFLNSLKMKMSIIIGVVQMNLGIMISYFNARFFQSNL  296

Query  1056  NIWHQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQ  877
             N+W QF+PQMIFLNSLFGYL+VLI++KW+TGS+ADLYHVMIYMFLSPTD+L ENQ+F GQ
Sbjct  297   NVWFQFIPQMIFLNSLFGYLSVLIVMKWWTGSKADLYHVMIYMFLSPTDELGENQLFNGQ  356

Query  876   KYLQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghgh  697
             K +Q++L+LLA VAVPWMLFPKPFLLKKQH++RH+GQSYA L N +++++  +++    H
Sbjct  357   KTVQLVLLLLAFVAVPWMLFPKPFLLKKQHQDRHQGQSYALLENTEESLQVNSNH--DAH  414

Query  696   gHEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgf  517
             GHE+FEFSEVFVHQ+IHTIEFVLG+VSNTASYLRLWALSLAHSELSSVFYDKVLL A GF
Sbjct  415   GHEEFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLLTAWGF  474

Query  516   nniviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFAS  337
             NN +ILI+G+IVF+CATVGVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF P+SF  
Sbjct  475   NNWIILIVGLIVFVCATVGVLLLMETLSAFLHALRLHWVEFQNKFYEGDGYKFYPYSFTL  534

Query  336   IAHQDE  319
             +   DE
Sbjct  535   LDDDDE  540



>ref|XP_006293692.1| hypothetical protein CARUB_v10022649mg [Capsella rubella]
 gb|EOA26590.1| hypothetical protein CARUB_v10022649mg [Capsella rubella]
Length=821

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/423 (70%), Positives = 359/423 (85%), Gaps = 0/423 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYG+A+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  L+ + REKKLS+QKLG
Sbjct  399   IIDAYGIARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALFLLAREKKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               M+M F GRYVILLM+LFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMKMLFGGRYVILLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W+G+RSELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWYGSRSELPYLNSLKMKMSILLGIAQMNLGLLLSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ+ L
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q+LL+L A +AVPWMLFPKPF L+K H ER +G++Y  L +++  +E E D+   GH  E
Sbjct  639   QLLLLLSAFIAVPWMLFPKPFALRKIHMERFQGRTYGVLVSSEVDLEVEPDSARGGHHEE  698

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQLIH+IEF+LGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  699   EFNFSEIFVHQLIHSIEFILGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  758

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG+ VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA I+ 
Sbjct  759   LIRLIGLAVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFHGDGYKFKPFSFALISD  818

Query  327   QDE  319
              DE
Sbjct  819   DDE  821



>ref|NP_850122.1| vacuolar proton ATPase A1 [Arabidopsis thaliana]
 sp|Q8RWZ7.1|VHAA1_ARATH RecName: Full=V-type proton ATPase subunit a1; Short=V-ATPase 
subunit a1; AltName: Full=V-type proton ATPase 95 kDa subunit 
a isoform 1; Short=V-ATPase 95 kDa isoform a1; AltName: Full=Vacuolar 
H(+)-ATPase subunit a isoform 1; AltName: Full=Vacuolar 
proton pump subunit a1; AltName: Full=Vacuolar proton 
translocating ATPase 95 kDa subunit a isoform 1 [Arabidopsis 
thaliana]
 gb|AAM14030.1| putative vacuolar proton-ATPase subunit [Arabidopsis thaliana]
 gb|AEC08134.1| vacuolar proton ATPase A1 [Arabidopsis thaliana]
Length=817

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/419 (71%), Positives = 355/419 (85%), Gaps = 1/419 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLS+QKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GLIK
Sbjct  459   SFMEMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTVGLIK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+R+ELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRTELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ+ L
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhg-hghgH  691
             QI+L+LLA +AVPWMLFPKPF L+K H ER +G++Y  L +++  ++ E D+    GH  
Sbjct  639   QIVLLLLAFIAVPWMLFPKPFALRKIHMERFQGRTYGVLVSSEVDLDVEPDSARGGGHHE  698

Query  690   EDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnn  511
             E+F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ N
Sbjct  699   EEFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYEN  758

Query  510   iviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASI  334
             I+I +IG+ VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA I
Sbjct  759   ILIRLIGVAVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFNGDGYKFKPFSFALI  817



>ref|XP_001752776.1| predicted protein [Physcomitrella patens]
 gb|EDQ82280.1| predicted protein [Physcomitrella patens]
Length=788

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/429 (68%), Positives = 355/429 (83%), Gaps = 8/429 (2%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IV+AYGV +YQEANPG FTIVTFPFLFAVMFGDWGHGICL L  LY V  EKKL  QKLG
Sbjct  361   IVEAYGVGRYQEANPGCFTIVTFPFLFAVMFGDWGHGICLLLGALYLVLNEKKLGKQKLG  420

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDP-----SCRDATT  1243
             DIMEMA+ GRYVILLMA+FSIYTGFIYNEFFSVPF +FG +AY C DP     +C  A+T
Sbjct  421   DIMEMAYGGRYVILLMAIFSIYTGFIYNEFFSVPFGIFGGTAYRCPDPQYSVENCPVAST  480

Query  1242  TGLIK-VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFK  1066
             +GL K   + Y FGVDPVWHG+RSELPF NSLKMKMSILLG++QMNLGI+LSYFN R+F+
Sbjct  481   SGLEKWSYEPYAFGVDPVWHGSRSELPFTNSLKMKMSILLGISQMNLGILLSYFNARYFR  540

Query  1065  NDINIWHQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIF  886
             + +++W+QF+PQ++FLN+LFGYL+ LI+LKW  GS+ DLYHVMIYMFLSPT DLE+NQ+F
Sbjct  541   SALDVWYQFIPQLLFLNALFGYLSFLIVLKWCQGSKPDLYHVMIYMFLSPTGDLEDNQLF  600

Query  885   TGQKYLQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhg  706
             +GQ Y+QI+L+++ALVAVPWMLFPKP LL++QH ++ +G+ Y  L  +     S  D   
Sbjct  601   SGQSYVQIVLLIIALVAVPWMLFPKPLLLRRQHMQKLQGRHYTALSRS--DYSSSDDEGT  658

Query  705   hghgHEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLA  526
               H  E+FEF EV VHQ+IHTIEFVLG+VSNTASYLRLWALSLAH++LS+VFY++VL+ A
Sbjct  659   GEHDEEEFEFGEVLVHQMIHTIEFVLGAVSNTASYLRLWALSLAHAQLSAVFYERVLMFA  718

Query  525   MgfnniviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFS  346
               ++N VI +IG+IVF   T GVLL+METLSAFLHALRLHWVEFQNKFY+GDGYKF PFS
Sbjct  719   WAYSNPVIRLIGLIVFAFVTFGVLLLMETLSAFLHALRLHWVEFQNKFYQGDGYKFKPFS  778

Query  345   FASIAHQDE  319
             F + + +D+
Sbjct  779   FNTCSEEDD  787



>gb|KHG14972.1| vatM [Gossypium arboreum]
Length=792

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/407 (73%), Positives = 341/407 (84%), Gaps = 14/407 (3%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQEANP V+T+VTFPFLFAVMFGDWGHGICL L  L            KLG
Sbjct  400   IVDAYGVARYQEANPAVYTVVTFPFLFAVMFGDWGHGICLLLGAL------------KLG  447

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C DA + GLIK
Sbjct  448   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGGSAYKCRDVTCSDAKSAGLIK  507

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF++ ++I 
Sbjct  508   FRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFRSSLDIR  567

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL EN++F GQ+ L
Sbjct  568   YQFVPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGENELFWGQRPL  627

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLALVAVPWMLFPKPF+LKK H ER +G++Y  L +++  ++ E D+      HE
Sbjct  628   QIVLLLLALVAVPWMLFPKPFILKKLHSERFQGRTYGLLGSSEFDLDVEPDS--ARDHHE  685

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G++NI
Sbjct  686   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNI  745

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDG  367
             VI +IG+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDG
Sbjct  746   VIRLIGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDG  792



>gb|EEE55633.1| hypothetical protein OsJ_03980 [Oryza sativa Japonica Group]
Length=789

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/423 (68%), Positives = 345/423 (82%), Gaps = 14/423 (3%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+A+Y+EANP V++++TFPFLFAVMFGDWGHGICL L     + REKKLSSQKLG
Sbjct  381   IVDAYGIARYEEANPAVYSVITFPFLFAVMFGDWGHGICLLLGACVLILREKKLSSQKLG  440

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYVILLMALFSIY G IYNEFFSVPF +FG+SAY C + +C DA T GLIK
Sbjct  441   SFMEMAFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGKSAYECREKTCSDAHTAGLIK  500

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP W G+RSELPFLNSLKMKMSIL+GV QMNLGIVLSYF+ +F  N ++I 
Sbjct  501   VRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILMGVTQMNLGIVLSYFDAKFHGNALDI-  559

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
                        SLFGYL +LI++KW TGSQADLYHVMIYMFL P+ +L ENQ+F GQK L
Sbjct  560   -----------SLFGYLALLILIKWCTGSQADLYHVMIYMFLDPSGNLGENQLFWGQKEL  608

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L+A+VAVPWMLFPKPF+LKK H+ER +G +Y  L  ++   +SE D+      H+
Sbjct  609   QILLLLMAIVAVPWMLFPKPFILKKLHKERFQGHTYRFLGTSEMDPDSEPDS--ARSRHD  666

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+L+LA G++N+
Sbjct  667   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKLLVLAWGYDNL  726

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             V+ ++G+++F  AT  +LL ME+LSAFLHALRLHWVEF NKFY GDGYKF PFSFA +A 
Sbjct  727   VVKLVGLVIFSFATAFILLGMESLSAFLHALRLHWVEFMNKFYHGDGYKFRPFSFALLAD  786

Query  327   QDE  319
              ++
Sbjct  787   DED  789



>gb|EEC71752.1| hypothetical protein OsI_04326 [Oryza sativa Indica Group]
Length=806

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/423 (68%), Positives = 345/423 (82%), Gaps = 14/423 (3%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYG+A+Y+EANP V++++TFPFLFAVMFGDWGHGICL L     + REKKLSSQKLG
Sbjct  398   IVDAYGIARYEEANPAVYSVITFPFLFAVMFGDWGHGICLLLGACVLILREKKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEMAF GRYVILLMALFSIY G IYNEFFSVPF +FG+SAY C + +C DA T GLIK
Sbjct  458   SFMEMAFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGKSAYECREKTCSDAHTAGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP W G+RSELPFLNSLKMKMSIL+GV QMNLGIVLSYF+ +F  N ++I 
Sbjct  518   VRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILMGVTQMNLGIVLSYFDAKFHGNALDI-  576

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
                        SLFGYL +LI++KW TGSQADLYHVMIYMFL P+ +L ENQ+F GQK L
Sbjct  577   -----------SLFGYLALLILIKWCTGSQADLYHVMIYMFLDPSGNLGENQLFWGQKEL  625

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+L+A+VAVPWMLFPKPF+LKK H+ER +G +Y  L  ++   +SE D+      H+
Sbjct  626   QILLLLMAIVAVPWMLFPKPFILKKLHKERFQGHTYRFLGTSEMDPDSEPDS--ARSRHD  683

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+L+LA G++N+
Sbjct  684   DFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKLLVLAWGYDNL  743

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             V+ ++G+++F  AT  +LL ME+LSAFLHALRLHWVEF NKFY GDGYKF PFSFA +A 
Sbjct  744   VVKLVGLVIFSFATAFILLGMESLSAFLHALRLHWVEFMNKFYHGDGYKFRPFSFALLAD  803

Query  327   QDE  319
              ++
Sbjct  804   DED  806



>gb|KEH36223.1| vacuolar proton ATPase a3-like protein [Medicago truncatula]
Length=722

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/335 (79%), Positives = 304/335 (91%), Gaps = 2/335 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYG+AKYQEANPGV+TI+TFPFLFAVMFGDWGHGICL LATLYF+  EKK   QKLG
Sbjct  389   IIDAYGIAKYQEANPGVYTIITFPFLFAVMFGDWGHGICLLLATLYFIINEKKFYCQKLG  448

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI+EM F GRY+I++MALFSIYTG IYNEFFS+PFELFG+SAY C DP+CRDATT GL+K
Sbjct  449   DILEMVFGGRYIIMMMALFSIYTGLIYNEFFSIPFELFGQSAYGCRDPTCRDATTIGLVK  508

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRDTYPFGVDP WHGTRSELPFLNSLKMKMSILLGV+QMNLGI+LSY+N ++F+N+INIW
Sbjct  509   VRDTYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVSQMNLGIILSYYNAKYFENNINIW  568

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             HQFVPQ+IFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTDDL ENQ+F GQK L
Sbjct  569   HQFVPQIIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFVGQKLL  628

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPFLLKKQH+ERH+ QSY+ ++N DD +ES++        H+
Sbjct  629   QVILLLLALVSVPWMLLPKPFLLKKQHQERHKSQSYSLIYNVDDPLESKSHG--IHKNHQ  686

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWAL  583
             +F+FSEVFVHQLIHTIEFVLG+VSNTASYLRLWAL
Sbjct  687   EFDFSEVFVHQLIHTIEFVLGAVSNTASYLRLWAL  721



>emb|CDX83292.1| BnaA03g22140D [Brassica napus]
Length=823

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/426 (70%), Positives = 354/426 (83%), Gaps = 4/426 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLS QKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSKQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTAGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKY-  871
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ + 
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQPFA  638

Query  870   --LQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghgh  697
               L ILL+LLA +AVPWMLFPKPF L+K H ER +G++Y  L  ++  ++ E D+    H
Sbjct  639   PSLLILLLLLAFIAVPWMLFPKPFALRKIHMERFQGRTYGLLGTSEVDLDVEPDS-ARSH  697

Query  696   gHEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgf  517
               E+F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+
Sbjct  698   QEEEFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGY  757

Query  516   nniviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFAS  337
              NI+I +IG++VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSF  
Sbjct  758   ENILIRLIGVVVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFHGDGYKFKPFSFTL  817

Query  336   IAHQDE  319
             I+  DE
Sbjct  818   ISDDDE  823



>gb|EPS59200.1| hypothetical protein M569_15610, partial [Genlisea aurea]
Length=725

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/335 (80%), Positives = 297/335 (89%), Gaps = 1/335 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGIC+ LATL+ + REKK  SQKLG
Sbjct  392   IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICILLATLFLIIREKKYLSQKLG  451

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DIMEM F GRYVILLMA+FSIYTG IYNEFFSVPFELF  SAY C DP+CRD+TT GLIK
Sbjct  452   DIMEMTFGGRYVILLMAIFSIYTGLIYNEFFSVPFELFAPSAYVCRDPACRDSTTVGLIK  511

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDP WHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN  FFKN IN+W
Sbjct  512   SRDTYPFGVDPAWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNALFFKNSINVW  571

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPTD+L ENQ+F GQK  
Sbjct  572   FQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPGQKTT  631

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q++L+LLALV+VPWML PKPFLLK+QH +RH G+SYAPL + D++     + +   HGHE
Sbjct  632   QLVLLLLALVSVPWMLLPKPFLLKRQH-DRHHGESYAPLQDTDESSLQHPEANHDPHGHE  690

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWAL  583
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYLRLWAL
Sbjct  691   EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWAL  725



>emb|CDY63878.1| BnaCnng42810D [Brassica napus]
Length=850

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/422 (70%), Positives = 352/422 (83%), Gaps = 4/422 (1%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLS QKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSKQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTAGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKY-  871
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ + 
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQPFA  638

Query  870   --LQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghgh  697
               L ILL+LLA +AVPWMLFPKPF L+K H ER +G++Y  L  ++  ++ E D+    H
Sbjct  639   PSLLILLLLLAFIAVPWMLFPKPFALRKIHMERFQGRTYGLLGTSEVDLDVEPDS-ARSH  697

Query  696   gHEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgf  517
               E+F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+
Sbjct  698   QEEEFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGY  757

Query  516   nniviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFAS  337
              NI+I +IG++VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSF  
Sbjct  758   ENILIRLIGVVVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFHGDGYKFKPFSFTL  817

Query  336   IA  331
             I+
Sbjct  818   IS  819



>gb|EMT21067.1| hypothetical protein F775_21366 [Aegilops tauschii]
Length=737

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/423 (69%), Positives = 344/423 (81%), Gaps = 14/423 (3%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGV +Y+E NP V++++TFPFLFAVMFGDWGHGICL L  L+ + REKKLSSQKL 
Sbjct  329   IVDAYGVGRYEEINPAVYSVITFPFLFAVMFGDWGHGICLLLGALFLILREKKLSSQKLD  388

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
                EMAF GRYVILLMALFSIY G IYNEFFSVPF +FG+SAYAC + SC DA T GL+K
Sbjct  389   SFTEMAFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGKSAYACRENSCSDAYTAGLVK  448

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VRD YPFGVDP W G+RSELPFLNSLKMKMSIL+GV+QMNLGI+LSYF+ +F KN ++I 
Sbjct  449   VRDPYPFGVDPSWRGSRSELPFLNSLKMKMSILMGVSQMNLGILLSYFDAKFHKNALDI-  507

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
                        SLFGYL++LI++KW TGS+ADLYHVMIYMFL P  DL ENQ+F GQK L
Sbjct  508   -----------SLFGYLSLLILIKWCTGSKADLYHVMIYMFLDPAGDLGENQLFWGQKEL  556

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QILL+LLALVAVPWMLFPKPF+LKK H+ER +G SY  L  ++   +SE D+      H+
Sbjct  557   QILLLLLALVAVPWMLFPKPFILKKLHKERFQGHSYRFLGTSEMDPDSEPDS--ARSRHD  614

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             DF F EVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+K+LL A G++++
Sbjct  615   DFNFGEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKLLLFAWGYDSL  674

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +  ++G+IVF  AT  +LL ME+LSAFLHALRLHWVEF NKFY GDGYKF PFSFA++A 
Sbjct  675   IFKLVGLIVFAFATAFILLGMESLSAFLHALRLHWVEFMNKFYHGDGYKFKPFSFATLAD  734

Query  327   QDE  319
              +E
Sbjct  735   DEE  737



>gb|KCW55396.1| hypothetical protein EUGRSUZ_I01306 [Eucalyptus grandis]
Length=736

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/330 (81%), Positives = 295/330 (89%), Gaps = 1/330 (0%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVA+YQE NPGVFTIVTFPFLFAVMFGDWGHGICL LATL ++F+EKKLS QKLG
Sbjct  402   IVDAYGVARYQEVNPGVFTIVTFPFLFAVMFGDWGHGICLLLATLVYIFKEKKLSGQKLG  461

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
             DI EM F GRYVIL+MALFSIYTG IYNEFFSVPFELFG SAYAC D SCRDATT GLIK
Sbjct  462   DITEMTFGGRYVILMMALFSIYTGLIYNEFFSVPFELFGLSAYACRDLSCRDATTVGLIK  521

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
             VR+TYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGI+LS+FN +FF N +NIW
Sbjct  522   VRETYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSFFNAKFFGNCVNIW  581

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
              QF+PQ+IFLNSLFGYL++LII+KW TGS+ADLYH+MIYMFLSPTD+L EN +F GQK +
Sbjct  582   FQFIPQLIFLNSLFGYLSLLIIVKWCTGSKADLYHIMIYMFLSPTDELGENALFPGQKMV  641

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             QI+L+LLALV+VPWML PKPFLLKKQHEERHRG SY PL   D++ + +T NH     HE
Sbjct  642   QIVLLLLALVSVPWMLLPKPFLLKKQHEERHRGNSYMPLETTDNSFQLDT-NHDAHGDHE  700

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYL  598
             +FEFSEVFVHQLIHTIEFVLG+VSNTASYL
Sbjct  701   EFEFSEVFVHQLIHTIEFVLGAVSNTASYL  730



>ref|XP_006365750.1| PREDICTED: vacuolar proton ATPase a1-like isoform X2 [Solanum 
tuberosum]
Length=790

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/423 (66%), Positives = 327/423 (77%), Gaps = 30/423 (7%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICL L  L  + RE KLSSQKLG
Sbjct  398   IVDAYGVAKYQEANPAVYTIVTFPFLFAVMFGDWGHGICLLLGALVLIARESKLSSQKLG  457

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM++FSIY G IYNEFFSVPF +FG SAY C D +C DA T GLIK
Sbjct  458   SFMEMLFGGRYVLLLMSIFSIYCGLIYNEFFSVPFHIFGDSAYKCRDATCSDAQTVGLIK  517

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              +D YPFGVDP W G+RSELPFLNSLKMKMSILLGVAQMNLGI+LSYFN RFF + ++I 
Sbjct  518   YKDPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNARFFSSSLDIK  577

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQ+IFLNSLFGYL++L+++KW TGSQADLYHVMIYMFLSP + L EN++F GQ  L
Sbjct  578   YQFIPQIIFLNSLFGYLSLLVVVKWCTGSQADLYHVMIYMFLSPFEALGENRLFWGQSVL  637

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q                            R +G++Y  L  ++   + + D+       E
Sbjct  638   Q----------------------------RFQGRTYGMLGTSEMGSDDQPDS--ARERAE  667

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH+IEFVLG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ NI
Sbjct  668   EFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENI  727

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA +A 
Sbjct  728   IIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFMPFSFALLAD  787

Query  327   QDE  319
              ++
Sbjct  788   DED  790



>gb|EYU36217.1| hypothetical protein MIMGU_mgv1a001612mg [Erythranthe guttata]
Length=785

 Score =   535 bits (1377),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 280/423 (66%), Positives = 325/423 (77%), Gaps = 32/423 (8%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IVDAYGVAKYQEANP V+ +VTFPFLFAVMFGDWGHGICL L  L+ + REKK  SQKLG
Sbjct  395   IVDAYGVAKYQEANPAVYAVVTFPFLFAVMFGDWGHGICLLLGALFLLAREKKFGSQKLG  454

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYV+LLM+LFSIY G IYNEFFSVPF +FG SAY C D +C DA T GLIK
Sbjct  455   SFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPFHIFGSSAYNCRDATCSDAHTVGLIK  514

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RDTYPFGVDP W G+RSELPFLNSLKMKMSIL G+AQMNLGI+LSYFN R+F N ++I 
Sbjct  515   DRDTYPFGVDPSWRGSRSELPFLNSLKMKMSILFGLAQMNLGIILSYFNARYFNNSLDIK  574

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QFVPQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSP +DL +N++F GQ   
Sbjct  575   YQFVPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPFEDLGDNKLFWGQG--  632

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
                                          R +G++Y  L  +D   + E D+       E
Sbjct  633   -----------------------------RFQGRTYGVLGTSDMYNDEEPDS-ARHPREE  662

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSEVFVHQ+IH IEF+LG+VSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+NNI
Sbjct  663   EFNFSEVFVHQMIHAIEFILGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNI  722

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I ++G+ VF  AT  +LL+METLSAFLHALRLHWVEFQNKFY GDGYKF PFSFA++  
Sbjct  723   IIRLVGLAVFAFATSFILLMMETLSAFLHALRLHWVEFQNKFYSGDGYKFRPFSFAALTD  782

Query  327   QDE  319
              ++
Sbjct  783   DED  785



>emb|CDY53381.1| BnaA04g16460D [Brassica napus]
Length=799

 Score =   533 bits (1374),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 282/423 (67%), Positives = 338/423 (80%), Gaps = 22/423 (5%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLS+QKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDATCSDAYTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+R+ELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRTELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ+ L
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q                      +K H ER +G++Y  L  ++  ++ E D+   GH  E
Sbjct  639   QA---------------------RKIHMERFQGRTYGVLGTSEVDLDVEPDS-ARGHQEE  676

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ NI
Sbjct  677   EFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENI  736

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG++VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA I+ 
Sbjct  737   LIRLIGVVVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFHGDGYKFKPFSFALISD  796

Query  327   QDE  319
              DE
Sbjct  797   DDE  799



>emb|CDY15756.1| BnaC04g15680D [Brassica napus]
Length=799

 Score =   526 bits (1354),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 282/423 (67%), Positives = 338/423 (80%), Gaps = 22/423 (5%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLSSQKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLTRERKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHVFGGSAYKCRDTTCSDAYTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYHVMIYMFLSPT++L EN++F GQ+ L
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTEELGENELFWGQRPL  638

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
             Q                      +K H ER +G++Y  L  ++  ++ E  +   GH  E
Sbjct  639   QA---------------------QKIHMERFQGRTYGVLGTSEVDLDVEPGS-ARGHQEE  676

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ NI
Sbjct  677   EFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENI  736

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG++VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA +++
Sbjct  737   LIRLIGLVVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFHGDGYKFKPFSFALVSN  796

Query  327   QDE  319
              DE
Sbjct  797   DDE  799



>emb|CDX77187.1| BnaC04g39820D [Brassica napus]
Length=794

 Score =   522 bits (1345),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 278/423 (66%), Positives = 334/423 (79%), Gaps = 27/423 (6%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLS+QKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSTQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA TTGL+K
Sbjct  459   SFMEMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGGSAYRCRDTTCSDAYTTGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+R+ELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRTELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYH+++ +                    
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHILLLLM-------------------  619

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
                    A +AVPWMLFPKPF L+K H ER +G++Y  L  ++  ++ E D+   GH  E
Sbjct  620   -------AFIAVPWMLFPKPFALRKIHMERFQGRTYGVLGTSEVDLDVEPDS-ARGHQEE  671

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ NI
Sbjct  672   EFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENI  731

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG++VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA I+ 
Sbjct  732   LIRLIGVVVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFHGDGYKFKPFSFALISD  791

Query  327   QDE  319
              DE
Sbjct  792   DDE  794



>emb|CDY04571.1| BnaA07g13970D [Brassica napus]
Length=794

 Score =   520 bits (1338),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 278/423 (66%), Positives = 333/423 (79%), Gaps = 27/423 (6%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             I+DAYGVA+YQEANP V+++VT+PFLFAVMFGDWGHG+CL L  LY + RE+KLSSQKLG
Sbjct  399   IIDAYGVARYQEANPAVYSVVTYPFLFAVMFGDWGHGLCLLLGALYLLARERKLSSQKLG  458

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDPSCRDATTTGLIK  1228
               MEM F GRYVILLMALFSIY G IYNEFFSVPF +FG SAY C D +C DA T GL+K
Sbjct  459   SFMEMLFGGRYVILLMALFSIYCGLIYNEFFSVPFHIFGGSAYKCRDTTCSDAYTVGLVK  518

Query  1227  VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFKNDINIW  1048
              RD YPFGVDP W G+RSELP+LNSLKMKMSILLG+AQMNLG++LS+FN RFF + ++I 
Sbjct  519   YRDPYPFGVDPSWRGSRSELPYLNSLKMKMSILLGIAQMNLGLILSFFNARFFGSSLDIR  578

Query  1047  HQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIFTGQKYL  868
             +QF+PQMIFLNSLFGYL++LII+KW TGSQADLYH+++ +                    
Sbjct  579   YQFIPQMIFLNSLFGYLSLLIIIKWCTGSQADLYHILLLLM-------------------  619

Query  867   QIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhghghgHE  688
                    A +AVPWMLFPKPF L+K H ER +G++Y  L  ++  ++ E  +   GH  E
Sbjct  620   -------AFIAVPWMLFPKPFALRKIHMERFQGRTYGVLGTSEVDLDVEPGS-ARGHQEE  671

Query  687   DFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLAMgfnni  508
             +F FSE+FVHQLIH+IEFVLGSVSNTASYLRLWALSLAHSELS+VFY+KVLLLA G+ NI
Sbjct  672   EFNFSEIFVHQLIHSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYENI  731

Query  507   viliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFASIAH  328
             +I +IG++VF  AT  +LL+METLSAFLHALRLHWVEF  KF+ GDGYKF PFSFA I++
Sbjct  732   LIRLIGLVVFAFATAFILLMMETLSAFLHALRLHWVEFMGKFFHGDGYKFKPFSFALISN  791

Query  327   QDE  319
              DE
Sbjct  792   DDE  794



>ref|XP_001781151.1| predicted protein [Physcomitrella patens]
 gb|EDQ54019.1| predicted protein [Physcomitrella patens]
Length=818

 Score =   520 bits (1339),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 292/429 (68%), Positives = 351/429 (82%), Gaps = 8/429 (2%)
 Frame = -2

Query  1587  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLFLATLYFVFREKKLSSQKLG  1408
             IV+AYGV +YQEANPG FTI+TFPFLFAVMFGDWGHGICL L  LY V  EKKL S+KLG
Sbjct  391   IVEAYGVGRYQEANPGCFTIITFPFLFAVMFGDWGHGICLLLGALYLVLNEKKLGSKKLG  450

Query  1407  DIMEMAFSGRYVILLMALFSIYTGFIYNEFFSVPFELFGRSAYACSDP-----SCRDATT  1243
             D MEMA+ GRYVILLMA+FSIYTGFIYNEFFSV F  FG SAY C DP     +C  ATT
Sbjct  451   DTMEMAYGGRYVILLMAMFSIYTGFIYNEFFSVSFGFFGGSAYQCPDPQYSVKNCPTATT  510

Query  1242  TGLIK-VRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNGRFFK  1066
             +G+ K   + Y FG+DP+WHG+RSELPF NSLKMKMSILLG+ QMNLGI+LSYFN R+F+
Sbjct  511   SGVEKWSYEPYAFGIDPIWHGSRSELPFTNSLKMKMSILLGICQMNLGILLSYFNARYFR  570

Query  1065  NDINIWHQFVPQMIFLNSLFGYLTVLIILKWYTGSQADLYHVMIYMFLSPTDDLEENQIF  886
             + +++W+QF+PQ++FLN+LFGYL+ LIILKW  GS+ DLYH+MIYMFLSPT+DL ENQ+F
Sbjct  571   SALDVWYQFIPQLLFLNALFGYLSFLIILKWCQGSKPDLYHIMIYMFLSPTEDLGENQLF  630

Query  885   TGQKYLQIllvllalvaVPWMLFPKPFLLKKQHEERHRGQSYAPLHNADDAVESETDNhg  706
              GQ Y+QI+L+L+ALVAVPWMLFPKP +++KQH ++  G++Y  L  +D   ES      
Sbjct  631   IGQTYVQIVLLLVALVAVPWMLFPKPLIMRKQHIQKMHGRTYGFLRESD--TESTDLEVD  688

Query  705   hghgHEDFEFSEVFVHQLIHTIEFVLGSVSNTASYLRLWALSLAHSELSSVFYDKVLLLA  526
               H  E+FEFSEVFVHQ+IHTIEFVL SVSNTASYLRLWALSLAH++LS+VFYD+VL+ A
Sbjct  689   VEHDEEEFEFSEVFVHQMIHTIEFVLNSVSNTASYLRLWALSLAHAQLSAVFYDRVLMFA  748

Query  525   MgfnniviliigiivfICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFS  346
               + N +I +IG+IVF  ATV VLL METLSAFLHALRLHWVEFQ KFY+GDGYKF PFS
Sbjct  749   WEYTNPIIRLIGLIVFANATVVVLLCMETLSAFLHALRLHWVEFQGKFYQGDGYKFHPFS  808

Query  345   FASIAHQDE  319
             F ++  +D+
Sbjct  809   FKTLFEEDD  817



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4436604669000