BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16927_g1_i2 len=492 path=[2374:0-156 4210:157-173 2544:174-212
305:213-444 537:445-468 4296:469-491]

Length=492
                                                                      Score     E

ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like        83.6    1e-15   
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like        83.6    2e-15   
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  82.8    2e-15   
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  82.8    3e-15   
gb|AFO67228.1|  putative cytochrome P450 72A                          78.6    4e-15   
ref|XP_002266550.1|  PREDICTED: cytochrome P450 CYP72A219-like        80.9    6e-15   Vitis vinifera
ref|XP_006442317.1|  hypothetical protein CICLE_v10023602mg           81.6    6e-15   
gb|KDO52111.1|  hypothetical protein CISIN_1g046539mg                 81.3    7e-15   
ref|XP_004244274.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  80.9    1e-14   
ref|XP_008226213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  80.9    1e-14   
emb|CAN72443.1|  hypothetical protein VITISV_032856                   77.8    2e-14   Vitis vinifera
ref|XP_008226215.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  80.1    2e-14   
ref|XP_010324391.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  79.7    2e-14   
ref|XP_009797873.1|  PREDICTED: cytochrome P450 CYP72A219-like        79.3    4e-14   
gb|ABC69422.1|  CYP72A58                                              79.3    4e-14   Nicotiana tabacum [American tobacco]
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    79.3    4e-14   
emb|CDP15975.1|  unnamed protein product                              79.0    5e-14   
ref|XP_002262693.1|  PREDICTED: cytochrome P450 CYP72A219             79.0    6e-14   Vitis vinifera
ref|XP_006477888.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    79.0    6e-14   
ref|XP_004300362.1|  PREDICTED: secologanin synthase-like             78.6    7e-14   
ref|XP_006348303.1|  PREDICTED: secologanin synthase-like             78.2    9e-14   
ref|XP_006442316.1|  hypothetical protein CICLE_v10024206mg           78.2    1e-13   
ref|XP_002268319.1|  PREDICTED: cytochrome P450 CYP72A219             78.2    1e-13   Vitis vinifera
ref|XP_010645072.1|  PREDICTED: cytochrome P450 CYP72A219-like        77.4    1e-13   
emb|CAN80407.1|  hypothetical protein VITISV_020336                   75.1    1e-13   Vitis vinifera
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  77.8    1e-13   
ref|XP_004243258.1|  PREDICTED: cytochrome P450 CYP72A219-like        77.8    1e-13   
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like        77.4    2e-13   
ref|XP_006348907.1|  PREDICTED: secologanin synthase-like             77.4    2e-13   
ref|XP_006477887.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    77.4    2e-13   
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like        77.4    2e-13   
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like        77.4    2e-13   
gb|KHN44056.1|  Secologanin synthase                                  77.4    2e-13   
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  77.4    2e-13   
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like        77.0    2e-13   Vitis vinifera
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like        77.0    2e-13   Vitis vinifera
emb|CDP15972.1|  unnamed protein product                              76.6    2e-13   
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like        77.0    2e-13   
emb|CAN71060.1|  hypothetical protein VITISV_032612                   75.1    3e-13   Vitis vinifera
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    77.0    3e-13   
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like             76.6    3e-13   
sp|H2DH21.1|C7A29_PANGI  RecName: Full=Cytochrome P450 CYP72A219;...  76.6    3e-13   
ref|XP_006348908.1|  PREDICTED: secologanin synthase-like             76.6    4e-13   
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like        76.6    4e-13   
ref|XP_006348909.1|  PREDICTED: secologanin synthase-like             76.3    4e-13   
ref|XP_006348982.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    77.0    4e-13   
ref|XP_004244272.1|  PREDICTED: cytochrome P450 CYP72A219-like        76.3    4e-13   
gb|KHN47456.1|  Secologanin synthase                                  76.3    5e-13   
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    76.3    5e-13   
ref|XP_006348304.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  76.3    5e-13   
ref|XP_008226210.1|  PREDICTED: cytochrome P450 CYP72A219-like        75.9    6e-13   
ref|XP_008226211.1|  PREDICTED: cytochrome P450 CYP72A219-like        75.9    6e-13   
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like        75.9    6e-13   
ref|XP_002263609.1|  PREDICTED: cytochrome P450 CYP72A219             75.9    7e-13   Vitis vinifera
emb|CBI39895.3|  unnamed protein product                              73.2    7e-13   
emb|CBI39886.3|  unnamed protein product                              75.9    7e-13   
emb|CDP19608.1|  unnamed protein product                              75.5    8e-13   
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like        75.5    8e-13   
gb|EYU30744.1|  hypothetical protein MIMGU_mgv1a004594mg              75.5    9e-13   
ref|XP_007212563.1|  hypothetical protein PRUPE_ppa015526mg           75.1    9e-13   
ref|XP_009615909.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  75.1    9e-13   
ref|XP_008226217.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  75.5    9e-13   
ref|XP_008226216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  75.5    1e-12   
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like             75.5    1e-12   
emb|CDP19601.1|  unnamed protein product                              75.1    1e-12   
ref|XP_010327096.1|  PREDICTED: cytochrome P450 CYP72A219-like        72.8    1e-12   
ref|XP_009615908.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  75.1    1e-12   
ref|XP_009796906.1|  PREDICTED: cytochrome P450 CYP72A219-like        74.7    1e-12   
gb|KEH38473.1|  cytochrome P450 family 72 protein                     74.3    1e-12   
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  75.1    1e-12   
ref|XP_007212438.1|  hypothetical protein PRUPE_ppa016770mg           74.7    1e-12   
ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like        74.7    1e-12   
ref|XP_008226214.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  74.7    2e-12   
emb|CAN63404.1|  hypothetical protein VITISV_001871                   74.3    2e-12   Vitis vinifera
ref|XP_010327256.1|  PREDICTED: cytochrome P450 CYP72A219-like        73.9    2e-12   
emb|CBI39940.3|  unnamed protein product                              73.6    2e-12   
gb|EYU44091.1|  hypothetical protein MIMGU_mgv1a0044502mg             70.9    2e-12   
ref|XP_006364093.1|  PREDICTED: secologanin synthase-like             74.7    2e-12   
gb|KDO49367.1|  hypothetical protein CISIN_1g034199mg                 70.1    2e-12   
emb|CBI22139.3|  unnamed protein product                              73.9    2e-12   
ref|XP_006348911.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    74.3    2e-12   
gb|KDO49366.1|  hypothetical protein CISIN_1g034199mg                 70.1    2e-12   
gb|KDO49365.1|  hypothetical protein CISIN_1g034199mg                 70.1    2e-12   
emb|CDP15988.1|  unnamed protein product                              74.3    2e-12   
gb|KHN14193.1|  Secologanin synthase                                  74.3    2e-12   
ref|XP_006598136.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  73.6    2e-12   
ref|XP_006364094.1|  PREDICTED: secologanin synthase-like             74.3    2e-12   
ref|NP_001291324.1|  cytochrome P450 CYP72A219-like                   74.3    2e-12   
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59           73.9    2e-12   
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  73.9    3e-12   
gb|KHN44057.1|  Secologanin synthase                                  73.9    3e-12   
ref|XP_004243262.1|  PREDICTED: cytochrome P450 CYP72A219-like        73.9    3e-12   
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219             73.9    3e-12   
emb|CAN67740.1|  hypothetical protein VITISV_015554                   73.9    3e-12   Vitis vinifera
ref|XP_007213922.1|  hypothetical protein PRUPE_ppa004271mg           73.9    3e-12   
gb|KDO35797.1|  hypothetical protein CISIN_1g037705mg                 69.3    3e-12   
ref|XP_004243260.1|  PREDICTED: cytochrome P450 CYP72A219             73.9    3e-12   
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219             73.9    3e-12   Vitis vinifera
emb|CBI22134.3|  unnamed protein product                              73.9    3e-12   
ref|XP_006442301.1|  hypothetical protein CICLE_v100197312mg          69.3    3e-12   
ref|XP_004243257.1|  PREDICTED: cytochrome P450 CYP72A219-like        73.6    3e-12   
gb|ADU19849.1|  putative secologanin synthase                         73.6    3e-12   
gb|KEH28455.1|  cytochrome P450 family 72 protein                     73.2    4e-12   
ref|XP_010060787.1|  PREDICTED: cytochrome P450 72A15-like            69.3    4e-12   
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like        73.6    4e-12   
ref|XP_007227257.1|  hypothetical protein PRUPE_ppa017915mg           73.6    4e-12   
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like        73.6    5e-12   
ref|XP_009343588.1|  PREDICTED: secologanin synthase-like             69.3    5e-12   
gb|KGN66156.1|  hypothetical protein Csa_1G574240                     70.1    5e-12   
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                        73.2    5e-12   
emb|CAN72247.1|  hypothetical protein VITISV_024665                   70.9    7e-12   Vitis vinifera
ref|XP_008219216.1|  PREDICTED: cytochrome P450 CYP72A219-like        72.8    7e-12   
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like        72.8    8e-12   
ref|XP_004243256.1|  PREDICTED: cytochrome P450 CYP72A219-like        72.4    8e-12   
emb|CDP22280.1|  unnamed protein product                              67.8    1e-11   
emb|CBI22131.3|  unnamed protein product                              72.0    1e-11   
gb|KEH38478.1|  cytochrome P450 family 72 protein                     72.0    1e-11   
emb|CBI22129.3|  unnamed protein product                              71.6    1e-11   
gb|KEH38475.1|  cytochrome P450 family 72 protein                     71.6    2e-11   
gb|ABC69393.1|  CYP72A55v2                                            71.6    2e-11   Nicotiana tabacum [American tobacco]
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  71.6    2e-11   
gb|EYU43426.1|  hypothetical protein MIMGU_mgv1a018638mg              70.9    2e-11   
gb|AEI59770.1|  cytochrome P450                                       71.6    2e-11   
gb|ABC69392.1|  CYP72A55v1                                            71.6    2e-11   Nicotiana tabacum [American tobacco]
ref|XP_009339350.1|  PREDICTED: cytochrome P450 CYP72A219-like        71.6    2e-11   
emb|CAN72865.1|  hypothetical protein VITISV_029731                   71.6    2e-11   Vitis vinifera
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like        71.6    2e-11   
ref|XP_008219294.1|  PREDICTED: cytochrome P450 CYP72A219-like        71.6    2e-11   
ref|XP_006442293.1|  hypothetical protein CICLE_v10024650mg           68.6    2e-11   
ref|XP_008386157.1|  PREDICTED: cytochrome P450 CYP72A219-like        71.2    2e-11   
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219             71.2    2e-11   
ref|XP_009781171.1|  PREDICTED: cytochrome P450 CYP72A219-like        71.2    2e-11   
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like        71.2    2e-11   
gb|KDO49369.1|  hypothetical protein CISIN_1g044222mg                 67.4    2e-11   
ref|XP_006360179.1|  PREDICTED: secologanin synthase-like             71.2    3e-11   
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like            71.2    3e-11   
ref|XP_007133274.1|  hypothetical protein PHAVU_011G165900g           68.2    3e-11   
ref|XP_004295683.1|  PREDICTED: secologanin synthase-like             71.2    3e-11   
ref|XP_006477947.1|  PREDICTED: secologanin synthase-like             68.9    3e-11   
ref|XP_006442294.1|  hypothetical protein CICLE_v10024650mg           68.9    3e-11   
ref|XP_004307203.1|  PREDICTED: secologanin synthase-like             70.9    3e-11   
ref|XP_009790251.1|  PREDICTED: cytochrome P450 CYP72A219-like        70.9    3e-11   
ref|XP_004244273.1|  PREDICTED: cytochrome P450 CYP72A219-like        70.9    3e-11   
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...  70.9    3e-11   
gb|EYU31636.1|  hypothetical protein MIMGU_mgv1a004595mg              70.9    4e-11   
dbj|BAL45206.1|  cytochrome P450 monooxygenase                        70.5    4e-11   
emb|CDP15985.1|  unnamed protein product                              70.5    5e-11   
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like        70.5    5e-11   Vitis vinifera
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like             70.1    5e-11   
ref|XP_010092742.1|  Secologanin synthase                             70.1    5e-11   
gb|AHK60841.1|  CYP72A225                                             70.1    5e-11   
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like            70.1    6e-11   
gb|KEH38471.1|  cytochrome P450 family monooxygenase                  70.1    6e-11   
ref|XP_004295684.1|  PREDICTED: secologanin synthase-like             70.1    6e-11   
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like             70.1    6e-11   
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like            70.1    6e-11   
ref|XP_004294187.1|  PREDICTED: secologanin synthase-like             70.1    6e-11   
gb|ADO16184.1|  cytochrome P450 mono-oxygenase                        70.1    6e-11   
ref|XP_006495016.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  69.7    7e-11   
ref|XP_006349622.1|  PREDICTED: secologanin synthase-like             69.7    7e-11   
ref|XP_004248200.1|  PREDICTED: cytochrome P450 CYP72A219-like        69.7    7e-11   
ref|XP_006495017.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  69.7    7e-11   
ref|XP_006477952.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    69.7    7e-11   
ref|XP_006348302.1|  PREDICTED: secologanin synthase-like             69.7    8e-11   
gb|ABC69390.1|  CYP72A53v1                                            69.7    8e-11   Nicotiana tabacum [American tobacco]
gb|AGX93049.1|  secologanin synthase-like protein                     69.7    8e-11   
gb|KHG14489.1|  Secologanin synthase                                  69.7    8e-11   
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like            69.7    8e-11   
ref|XP_006495010.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    69.7    8e-11   
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    69.7    9e-11   
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                   69.3    9e-11   
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219             69.3    1e-10   Vitis vinifera
ref|XP_006442315.1|  hypothetical protein CICLE_v10023450mg           66.2    1e-10   
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like            68.9    1e-10   
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like             68.9    1e-10   
emb|CBI22133.3|  unnamed protein product                              69.3    1e-10   
ref|XP_007224159.1|  hypothetical protein PRUPE_ppa016446mg           68.9    1e-10   
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...  68.9    1e-10   
ref|XP_009343590.1|  PREDICTED: cytochrome P450 CYP72A219-like        68.9    1e-10   
ref|XP_008366858.1|  PREDICTED: cytochrome P450 CYP72A219-like        68.9    1e-10   
gb|KDO52098.1|  hypothetical protein CISIN_1g038814mg                 66.2    2e-10   
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g           68.6    2e-10   
gb|KCW67648.1|  hypothetical protein EUGRSUZ_F01396                   68.6    2e-10   
emb|CBI39916.3|  unnamed protein product                              68.6    2e-10   
ref|XP_011091090.1|  PREDICTED: cytochrome P450 CYP72A219-like        68.6    2e-10   
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like        68.6    2e-10   
gb|ABC69419.1|  CYP72A56                                              68.6    2e-10   Nicotiana tabacum [American tobacco]
emb|CDP15982.1|  unnamed protein product                              68.6    2e-10   
emb|CDP19599.1|  unnamed protein product                              68.6    2e-10   
dbj|BAL45203.1|  cytochrome P450 monooxygenase                        68.6    2e-10   
ref|XP_004244382.2|  PREDICTED: cytochrome P450 CYP72A219-like        68.6    2e-10   
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  68.2    2e-10   
ref|XP_004294188.1|  PREDICTED: secologanin synthase-like             68.2    2e-10   
gb|ABC69389.1|  CYP72A52v1                                            68.2    3e-10   Nicotiana tabacum [American tobacco]
ref|XP_009628921.1|  PREDICTED: cytochrome P450 CYP72A219-like        68.2    3e-10   
ref|XP_006442299.1|  hypothetical protein CICLE_v100199322mg          65.5    3e-10   
ref|XP_008226302.1|  PREDICTED: cytochrome P450 CYP72A219-like        67.8    3e-10   
ref|XP_009790240.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  67.8    3e-10   
ref|XP_009594690.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  67.8    3e-10   
emb|CDP15981.1|  unnamed protein product                              67.8    3e-10   
ref|XP_010275158.1|  PREDICTED: cytochrome P450 CYP72A219-like        67.8    3e-10   
ref|XP_010041835.1|  PREDICTED: cytochrome P450 72A15-like            67.4    4e-10   
emb|CDP15976.1|  unnamed protein product                              67.8    4e-10   
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g           67.8    4e-10   
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g           67.8    4e-10   
emb|CDP06076.1|  unnamed protein product                              67.4    4e-10   
ref|XP_006364092.1|  PREDICTED: secologanin synthase-like             67.4    4e-10   
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g           67.4    4e-10   
ref|XP_010064522.1|  PREDICTED: cytochrome P450 72A15-like            67.4    5e-10   
gb|AGX93044.1|  secologanin synthase-like protein                     67.4    5e-10   
gb|AGX93047.1|  secologanin synthase-like protein                     67.4    5e-10   
gb|AGX93046.1|  secologanin synthase-like protein                     67.4    5e-10   
ref|XP_004248734.1|  PREDICTED: cytochrome P450 CYP72A219             67.0    5e-10   
ref|XP_009790250.1|  PREDICTED: cytochrome P450 CYP72A219-like        67.0    6e-10   
ref|XP_009339348.1|  PREDICTED: cytochrome P450 CYP72A219-like        67.0    6e-10   
gb|KEH38479.1|  cytochrome P450 family 72 protein                     63.2    6e-10   
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like        67.0    6e-10   
ref|XP_003525967.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    67.0    6e-10   
gb|AEI59771.1|  cytochrome P450                                       67.0    6e-10   
ref|XP_009356829.1|  PREDICTED: cytochrome P450 CYP72A219-like        67.0    7e-10   
gb|KGN55014.1|  hypothetical protein Csa_4G622240                     63.2    7e-10   
ref|XP_009339365.1|  PREDICTED: cytochrome P450 CYP72A219-like        66.6    7e-10   
ref|XP_009758460.1|  PREDICTED: cytochrome P450 CYP72A219-like        66.6    8e-10   
ref|XP_010489833.1|  PREDICTED: cytochrome P450 72A11-like            62.8    8e-10   
ref|XP_008367417.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.3    8e-10   
ref|XP_009594691.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  66.2    9e-10   
gb|AJD25167.1|  cytochrome P450 CYP72A326                             66.2    1e-09   
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like            66.2    1e-09   
ref|XP_004488669.1|  PREDICTED: secologanin synthase-like             66.2    1e-09   
gb|ABC59075.1|  cytochrome P450 monooxygenase CYP72A67                66.2    1e-09   Medicago truncatula
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like        66.2    1e-09   
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like        66.2    1e-09   
gb|KEH37983.1|  cytochrome P450 family 72 protein                     66.2    1e-09   
dbj|BAL45204.1|  cytochrome P450 monooxygenase                        65.9    1e-09   
ref|XP_004243255.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X1  65.9    1e-09   
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  65.9    1e-09   
gb|KEH37984.1|  cytochrome P450 family 72 protein                     65.5    1e-09   
gb|EPS65856.1|  hypothetical protein M569_08920                       62.8    2e-09   
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like        65.5    2e-09   
gb|ABC69417.1|  CYP72A54                                              65.5    2e-09   Nicotiana tabacum [American tobacco]
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  65.5    2e-09   
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like        65.5    2e-09   
ref|XP_009394211.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.2    2e-09   
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  65.5    2e-09   
gb|ABC59077.1|  cytochrome P450 monooxygenase CYP72A68                65.5    2e-09   Medicago truncatula
ref|XP_010694548.1|  PREDICTED: cytochrome P450 CYP72A219-like        65.5    2e-09   
gb|KEH36886.1|  cytochrome P450 family monooxygenase                  64.7    2e-09   
gb|AGX93057.1|  7-deoxyloganic acid 7-hydroxylase-like protein        65.1    2e-09   
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                  65.1    3e-09   
ref|XP_006364091.1|  PREDICTED: secologanin synthase-like             65.1    3e-09   
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like            65.1    3e-09   
ref|XP_007022099.1|  Cytochrome P450, family 72, subfamily A, pol...  65.1    3e-09   
gb|AJD25170.1|  cytochrome P450 CYP72A329                             65.1    3e-09   
ref|XP_011082966.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.7    3e-09   
ref|XP_004301212.1|  PREDICTED: secologanin synthase-like             64.7    4e-09   
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like             64.7    4e-09   
ref|XP_009343589.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.7    4e-09   
ref|XP_007151804.1|  hypothetical protein PHAVU_004G076200g           61.2    4e-09   
ref|XP_006442298.1|  hypothetical protein CICLE_v10019876mg           64.3    4e-09   
ref|XP_007149357.1|  hypothetical protein PHAVU_005G063500g           64.3    4e-09   
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.3    5e-09   
ref|XP_008386423.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.3    5e-09   
ref|XP_011091086.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.3    5e-09   
ref|XP_006387917.1|  hypothetical protein POPTR_0480s00200g           60.5    5e-09   
ref|XP_006377685.1|  hypothetical protein POPTR_0011s102202g          60.5    5e-09   
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.3    5e-09   
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like             64.3    6e-09   
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...  63.9    6e-09   
ref|XP_007149354.1|  hypothetical protein PHAVU_005G0634001g          63.9    6e-09   
emb|CDP19600.1|  unnamed protein product                              63.9    6e-09   
gb|AGX93059.1|  7-deoxyloganic acid 7-hydroxylase-like protein        63.9    6e-09   
gb|KGN55010.1|  hypothetical protein Csa_4G621220                     61.2    6e-09   
ref|XP_006416747.1|  hypothetical protein EUTSA_v10007523mg           63.9    6e-09   
ref|XP_009124502.1|  PREDICTED: cytochrome P450 72C1-like             63.9    7e-09   
emb|CDX83929.1|  BnaC08g17160D                                        63.9    7e-09   
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.9    7e-09   
ref|XP_009110430.1|  PREDICTED: cytochrome P450 72C1-like             63.9    7e-09   
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...  63.9    7e-09   
ref|XP_003543170.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase         63.9    7e-09   
gb|KHN47459.1|  Secologanin synthase                                  63.9    7e-09   
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g           63.5    8e-09   
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g           63.5    8e-09   
gb|AGX93061.1|  7-deoxyloganic acid 7-hydroxylase-like protein        63.5    8e-09   
ref|XP_004248201.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.5    8e-09   
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...  63.5    8e-09   
gb|AFK42047.1|  unknown                                               63.5    8e-09   
ref|NP_188081.1|  cytochrome P450, family 72, subfamily A, polype...  63.5    8e-09   
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...  63.5    9e-09   
emb|CDP15973.1|  unnamed protein product                              63.5    9e-09   
ref|XP_003531823.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...  63.5    9e-09   
ref|XP_003605470.1|  Cytochrome P450 monooxygenase CYP72A61           63.5    9e-09   
dbj|BAP90521.1|  secologanin synthase                                 63.5    1e-08   
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.5    1e-08   
dbj|BAL45199.1|  cytochrome P450 monooxygenase                        63.5    1e-08   
gb|KFK43897.1|  hypothetical protein AALP_AA1G188200                  63.2    1e-08   
gb|AGX93058.1|  7-deoxyloganic acid 7-hydroxylase-like protein        63.2    1e-08   
sp|Q05047.1|C72A1_CATRO  RecName: Full=Secologanin synthase; Shor...  63.2    1e-08   
ref|XP_003605471.1|  Cytochrome P450 monooxygenase CYP72A61           63.2    1e-08   
ref|XP_011091092.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.2    1e-08   
ref|XP_006495015.1|  PREDICTED: secologanin synthase-like             62.4    1e-08   
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.2    1e-08   
ref|XP_007131275.1|  hypothetical protein PHAVU_011G000200g           63.2    1e-08   
ref|XP_008443405.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.2    1e-08   
gb|KGN55013.1|  hypothetical protein Csa_4G622230                     60.5    1e-08   
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.8    1e-08   
gb|AAA17732.1|  cytochrome P450                                       62.8    1e-08   
gb|AGX93060.1|  7-deoxyloganic acid 7-hydroxylase-like protein        62.8    1e-08   
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...  62.8    2e-08   
ref|XP_011091091.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.8    2e-08   
ref|XP_010465361.1|  PREDICTED: cytochrome P450 72A13-like            62.8    2e-08   
sp|Q9SHG5.2|C72C1_ARATH  RecName: Full=Cytochrome P450 72C1; AltN...  62.8    2e-08   
gb|AFK38261.1|  unknown                                               58.5    2e-08   
ref|XP_011083293.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.8    2e-08   
gb|KGN59564.1|  hypothetical protein Csa_3G825090                     59.7    2e-08   
ref|XP_009117728.1|  PREDICTED: cytochrome P450 72C1-like             62.4    2e-08   
ref|XP_007035043.1|  Cytochrome P450, putative                        62.4    2e-08   
gb|AIA82924.1|  SLS1                                                  62.4    2e-08   
emb|CDY21768.1|  BnaA09g45190D                                        62.4    2e-08   
ref|XP_004167171.1|  PREDICTED: secologanin synthase-like             59.7    2e-08   
ref|XP_006300449.1|  hypothetical protein CARUB_v10020157mg           62.4    2e-08   
ref|XP_009339373.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.4    2e-08   
gb|AJD25171.1|  cytochrome P450 CYP72A330                             62.4    2e-08   
ref|XP_003605472.1|  Cytochrome P450 monooxygenase CYP72A61           62.0    2e-08   
gb|EPS71190.1|  hypothetical protein M569_03571                       58.9    3e-08   
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...  62.0    3e-08   
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like             62.0    3e-08   
ref|XP_003543172.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    62.0    3e-08   
ref|XP_009149145.1|  PREDICTED: cytochrome P450 72C1                  62.0    3e-08   
ref|XP_004242635.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.0    3e-08   
emb|CDY67933.1|  BnaAnng25600D                                        62.0    3e-08   
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g           62.0    3e-08   
emb|CDY64008.1|  BnaCnng42960D                                        62.0    3e-08   
ref|XP_006495012.1|  PREDICTED: cytochrome P450 72C1-like isoform X2  58.9    3e-08   
ref|XP_006495011.1|  PREDICTED: cytochrome P450 72C1-like isoform X1  59.3    3e-08   
ref|XP_008443404.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.0    3e-08   
ref|XP_004146075.1|  PREDICTED: secologanin synthase-like             62.0    3e-08   
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like             61.6    3e-08   
ref|XP_002892932.1|  CYP72C1                                          61.6    3e-08   
gb|KEH38469.1|  cytochrome P450 family 709 protein                    61.6    3e-08   
ref|NP_173149.1|  cytochrome p450 72c1                                61.6    4e-08   
ref|XP_004294189.1|  PREDICTED: secologanin synthase-like             61.6    4e-08   
ref|XP_002870785.1|  CYP72C1                                          61.6    4e-08   
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like        61.6    4e-08   
gb|AAA17746.1|  cytochrome P450                                       61.6    4e-08   
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like             61.6    4e-08   
gb|AGX93064.1|  secologanin synthase                                  61.6    4e-08   
gb|EPS71634.1|  hypothetical protein M569_03124                       59.3    4e-08   
gb|EYU30753.1|  hypothetical protein MIMGU_mgv1a004802mg              61.6    4e-08   
ref|XP_004151605.1|  PREDICTED: secologanin synthase-like             60.8    4e-08   
gb|EYU29826.1|  hypothetical protein MIMGU_mgv1a026336mg              61.2    5e-08   
gb|KGN59565.1|  hypothetical protein Csa_3G825100                     58.9    5e-08   
ref|XP_008386384.1|  PREDICTED: cytochrome P450 CYP72A219-like        61.2    5e-08   
emb|CDY20078.1|  BnaA01g29240D                                        61.2    5e-08   
emb|CDX97590.1|  BnaA05g24890D                                        61.2    5e-08   
emb|CDY32348.1|  BnaC01g36670D                                        61.2    5e-08   
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  61.2    6e-08   
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...  60.8    6e-08   
ref|XP_006307236.1|  hypothetical protein CARUB_v10008841mg           60.8    6e-08   
gb|KDO52099.1|  hypothetical protein CISIN_1g045884mg                 58.2    6e-08   
emb|CDP15978.1|  unnamed protein product                              60.8    7e-08   
gb|AGX93045.1|  secologanin synthase-like protein                     60.8    7e-08   
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like        60.8    7e-08   
ref|XP_010068176.1|  PREDICTED: cytochrome P450 CYP72A219-like        58.2    8e-08   
emb|CDX96796.1|  BnaA08g23390D                                        60.8    8e-08   
ref|XP_009146336.1|  PREDICTED: cytochrome P450 72A15                 60.5    8e-08   
ref|XP_007022096.1|  Cytochrome P450, family 72, subfamily A, pol...  60.5    8e-08   
ref|XP_010694547.1|  PREDICTED: cytochrome P450 72A15-like            60.5    8e-08   
emb|CDY20074.1|  BnaA01g29280D                                        58.9    8e-08   
ref|XP_009116688.1|  PREDICTED: cytochrome P450 72A15-like            60.5    8e-08   
gb|KDO52097.1|  hypothetical protein CISIN_1g039833mg                 57.4    1e-07   
ref|XP_006377672.1|  hypothetical protein POPTR_0011s101202g          60.1    1e-07   
ref|XP_004151308.1|  PREDICTED: secologanin synthase-like             60.1    1e-07   
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like        60.1    1e-07   
emb|CDX98485.1|  BnaC05g38900D                                        60.1    1e-07   
ref|XP_006377676.1|  hypothetical protein POPTR_0011s10150g           60.1    1e-07   
emb|CDP11335.1|  unnamed protein product                              60.1    1e-07   
gb|AEI59772.1|  cytochrome P450                                       60.1    1e-07   
ref|XP_006343585.1|  PREDICTED: secologanin synthase-like             60.1    1e-07   
ref|XP_010498047.1|  PREDICTED: cytochrome P450 72C1-like             59.7    2e-07   
gb|KHN36820.1|  Secologanin synthase                                  59.7    2e-07   
ref|XP_010476840.1|  PREDICTED: cytochrome P450 72C1-like             59.7    2e-07   
emb|CDY32349.1|  BnaC01g36680D                                        59.3    2e-07   
ref|XP_010926871.1|  PREDICTED: cytochrome P450 72A15-like isofor...  59.3    2e-07   
ref|XP_010552411.1|  PREDICTED: cytochrome P450 72A13-like            59.3    2e-07   
ref|XP_009116727.1|  PREDICTED: cytochrome P450 72A13-like isofor...  59.3    2e-07   
gb|AJD25169.1|  cytochrome P450 CYP72A328                             59.3    2e-07   
ref|XP_009116734.1|  PREDICTED: cytochrome P450 72A13-like isofor...  59.3    2e-07   
dbj|BAL45208.1|  cytochrome P450 monooxygenase                        59.3    2e-07   
gb|KFK38825.1|  hypothetical protein AALP_AA3G165400                  59.7    2e-07   
gb|AGX93062.1|  CYP72A224 7-deoxyloganic acid 7-hydroxylase           59.3    2e-07   
ref|XP_006407059.1|  hypothetical protein EUTSA_v10021962mg           58.9    2e-07   
emb|CDP19607.1|  unnamed protein product                              58.9    3e-07   
ref|XP_002882887.1|  CYP72A7                                          58.9    3e-07   
ref|XP_009116708.1|  PREDICTED: cytochrome P450 72A15-like isofor...  58.9    3e-07   
emb|CDP15983.1|  unnamed protein product                              58.9    3e-07   
emb|CDX75784.1|  BnaC03g38670D                                        58.9    3e-07   
ref|XP_010459266.1|  PREDICTED: cytochrome P450 72C1 isoform X1       58.9    3e-07   
gb|KFK38824.1|  hypothetical protein AALP_AA3G165400                  59.3    3e-07   
emb|CDY70955.1|  BnaUnng04110D                                        57.4    3e-07   
ref|XP_010540131.1|  PREDICTED: cytochrome P450 72C1-like isoform X1  58.9    3e-07   
gb|AGX93048.1|  secologanin synthase-like protein                     58.9    3e-07   
gb|EPS70870.1|  hypothetical protein M569_03891                       58.9    3e-07   
ref|XP_009146335.1|  PREDICTED: cytochrome P450 72A15-like            58.9    3e-07   
gb|AJD25168.1|  cytochrome P450 CYP72A327                             58.9    3e-07   
ref|XP_011082818.1|  PREDICTED: cytochrome P450 CYP72A219-like        58.5    3e-07   
emb|CDP15986.1|  unnamed protein product                              58.5    3e-07   
ref|XP_010537687.1|  PREDICTED: cytochrome P450 72C1-like             58.5    4e-07   
ref|XP_011091093.1|  PREDICTED: secologanin synthase-like             58.5    4e-07   
ref|XP_004488695.1|  PREDICTED: secologanin synthase-like             58.5    4e-07   
ref|XP_010465353.1|  PREDICTED: cytochrome P450 72A13-like            58.5    4e-07   
emb|CDX97592.1|  BnaA05g24870D                                        58.5    4e-07   
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg           58.5    4e-07   
emb|CDX98486.1|  BnaC05g38890D                                        58.5    4e-07   
ref|XP_010465357.1|  PREDICTED: cytochrome P450 72A13-like            58.2    5e-07   
ref|XP_010502032.1|  PREDICTED: cytochrome P450 72A13-like isofor...  58.2    5e-07   
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like        58.2    5e-07   
ref|XP_010540137.1|  PREDICTED: cytochrome P450 72C1-like             58.2    5e-07   
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...  58.2    5e-07   
ref|XP_006598147.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    57.8    7e-07   
emb|CDP19609.1|  unnamed protein product                              57.8    7e-07   
gb|KHN44046.1|  Secologanin synthase                                  57.8    7e-07   
gb|KHG18227.1|  Secologanin synthase                                  57.8    7e-07   
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like        57.8    7e-07   
emb|CDY20075.1|  BnaA01g29270D                                        57.8    8e-07   
emb|CDY32351.1|  BnaC01g36700D                                        57.4    8e-07   
emb|CDP15977.1|  unnamed protein product                              55.5    8e-07   
emb|CDY28091.1|  BnaC06g02720D                                        55.1    8e-07   
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein        57.4    9e-07   
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like            57.4    9e-07   
ref|XP_009135391.1|  PREDICTED: cytochrome P450 72A15-like            57.4    9e-07   
ref|XP_010465352.1|  PREDICTED: cytochrome P450 72A13-like            57.4    9e-07   
gb|KCW62986.1|  hypothetical protein EUGRSUZ_G00586                   56.2    9e-07   
ref|XP_008778221.1|  PREDICTED: cytochrome P450 72A15-like            57.4    1e-06   
ref|XP_010501993.1|  PREDICTED: cytochrome P450 72A13-like            57.4    1e-06   
ref|XP_010465360.1|  PREDICTED: cytochrome P450 72A15                 57.4    1e-06   
gb|KCW84981.1|  hypothetical protein EUGRSUZ_B01805                   57.0    1e-06   
ref|XP_006299550.1|  hypothetical protein CARUB_v10015724mg           57.0    1e-06   
ref|XP_010678723.1|  PREDICTED: cytochrome P450 CYP72A219-like        57.0    1e-06   
gb|EYU31631.1|  hypothetical protein MIMGU_mgv1a004628mg              56.6    1e-06   
ref|XP_010535012.1|  PREDICTED: cytochrome P450 72A13-like            57.0    1e-06   
gb|EYU31630.1|  hypothetical protein MIMGU_mgv1a004628mg              57.0    1e-06   
ref|XP_011098146.1|  PREDICTED: cytochrome P450 CYP72A219-like        57.0    1e-06   
emb|CDX97593.1|  BnaA05g24860D                                        57.0    1e-06   
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like            56.6    1e-06   
gb|EPS61577.1|  hypothetical protein M569_13217                       56.6    1e-06   
gb|KCW62995.1|  hypothetical protein EUGRSUZ_G00595                   56.6    1e-06   
ref|XP_010502007.1|  PREDICTED: cytochrome P450 72A15-like            56.6    1e-06   
gb|AFO67233.1|  putative cytochrome P450 monooxygenase                54.3    1e-06   
gb|KHG20902.1|  Secologanin synthase                                  56.6    2e-06   
ref|XP_010042230.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  56.6    2e-06   
emb|CDX98481.1|  BnaC05g38940D                                        57.0    2e-06   
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like            56.6    2e-06   
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                 56.6    2e-06   
ref|XP_010552154.1|  PREDICTED: cytochrome P450 72A15-like            56.6    2e-06   
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like            56.6    2e-06   
emb|CAN60852.1|  hypothetical protein VITISV_030624                   56.6    2e-06   
ref|XP_010487262.1|  PREDICTED: cytochrome P450 72A13-like            56.6    2e-06   
emb|CDY51038.1|  BnaA06g03010D                                        56.6    2e-06   
ref|XP_010487267.1|  PREDICTED: cytochrome P450 72A15-like            56.6    2e-06   
ref|XP_009362696.1|  PREDICTED: cytochrome P450 CYP72A219-like        56.2    2e-06   
gb|EYU26282.1|  hypothetical protein MIMGU_mgv1a026663mg              56.2    2e-06   
ref|XP_008393592.1|  PREDICTED: cytochrome P450 CYP72A219-like        56.2    2e-06   
ref|XP_010535013.1|  PREDICTED: cytochrome P450 72A13-like            56.2    2e-06   
ref|XP_004514083.1|  PREDICTED: cytochrome P450 72C1-like             52.4    2e-06   
ref|XP_003635295.1|  PREDICTED: cytochrome P450 CYP72A219             56.2    2e-06   
ref|XP_010535014.1|  PREDICTED: cytochrome P450 72A13-like            56.2    2e-06   
emb|CDP15979.1|  unnamed protein product                              55.8    3e-06   
ref|XP_006407061.1|  hypothetical protein EUTSA_v10020533mg           55.8    3e-06   
ref|XP_003635296.2|  PREDICTED: cytochrome P450 CYP72A219-like        55.8    3e-06   
emb|CBI33076.3|  unnamed protein product                              55.8    3e-06   
ref|XP_010042221.1|  PREDICTED: cytochrome P450 72A15-like            55.5    3e-06   
emb|CDY28093.1|  BnaC06g02740D                                        55.8    3e-06   
emb|CDX81797.1|  BnaC08g38040D                                        55.8    3e-06   
ref|XP_006407058.1|  hypothetical protein EUTSA_v10021993mg           55.8    3e-06   
gb|EPS71635.1|  hypothetical protein M569_03125                       54.3    3e-06   
ref|XP_008352112.1|  PREDICTED: cytochrome P450 CYP72A219-like        55.8    3e-06   
ref|XP_011098149.1|  PREDICTED: cytochrome P450 CYP72A219-like        55.8    3e-06   
ref|XP_010470433.1|  PREDICTED: cytochrome P450 72A13-like            55.8    3e-06   
emb|CAN60851.1|  hypothetical protein VITISV_030623                   55.8    3e-06   
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like            55.5    3e-06   
gb|KCW84980.1|  hypothetical protein EUGRSUZ_B01804                   55.5    4e-06   
ref|XP_008673839.1|  PREDICTED: cytochrome P450 734A5-like isofor...  52.8    4e-06   
ref|XP_004969238.1|  PREDICTED: secologanin synthase-like             55.5    4e-06   
gb|EYU38223.1|  hypothetical protein MIMGU_mgv1a005129mg              55.5    4e-06   
emb|CBI39884.3|  unnamed protein product                              55.5    4e-06   
ref|NP_188079.1|  cytochrome P450, family 72, subfamily A, polype...  55.5    4e-06   
ref|XP_002263652.1|  PREDICTED: cytochrome P450 CYP72A219-like        55.5    4e-06   
ref|XP_010487266.1|  PREDICTED: cytochrome P450 72A13-like            55.5    4e-06   
ref|XP_010042988.1|  PREDICTED: cytochrome P450 CYP72A219-like        55.5    4e-06   
ref|XP_008673840.1|  PREDICTED: cytochrome P450 734A5-like isofor...  52.4    4e-06   
emb|CDY65330.1|  BnaC03g73760D                                        54.7    5e-06   
gb|KCW85029.1|  hypothetical protein EUGRSUZ_B01868                   55.1    5e-06   
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like            55.1    5e-06   
emb|CDY51036.1|  BnaA06g02990D                                        55.1    5e-06   
ref|XP_010465355.1|  PREDICTED: cytochrome P450 72A15-like            55.1    5e-06   
ref|XP_006297414.1|  hypothetical protein CARUB_v10013438mg           55.1    5e-06   
ref|XP_011098148.1|  PREDICTED: cytochrome P450 CYP72A219-like        55.1    5e-06   
ref|XP_010242111.1|  PREDICTED: cytochrome P450 CYP72A219-like        55.1    6e-06   
ref|XP_006407060.1|  hypothetical protein EUTSA_v10022297mg           54.3    6e-06   
emb|CDX98484.1|  BnaC05g38910D                                        54.7    6e-06   



>ref|XP_009617254.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  136  SATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMI  315
            +A+C+   +  I  +VC WRV+NW W RPK LEK LR Q LKGN+Y + YGD KEL+ MI
Sbjct  9    TASCA---AIIITLVVCIWRVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKELSGMI  65

Query  316  NETKSKPMKV  345
             E  SKPM +
Sbjct  66   KEANSKPMNL  75



>ref|XP_009617253.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum]
Length=518

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  136  SATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMI  315
            +A+C+   +  I  +VC WRV+NW W RPK LEK LR Q LKGN+Y + YGD KEL+ MI
Sbjct  9    TASCA---AIIITLVVCIWRVLNWVWFRPKKLEKLLRKQGLKGNSYKILYGDMKELSGMI  65

Query  316  NETKSKPMKV  345
             E  SKPM +
Sbjct  66   KEANSKPMNL  75



>ref|XP_009789309.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 3/71 (4%)
 Frame = +1

Query  133  SSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKM  312
            ++A+C+   +  I  +VC WRV+NW W RPK LEK  R Q LKGN+Y + YGD KEL+ M
Sbjct  8    ATASCA---AIIITLMVCIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSGM  64

Query  313  INETKSKPMKV  345
            I E  SKPM +
Sbjct  65   IEEANSKPMNL  75



>ref|XP_009789316.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=516

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 3/71 (4%)
 Frame = +1

Query  133  SSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKM  312
            ++A+C+   +  I  +VC WRV+NW W RPK LEK  R Q LKGN+Y + YGD KEL+ M
Sbjct  8    ATASCA---AIIITLMVCIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSGM  64

Query  313  INETKSKPMKV  345
            I E  SKPM +
Sbjct  65   IEEANSKPMNL  75



>gb|AFO67228.1| putative cytochrome P450 72A, partial [Aralia elata]
Length=151

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I+ ++ AWRV+NW W RP+ LEK+LR Q   GN+Y LF+GD KE+A +I E KSKP+ +
Sbjct  15   IVVVILAWRVLNWVWFRPRKLEKYLRQQGFDGNSYRLFFGDGKEMAMIIKEAKSKPINL  73



>ref|XP_002266550.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=388

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = +1

Query  133  SSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKM  312
            SS   SF  +F I+ L+ AWR++NW WLRPK LE+ LR Q L GN+Y L +GD +E+++M
Sbjct  4    SSVAISF--AF-IVLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRM  60

Query  313  INETKSKPMK  342
            INE  S+PM 
Sbjct  61   INEANSRPMS  70



>ref|XP_006442317.1| hypothetical protein CICLE_v10023602mg [Citrus clementina]
 gb|ESR55557.1| hypothetical protein CICLE_v10023602mg [Citrus clementina]
Length=512

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  TCSFFRSFPIIFLV-CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMIN  318
            + +FF +F  I L  CAW+++NWAWL+PK LE +LR Q   GN+Y +F+GDTK+++ M+ 
Sbjct  2    SLAFFSAFATIILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDTKDMSMMLK  61

Query  319  ETKSKPMKV  345
            E K++P+ +
Sbjct  62   EAKARPISL  70



>gb|KDO52111.1| hypothetical protein CISIN_1g046539mg [Citrus sinensis]
Length=484

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  TCSFFRSFPIIFLV-CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMIN  318
            + +FF +F  I L  CAW+++NWAWL+PK LE +LR Q   GN+Y +F+GDTK+++ M+ 
Sbjct  2    SLAFFSAFATIILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDTKDMSMMLK  61

Query  319  ETKSKPMKV  345
            E K++P+ +
Sbjct  62   EAKARPISL  70



>ref|XP_004244274.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I   VC W+V+NW W RPK LEK LR Q L GN+Y L YGD K+ +KMI E  SKPM +
Sbjct  13   ITLFVCLWKVLNWVWFRPKKLEKLLRKQGLNGNSYRLLYGDMKDFSKMIKEANSKPMNL  71



>ref|XP_008226213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLA  351
            I +  AWRV+NW WLRPK LEK LR Q L GN+Y L +GDTK+L+KM+ +T+SKP+K+  
Sbjct  18   IVITWAWRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQTQSKPIKLST  77

Query  352  SKQ  360
            S  
Sbjct  78   SHD  80



>emb|CAN72443.1| hypothetical protein VITISV_032856 [Vitis vinifera]
Length=245

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +1

Query  133  SSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKM  312
            SS   SF     I  L+ AWR++NW WLRPK LE+ LR Q L GN+Y+  YGD KE+++M
Sbjct  4    SSVAISFVF---ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYSCLYGDFKEMSRM  60

Query  313  INETKSKPM  339
            INE  S+P+
Sbjct  61   INEANSRPI  69



>ref|XP_008226215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Prunus 
mume]
Length=518

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLASKQ  360
            AWRV+NW WLRPK LEK LR Q L GN+Y L +GDTK+L+KM+ +T+SKP+K+  S  
Sbjct  20   AWRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQTQSKPIKLSTSHD  77



>ref|XP_010324391.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Solanum 
lycopersicum]
Length=472

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I   VC W+V+NW W RPK LEK LR Q L GN+Y L YGD K+ +KMI E  SKPM +
Sbjct  13   ITLFVCLWKVLNWVWFRPKKLEKLLRKQGLNGNSYRLLYGDMKDFSKMIKEANSKPMNL  71



>ref|XP_009797873.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=519

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = +1

Query  136  SATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMI  315
            +A+C+   +  I  LVC WRV+NW W RPK LE  LR Q L+GN+Y + YGD KE + MI
Sbjct  10   TASCA---AIVITLLVCIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMI  66

Query  316  NETKSKPMKV  345
             E  SKPM +
Sbjct  67   KEAYSKPMSL  76



>gb|ABC69422.1| CYP72A58 [Nicotiana tabacum]
Length=513

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = +1

Query  136  SATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMI  315
            +A+C+   +  I  LVC WRV+NW W RPK LE  LR Q L+GN+Y + YGD KE + MI
Sbjct  4    TASCA---AIVITLLVCIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMI  60

Query  316  NETKSKPMKV  345
             E  SKPM +
Sbjct  61   KEAYSKPMSL  70



>ref|XP_006363756.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=519

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I F++ AWR+++WAW RP+ LEK LR Q LKGN+Y L YGD KEL+K I + KSKP+
Sbjct  16   ITFVIYAWRLLDWAWFRPRKLEKCLRKQGLKGNSYKLIYGDIKELSKSIEDAKSKPL  72



>emb|CDP15975.1| unnamed protein product [Coffea canephora]
Length=516

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            + LV AWRV+NWAWLRPK LEK L+ Q LKGN Y L YGD KE++ +I E +SKP+ +
Sbjct  16   VILVLAWRVLNWAWLRPKKLEKQLKEQGLKGNPYRLLYGDFKEISTLIREAQSKPINL  73



>ref|XP_002262693.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I  L+ AWR++NW WLRPK LE+ LR Q L GN+Y+  YGD KE+++MINE  S+P+
Sbjct  13   ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYSCLYGDFKEMSRMINEANSRPI  69



>ref|XP_006477888.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=512

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            II   CAW+++NWAWL+PK LE +LR Q   GN+Y +F+GDTK+++ M+ E K++P+ +
Sbjct  12   IILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDTKDMSMMLKEAKARPISL  70



>ref|XP_004300362.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=517

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  175  FLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMK  342
             L C+W V+NW WLRPK LE+ LR Q  +GN+Y LFYGD K+   M+ E KSKPMK
Sbjct  17   LLSCSWSVLNWVWLRPKILERLLRQQGFQGNSYKLFYGDVKDSYAMLREAKSKPMK  72



>ref|XP_006348303.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=519

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +   VC W+V+NW W RPK LEK LR Q LKGN+Y + YGD K+ + MI E  SKPM +
Sbjct  17   VALFVCLWKVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKDFSGMIKEANSKPMNI  75



>ref|XP_006442316.1| hypothetical protein CICLE_v10024206mg [Citrus clementina]
 gb|ESR55556.1| hypothetical protein CICLE_v10024206mg [Citrus clementina]
Length=512

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            II   CAW+++NWAWL+PK LE +LR Q   GN+Y +F+GD K+++ M+ ETK++P+ +
Sbjct  12   IILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDMKDMSLMLKETKARPISL  70



>ref|XP_002268319.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I+ L+ AWR++NW WLRPK LE+ LR Q L GN+Y L +GD +E+++MINE  S+P+
Sbjct  13   IVLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSEMINEANSRPI  69



>ref|XP_010645072.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=390

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 3/70 (4%)
 Frame = +1

Query  133  SSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKM  312
            SS   SF     I  L+ AWR++NW WLRPK LE+ LR Q L GN+Y L +GD +E+++M
Sbjct  15   SSVAISFVF---ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRM  71

Query  313  INETKSKPMK  342
            INE  S+P+ 
Sbjct  72   INEANSRPIS  81



>emb|CAN80407.1| hypothetical protein VITISV_020336 [Vitis vinifera]
Length=193

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +1

Query  133  SSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKM  312
            SS   SF     I  L+ AWR++NW WLRPK LE+ LR Q L GN+Y L +GD +E++ M
Sbjct  4    SSVAISFVF---ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSXM  60

Query  313  INETKSKPM  339
            INE  S+P+
Sbjct  61   INEANSRPI  69



>ref|XP_006348901.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +1

Query  139  ATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMIN  318
            ++CS   +  I  L+C WRV+NW W RPK LEK L+ Q +KGN+Y++ YGDTKEL+  I 
Sbjct  10   SSCS---AIAITLLLCLWRVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSLRIK  66

Query  319  ETKSKPMKV  345
            E  SK M +
Sbjct  67   EVTSKSMSL  75



>ref|XP_004243258.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            +  LV  WRV+NWAW RPK LEK+LR   LKGN Y LFYGD  E+   +NE +SKP+
Sbjct  15   VTLLVYTWRVLNWAWFRPKKLEKYLRKSGLKGNPYKLFYGDLNEITNKVNEARSKPI  71



>ref|XP_004243261.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I LV  W+V+NWAW RPK LEK+LR   LKGN Y L YGD KEL   +NE KSKP+
Sbjct  16   ILLVYTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKELKNKLNEAKSKPI  71



>ref|XP_006348907.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I LV  WRV+NWAW +PK LEK+LR   LKGN Y LFYGD  EL   +NE +SKP+
Sbjct  16   ILLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNELTNKLNEARSKPI  71



>ref|XP_006477887.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=512

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            II   CAW+++NWAWL+PK LE +LR Q   GN+Y +F+GD K+++ M+ E K++P+ V
Sbjct  12   IILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDMKDMSLMLKEAKARPISV  70



>ref|XP_004243263.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 3/69 (4%)
 Frame = +1

Query  139  ATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMIN  318
            A+CS      I  L+C W V+NW W RPK LEK L+ Q +KGN+Y++ YGDTKEL+  I 
Sbjct  10   ASCSVI---AITLLLCIWSVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSMRIK  66

Query  319  ETKSKPMKV  345
            E  SK M V
Sbjct  67   EVTSKSMSV  75



>ref|XP_004243845.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I F++ AWR+++WAW RP+ L+K LR Q LKGN+Y L +GD KEL+K I + +SKP+ V
Sbjct  15   ITFVIYAWRLLDWAWFRPRKLDKCLRQQGLKGNSYKLIFGDIKELSKSIEDAESKPLDV  73



>gb|KHN44056.1| Secologanin synthase [Glycine soja]
Length=520

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  184  CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            C+W+V+NW WLRPK LEK LR Q  +GN YTLF+GD+KE  KM  E  SKPM
Sbjct  19   CSWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPM  70



>ref|XP_006598137.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  184  CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            C+W+V+NW WLRPK LEK LR Q  +GN YTLF+GD+KE  KM  E  SKPM
Sbjct  19   CSWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPM  70



>ref|XP_002270501.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I  L+ AWR++NW WLRPK LE+ LR Q L GN+Y L +GD +E+++MINE  S+P+
Sbjct  13   ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPI  69



>ref|XP_002265784.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=526

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I  L+ AWR++NW WLRPK LE+ LR Q L GN+Y L +GD +E+++MINE  S+P+
Sbjct  24   ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPI  80



>emb|CDP15972.1| unnamed protein product [Coffea canephora]
Length=400

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  LVCAWR +N  WLRPK LEK LR Q L GN+YT  YGD KE+  MI E  SKP+ +
Sbjct  13   IALLVCAWRALNSLWLRPKKLEKCLRAQGLSGNSYTPVYGDFKEMVSMIEEAYSKPINL  71



>ref|XP_004243259.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            +  LV  WRV+NWAW +PK LEK+LR   LKGN Y L YGD+KEL   +NE +SKP+
Sbjct  15   VTLLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLLYGDSKELTNKLNEARSKPI  71



>emb|CAN71060.1| hypothetical protein VITISV_032612 [Vitis vinifera]
Length=299

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWRV+NW WLRPK LE+ L+ Q L GN+Y L YGD KE++ MI E  S+P+ +
Sbjct  16   ITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLXYGDFKEMSMMIKEATSRPISI  74



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I F++ AWR+++WAW  P+ LEK LR Q LKGN+Y L YGD KEL+K I + +SKP+ V
Sbjct  15   ITFVIYAWRLLDWAWFMPRKLEKCLRQQGLKGNSYKLIYGDIKELSKSIEDAESKPLNV  73



>ref|XP_006348910.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            + LV  WRV+NWAWL+PK LEK+LR   LKGN Y L++GD KE    +NE KSKP+
Sbjct  16   VLLVYTWRVLNWAWLKPKKLEKYLRKSGLKGNPYKLYHGDLKEFTNKLNEAKSKPI  71



>sp|H2DH21.1|C7A29_PANGI RecName: Full=Cytochrome P450 CYP72A219; AltName: Full=Cytochrome 
P450 CYP72A129 [Panax ginseng]
 gb|AEY75218.1| cytochrome P450 CYP72A129 [Panax ginseng]
Length=518

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            ++ ++  WR+ NW WLRP+ LEK+LR Q   GN+Y LF+GD KE+  M+ E KSKP+ +
Sbjct  15   VVVILLGWRIFNWVWLRPRKLEKYLRNQGFNGNSYRLFFGDVKEMIVMLKEAKSKPINL  73



>ref|XP_006348908.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I LV  W+V+NWAW +PK LEK+LR   LKGN Y L YGD+KEL   +NE +SKP+
Sbjct  16   ILLVYTWKVLNWAWFKPKKLEKYLRKNGLKGNPYKLLYGDSKELTNKLNEARSKPI  71



>ref|XP_011082820.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=519

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWR+VNW W+RPK +EK LR Q   GN Y + YGDT ++AKMI E  SKP+K+
Sbjct  17   AWRIVNWVWIRPKNIEKRLRAQGFGGNPYRILYGDTNDMAKMIKEANSKPIKL  69



>ref|XP_006348909.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I LV  W+V+NWAW +PK LEK+LR   LKGN Y L YGD KEL   +NE KSKP+
Sbjct  16   ILLVYTWKVLNWAWFKPKKLEKYLRKSGLKGNKYKLLYGDLKELTNKLNEAKSKPI  71



>ref|XP_006348982.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=860

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I+ ++  W+V+NWAW RPK LEK+LR   LKGN Y L YGD KEL   +NE KSKP+
Sbjct  36   ILLVIYTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKELTNKLNEAKSKPI  92



>ref|XP_004244272.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=514

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  151  FFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKS  330
            F  +  I   VC W+V+NW W +PK LEK LR Q L GN+Y   YGD K+ +KMI E  S
Sbjct  6    FCCAIAITLFVCLWKVLNWVWFQPKKLEKLLRKQGLNGNSYRFLYGDMKDFSKMIKEANS  65

Query  331  KPMKV  345
            KPM +
Sbjct  66   KPMNM  70



>gb|KHN47456.1| Secologanin synthase [Glycine soja]
Length=537

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLA  351
            AW+++NW WLRPK LE+ LR Q L+GN+YTLF GD KE  KM NE  SKPM + +
Sbjct  39   AWKMLNWLWLRPKRLERLLREQGLQGNSYTLFVGDLKEFGKMRNEALSKPMNLFS  93



>ref|XP_003543171.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=537

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLA  351
            AW+++NW WLRPK LE+ LR Q L+GN+YTLF GD KE  KM NE  SKPM + +
Sbjct  39   AWKMLNWLWLRPKRLERLLREQGLQGNSYTLFVGDLKEFGKMRNEALSKPMNLFS  93



>ref|XP_006348304.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I   VC W+V+NW W  PK LEK LR Q L GN+Y L YGD K+L+ MI E  SKPM +
Sbjct  17   ITLFVCLWKVLNWVWFNPKKLEKLLRKQGLNGNSYRLLYGDMKDLSGMIKEANSKPMNM  75



>ref|XP_008226210.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWRV+NW WLRPK LE+ LR Q L GN+Y L  GDTKE + M+ ETKSKPM +
Sbjct  23   AWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMVKETKSKPMDL  75



>ref|XP_008226211.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +  AWRV+NW WLRPK LE+ LR Q L GN+Y L  GDTKE + M+ E KSKPM +
Sbjct  20   ITLAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMVKEAKSKPMNL  75



>ref|XP_004243254.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  163  FPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMK  342
            F  I LV  W+V+NWAW RPK LEK+ R Q L GN+Y L +GD KE +K I E +SKP+ 
Sbjct  13   FVTILLVHTWKVLNWAWFRPKKLEKFFRQQGLCGNSYRLLHGDLKEFSKSIKEAQSKPIN  72

Query  343  VLAS  354
             L++
Sbjct  73   NLSN  76



>ref|XP_002263609.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +1

Query  133  SSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKM  312
            SS   SF   F  + + C WR++NW WLRPK LE+ LR Q L GN+Y L  GD+KE+++M
Sbjct  4    SSVAISF--GFLTVLISCVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRM  61

Query  313  INETKSKPMKV  345
            + E  S+P+ +
Sbjct  62   MKEAYSRPISL  72



>emb|CBI39895.3| unnamed protein product [Vitis vinifera]
Length=235

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +1

Query  130  RSSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAK  309
             SS   SF   F  + + C WR++NW WLRPK LE+ LR Q L GN+Y L +GD KE++ 
Sbjct  3    HSSVAISF--GFLTVLISCLWRLLNWVWLRPKRLERCLREQGLAGNSYRLLHGDFKEMSM  60

Query  310  MINETKSKPMKV  345
            M+ E  S+P+ +
Sbjct  61   MLKEAYSRPISL  72



>emb|CBI39886.3| unnamed protein product [Vitis vinifera]
Length=550

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +1

Query  133  SSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKM  312
            SS   SF   F  + + C WR++NW WLRPK LE+ LR Q L GN+Y L  GD+KE+++M
Sbjct  4    SSVAISF--GFLTVLISCVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRM  61

Query  313  INETKSKPMKV  345
            + E  S+P+ +
Sbjct  62   MKEAYSRPISL  72



>emb|CDP19608.1| unnamed protein product [Coffea canephora]
Length=470

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I+ L+ AWR +NWAW+ PK +EK LR Q L+GN+Y   +GDT+++ +M+ E KSKP+ +
Sbjct  14   IVLLIGAWRFLNWAWITPKKMEKRLRRQGLQGNSYRFLFGDTRDMGRMLEEAKSKPISL  72



>ref|XP_011082968.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 5/73 (7%)
 Frame = +1

Query  127  WRSSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELA  306
            W+  A  S F     + L+ +WRVVNWA++RPK LEK+LR Q L GN+Y L YGD KE+ 
Sbjct  5    WQILAASSAF-----VVLMYSWRVVNWAYIRPKRLEKFLRKQGLSGNSYRLVYGDLKEML  59

Query  307  KMINETKSKPMKV  345
            KM+ + +SKP+ +
Sbjct  60   KMMEDGRSKPINL  72



>gb|EYU30744.1| hypothetical protein MIMGU_mgv1a004594mg [Erythranthe guttata]
Length=519

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLAS  354
            +V AW+V+NW W RP+ LEKWLR    +GN+Y + +GD+KE++ MI E KSKP+   ++
Sbjct  17   IVYAWKVLNWVWFRPRNLEKWLRQLGFEGNSYRVLFGDSKEMSNMIKEAKSKPISAFSN  75



>ref|XP_007212563.1| hypothetical protein PRUPE_ppa015526mg [Prunus persica]
 gb|EMJ13762.1| hypothetical protein PRUPE_ppa015526mg [Prunus persica]
Length=490

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLA  351
            I +  AWRV+NW WLRPK LE+ LR Q L GN+Y L +GDTKE + M+++ +SKP+K+  
Sbjct  15   IVIAWAWRVLNWVWLRPKKLERSLREQGLTGNSYKLLFGDTKESSMMLDQAQSKPIKLST  74

Query  352  SK  357
            S 
Sbjct  75   SH  76



>ref|XP_009615909.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
tomentosiformis]
Length=436

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            IFLV  W+V+NW W RPK LEK LR + LKGN Y L YGD  EL K I E KSKP+
Sbjct  13   IFLVYTWKVLNWVWFRPKKLEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPI  68



>ref|XP_008226217.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=522

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I +  AWRV+NW WLRP  LE+ LR Q L GN+Y L +GDTKE++ M+ + +SKP+K+
Sbjct  19   IVIAWAWRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGDTKEISMMVEQAQSKPIKL  76



>ref|XP_008226216.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I +  AWRV+NW WLRP  LE+ LR Q L GN+Y L +GDTKE++ M+ + +SKP+K+
Sbjct  18   IVIAWAWRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGDTKEISMMVEQAQSKPIKL  75



>ref|XP_006348906.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLA  351
            I LV  W+V+NWAW RPK LEK+LR Q L GN+Y L +GD KE +K I E +SKP+  L+
Sbjct  16   ILLVYTWKVLNWAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFSKSIKEAQSKPIDNLS  75

Query  352  S  354
            +
Sbjct  76   N  76



>emb|CDP19601.1| unnamed protein product [Coffea canephora]
Length=514

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I+ L+ AWR +NWAW+ PK +EK LR Q L+GN+Y   +GDT+++ +M+ E KSKP+ +
Sbjct  14   IVLLIGAWRFLNWAWITPKKMEKRLRRQGLQGNSYRFLFGDTRDMGRMLEEAKSKPISL  72



>ref|XP_010327096.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=250

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  160  SFPIIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            SF IIF++   WR++N+ W +PK LEK LR Q LKGN+Y L YGD KE+  MI E  SKP
Sbjct  14   SFAIIFVLRWTWRILNYVWFKPKKLEKQLRQQGLKGNSYKLLYGDMKEMKMMIEEATSKP  73

Query  337  M  339
            +
Sbjct  74   I  74



>ref|XP_009615908.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=514

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            IFLV  W+V+NW W RPK LEK LR + LKGN Y L YGD  EL K I E KSKP+
Sbjct  13   IFLVYTWKVLNWVWFRPKKLEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPI  68



>ref|XP_009796906.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=446

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I LV  WRV+NWAW RPK LEK LR   LKGN Y L YGD  EL K I E KSKP+
Sbjct  23   ILLVYTWRVLNWAWFRPKKLEKCLRLSGLKGNPYKLLYGDLNELTKSIIEAKSKPI  78



>gb|KEH38473.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=416

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +F + AWR++NW WL+PK LEK+LR Q LKGN+Y L  GD  +L KM  E  SKPM +
Sbjct  15   LFFILAWRILNWLWLKPKKLEKFLREQGLKGNSYRLLVGDMNDLLKMRKEATSKPMNL  72



>ref|XP_010644780.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Vitis vinifera]
Length=518

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWRV+NW WLRPK LE+ L+ Q L GN+Y L YGD KE++ MI E  S+P+ +
Sbjct  16   ITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIKEATSRPISI  74



>ref|XP_007212438.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
 gb|EMJ13637.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
Length=506

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWRV+NW WLRPK LE+ LR Q L GN+Y L  GDTKE + M+ E KSKPM +
Sbjct  10   AWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMVKEAKSKPMNL  62



>ref|XP_009620491.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  163  FPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMK  342
            F +  ++  W+++NWAW RP+ L++ LR Q LKGN+Y L +GD KEL+K I E KSKP+ 
Sbjct  12   FAVTSVIYVWKLLNWAWFRPRKLDQCLRQQGLKGNSYKLIFGDLKELSKSIEEAKSKPLN  71

Query  343  V  345
            V
Sbjct  72   V  72



>ref|XP_008226214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=518

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLASK  357
            AWRV+NW WLRPK LE+ LR Q L GN+Y L +GDTKE + M+++ +SKP+K+  S 
Sbjct  20   AWRVLNWVWLRPKKLERSLREQGLTGNSYKLLFGDTKESSMMLDQAQSKPIKLSTSH  76



>emb|CAN63404.1| hypothetical protein VITISV_001871 [Vitis vinifera]
Length=471

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +1

Query  130  RSSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAK  309
             SS   SF   F  + + C WR++NW WLRPK LE+ LR Q L GN+Y L +GD KE++ 
Sbjct  3    HSSVAISF--GFLTVLISCLWRLLNWVWLRPKRLERCLREQGLAGNSYRLLHGDFKEMSM  60

Query  310  MINETKSKPMKV  345
            M+ E  S+P+ +
Sbjct  61   MLKEAYSRPISL  72



>ref|XP_010327256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=399

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +1

Query  160  SFPIIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            SF IIF++   WR++N  W +PK LEK LR Q LKGN+Y L YGD KE+ KMI E  SKP
Sbjct  33   SFAIIFVLRWTWRILNHVWFKPKKLEKQLRQQGLKGNSYKLLYGDMKEMKKMIEEATSKP  92

Query  337  MKV  345
            + +
Sbjct  93   INL  95



>emb|CBI39940.3| unnamed protein product [Vitis vinifera]
Length=349

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWR++NW WLRPK LE+ LR Q + GN+Y L +GD +E+ +MI+E  S+P+ +
Sbjct  37   ITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMISEANSRPISL  95



>gb|EYU44091.1| hypothetical protein MIMGU_mgv1a0044502mg, partial [Erythranthe 
guttata]
Length=136

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  151  FFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKS  330
            F  SF  + L   WR++NWA+++PK LEK L  Q L GN Y   YGD KE++KM N  KS
Sbjct  8    FAASFGFVVLFYTWRILNWAYIQPKRLEKSLGNQGLTGNTYKFLYGDLKEMSKMFNHAKS  67

Query  331  KPMKV  345
             P+ +
Sbjct  68   TPINL  72



>ref|XP_006364093.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=536

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  160  SFPIIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            SF IIF++   WR++N+ W +PK LEK LR Q  KGN+Y L YGD KE+ KMI E  SKP
Sbjct  33   SFAIIFVLRWTWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMKEMKKMIEEATSKP  92

Query  337  M  339
            +
Sbjct  93   I  93



>gb|KDO49367.1| hypothetical protein CISIN_1g034199mg [Citrus sinensis]
 gb|KDO49368.1| hypothetical protein CISIN_1g034199mg [Citrus sinensis]
Length=97

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +  L  AWRV+NW WLRPK LEK+LR Q LKGN+Y L +GD KE +  + E K++P+ +
Sbjct  15   VTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLSL  73



>emb|CBI22139.3| unnamed protein product [Vitis vinifera]
Length=417

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +1

Query  130  RSSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAK  309
             SS   SF   F  + + C WR++NW WLRPK LE+ LR Q L GN+Y L +GD KE++ 
Sbjct  3    HSSVAISF--GFLTVLISCLWRLLNWVWLRPKRLERCLREQGLAGNSYRLLHGDFKEMSM  60

Query  310  MINETKSKPMKV  345
            M+ E  S+P+ +
Sbjct  61   MLKEAYSRPISL  72



>ref|XP_006348911.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  ++ AW++++WAW RP+ LEK LR Q LKGN+Y L +GD KELAK   +  SKP+KV
Sbjct  15   ITIVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELAKSFEDANSKPLKV  73



>gb|KDO49366.1| hypothetical protein CISIN_1g034199mg [Citrus sinensis]
Length=94

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +  L  AWRV+NW WLRPK LEK+LR Q LKGN+Y L +GD KE +  + E K++P+ +
Sbjct  15   VTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLSL  73



>gb|KDO49365.1| hypothetical protein CISIN_1g034199mg [Citrus sinensis]
Length=101

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWRV+NW WLRPK LEK+LR Q LKGN+Y L +GD KE +  + E K++P+ +
Sbjct  21   AWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLSL  73



>emb|CDP15988.1| unnamed protein product [Coffea canephora]
Length=515

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
              ++ +WR++NWAW +PK LEK LR Q L+GN+Y L +GD KE  +M  E KSKPM
Sbjct  15   FLVILSWRILNWAWFKPKKLEKCLRQQGLRGNSYNLVFGDMKETVRMTQEAKSKPM  70



>gb|KHN14193.1| Secologanin synthase [Glycine soja]
Length=518

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  139  ATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMIN  318
            A+C       I+ L  AWRV+NW WLRPK LE+ LR Q L+GN Y L  GD KE+  M  
Sbjct  4    ASCVCLVVILILALTLAWRVLNWLWLRPKRLERLLREQGLQGNPYRLLVGDLKEIMNMQK  63

Query  319  ETKSKPMKV  345
            E  SKPM +
Sbjct  64   EVTSKPMNL  72



>ref|XP_006598136.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Glycine 
max]
Length=389

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  184  CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            CAW+V+ W WLRPK LEK LR Q L+GN YTLF GD+KE  KM  E  SKPM +
Sbjct  19   CAWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNL  72



>ref|XP_006364094.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  160  SFPIIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            SF II ++  AWR++N+ W +PK LEK LR Q  KGN+Y L YGD KE+ KMI E  SKP
Sbjct  14   SFAIILVLGWAWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMKEMKKMIEEATSKP  73

Query  337  M  339
            +
Sbjct  74   I  74



>ref|NP_001291324.1| cytochrome P450 CYP72A219-like [Sesamum indicum]
 gb|AAZ07706.1| cytochrome P450 monooxygenase [Sesamum indicum]
Length=514

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            + LV AW+++NW W RP+ LEK LR Q  KGN+Y LF+GD  EL  M  E KSKPM
Sbjct  15   VALVYAWKILNWVWFRPRKLEKILRQQGFKGNSYKLFFGDFNELKAMTKEAKSKPM  70



>ref|XP_003617766.1| Cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
 gb|AET00725.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=516

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 47/77 (61%), Gaps = 10/77 (13%)
 Frame = +1

Query  124  EWRSSATCSFFRSFPIIF---LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDT  294
            EW SS         PII    L+ AWR++NW WLRPK LEK LR Q L+GN Y + YGD 
Sbjct  2    EWYSSI-------IPIIVTVGLIWAWRILNWLWLRPKKLEKLLREQGLQGNPYRILYGDI  54

Query  295  KELAKMINETKSKPMKV  345
            K+L KM  E +SK M +
Sbjct  55   KDLLKMEKEARSKSMNL  71



>ref|XP_003546751.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  184  CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            CAW+V+ W WLRPK LEK LR Q L+GN YTLF GD+KE  KM  E  SKPM +
Sbjct  19   CAWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNL  72



>gb|KHN44057.1| Secologanin synthase [Glycine soja]
Length=520

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  184  CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            CAW+V+ W WLRPK LEK LR Q L+GN YTLF GD+KE  KM  E  SKPM +
Sbjct  19   CAWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNL  72



>ref|XP_004243262.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I LV   RV+NWAW +PK LEK+LR   LKGN Y LFYGD  E+   +NE +SKP+
Sbjct  16   ILLVYTLRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNEITNKLNEARSKPI  71



>ref|XP_004243253.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=518

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVL  348
            I  ++ AW++++WAW RP+ LEK LR Q LKGN+Y L +GD KELAK   + KSKP+ V 
Sbjct  15   ITSVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELAKSFEDVKSKPLNVF  74



>emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera]
Length=518

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I  L+ AWRV+NW WLRPK LE+ L+ Q L GN+Y L YGD KE++ MI E  S+P+
Sbjct  16   ITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIKEATSRPI  72



>ref|XP_007213922.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
 gb|EMJ15121.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
Length=519

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVL  348
            AWRV+NW WLRPK LE+ LR Q L GN+Y L  GDTKE + M+ E KSKPM + 
Sbjct  23   AWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMLKEAKSKPMDLF  76



>gb|KDO35797.1| hypothetical protein CISIN_1g037705mg, partial [Citrus sinensis]
Length=96

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +1

Query  160  SFPIIFLVCAW-RVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            S  I+ + CAW  ++NW WL+PK LEK+LR Q   GN+Y +F+GD KELA+   E KS+P
Sbjct  15   STAILAVACAWWMLLNWVWLKPKKLEKFLRKQGFSGNSYKVFHGDMKELAQTTKEAKSRP  74

Query  337  MKV  345
            + +
Sbjct  75   ISL  77



>ref|XP_004243260.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=517

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I LV  WRV+NWAW RPK LE +LR + LKGN Y L YGD  EL K I E KSK + +
Sbjct  16   ILLVYTWRVLNWAWFRPKKLENFLRQRGLKGNPYKLLYGDLNELTKSIVEAKSKSINI  73



>ref|XP_002270326.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=516

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWR++NW WLRPK LE+ LR Q + GN+Y L +GD +E+ +MI+E  S+P+ +
Sbjct  13   ITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMISEANSRPISL  71



>emb|CBI22134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWR++NW WLRPK LE+ LR Q + GN+Y L +GD +E+ +MI+E  S+P+ +
Sbjct  26   ITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMISEANSRPISL  84



>ref|XP_006442301.1| hypothetical protein CICLE_v100197312mg, partial [Citrus clementina]
 gb|ESR55541.1| hypothetical protein CICLE_v100197312mg, partial [Citrus clementina]
Length=98

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  136  SATCSFFRSFPIIFLVCAW-RVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKM  312
            + T S   S  I+ + CAW  ++NW WL+PK LEK+LR Q   GN+Y +F+GD KELA+ 
Sbjct  9    AVTFSIAFSTAILAVACAWWMLLNWVWLKPKKLEKFLREQGFSGNSYKVFHGDVKELAQT  68

Query  313  INETKSKPMKV  345
              E +S+P+ +
Sbjct  69   TKEAESRPISL  79



>ref|XP_004243257.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I+ ++  W+V+NWAW RPK  EK+LR   L GN Y L YGD KEL   +NE KSKP+
Sbjct  19   ILLVIYTWKVLNWAWFRPKKFEKYLRKSGLNGNPYKLLYGDLKELTNKLNEAKSKPI  75



>gb|ADU19849.1| putative secologanin synthase [Camptotheca acuminata]
Length=524

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  148  SFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETK  327
            S   S  ++FLV AW+++NWA+L PK +EK LR Q  KGN+Y L  GD KE + M+ ET 
Sbjct  11   SIAASVAVVFLVYAWKMLNWAYLTPKRIEKCLRKQGFKGNSYRLLVGDLKESSMMLKETM  70

Query  328  SKPMKV  345
            SKP+ V
Sbjct  71   SKPINV  76



>gb|KEH28455.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=415

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 47/77 (61%), Gaps = 10/77 (13%)
 Frame = +1

Query  124  EWRSSATCSFFRSFPIIF---LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDT  294
            EW SS         PII    L+ AWR++NW WLRPK LEK LR Q L+GN Y + YGD 
Sbjct  2    EWYSSI-------IPIIVTVGLIWAWRILNWLWLRPKKLEKLLREQGLQGNPYRILYGDI  54

Query  295  KELAKMINETKSKPMKV  345
            K+L KM  E +SK M +
Sbjct  55   KDLLKMEKEARSKSMNL  71



>ref|XP_010060787.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=109

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLAS-KQH  363
            AWRVVNW W+RPK LE+ LR Q L G  YT  +GD KE ++++ E  SKP+ +    K  
Sbjct  21   AWRVVNWVWVRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAISDDIKPR  80

Query  364  FYVLLH  381
             +  LH
Sbjct  81   LFPFLH  86



>ref|XP_008386388.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  184  CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            CAWRV+NW WLRPK LEK LR Q L GN+Y L+ GD KE++ M+ E  SKPM +
Sbjct  22   CAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNL  75



>ref|XP_007227257.1| hypothetical protein PRUPE_ppa017915mg [Prunus persica]
 gb|EMJ28456.1| hypothetical protein PRUPE_ppa017915mg [Prunus persica]
Length=515

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLA  351
            I +  AWRV+NW WLRPK LE+ L+ Q   GN+Y L +GDTK+ + M+ + +SKPMK+  
Sbjct  15   IVIAWAWRVLNWVWLRPKKLERCLKEQGFTGNSYRLLFGDTKDSSMMLRQAQSKPMKLST  74

Query  352  S  354
            S
Sbjct  75   S  75



>ref|XP_009339349.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=532

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  184  CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            CAWRV+NW WLRPK LEK LR Q L GN+Y L+ GD KE++ M+ E  SKPM
Sbjct  35   CAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPM  86



>ref|XP_009343588.1| PREDICTED: secologanin synthase-like [Pyrus x bretschneideri]
Length=112

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            II    AWRVVNW WLRPK LE++LR Q L GN+Y    GD KE   M+ +  SKPM +
Sbjct  15   IIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERTMMLKQAYSKPMNL  73



>gb|KGN66156.1| hypothetical protein Csa_1G574240 [Cucumis sativus]
Length=172

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  163  FPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            F +  L C WR +NW WL PK LEK LR Q   GN+Y L+ GD K+L  M  E KSKPM
Sbjct  12   FMVCLLRCGWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPM  70



>gb|AFO64616.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=515

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  SATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMI  315
            S T  F      IF+   +R+ NW W +PK +EK+LR Q L G +Y   +GD KEL +M 
Sbjct  3    SPTSFFALGVASIFIYLIYRIANWLWFKPKKIEKFLRKQGLNGTSYKFMFGDLKELVQMS  62

Query  316  NETKSKPMKV  345
            NE KSKPM +
Sbjct  63   NEAKSKPMSL  72



>emb|CAN72247.1| hypothetical protein VITISV_024665 [Vitis vinifera]
Length=288

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +1

Query  130  RSSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAK  309
             SS   SF   F  + + C WR++NW WLRPK LE+ L  Q L GN+Y L +GD KE++ 
Sbjct  44   HSSVAISF--GFLTVLISCLWRLLNWVWLRPKRLERCLXEQGLAGNSYRLLHGDFKEMSM  101

Query  310  MINETKSKPMKV  345
            M+ E  S+P+ +
Sbjct  102  MLKEAYSRPISL  113



>ref|XP_008219216.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLA  351
            I +  AWRV+NW WLRPK LE+ LR Q   GN+Y L +GDTK+ + M+ + +SKPMK+  
Sbjct  15   IVIAWAWRVLNWMWLRPKKLERCLREQGFTGNSYRLLFGDTKDSSMMLRQAQSKPMKLST  74

Query  352  S  354
            S
Sbjct  75   S  75



>ref|XP_010644729.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=514

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I  L+ AWR++NW WLRPK LE+ LR Q L GN+Y L +GD +E+++M NE  S P+
Sbjct  13   ITLLIFAWRLLNWVWLRPKKLERCLRKQGLTGNSYRLLHGDFREMSRMNNEANSGPI  69



>ref|XP_004243256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=516

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I L+C W+V+NWAW RPK LEK+     LKG  Y L YGD  EL K I E KSKP+
Sbjct  15   ILLICTWKVLNWAWFRPKKLEKYFIQNGLKGKPYKLLYGDLNELTKSIVEAKSKPI  70



>emb|CDP22280.1| unnamed protein product [Coffea canephora]
Length=97

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  SATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMI  315
            S    F     ++ LV AW+V NWAWL PK LEK L+ Q L+GN Y L YGD KE + + 
Sbjct  6    SPIAVFCYCILLLILVLAWKVFNWAWLTPKKLEKRLKEQGLRGNPYKLLYGDFKENSTLF  65

Query  316  NETKSKPMKV  345
             E  SKP+ +
Sbjct  66   KEAHSKPINL  75



>emb|CBI22131.3| unnamed protein product [Vitis vinifera]
Length=475

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWR++NW WLRPK LE+ L+ Q L GN+Y L +GD KE+  MI E  S+P+ +
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDLKEMFMMIKEASSRPISI  74



>gb|KEH38478.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            L+ AW+++NW WL+PK LEK+LR Q LKGN+Y L  GD ++L KM  ET SKPM +
Sbjct  17   LIWAWKILNWLWLKPKKLEKFLREQGLKGNSYRLLVGDIRDLLKMRKETTSKPMNL  72



>emb|CBI22129.3| unnamed protein product [Vitis vinifera]
Length=443

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWR++NW WLRPK LE+ L+ Q L GN+Y L +GD KE+  MI E  S+P+ +
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIKEASSRPISI  74



>gb|KEH38475.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            L+ AWR++NW WL+PK LEK LR Q LKGN+Y L  GD K+L K+  E  SKPM +
Sbjct  17   LIWAWRILNWIWLKPKKLEKELREQGLKGNSYRLLVGDIKDLLKIRKEATSKPMNL  72



>gb|ABC69393.1| CYP72A55v2 [Nicotiana tabacum]
Length=521

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +1

Query  169  IIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            IIFLV  AW ++ W W++PK LE  LR Q LKGN+Y LFYGD KEL+K + E  SKP+  
Sbjct  15   IIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEINSKPIIN  74

Query  346  LASK  357
            L+++
Sbjct  75   LSNE  78



>ref|XP_010644781.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Vitis vinifera]
Length=518

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWR++NW WLRPK LE+ L+ Q L GN+Y L +GD KE+  MI E  S+P+ +
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDLKEMFMMIKEASSRPISI  74



>gb|EYU43426.1| hypothetical protein MIMGU_mgv1a018638mg, partial [Erythranthe 
guttata]
Length=361

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  151  FFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKS  330
            F  SF  + L   WR++NWA+++PK LEK L  Q L GN Y   YGD KE++KM N  KS
Sbjct  8    FAASFGFVVLFYTWRILNWAYIQPKRLEKSLGNQGLTGNTYKFLYGDLKEMSKMFNHAKS  67

Query  331  KPMKV  345
             P+ +
Sbjct  68   TPINL  72



>gb|AEI59770.1| cytochrome P450 [Helianthus annuus]
Length=520

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            II   C+WR+ N+ WL+PK  E +LR Q LKGN+Y  F GD +E+ KM+N+ K+KP+
Sbjct  15   IILGWCSWRMYNFLWLKPKRTEMFLRNQGLKGNSYKFFLGDFREMVKMVNDAKTKPI  71



>gb|ABC69392.1| CYP72A55v1 [Nicotiana tabacum]
Length=521

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +1

Query  169  IIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            IIFLV  AW ++ W W++PK LE  LR Q LKGN+Y LFYGD KEL+K + E  SKP+  
Sbjct  15   IIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYGLFYGDMKELSKSLKEINSKPIIN  74

Query  346  LASK  357
            L+++
Sbjct  75   LSNE  78



>ref|XP_009339350.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=519

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  184  CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            CAWRV+NW WLRPK LEK LR Q L GN+Y L+ GD +E + M+ E  SKPM +
Sbjct  22   CAWRVLNWVWLRPKDLEKCLRQQGLAGNSYRLWSGDLRESSIMLKEAMSKPMNL  75



>emb|CAN72865.1| hypothetical protein VITISV_029731 [Vitis vinifera]
Length=502

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWR++NW WLRPK LE+ L+ Q L GN+Y L +GD KE+  MI E  S+P+ +
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIKEATSRPISI  74



>ref|XP_009618785.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=531

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +1

Query  169  IIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            IIFLV  AW ++ W W++PK LE  LR Q LKGN+Y LFYGD KEL+K + E  SKP+  
Sbjct  25   IIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEINSKPIIN  84

Query  346  LASK  357
            L+++
Sbjct  85   LSNE  88



>ref|XP_008219294.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=515

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLA  351
            I +  AWR +NW WLRPK LE+ LR Q   GN+Y L +GDTK+ + M+ + +SKPMK+  
Sbjct  15   IVIAWAWRALNWVWLRPKKLERCLREQGFTGNSYRLLFGDTKDSSMMLRQAQSKPMKLST  74

Query  352  SK  357
            S 
Sbjct  75   SH  76



>ref|XP_006442293.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
 gb|ESR55533.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
Length=167

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +  L  AWRV+NW WLRPK LEK+LR Q LKGN+Y L +GD KE    + E K++P+ +
Sbjct  15   VTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENFIELKEAKARPLSL  73



>ref|XP_008386157.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +I +  AWR++NW WLRPK LE++LR Q L GN+Y  + GD KE++ MI +  SKP+ +
Sbjct  17   VIIIAGAWRLLNWLWLRPKKLERYLRQQGLTGNSYRFYTGDMKEISTMIKQAYSKPVSL  75



>ref|XP_003634773.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
 emb|CBI22132.3| unnamed protein product [Vitis vinifera]
Length=518

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWR++NW WLRPK LE+ L+ Q L GN+Y L +GD KE+  MI E  S+P+ +
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIKEATSRPISI  74



>ref|XP_009781171.1| PREDICTED: cytochrome P450 CYP72A219-like, partial [Nicotiana 
sylvestris]
Length=449

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            + ++ AW+++ WAW RP+ LE+ LR Q L GN+Y L +GD KEL+K I E KSKP+ V
Sbjct  16   LLVIYAWKLLKWAWFRPRKLEQCLRQQGLIGNSYKLIFGDLKELSKSIEEVKSKPLNV  73



>ref|XP_009602242.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=513

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  151  FFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKS  330
             F +  I  ++  WR+VNW WLRP+ LEK  R Q + G+ Y   YGDTKE+A+M  E K 
Sbjct  7    LFSAIVIALVIWVWRMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAEMTKEAKF  66

Query  331  KPMKV  345
            KP+K+
Sbjct  67   KPIKL  71



>gb|KDO49369.1| hypothetical protein CISIN_1g044222mg [Citrus sinensis]
Length=122

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AW V+NW WLRPK LEK+LR Q LKGN+Y L +GD KE   M+ + K++P+ +
Sbjct  21   AWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESTIMLKKAKARPLSL  73



>ref|XP_006360179.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=514

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I +   W+V+NW W  PK LE  LR Q LKGN+Y L YGD K++ +MI E  SKPM +
Sbjct  15   IAITLLWKVLNWVWFNPKKLENLLRKQGLKGNSYRLLYGDMKDVTRMIKEANSKPMNM  72



>ref|XP_010060780.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 ref|XP_010060781.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67645.1| hypothetical protein EUGRSUZ_F01392 [Eucalyptus grandis]
Length=510

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLAS-KQH  363
            AWRVVNW WLRPK LE+ LR Q L G  YT  +GD KE ++++ E  SKP+ +    K  
Sbjct  21   AWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAISDDIKPR  80

Query  364  FYVLLH  381
             +  LH
Sbjct  81   LFPFLH  86



>ref|XP_007133274.1| hypothetical protein PHAVU_011G165900g [Phaseolus vulgaris]
 gb|ESW05268.1| hypothetical protein PHAVU_011G165900g [Phaseolus vulgaris]
Length=180

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = +1

Query  145  CSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINET  324
              F  +F I+FL  A   +NW WL PK  E++LR Q LKGN YTLF+GD K ++ M+++ 
Sbjct  12   VGFLIAFVIMFLTKA---LNWVWLEPKRAERFLRRQGLKGNPYTLFFGDIKAMSMMLHQA  68

Query  325  KSKPMKV  345
            KSKP+ +
Sbjct  69   KSKPILI  75



>ref|XP_004295683.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLASKQ  360
            AW +++W W +PK LE+ LR Q  +GNAY LFYGD KE A M+ E KSKPM +  S  
Sbjct  23   AWSLLDWVWFKPKKLERCLRQQGFQGNAYRLFYGDMKENAIMVKEAKSKPMNLSTSHD  80



>ref|XP_006477947.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=263

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +  L  AWRV+NW WLRP+ LEK+LR Q LKGN+Y L +GD KE +  + E K++P+ +
Sbjct  15   VTVLTWAWRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLSL  73



>ref|XP_006442294.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
 ref|XP_006442295.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
 gb|ESR55534.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
 gb|ESR55535.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
Length=266

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +  L  AWRV+NW WLRPK LEK+LR Q LKGN+Y L +GD KE    + E K++P+ +
Sbjct  15   VTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENFIELKEAKARPLSL  73



>ref|XP_004307203.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=543

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  SFFRSFPIIFLV----CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMI  315
            SF  +  I+ L     CAWRV+NW WL+PK LEK LR Q L GN+Y +  GD KE  +++
Sbjct  29   SFIIALSIVLLSIASSCAWRVLNWVWLKPKKLEKCLRQQGLAGNSYRVLIGDVKESFRVM  88

Query  316  NETKSKPMKV  345
             E  SKPM +
Sbjct  89   KEACSKPMNL  98



>ref|XP_009790251.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
 gb|ABC69391.1| CYP72A53v2 [Nicotiana tabacum]
Length=518

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  160  SFPIIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            SF IIF++  AW+++N+ WL+PK LEK+LR Q  KGN+Y   +GD KE+ KM  E  SKP
Sbjct  14   SFAIIFVLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMKEMKKMGEEAMSKP  73

Query  337  M  339
            +
Sbjct  74   I  74



>ref|XP_004244273.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I   VC W+V+NW WL PK LE  LR Q L GN+Y + YGD  +   MI E  SKPM +
Sbjct  17   IALFVCLWKVLNWVWLNPKKLENLLRKQGLNGNSYKILYGDLNDFIGMIREASSKPMNL  75



>ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=587

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  184  CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            C WR +NW WL PK LEK LR Q   GN+Y L+ GD K+L  M  E KSKPM
Sbjct  89   CGWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPM  140



>gb|EYU31636.1| hypothetical protein MIMGU_mgv1a004595mg [Erythranthe guttata]
Length=519

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            + L   WR++NWA++RPK LEK LR Q L GN Y   YGD KE+  MIN  KS P+ +
Sbjct  18   VVLFYTWRILNWAYIRPKRLEKSLRKQGLIGNTYNFLYGDLKEMLNMINHAKSHPINL  75



>dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis]
Length=522

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWR++NW WLRPK LE+ LR Q L+GN Y L  GD K+L KM  E KSKPM +
Sbjct  24   AWRMLNWLWLRPKKLERLLREQGLQGNPYRLIVGDLKDLMKMRKEAKSKPMNL  76



>emb|CDP15985.1| unnamed protein product [Coffea canephora]
Length=513

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            ++  V AWRV+NWAW +PK L+K L+ Q  KGN Y L YGD K+++ +  E  SKP+ +
Sbjct  17   VVLSVLAWRVLNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDLKQISSLFQEANSKPISL  75



>ref|XP_002271303.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWR++NW WLRPK LE+ LR Q L GN+Y L +GD +E+ +MI+E  S+ + +
Sbjct  13   ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMLRMISEANSRSISL  71



>ref|XP_006477946.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +  L  AWRV+NW WLRPK LEK+LR Q LKGN+Y L +GD KE +  + E K++P+ +
Sbjct  15   VTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLSL  73



>ref|XP_010092742.1| Secologanin synthase [Morus notabilis]
 gb|EXB52087.1| Secologanin synthase [Morus notabilis]
Length=518

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 5/72 (7%)
 Frame = +1

Query  145  CSFFRSFPIIFLVC-----AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAK  309
             SF +   ++F +      AWRV+NW WLRPK LE  LR Q LKGN+Y L+ GD KE + 
Sbjct  3    VSFLKLSSVVFAILLITTWAWRVLNWVWLRPKRLENCLRKQGLKGNSYRLWSGDLKESSL  62

Query  310  MINETKSKPMKV  345
            MI E  SKP+ +
Sbjct  63   MIKEASSKPINL  74



>gb|AHK60841.1| CYP72A225 [Catharanthus roseus]
Length=538

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 4/67 (6%)
 Frame = +1

Query  151  FFRSFPII----FLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMIN  318
            F+R   ++    FL+ AW+++NWAW++PK LEK LR   LKGN+Y L  GD  E ++M  
Sbjct  21   FYRGISVLGTCFFLLLAWKMLNWAWIKPKKLEKRLRQLGLKGNSYRLLIGDLGETSQMDK  80

Query  319  ETKSKPM  339
            E KSKP+
Sbjct  81   EAKSKPI  87



>ref|XP_010060782.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWRVVNW WLRPK LE+ LR Q L G  YT  +GD KE ++++ E  SKP+ V
Sbjct  21   AWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAV  73



>gb|KEH38471.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=523

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +1

Query  133  SSATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKM  312
            SS T +FF     + L+  W+++NW WLRPK +EK LR Q L+G+ Y +  GDT+E+ KM
Sbjct  6    SSTTATFFLIVAPLVLLWTWKLLNWLWLRPKRIEKVLRAQGLQGSPYKILVGDTREMIKM  65

Query  313  INETKSKPMKVLASKQHFYVLLHLF  387
            + E    P+   +      V  H+F
Sbjct  66   MMENAKSPIFTNSLSDDKDVTPHIF  90



>ref|XP_004295684.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  163  FPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMK  342
            F  I +  AW V++W WL+PK LE+ LR Q  KGN+Y + YGDTK+ + M  E KSKPM 
Sbjct  15   FVSIVVRLAWSVLDWVWLKPKKLERCLREQGFKGNSYRILYGDTKDESIMRAEAKSKPMN  74

Query  343  VLAS  354
            +  S
Sbjct  75   ISTS  78



>ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=521

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  184  CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            C WR +NW WL PK LEK LR Q   GN+Y L+ GD K+L  M  E KSKPM
Sbjct  23   CGWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPM  74



>ref|XP_010060776.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67641.1| hypothetical protein EUGRSUZ_F01387 [Eucalyptus grandis]
Length=510

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWR VNW WLRPK LE+ LR Q L G  YT  +GD KE  +M+ E KSKP+ V
Sbjct  21   AWRAVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENLRMLKEAKSKPIAV  73



>ref|XP_004294187.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  163  FPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMK  342
            F  I +  AW V++W WL+PK LE+ LR Q  KGN+Y + YGDTKE   M+ + KSKPM 
Sbjct  15   FVSIVVRLAWSVLDWVWLKPKKLERCLRKQGFKGNSYRILYGDTKENVIMLKKAKSKPMN  74

Query  343  VLASKQ  360
            +  S  
Sbjct  75   LSTSHD  80



>gb|ADO16184.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=516

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            L   W+++NWAWL PK LEK LR Q  KGN+Y    GD  ELAKM  E +SKPM +
Sbjct  18   LKLGWKLLNWAWLMPKKLEKLLREQGYKGNSYKPITGDIMELAKMTKEARSKPMSI  73



>ref|XP_006495016.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=519

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +1

Query  160  SFPIIFLVCAW-RVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            S  I+ + CAW  ++NW WL+PK LEK+LR Q   GN+Y +F+GD KELA+   E KS+P
Sbjct  17   STAILAVACAWWMLLNWVWLKPKKLEKFLREQGFSGNSYKVFHGDMKELAQTTKEAKSRP  76

Query  337  MKV  345
            + +
Sbjct  77   ISL  79



>ref|XP_006349622.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=516

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  160  SFPIIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            SF IIF++  AWR++N+ WL+PK LEK LR +  KGN+Y   +GD KE++KM  E  SKP
Sbjct  13   SFAIIFVLRWAWRILNYVWLKPKYLEKQLRQEGFKGNSYKFLFGDMKEMSKMGEEALSKP  72

Query  337  M  339
            +
Sbjct  73   V  73



>ref|XP_004248200.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I+ L+ AWR++NW W +PK LEK LR Q  KGN+Y   +GD KE+ KM  E  SKP+
Sbjct  22   ILVLIWAWRILNWVWFKPKMLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKEALSKPI  78



>ref|XP_006495017.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Citrus 
sinensis]
Length=519

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +1

Query  160  SFPIIFLVCAW-RVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            S  I+ + CAW  ++NW WL+PK LEK+LR Q   GN+Y +F+GD KELA+   E KS+P
Sbjct  17   STAILAVACAWWMLLNWVWLKPKKLEKFLREQGFSGNSYKVFHGDMKELAQTTKEAKSRP  76

Query  337  MKV  345
            + +
Sbjct  77   ISL  79



>ref|XP_006477952.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=519

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  136  SATCSFFRSFPIIFLVCAW-RVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKM  312
            + T S   S  I+ + CAW  ++NW WL+PK LEK+LR Q   GN+Y +F+GD KELA+ 
Sbjct  9    AVTFSIAFSTAILAVGCAWWMLLNWVWLKPKKLEKFLREQGFSGNSYKVFHGDMKELAQT  68

Query  313  INETKSKPMKV  345
              E KS+P+ +
Sbjct  69   TKEAKSRPISL  79



>ref|XP_006348302.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = +1

Query  139  ATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMIN  318
              C F  +  I   VC W+V+NW W  PK LE  LR Q L GN+Y + YGD  +   MI 
Sbjct  9    TVCCF--AIAIALFVCLWKVLNWVWFNPKKLENLLRKQGLNGNSYKILYGDLNDFIGMIR  66

Query  319  ETKSKPMKV  345
            E  SKPM +
Sbjct  67   EATSKPMNL  75



>gb|ABC69390.1| CYP72A53v1 [Nicotiana tabacum]
Length=518

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  160  SFPIIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            SF IIF++  AW+++N+ WL+PK LEK+LR Q  KGN+Y   +GD KE  KM  E  SKP
Sbjct  14   SFAIIFVLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMKETKKMGEEAMSKP  73

Query  337  M  339
            +
Sbjct  74   I  74



>gb|AGX93049.1| secologanin synthase-like protein [Vinca minor]
Length=524

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I+ +  AWRV++WAW  PK LEK LR Q  KGN+Y    GD KE  KM+ E  SKPM++
Sbjct  18   IVLVAWAWRVLDWAWFTPKRLEKRLRQQGFKGNSYKFLVGDVKESGKMLQEAMSKPMEL  76



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            + ++C W+++NWAWL PK LEK LR Q   GN+Y L +G+ KE+  M  + +S+PM +
Sbjct  19   VLILCGWKILNWAWLTPKKLEKCLRQQGFNGNSYRLLFGEIKEMFTMTRQARSRPMSL  76



>ref|XP_010060783.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWRVVNW WLRPK LE+ LR Q L G  YT  +GD KE ++++ E  SKP+ V
Sbjct  21   AWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPISV  73



>ref|XP_006495010.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=519

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +1

Query  160  SFPIIFLVCAW-RVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            S  I+ + CAW  ++NW WL+PK LEK+LR Q   GN+Y +F+GD KELA+   E KS+P
Sbjct  17   STAILAVACAWWMLLNWVWLKPKKLEKFLRKQGFSGNSYKVFHGDMKELAQTTKEAKSRP  76

Query  337  MKV  345
            + +
Sbjct  77   ISL  79



>ref|XP_006594768.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = +1

Query  139  ATCSFFRSFPIIFLVC---AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAK  309
            AT S    F I+ L     AWR++NW W+RPK LE+ LR Q L+GN Y +  GD KE+ K
Sbjct  6    ATTSSSIVFVIVILALTSWAWRMLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVK  65

Query  310  MINETKSKPMKV  345
            +  E +SKPM +
Sbjct  66   LQMEARSKPMNL  77



>gb|KCW67646.1| hypothetical protein EUGRSUZ_F01394 [Eucalyptus grandis]
Length=510

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWRVVNW WLRPK LE+ LR Q L G  YT  +GD KE ++++ E  SKP+ V
Sbjct  21   AWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPISV  73



>ref|XP_002265455.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWR++N  WL+PK +E++LR Q L GN+Y L +GD +E+++MI+E  S+P+ +
Sbjct  13   ITLLIYAWRLLNSVWLKPKKIERYLRQQGLIGNSYRLLHGDFREMSRMIDEANSRPISL  71



>ref|XP_006442315.1| hypothetical protein CICLE_v10023450mg [Citrus clementina]
 gb|ESR55555.1| hypothetical protein CICLE_v10023450mg [Citrus clementina]
Length=145

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +1

Query  184  CAWRVVNWAWLR-PKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLASK  357
            CAW+++NWAWL  PK LEK+LR     GN+YTL +GD KE+A M     SKP+ +L+  
Sbjct  7    CAWKILNWAWLNDPKKLEKFLRQLGFFGNSYTLIHGDMKEMAMMTTLAISKPISLLSDD  65



>ref|XP_010060775.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67640.1| hypothetical protein EUGRSUZ_F01386 [Eucalyptus grandis]
Length=510

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWR VNW WLRPK LE+ LR Q L G +YT   GD KE  +M+ E KSKP+ V
Sbjct  21   AWRAVNWVWLRPKRLERLLRQQGLSGKSYTFLVGDLKENLRMLKEAKSKPIAV  73



>ref|XP_006477948.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +  L  AWRV+NW WLRP+ LEK+LR Q LKGN+Y L +GD KE +  + E K++P+ +
Sbjct  15   VTVLTWAWRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLSL  73



>emb|CBI22133.3| unnamed protein product [Vitis vinifera]
Length=629

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWR++NW WLRPK LE+ LR Q L GN+Y L +GD +E+ +MI+E  S+ + +
Sbjct  83   ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMLRMISEANSRSISL  141



>ref|XP_007224159.1| hypothetical protein PRUPE_ppa016446mg [Prunus persica]
 gb|EMJ25358.1| hypothetical protein PRUPE_ppa016446mg [Prunus persica]
Length=519

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLA  351
            I +  AWRV+NW  LRPK LE+ LR Q   GN+Y L +GDTK+ + M+ + +SKPMK+  
Sbjct  15   IVIAWAWRVLNWMCLRPKKLERCLREQGFTGNSYRLLFGDTKDSSMMLRQAQSKPMKLST  74

Query  352  S  354
            S
Sbjct  75   S  75



>ref|XP_010060778.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW67643.1| hypothetical protein EUGRSUZ_F01390 [Eucalyptus grandis]
Length=510

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I    AWRVVNW WLRP+ LE+ LR Q L G  YT  +GD KE ++++ E  SKP+ V
Sbjct  16   ILTTWAWRVVNWVWLRPQRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAV  73



>ref|XP_009343590.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            II    AWRVVNW WLRPK LE++LR Q L GN+Y    GD KE   M+ +  SKPM +
Sbjct  15   IIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERTMMLKQAYSKPMNL  73



>ref|XP_008366858.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=516

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            II    AWRVVNW WLRPK LE++LR Q L GN+Y    GD KE   M+ +  SKPM +
Sbjct  15   IIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERTMMLKQAYSKPMNL  73



>gb|KDO52098.1| hypothetical protein CISIN_1g038814mg, partial [Citrus sinensis]
Length=189

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            AW+++NWAWL+PK +EK LR Q  KGN+Y   +GD +E A + N+ KSKP+
Sbjct  4    AWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPI  54



>ref|XP_007149361.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
 gb|ESW21355.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
Length=516

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLA  351
            AWR+VNW WL PK LE+ LR Q L+G  Y  F GDTKE+ KM  E  SKPM + +
Sbjct  17   AWRMVNWLWLTPKRLERLLREQGLEGKPYKFFVGDTKEIEKMKKEGLSKPMDLFS  71



>gb|KCW67648.1| hypothetical protein EUGRSUZ_F01396 [Eucalyptus grandis]
Length=519

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWRVVNW W+RPK LE+ LR Q L G  YT  +GD KE ++++ E  SKP+ +
Sbjct  21   AWRVVNWVWVRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAI  73



>emb|CBI39916.3| unnamed protein product [Vitis vinifera]
Length=505

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I  L+ AWR++N  WL+PK +E++LR Q L GN+Y L +GD +E+++MI+E  S+P+ +
Sbjct  13   ITLLIYAWRLLNSVWLKPKKIERYLRQQGLIGNSYRLLHGDFREMSRMIDEANSRPISL  71



>ref|XP_011091090.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            ++ L  AWR +NW W++P+ LEK LR Q  KGN+Y   +GD +E AK+  E  SKP+ +
Sbjct  12   VVLLHTAWRFLNWVWIKPRKLEKLLRKQGFKGNSYRFLFGDAREAAKLYEEAYSKPIGI  70



>ref|XP_009615907.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            LV  W+V+NWAW  PK +EK LR + LKGN Y L YGD  EL K I E KSKP+
Sbjct  17   LVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPI  70



>gb|ABC69419.1| CYP72A56 [Nicotiana tabacum]
Length=516

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            LV  W+V+NWAW  PK +EK LR + LKGN Y L YGD  EL K I E KSKP+
Sbjct  17   LVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPI  70



>emb|CDP15982.1| unnamed protein product [Coffea canephora]
Length=515

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            ++  V AWR +NWAW +PK L+K L+ Q  KGN Y L YGD K+++ +  E  SKP+ +
Sbjct  17   VVLSVLAWRALNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDFKQISSLFQEANSKPISL  75



>emb|CDP19599.1| unnamed protein product [Coffea canephora]
Length=515

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
              ++ +WR++NWAW +PK  EK LR Q L+GN+Y L  GD KE  +M  E KSKP+
Sbjct  15   FLVILSWRILNWAWFKPKKREKCLRQQGLRGNSYNLVLGDMKETVRMTQEAKSKPI  70



>dbj|BAL45203.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=520

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            LV  WRV+NW WL+PK LEK LR Q  KGN+Y L  GD K+  KM  + KSKPM++
Sbjct  20   LVYTWRVLNWIWLKPKRLEKLLREQGCKGNSYRLVLGDLKDSYKMGKQAKSKPMEL  75



>ref|XP_004244382.2| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=511

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            ++ ++  WR+VNW W+RP+ +EK  R Q L G+ Y   YGDTKE+AK+  + K KPMK+
Sbjct  11   LVTMIWMWRMVNWVWIRPRKIEKCFRKQGLNGHPYRTLYGDTKEMAKLTKQAKLKPMKL  69



>ref|XP_006477949.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=517

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +1

Query  169  IIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            I+ LV  AW V+NW WLRPK LEK+LR Q LKGN+Y L +GD KE + M+ + K++P+ +
Sbjct  14   IVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESSIMLKKAKARPLSL  73



>ref|XP_004294188.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=521

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLASKQ  360
            AW V++W WL+PK LE+ LR Q L+GN+Y +F+GD KE + M+ + KSKPM +L+S  
Sbjct  23   AWSVLDWLWLKPKKLERCLREQGLQGNSYRIFHGDMKENSVMLTQAKSKPM-ILSSSH  79



>gb|ABC69389.1| CYP72A52v1 [Nicotiana tabacum]
Length=518

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  160  SFPIIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            SF IIF++  AW+++N+ WL+PK LEK +R Q  KGN+Y   +GD KE+ KM  E  SKP
Sbjct  14   SFAIIFVLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMKEIKKMGEEAMSKP  73

Query  337  M  339
            +
Sbjct  74   I  74



>ref|XP_009628921.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  160  SFPIIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            SF IIF++  AW+++N+ WL+PK LEK +R Q  KGN+Y   +GD KE+ KM  E  SKP
Sbjct  14   SFAIIFVLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMKEIKKMGEEAMSKP  73

Query  337  M  339
            +
Sbjct  74   I  74



>ref|XP_006442299.1| hypothetical protein CICLE_v100199322mg, partial [Citrus clementina]
 gb|ESR55539.1| hypothetical protein CICLE_v100199322mg, partial [Citrus clementina]
Length=210

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  196  VVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            ++NW WL+PK LEK+LR Q   GN+Y +FYGD KELA+   E KS+P+ +
Sbjct  2    LLNWVWLKPKKLEKFLRKQGFSGNSYKVFYGDMKELAQTTKEAKSRPISL  51



>ref|XP_008226302.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=518

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  175  FLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMK  342
             +   W+VVNW WL+PK LE++LR Q L GN+Y L  GD  + +KM  E  SKPM+
Sbjct  17   LITLGWKVVNWVWLKPKKLERYLRQQGLSGNSYRLLIGDLTDNSKMTKEALSKPME  72



>ref|XP_009790240.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=512

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +1

Query  160  SFPIIFLVC--AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSK  333
            SF II ++    WR +NW WL+PK LEK LR    +GN+Y L YGD KE+  M  E KSK
Sbjct  9    SFVIIIILYRWGWRFMNWLWLQPKCLEKCLRELGFRGNSYKLLYGDMKEVVMMDEEAKSK  68

Query  334  PMK  342
            P+K
Sbjct  69   PIK  71



>ref|XP_009594690.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMK  342
            II L   WR +NW WL+PK LEK L+    +GN+Y L YGD KE+  M  E KSKP+K
Sbjct  15   IILLRWGWRFMNWLWLQPKCLEKCLKELGFRGNSYKLLYGDMKEVVMMDEEAKSKPIK  72



>emb|CDP15981.1| unnamed protein product [Coffea canephora]
Length=513

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            ++  V AW+V++W W +P+ LEK L+ Q  KGN Y LFYGD KE+  +  E  SKP+ +
Sbjct  16   LVLSVLAWKVLSWVWFKPRKLEKHLKQQGFKGNPYKLFYGDFKEIGTLFQEAYSKPISL  74



>ref|XP_010275158.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=527

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            + L+ AWR +NW WL+PK LE++LR Q +KG++Y L YG  +E ++M+ E +SKP
Sbjct  19   LILLWAWRFLNWVWLKPKKLERFLREQGIKGHSYGLLYGTLREESRMMKEVQSKP  73



>ref|XP_010041835.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=398

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLAS-KQH  363
            AWRVVN  WLRPK LE+ LR Q L G  YT  +GD KE ++++ E  SKP+ +    K  
Sbjct  21   AWRVVNLVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAISDDIKPR  80

Query  364  FYVLLH  381
             +  LH
Sbjct  81   LFPFLH  86



>emb|CDP15976.1| unnamed protein product [Coffea canephora]
Length=525

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  SATCSFFRSFPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMI  315
            S    F     ++  V AWR   WAWL PK LEK L+ Q L+GN Y L YGD KE+A   
Sbjct  6    SPIAVFSSCILLLISVLAWRAFKWAWLTPKKLEKRLKEQGLRGNPYKLLYGDFKEIATHF  65

Query  316  NETKSKPMKV  345
             E  SKP+ V
Sbjct  66   KEAHSKPINV  75



>ref|XP_007149376.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
 gb|ESW21370.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
Length=523

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLAS  354
            AW ++NW W  PK LE+ LR Q L+GN YTL  GDT E AKM  E  SKPM + ++
Sbjct  24   AWMMLNWLWFTPKRLERLLREQGLQGNPYTLLVGDTNEFAKMRKEAFSKPMDLFSN  79



>ref|XP_007149362.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
 gb|ESW21356.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
Length=523

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLA  351
            AW ++NW W  PK LE+ LR Q L+GN YTL  GDTK+ AKM  E  SKPM + +
Sbjct  24   AWMMLNWVWFTPKRLERLLREQGLQGNPYTLLVGDTKDFAKMRKEAFSKPMNLFS  78



>emb|CDP06076.1| unnamed protein product [Coffea canephora]
Length=515

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +1

Query  163  FPIIFLVCAW--RVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            F +I L+  W  R VNW WL PK +E+ LR Q   GN Y L YGDTKE+  MI    SKP
Sbjct  11   FVLIMLLIFWAARTVNWVWLNPKRIERCLRKQGFNGNPYRLLYGDTKEIGSMIKAANSKP  70

Query  337  MKV  345
            +K+
Sbjct  71   IKL  73



>ref|XP_006364092.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=521

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            I+ L  AWR++NW W +PK LEK LR Q  KGN+Y   +GD KE+ KM  E  SKP+
Sbjct  20   ILVLRWAWRILNWVWFKPKKLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKEALSKPI  76



>ref|XP_007149364.1| hypothetical protein PHAVU_005G064100g [Phaseolus vulgaris]
 gb|ESW21358.1| hypothetical protein PHAVU_005G064100g [Phaseolus vulgaris]
Length=520

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLAS  354
            AW ++NW W  PK LE+ LR Q L+GN YTL  GDTK+ AKM  E  SKPM + + 
Sbjct  20   AWMMLNWVWFTPKRLERLLREQGLQGNPYTLLVGDTKDFAKMRKEAFSKPMNLFSH  75



>ref|XP_010064522.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67638.1| hypothetical protein EUGRSUZ_F01383 [Eucalyptus grandis]
Length=510

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  172  IFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            +    AW VVNWAWLRPK +E  LR Q L G  +T  +GD KE+++++ E KSKP
Sbjct  16   VLTTLAWMVVNWAWLRPKRIEGLLRQQGLSGRPHTFLFGDLKEISRLMREAKSKP  70



>gb|AGX93044.1| secologanin synthase-like protein, partial [Lonicera japonica]
Length=520

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            L+ AWRV+NWAW  PK LEK LR Q  KGN Y    GD KE A M+ +  SKP+
Sbjct  19   LLWAWRVLNWAWFTPKKLEKKLRDQGFKGNPYRFLVGDVKESAAMLEQAMSKPI  72



>gb|AGX93047.1| secologanin synthase-like protein [Rauvolfia serpentina]
Length=524

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWRV++WAW  PK +EK LR Q  KGNAY    GD KE  KM+ E  SKPM++
Sbjct  24   AWRVLDWAWFTPKRIEKRLRQQGFKGNAYRFMVGDVKENGKMLQEAMSKPMEL  76



>gb|AGX93046.1| secologanin synthase-like protein [Amsonia hubrichtii]
Length=524

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            AWRV++WAW  PK LEK LR Q  KGNAY    GD KE  KM+ E  SKPM
Sbjct  24   AWRVLDWAWFTPKRLEKRLRQQGYKGNAYRFLVGDVKENGKMLQEAMSKPM  74



>ref|XP_004248734.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=516

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  160  SFPIIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            SF IIF++  AWR++N+ WL+PK LEK LR Q  KG+ Y   +GD KE++KM  E  SKP
Sbjct  13   SFAIIFVLRWAWRILNYVWLKPKYLEKQLRKQGFKGHTYKFLFGDMKEMSKMGEEAWSKP  72

Query  337  M  339
            +
Sbjct  73   V  73



>ref|XP_009790250.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +1

Query  160  SFPIIFLVC-AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            SF +IF++  AW+++NW W +PK LEK LR Q  KGN+Y   +GD  E+ KM  E  SKP
Sbjct  14   SFVVIFILKWAWKILNWVWFKPKELEKCLRQQGFKGNSYRFLFGDVNEMMKMGKEALSKP  73

Query  337  M  339
            +
Sbjct  74   I  74



>ref|XP_009339348.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=525

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLASK--Q  360
            AW ++NW W RPK LE++LR Q L GN+Y L +GD KE++ M  + +SKP+  L+     
Sbjct  21   AWSLLNWVWFRPKKLERYLRQQGLAGNSYRLLFGDLKEISMMHKQARSKPINHLSHDIVP  80

Query  361  HFYVLLH  381
            H    LH
Sbjct  81   HILPFLH  87



>gb|KEH38479.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=99

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            ++ LV AW+++ W+WL+PK LE+ LR Q LKGN Y    GD KE  KM  E +SKP+ +
Sbjct  14   LVTLVWAWKMLIWSWLKPKKLERVLREQGLKGNPYRFLVGDMKEYLKMEKEVRSKPLNL  72



>ref|XP_008450754.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=517

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 40/75 (53%), Gaps = 8/75 (11%)
 Frame = +1

Query  163  FPIIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM-  339
            F +  L C WR +NW WL PK LEK LR Q   GN Y L+ GD  ++  M  E KSKPM 
Sbjct  12   FMVCLLRCGWRFLNWIWLTPKKLEKCLREQGFAGNPYRLYSGDLNDVVAMEEEAKSKPMN  71

Query  340  -------KVLASKQH  363
                   +V+ S  H
Sbjct  72   FSHDIVPRVIPSMHH  86



>ref|XP_003525967.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=518

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +1

Query  136  SATCSFFRSFPIIFL-VCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKM  312
             AT   F  F I F+ +   + ++W WL PK  E++LR Q LKGN+YTLF+GD K ++ +
Sbjct  4    DATTMMFVGFCIAFVTILLTKALSWLWLEPKRAERYLRRQGLKGNSYTLFFGDIKAISTL  63

Query  313  INETKSKPMKV  345
            I + KSKP+ +
Sbjct  64   IQKAKSKPIDI  74



>gb|AEI59771.1| cytochrome P450 [Helianthus annuus]
Length=511

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            II  + A+ + NW WL+PK +EK+LR Q LKG++Y  F GD +E+ K+  E KSKP+K+
Sbjct  9    IILALSAFGLFNWLWLKPKRMEKFLRKQGLKGSSYRFFSGDLQEIVKLAVEAKSKPIKL  67



>ref|XP_009356829.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            II    AWRVVNW WLRPK LE++LR Q L GN+Y    GD  E   M+ +  SKPM +
Sbjct  15   IIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLTERTMMLKQAYSKPMNL  73



>gb|KGN55014.1| hypothetical protein Csa_4G622240 [Cucumis sativus]
Length=119

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
             W++V+W W RPK LEK LR Q   GN+Y + +GD KE A M  E  SKPM
Sbjct  28   GWKIVDWIWFRPKKLEKLLRRQGFTGNSYRILHGDLKESAAMRKEAMSKPM  78



>ref|XP_009339365.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=526

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVLASK--Q  360
            AW ++NW W RPK LE++LR Q L GN+Y L +GD KE + M  + +SKPM  L+     
Sbjct  21   AWSLLNWVWFRPKKLERYLRQQGLGGNSYRLLFGDLKESSMMHKQARSKPMNHLSHDIVP  80

Query  361  HFYVLLH  381
            H    LH
Sbjct  81   HILPFLH  87



>ref|XP_009758460.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=525

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
             W+V+NWAW RPK +E  LR + LKGN Y L YGD  EL K + E KSKP+
Sbjct  29   TWKVLNWAWFRPKKMENCLRQRGLKGNPYKLLYGDLNELTKSVIEAKSKPI  79



>ref|XP_010489833.1| PREDICTED: cytochrome P450 72A11-like [Camelina sativa]
Length=105

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
             WR + W W +PK LE +LR Q L G  YTLF GD K    M+ E KSKP+K+
Sbjct  21   VWRTLQWVWFKPKMLESYLRRQGLSGTPYTLFVGDLKRHFSMLTEAKSKPIKL  73



>ref|XP_008367417.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=238

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AW+VVNW WLRPK LE++LR Q + GN+Y    GD KE++    +  SKPM +
Sbjct  20   AWKVVNWLWLRPKKLERYLRQQGIAGNSYXFMSGDMKEISMTTEQAYSKPMSL  72



>ref|XP_009594691.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
tomentosiformis]
Length=419

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMK  342
            II L   WR +NW WL+PK LEK L+    +GN+Y L YGD KE+  M  E KSKP+K
Sbjct  15   IILLRWGWRFMNWLWLQPKCLEKCLKELGFRGNSYKLLYGDMKEVVMMDEEAKSKPIK  72



>gb|AJD25167.1| cytochrome P450 CYP72A326 [Salvia miltiorrhiza]
Length=518

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWR++NWA+LRPK LEK LR Q L GN+Y    GD KE+ K + E  SKP+ +
Sbjct  21   AWRLLNWAYLRPKRLEKILRKQGLNGNSYIPVSGDMKEMVKAMQEANSKPINL  73



>ref|XP_010060773.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67635.1| hypothetical protein EUGRSUZ_F01380 [Eucalyptus grandis]
Length=510

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWRVVNW WLRPK LE +LR Q L G  YT  +GD KE ++++    SKP+ +
Sbjct  21   AWRVVNWTWLRPKRLEGFLRQQGLSGKPYTFLFGDLKEDSRLLRIANSKPIAI  73



>ref|XP_004488669.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=518

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +I LV AW++++W WLRPK LEK LR Q LKGN Y L  GD KE  K   + +SKPM +
Sbjct  14   LIMLVWAWKMLHWLWLRPKKLEKLLREQGLKGNPYRLLVGDMKEFFKSEMKARSKPMNL  72



>gb|ABC59075.1| cytochrome P450 monooxygenase CYP72A67 [Medicago truncatula]
 gb|KEH36885.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=520

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            LV  WRV+NW WL+PK LEK LR Q   GN+Y L  GD K+  KM  + KSKPM++
Sbjct  20   LVYTWRVLNWIWLKPKRLEKLLREQGCNGNSYRLVLGDLKDSYKMGKKAKSKPMEL  75



>ref|XP_009356840.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWRVVNW WLRPK LE++LR Q L GN Y    GD KE++    +  SKPM +
Sbjct  20   AWRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSL  72



>ref|XP_009343587.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  AWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            AWRVVNW WLRPK LE++LR Q L GN Y    GD KE++    +  SKPM +
Sbjct  20   AWRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSL  72



>gb|KEH37983.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=520

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            LV AWRV+NW WL+PK +EK LR Q L+GN Y L  GD K+   M  + +SKPM +
Sbjct  20   LVYAWRVLNWMWLKPKKMEKLLREQGLQGNPYRLLLGDAKDYFVMQKKVQSKPMNL  75



>dbj|BAL45204.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=520

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            LV AWRV+NW WL+PK +EK LR Q L+GN Y L  GD K+   M  + +SKPM +
Sbjct  20   LVYAWRVLNWMWLKPKKMEKLLREQGLQGNPYRLLLGDAKDYFVMQKKVQSKPMNL  75



>ref|XP_004243255.1| PREDICTED: cytochrome P450 CYP72A219 isoform X1 [Solanum lycopersicum]
Length=526

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 41/76 (54%), Gaps = 12/76 (16%)
 Frame = +1

Query  148  SFFRSFPIIF------------LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGD  291
            SF RS  I +            L   W+V+NWAW  PK LE  LR + LKGN Y L YGD
Sbjct  5    SFMRSMEISYNIIITTICVVILLFYTWKVLNWAWFGPKKLENCLRQRGLKGNPYKLLYGD  64

Query  292  TKELAKMINETKSKPM  339
              EL K I E KSKP+
Sbjct  65   LNELTKSIVEAKSKPI  80



>ref|XP_008798317.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP72A219-like 
[Phoenix dactylifera]
Length=527

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            ++F++ AWR + W W RPK LE+ LRGQ L+G+ Y   +GD KE A++  E +SKPM
Sbjct  24   LLFVLRAWRGLEWVWWRPKRLERALRGQGLRGSRYRFLHGDLKETARLNKEARSKPM  80



>gb|KEH37984.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=394

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            LV AWRV+NW WL+PK +EK LR Q L+GN Y L  GD K+   M  + +SKPM +
Sbjct  20   LVYAWRVLNWMWLKPKKMEKLLREQGLQGNPYRLLLGDAKDYFVMQKKVQSKPMNL  75



>gb|EPS65856.1| hypothetical protein M569_08920 [Genlisea aurea]
Length=154

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +1

Query  169  IIFLV--CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKS  330
            ++FLV  C+W+ +N+A+LRP+ LE++LR Q  KGN +   YGDTKE+ ++   +K+
Sbjct  12   LVFLVAFCSWKALNFAYLRPRKLERFLRKQGFKGNRFKFLYGDTKEMRQIFEASKT  67



>ref|XP_009796418.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            IIFL   W+ +NW W++PK +EK L+ +  KG++Y L +GD KE+  M+ E K+KPM
Sbjct  17   IIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKEINTMVEEAKTKPM  73



>gb|ABC69417.1| CYP72A54 [Nicotiana tabacum]
Length=517

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            IIFL   W+ +NW W++PK +EK L+ +  KG++Y L +GD KE+  M+ E K+KPM
Sbjct  17   IIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKEINTMVEEAKTKPM  73



>ref|XP_009394213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            ++FL  A RV+NWAW RP+ LE+ LR Q L G  Y   YGD KE+ ++  E ++KPM
Sbjct  20   LLFLAWALRVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRLRKEARAKPM  76



>ref|XP_009394217.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=538

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            ++FL  A RV+NWAW RP+ LE+ LR Q L G AY   YGD KE A+   E ++KPM
Sbjct  36   LLFLAWALRVLNWAWWRPRWLERALRAQGLNGTAYRFPYGDLKENARFSKEARAKPM  92



>ref|XP_009394211.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=196

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            ++FL  A RV+NWAW RP+ LE+ LR Q L G  Y   YGD KE  ++  E ++KPM +
Sbjct  20   LLFLAWALRVLNWAWWRPRRLERALRAQGLNGTPYGFPYGDVKETVRLREEARAKPMPL  78



>ref|XP_009394212.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPM  339
            ++FL  A RV+NWAW RP+ LE+ LR Q L G  Y   YGD KE+ ++  E ++KPM
Sbjct  20   LLFLAWALRVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRLRKEARAKPM  76



>gb|ABC59077.1| cytochrome P450 monooxygenase CYP72A68 [Medicago truncatula]
 gb|KEH37987.1| cytochrome P450 family 709 protein [Medicago truncatula]
Length=520

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            LV AWRV+NW WL+PK +EK LR Q L+GN Y L  GD K+   M  + +SKPM +
Sbjct  20   LVYAWRVLNWMWLKPKKIEKLLREQGLQGNPYRLLLGDAKDYFVMQKKVQSKPMNL  75



>ref|XP_010694548.1| PREDICTED: cytochrome P450 CYP72A219-like [Beta vulgaris subsp. 
vulgaris]
Length=518

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  169  IIFLVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKVL  348
            ++ L   W V+NW W +PK LE  LR Q  +GN Y L +GDTK+ A+M+ E ++KPM  L
Sbjct  15   VVLLSVLWSVLNWVWWKPKRLEICLRKQGFQGNPYRLLHGDTKDRARMMLEARTKPMPCL  74

Query  349  AS  354
            ++
Sbjct  75   SN  76



>gb|KEH36886.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=383

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  178  LVCAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            LV  WRV+NW WL+PK LEK LR Q   GN+Y L  GD K+  KM  + KSKPM++
Sbjct  20   LVYTWRVLNWIWLKPKRLEKLLREQGCNGNSYRLVLGDLKDSYKMGKKAKSKPMEL  75



>gb|AGX93057.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Cinchona calisaya]
Length=519

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  190  WRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            +RV++W WLRPK LEK LR Q  +GN Y LF GD  E  K+I E  SKP+ V
Sbjct  22   YRVLDWVWLRPKKLEKCLREQGFRGNPYRLFLGDQYESGKLIREAMSKPIPV  73



>gb|KFK38823.1| hypothetical protein AALP_AA3G165300 [Arabis alpina]
Length=512

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  190  WRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKPMKV  345
            WR++ W W +PK LE +LRGQ L G +YTL  GD K  + M+ E +SKP+K+
Sbjct  22   WRILKWVWFKPKMLESYLRGQGLPGTSYTLLVGDVKRNSNMLLEARSKPIKL  73



>ref|XP_006364091.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=510

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +1

Query  160  SFPIIFLV-CAWRVVNWAWLRPKTLEKWLRGQALKGNAYTLFYGDTKELAKMINETKSKP  336
            +F II ++   WR++NW WL+P+ LEK LR    +GN+Y L  GD  E+ KM  E KSKP
Sbjct  9    AFAIILVIFLRWRLLNWLWLQPRPLEKCLRELGFRGNSYRLLVGDMNEVVKMDEEAKSKP  68

Query  337  MK  342
            +K
Sbjct  69   IK  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 523403727248