BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16927_g1_i1 len=1838 path=[2374:0-156 2531:157-169 2544:170-208
2582:209-1785 537:1786-1809 4182:1810-1837]

Length=1838
                                                                      Score     E

ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like          660   0.0      
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    647   0.0      
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    646   0.0      
ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like          645   0.0      
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219               644   0.0      
ref|XP_009615908.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    643   0.0      
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like          643   0.0      
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like               640   0.0      
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      639   0.0      
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    637   0.0      
ref|XP_006348908.1|  PREDICTED: secologanin synthase-like               636   0.0      
ref|XP_006348907.1|  PREDICTED: secologanin synthase-like               635   0.0      
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like          635   0.0      
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like          635   0.0      
ref|XP_004243255.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X1    633   0.0      
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like          632   0.0      
ref|XP_006348303.1|  PREDICTED: secologanin synthase-like               632   0.0      
ref|XP_004243260.1|  PREDICTED: cytochrome P450 CYP72A219               631   0.0      
ref|XP_004243258.1|  PREDICTED: cytochrome P450 CYP72A219-like          630   0.0      
ref|XP_004243256.1|  PREDICTED: cytochrome P450 CYP72A219-like          630   0.0      
ref|XP_004243262.1|  PREDICTED: cytochrome P450 CYP72A219-like          630   0.0      
ref|XP_009758460.1|  PREDICTED: cytochrome P450 CYP72A219-like          630   0.0      
ref|XP_006348304.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    629   0.0      
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like          628   0.0      
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      625   0.0      
ref|XP_006348909.1|  PREDICTED: secologanin synthase-like               625   0.0      
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like          625   0.0      
gb|ABC69419.1|  CYP72A56                                                622   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006348302.1|  PREDICTED: secologanin synthase-like               621   0.0      
ref|XP_004244272.1|  PREDICTED: cytochrome P450 CYP72A219-like          620   0.0      
emb|CDP15976.1|  unnamed protein product                                619   0.0      
gb|ABC69422.1|  CYP72A58                                                619   0.0      Nicotiana tabacum [American tobacco]
dbj|BAL45206.1|  cytochrome P450 monooxygenase                          619   0.0      
ref|XP_009797873.1|  PREDICTED: cytochrome P450 CYP72A219-like          619   0.0      
ref|XP_006348911.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      619   0.0      
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like          613   0.0      
ref|XP_004244273.1|  PREDICTED: cytochrome P450 CYP72A219-like          613   0.0      
gb|ABC69417.1|  CYP72A54                                                612   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like          613   0.0      
gb|ABC69393.1|  CYP72A55v2                                              608   0.0      Nicotiana tabacum [American tobacco]
emb|CDP15978.1|  unnamed protein product                                607   0.0      
ref|XP_004243257.1|  PREDICTED: cytochrome P450 CYP72A219-like          606   0.0      
gb|ABC69392.1|  CYP72A55v1                                              605   0.0      Nicotiana tabacum [American tobacco]
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like          602   0.0      
emb|CDP15988.1|  unnamed protein product                                600   0.0      
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219               600   0.0      Vitis vinifera
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    600   0.0      
sp|H2DH21.1|C7A29_PANGI  RecName: Full=Cytochrome P450 CYP72A219;...    599   0.0      
ref|XP_004244274.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    599   0.0      
gb|KEH38478.1|  cytochrome P450 family 72 protein                       599   0.0      
ref|XP_004307203.1|  PREDICTED: secologanin synthase-like               600   0.0      
ref|XP_006360179.1|  PREDICTED: secologanin synthase-like               598   0.0      
ref|XP_002268319.1|  PREDICTED: cytochrome P450 CYP72A219               598   0.0      Vitis vinifera
emb|CDP15975.1|  unnamed protein product                                597   0.0      
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g             597   0.0      
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               596   0.0      
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like          595   0.0      
gb|KHN44056.1|  Secologanin synthase                                    595   0.0      
emb|CDP19599.1|  unnamed protein product                                594   0.0      
emb|CDP19609.1|  unnamed protein product                                594   0.0      
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like          593   0.0      
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    592   0.0      
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    592   0.0      
ref|XP_002262693.1|  PREDICTED: cytochrome P450 CYP72A219               592   0.0      Vitis vinifera
gb|KEH38475.1|  cytochrome P450 family 72 protein                       592   0.0      
dbj|BAL45198.1|  cytochrome P450 monooxygenase                          592   0.0      
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like          592   0.0      Vitis vinifera
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    592   0.0      
gb|ABC59078.1|  cytochrome P450 monooxygenase CYP72A59                  591   0.0      Medicago truncatula
gb|KHN44057.1|  Secologanin synthase                                    591   0.0      
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like          591   0.0      
ref|XP_008226215.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    591   0.0      
gb|KHN14193.1|  Secologanin synthase                                    590   0.0      
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             590   0.0      
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          590   0.0      
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like          589   0.0      Vitis vinifera
ref|XP_011082965.1|  PREDICTED: cytochrome P450 CYP72A219-like          589   0.0      
ref|XP_008226213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    589   0.0      
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like          589   0.0      
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      589   0.0      
emb|CDP11335.1|  unnamed protein product                                588   0.0      
emb|CDP15983.1|  unnamed protein product                                588   0.0      
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219               588   0.0      Vitis vinifera
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like          588   0.0      
gb|KHN47456.1|  Secologanin synthase                                    588   0.0      
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      588   0.0      
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like               587   0.0      
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like               587   0.0      
emb|CBI22134.3|  unnamed protein product                                587   0.0      
emb|CDP15973.1|  unnamed protein product                                586   0.0      
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             586   0.0      
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like          586   0.0      Vitis vinifera
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like          585   0.0      
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          585   0.0      
emb|CDP19600.1|  unnamed protein product                                584   0.0      
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             584   0.0      
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    586   0.0      
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59             583   0.0      
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          582   0.0      
gb|AAZ07706.1|  cytochrome P450 monooxygenase                           582   0.0      Sesamum indicum [beniseed]
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    582   0.0      
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          582   0.0      
ref|XP_010092742.1|  Secologanin synthase                               581   0.0      
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like          580   0.0      
gb|KHN36820.1|  Secologanin synthase                                    579   0.0      
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like               580   0.0      
ref|XP_009339350.1|  PREDICTED: cytochrome P450 CYP72A219-like          579   0.0      
ref|XP_004294187.1|  PREDICTED: secologanin synthase-like               579   0.0      
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             579   0.0      
emb|CDP19601.1|  unnamed protein product                                578   0.0      
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             577   0.0      
gb|EYU31636.1|  hypothetical protein MIMGU_mgv1a004595mg                577   0.0      
ref|XP_004146075.1|  PREDICTED: secologanin synthase-like               578   0.0      
emb|CDP15981.1|  unnamed protein product                                577   0.0      
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    577   0.0      
ref|XP_008226214.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    577   0.0      
ref|XP_006364091.1|  PREDICTED: secologanin synthase-like               576   0.0      
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like          576   0.0      
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    577   0.0      
ref|XP_002263609.1|  PREDICTED: cytochrome P450 CYP72A219               575   0.0      Vitis vinifera
ref|XP_007212438.1|  hypothetical protein PRUPE_ppa016770mg             575   0.0      
gb|EYU31635.1|  hypothetical protein MIMGU_mgv1a025572mg                575   0.0      
emb|CDP15982.1|  unnamed protein product                                575   0.0      
ref|XP_008226211.1|  PREDICTED: cytochrome P450 CYP72A219-like          575   0.0      
emb|CBI39886.3|  unnamed protein product                                576   0.0      
ref|XP_011082966.1|  PREDICTED: cytochrome P450 CYP72A219-like          574   0.0      
gb|AGX93057.1|  7-deoxyloganic acid 7-hydroxylase-like protein          573   0.0      
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like          574   0.0      
ref|XP_006343585.1|  PREDICTED: secologanin synthase-like               573   0.0      
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               573   0.0      
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...    573   0.0      
ref|XP_004488669.1|  PREDICTED: secologanin synthase-like               572   0.0      
ref|XP_002263652.1|  PREDICTED: cytochrome P450 CYP72A219-like          572   0.0      Vitis vinifera
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    572   0.0      
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like               571   0.0      
ref|XP_004248201.1|  PREDICTED: cytochrome P450 CYP72A219-like          569   0.0      
ref|XP_004295683.1|  PREDICTED: secologanin synthase-like               570   0.0      
ref|XP_004242635.1|  PREDICTED: cytochrome P450 CYP72A219-like          568   0.0      
gb|KEH38469.1|  cytochrome P450 family 709 protein                      568   0.0      
ref|XP_008226210.1|  PREDICTED: cytochrome P450 CYP72A219-like          568   0.0      
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219               568   0.0      
gb|EYU30744.1|  hypothetical protein MIMGU_mgv1a004594mg                568   0.0      
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like               568   0.0      
gb|KHG14489.1|  Secologanin synthase                                    567   0.0      
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like               567   0.0      
gb|EYU31630.1|  hypothetical protein MIMGU_mgv1a004628mg                566   0.0      
ref|XP_007213922.1|  hypothetical protein PRUPE_ppa004271mg             566   0.0      
ref|XP_006364092.1|  PREDICTED: secologanin synthase-like               565   0.0      
ref|XP_004168302.1|  PREDICTED: secologanin synthase-like               565   0.0      
gb|ABC69389.1|  CYP72A52v1                                              565   0.0      Nicotiana tabacum [American tobacco]
ref|XP_004295684.1|  PREDICTED: secologanin synthase-like               565   0.0      
ref|XP_009790240.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    565   0.0      
ref|XP_009594690.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    565   0.0      
ref|XP_006348902.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    561   0.0      
emb|CAN67740.1|  hypothetical protein VITISV_015554                     565   0.0      Vitis vinifera
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like               564   0.0      
ref|XP_009628921.1|  PREDICTED: cytochrome P450 CYP72A219-like          564   0.0      
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          563   0.0      
ref|XP_003543172.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      563   0.0      
ref|XP_009343589.1|  PREDICTED: cytochrome P450 CYP72A219-like          563   0.0      
ref|XP_004248200.1|  PREDICTED: cytochrome P450 CYP72A219-like          563   0.0      
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like          563   0.0      
emb|CDP15985.1|  unnamed protein product                                563   0.0      
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    563   0.0      
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              561   0.0      
gb|KEH37983.1|  cytochrome P450 family 72 protein                       561   0.0      
gb|AGX93058.1|  7-deoxyloganic acid 7-hydroxylase-like protein          561   0.0      
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g             561   0.0      
gb|AHK60841.1|  CYP72A225                                               561   0.0      
dbj|BAL45204.1|  cytochrome P450 monooxygenase                          560   0.0      
ref|XP_004244382.2|  PREDICTED: cytochrome P450 CYP72A219-like          560   0.0      
ref|XP_009790251.1|  PREDICTED: cytochrome P450 CYP72A219-like          560   0.0      
ref|XP_003525967.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      560   0.0      
ref|XP_006349622.1|  PREDICTED: secologanin synthase-like               560   0.0      
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     559   0.0      
ref|XP_009790250.1|  PREDICTED: cytochrome P450 CYP72A219-like          559   0.0      
gb|ABC59077.1|  cytochrome P450 monooxygenase CYP72A68                  560   0.0      Medicago truncatula
gb|ABC69390.1|  CYP72A53v1                                              559   0.0      Nicotiana tabacum [American tobacco]
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like          559   0.0      
ref|XP_009343590.1|  PREDICTED: cytochrome P450 CYP72A219-like          558   0.0      
ref|XP_009146335.1|  PREDICTED: cytochrome P450 72A15-like              558   0.0      
ref|XP_004248734.1|  PREDICTED: cytochrome P450 CYP72A219               558   0.0      
ref|XP_008226217.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    558   0.0      
gb|KHG18227.1|  Secologanin synthase                                    557   0.0      
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    556   0.0      
ref|XP_008226216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    557   0.0      
ref|XP_004488665.1|  PREDICTED: secologanin synthase-like               557   0.0      
gb|AGX93061.1|  7-deoxyloganic acid 7-hydroxylase-like protein          556   0.0      
gb|AIA82924.1|  SLS1                                                    556   0.0      
ref|XP_008366858.1|  PREDICTED: cytochrome P450 CYP72A219-like          556   0.0      
ref|XP_010323670.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X2    553   0.0      
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like              555   0.0      
ref|XP_009356829.1|  PREDICTED: cytochrome P450 CYP72A219-like          555   0.0      
ref|XP_008219294.1|  PREDICTED: cytochrome P450 CYP72A219-like          555   0.0      
ref|NP_188079.1|  cytochrome P450, family 72, subfamily A, polype...    555   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    556   0.0      
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...    555   0.0      
emb|CDP15980.1|  unnamed protein product                                555   0.0      
gb|EYU38228.1|  hypothetical protein MIMGU_mgv1a004669mg                554   0.0      
ref|XP_006364094.1|  PREDICTED: secologanin synthase-like               554   0.0      
ref|XP_008386157.1|  PREDICTED: cytochrome P450 CYP72A219-like          554   0.0      
ref|XP_011098148.1|  PREDICTED: cytochrome P450 CYP72A219-like          554   0.0      
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          554   0.0      
gb|AGX93059.1|  7-deoxyloganic acid 7-hydroxylase-like protein          553   0.0      
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          553   0.0      
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              553   0.0      
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              553   0.0      
dbj|BAL45203.1|  cytochrome P450 monooxygenase                          553   0.0      
emb|CDX97592.1|  BnaA05g24870D                                          552   0.0      
ref|XP_010092744.1|  Secologanin synthase                               554   0.0      
ref|XP_008443405.1|  PREDICTED: cytochrome P450 CYP72A219-like          553   0.0      
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          552   0.0      
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg             551   0.0      
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...    551   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...    551   0.0      
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    551   0.0      
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like              550   0.0      
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              550   0.0      
ref|XP_007227257.1|  hypothetical protein PRUPE_ppa017915mg             550   0.0      
gb|AGX93060.1|  7-deoxyloganic acid 7-hydroxylase-like protein          550   0.0      
emb|CDX97591.1|  BnaA05g24880D                                          549   0.0      
ref|XP_002882888.1|  CYP72A15                                           550   0.0      
ref|XP_010502032.1|  PREDICTED: cytochrome P450 72A13-like isofor...    549   0.0      
ref|XP_011098149.1|  PREDICTED: cytochrome P450 CYP72A219-like          549   0.0      
gb|AJD25171.1|  cytochrome P450 CYP72A330                               549   0.0      
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like              549   0.0      
gb|AGX93062.1|  CYP72A224 7-deoxyloganic acid 7-hydroxylase             549   0.0      
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    549   0.0      
ref|XP_011083293.1|  PREDICTED: cytochrome P450 CYP72A219-like          548   0.0      
gb|ABC59075.1|  cytochrome P450 monooxygenase CYP72A67                  548   0.0      Medicago truncatula
gb|ADU19849.1|  putative secologanin synthase                           548   0.0      
ref|XP_004151308.1|  PREDICTED: secologanin synthase-like               548   0.0      
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                   548   0.0      
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like              548   0.0      
ref|XP_010487267.1|  PREDICTED: cytochrome P450 72A15-like              549   0.0      
ref|XP_010465353.1|  PREDICTED: cytochrome P450 72A13-like              547   0.0      
ref|XP_010535012.1|  PREDICTED: cytochrome P450 72A13-like              547   0.0      
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          548   0.0      
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                    547   0.0      
ref|XP_011082818.1|  PREDICTED: cytochrome P450 CYP72A219-like          547   0.0      
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...    547   0.0      
dbj|BAF98466.1|  cytochrome P450                                        547   0.0      Coptis japonica var. dissecta
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          547   0.0      
ref|XP_007224159.1|  hypothetical protein PRUPE_ppa016446mg             546   0.0      
ref|XP_008219216.1|  PREDICTED: cytochrome P450 CYP72A219-like          546   0.0      
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              546   0.0      
gb|AJD25169.1|  cytochrome P450 CYP72A328                               546   0.0      
emb|CDX98485.1|  BnaC05g38900D                                          546   0.0      
ref|XP_011098146.1|  PREDICTED: cytochrome P450 CYP72A219-like          545   0.0      
gb|AJD25170.1|  cytochrome P450 CYP72A329                               545   0.0      
ref|XP_010465352.1|  PREDICTED: cytochrome P450 72A13-like              545   0.0      
ref|XP_006299550.1|  hypothetical protein CARUB_v10015724mg             545   0.0      
ref|XP_010324391.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    543   0.0      
ref|XP_010502007.1|  PREDICTED: cytochrome P450 72A15-like              545   0.0      
ref|XP_004300362.1|  PREDICTED: secologanin synthase-like               545   0.0      
ref|XP_010465361.1|  PREDICTED: cytochrome P450 72A13-like              544   0.0      
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like              544   0.0      
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    544   0.0      
ref|XP_007022099.1|  Cytochrome P450, family 72, subfamily A, pol...    543   0.0      
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              544   0.0      
ref|XP_009116708.1|  PREDICTED: cytochrome P450 72A15-like isofor...    543   0.0      
gb|EYU30753.1|  hypothetical protein MIMGU_mgv1a004802mg                543   0.0      
ref|XP_010552154.1|  PREDICTED: cytochrome P450 72A15-like              544   0.0      
ref|XP_010542332.1|  PREDICTED: cytochrome P450 72A13-like              543   0.0      
gb|EPS69403.1|  hypothetical protein M569_05363                         543   0.0      
emb|CDX98486.1|  BnaC05g38890D                                          543   0.0      
emb|CDX98484.1|  BnaC05g38910D                                          542   0.0      
ref|XP_009394810.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    543   0.0      
gb|KEH38476.1|  cytochrome P450 family 72 protein                       541   0.0      
emb|CDP15979.1|  unnamed protein product                                542   0.0      
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    542   0.0      
ref|NP_188084.1|  cytochrome P450, family 72, subfamily A, polype...    542   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY20075.1|  BnaA01g29270D                                          541   0.0      
ref|XP_008443404.1|  PREDICTED: cytochrome P450 CYP72A219-like          541   0.0      
ref|XP_009781171.1|  PREDICTED: cytochrome P450 CYP72A219-like          539   0.0      
gb|KHN47459.1|  Secologanin synthase                                    541   0.0      
ref|XP_004294189.1|  PREDICTED: secologanin synthase-like               541   0.0      
emb|CBI39937.3|  unnamed protein product                                539   0.0      
ref|XP_003543170.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase           541   0.0      
ref|XP_010501993.1|  PREDICTED: cytochrome P450 72A13-like              540   0.0      
gb|KCW67648.1|  hypothetical protein EUGRSUZ_F01396                     540   0.0      
emb|CDX82468.1|  BnaA03g33530D                                          541   0.0      
ref|XP_010487262.1|  PREDICTED: cytochrome P450 72A13-like              540   0.0      
ref|XP_004488695.1|  PREDICTED: secologanin synthase-like               540   0.0      
emb|CDX97593.1|  BnaA05g24860D                                          540   0.0      
emb|CDX97588.1|  BnaA05g24910D                                          540   0.0      
gb|AJD25168.1|  cytochrome P450 CYP72A327                               540   0.0      
ref|XP_010465360.1|  PREDICTED: cytochrome P450 72A15                   539   0.0      
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like          539   0.0      
ref|XP_006297414.1|  hypothetical protein CARUB_v10013438mg             539   0.0      
ref|XP_009339365.1|  PREDICTED: cytochrome P450 CYP72A219-like          539   0.0      
emb|CDY20078.1|  BnaA01g29240D                                          538   0.0      
ref|XP_009339348.1|  PREDICTED: cytochrome P450 CYP72A219-like          538   0.0      
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              538   0.0      
emb|CDX82471.1|  BnaA03g33500D                                          538   0.0      
ref|XP_009394809.1|  PREDICTED: cytochrome P450 72A13-like              538   0.0      
ref|XP_010535013.1|  PREDICTED: cytochrome P450 72A13-like              537   0.0      
gb|KFK38821.1|  hypothetical protein AALP_AA3G164800                    537   0.0      
ref|NP_188083.1|  cytochrome P450, family 72, subfamily A, polype...    536   0.0      
ref|XP_009135394.1|  PREDICTED: cytochrome P450 72A15-like              536   0.0      
gb|EPS70870.1|  hypothetical protein M569_03891                         537   0.0      
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein          536   0.0      
ref|XP_010465366.1|  PREDICTED: cytochrome P450 72A13-like              536   0.0      
ref|XP_009116688.1|  PREDICTED: cytochrome P450 72A15-like              536   0.0      
ref|XP_010487266.1|  PREDICTED: cytochrome P450 72A13-like              536   0.0      
emb|CDY51038.1|  BnaA06g03010D                                          536   0.0      
emb|CBI39923.3|  unnamed protein product                                533   0.0      
ref|XP_009146340.1|  PREDICTED: cytochrome P450 72A13                   537   0.0      
emb|CDY32348.1|  BnaC01g36670D                                          535   0.0      
emb|CDY32349.1|  BnaC01g36680D                                          535   0.0      
ref|XP_008778221.1|  PREDICTED: cytochrome P450 72A15-like              536   0.0      
ref|XP_007212563.1|  hypothetical protein PRUPE_ppa015526mg             535   0.0      
gb|AJD25167.1|  cytochrome P450 CYP72A326                               535   0.0      
ref|XP_008226302.1|  PREDICTED: cytochrome P450 CYP72A219-like          535   0.0      
gb|KEH38470.1|  cytochrome P450 family monooxygenase                    535   0.0      
gb|KHN44046.1|  Secologanin synthase                                    535   0.0      
ref|XP_010465357.1|  PREDICTED: cytochrome P450 72A13-like              535   0.0      
ref|XP_006364093.1|  PREDICTED: secologanin synthase-like               536   0.0      
ref|XP_010502020.1|  PREDICTED: cytochrome P450 72A13 isoform X2        535   0.0      
ref|XP_006598147.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      535   0.0      
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like              534   0.0      
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    534   0.0      
ref|XP_004146006.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    533   1e-180   
gb|AEI59772.1|  cytochrome P450                                         533   2e-180   
ref|XP_010683652.1|  PREDICTED: cytochrome P450 CYP72A219-like          532   2e-180   
gb|AGX93046.1|  secologanin synthase-like protein                       533   4e-180   
ref|XP_002458199.1|  hypothetical protein SORBIDRAFT_03g028600          533   4e-180   
gb|AAM77716.1|AF465265_1  cytochrome P450 monooxygenase CYP72A16        533   4e-180   
ref|XP_010465355.1|  PREDICTED: cytochrome P450 72A15-like              532   5e-180   
emb|CBI39916.3|  unnamed protein product                                531   7e-180   
ref|XP_010535014.1|  PREDICTED: cytochrome P450 72A13-like              531   8e-180   
gb|KFK38819.1|  hypothetical protein AALP_AA3G164600                    531   1e-179   
ref|XP_010694548.1|  PREDICTED: cytochrome P450 CYP72A219-like          531   1e-179   
ref|XP_008386384.1|  PREDICTED: cytochrome P450 CYP72A219-like          530   2e-179   
emb|CDY51036.1|  BnaA06g02990D                                          530   2e-179   
ref|NP_001170729.1|  uncharacterized protein LOC100384816 precursor     531   2e-179   
emb|CBI39917.3|  unnamed protein product                                528   2e-179   
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              530   2e-179   
emb|CDY28093.1|  BnaC06g02740D                                          530   4e-179   
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    530   4e-179   
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          529   8e-179   
emb|CBI39929.3|  unnamed protein product                                526   1e-178   
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          529   1e-178   
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like              529   1e-178   
ref|XP_006407058.1|  hypothetical protein EUTSA_v10021993mg             528   1e-178   
ref|XP_010465358.1|  PREDICTED: cytochrome P450 72A13-like isofor...    528   1e-178   
ref|XP_010694547.1|  PREDICTED: cytochrome P450 72A15-like              529   1e-178   
ref|XP_010502013.1|  PREDICTED: cytochrome P450 72A13 isoform X1        528   2e-178   
gb|AJD25172.1|  cytochrome P450 CYP72A331                               528   2e-178   
ref|XP_004969231.1|  PREDICTED: secologanin synthase-like               527   4e-178   
dbj|BAP90521.1|  secologanin synthase                                   527   5e-178   
ref|XP_003569397.1|  PREDICTED: cytochrome P450 72A15-like              527   6e-178   
gb|KEH38471.1|  cytochrome P450 family monooxygenase                    527   6e-178   
ref|XP_010275158.1|  PREDICTED: cytochrome P450 CYP72A219-like          527   6e-178   
ref|XP_010926800.1|  PREDICTED: cytochrome P450 72A15-like isofor...    526   7e-178   
ref|XP_010064522.1|  PREDICTED: cytochrome P450 72A15-like              526   9e-178   
ref|XP_002455991.1|  hypothetical protein SORBIDRAFT_03g028590          526   1e-177   
ref|XP_010241317.1|  PREDICTED: cytochrome P450 CYP72A219-like          526   1e-177   
gb|AEI59770.1|  cytochrome P450                                         526   1e-177   
emb|CAN72865.1|  hypothetical protein VITISV_029731                     525   2e-177   
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          526   2e-177   
ref|XP_007149357.1|  hypothetical protein PHAVU_005G063500g             525   2e-177   
gb|AFW83341.1|  putative cytochrome P450 superfamily protein            526   2e-177   
emb|CDP06076.1|  unnamed protein product                                524   5e-177   
ref|XP_010275244.1|  PREDICTED: cytochrome P450 CYP72A219-like          524   5e-177   
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    525   5e-177   
ref|XP_003531823.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    525   6e-177   
ref|NP_188086.1|  cytochrome P450, family 72, subfamily A, polype...    523   9e-177   
ref|XP_006348305.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    520   9e-177   
ref|XP_009116734.1|  PREDICTED: cytochrome P450 72A13-like isofor...    523   1e-176   
gb|AAL38603.1|AF446870_1  AT3g14620/MIE1_12                             523   1e-176   
ref|XP_009116727.1|  PREDICTED: cytochrome P450 72A13-like isofor...    523   1e-176   
dbj|BAL45208.1|  cytochrome P450 monooxygenase                          523   1e-176   
gb|AAA17732.1|  cytochrome P450                                         523   2e-176   
gb|AGX93044.1|  secologanin synthase-like protein                       523   3e-176   
ref|XP_009790241.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    520   3e-176   
ref|NP_188080.1|  cytochrome P450, family 72, subfamily A, polype...    522   3e-176   
gb|AGX93049.1|  secologanin synthase-like protein                       522   4e-176   
ref|XP_010683653.1|  PREDICTED: cytochrome P450 CYP72A219-like          520   5e-176   
emb|CBI39938.3|  unnamed protein product                                520   5e-176   
ref|XP_006442316.1|  hypothetical protein CICLE_v10024206mg             521   7e-176   
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like              521   8e-176   
sp|Q05047.1|C72A1_CATRO  RecName: Full=Secologanin synthase; Shor...    521   9e-176   
ref|XP_010926808.1|  PREDICTED: cytochrome P450 72A15-like isofor...    521   1e-175   
gb|KFK38818.1|  hypothetical protein AALP_AA3G164500                    521   1e-175   
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like          521   1e-175   
gb|AFK42047.1|  unknown                                                 521   1e-175   
ref|XP_006646125.1|  PREDICTED: secologanin synthase-like               520   2e-175   
ref|XP_004301212.1|  PREDICTED: secologanin synthase-like               520   2e-175   
ref|XP_007131275.1|  hypothetical protein PHAVU_011G000200g             521   2e-175   
ref|XP_006477887.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      520   2e-175   
ref|XP_006377676.1|  hypothetical protein POPTR_0011s10150g             519   3e-175   
ref|XP_004969230.1|  PREDICTED: secologanin synthase-like               520   3e-175   
ref|XP_010926817.1|  PREDICTED: cytochrome P450 72A15-like isofor...    520   4e-175   
ref|XP_009339373.1|  PREDICTED: cytochrome P450 CYP72A219-like          519   4e-175   
gb|AAK38094.1|  putative cytochrome P450                                520   4e-175   
gb|AGX93047.1|  secologanin synthase-like protein                       519   6e-175   
ref|XP_010487268.1|  PREDICTED: cytochrome P450 72A13-like              519   8e-175   
ref|XP_010644766.1|  PREDICTED: cytochrome P450 CYP72A219-like          516   8e-175   
ref|XP_003605470.1|  Cytochrome P450 monooxygenase CYP72A61             519   1e-174   
gb|AGX93064.1|  secologanin synthase                                    518   2e-174   
emb|CBI22133.3|  unnamed protein product                                522   2e-174   
emb|CDY32351.1|  BnaC01g36700D                                          517   2e-174   
ref|NP_001043632.1|  Os01g0627500                                       518   2e-174   
gb|AGX93045.1|  secologanin synthase-like protein                       518   3e-174   
dbj|BAL45199.1|  cytochrome P450 monooxygenase                          518   3e-174   
ref|XP_006300449.1|  hypothetical protein CARUB_v10020157mg             517   3e-174   
ref|XP_002882887.1|  CYP72A7                                            517   4e-174   
ref|XP_010242111.1|  PREDICTED: cytochrome P450 CYP72A219-like          516   4e-174   
gb|AAA17746.1|  cytochrome P450                                         516   6e-174   
emb|CDP15974.1|  unnamed protein product                                514   6e-174   
gb|AAK38093.1|  putative cytochrome P450                                516   8e-174   
ref|XP_010678727.1|  PREDICTED: cytochrome P450 CYP72A219-like          516   8e-174   
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like               516   8e-174   
ref|XP_006477888.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      516   1e-173   
ref|XP_006407061.1|  hypothetical protein EUTSA_v10020533mg             516   1e-173   
gb|EMT23021.1|  Secologanin synthase                                    516   1e-173   
gb|AGX93048.1|  secologanin synthase-like protein                       516   1e-173   
ref|XP_009116716.1|  PREDICTED: cytochrome P450 72A15-like isofor...    514   2e-173   
ref|NP_188082.1|  cytochrome P450, family 72, subfamily A, polype...    515   3e-173   
ref|XP_006442317.1|  hypothetical protein CICLE_v10023602mg             514   3e-173   
ref|NP_001044129.1|  Os01g0728300                                       514   3e-173   
gb|AAK38090.1|  putative cytochrome P450                                514   4e-173   
emb|CDP14360.1|  unnamed protein product                                510   5e-173   
gb|EAY75694.1|  hypothetical protein OsI_03601                          514   5e-173   
gb|AAK38092.1|  putative cytochrome P450                                514   1e-172   
ref|XP_002458200.1|  hypothetical protein SORBIDRAFT_03g028610          513   1e-172   
ref|XP_004294188.1|  PREDICTED: secologanin synthase-like               513   1e-172   
ref|XP_010676733.1|  PREDICTED: cytochrome P450 CYP72A219-like          513   2e-172   
ref|XP_010470433.1|  PREDICTED: cytochrome P450 72A13-like              511   5e-172   
gb|EPS61172.1|  hypothetical protein M569_13627                         511   7e-172   
ref|XP_006407056.1|  hypothetical protein EUTSA_v10022214mg             511   8e-172   
sp|H1A988.1|C7254_GLYUR  RecName: Full=11-oxo-beta-amyrin 30-oxid...    511   1e-171   
ref|XP_004969229.1|  PREDICTED: secologanin synthase-like               511   2e-171   
ref|XP_006299368.1|  hypothetical protein CARUB_v10015526mg             510   2e-171   
ref|NP_001140686.1|  putative cytochrome P450 superfamily protein       510   2e-171   
ref|XP_004969235.1|  PREDICTED: secologanin synthase-like               510   3e-171   
ref|XP_010926871.1|  PREDICTED: cytochrome P450 72A15-like isofor...    509   4e-171   
emb|CDY20076.1|  BnaA01g29260D                                          508   5e-171   
gb|AAK38091.1|  putative cytochrome P450                                509   6e-171   
ref|XP_009146337.1|  PREDICTED: cytochrome P450 72A13                   508   7e-171   
gb|ABC68405.1|  cytochrome P450 monooxygenase CYP72A68                  506   8e-171   
gb|EYU26263.1|  hypothetical protein MIMGU_mgv1a019274mg                508   1e-170   
ref|NP_188081.1|  cytochrome P450, family 72, subfamily A, polype...    508   1e-170   
emb|CDP06075.1|  unnamed protein product                                512   1e-170   
gb|EYU26272.1|  hypothetical protein MIMGU_mgv1a018891mg                508   1e-170   
ref|XP_006495017.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    507   4e-170   
ref|XP_003569406.1|  PREDICTED: cytochrome P450 72A14-like              506   1e-169   
emb|CDX97590.1|  BnaA05g24890D                                          505   1e-169   
emb|CDP19608.1|  unnamed protein product                                503   1e-169   
ref|XP_008364401.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    501   2e-169   
gb|EPS61578.1|  hypothetical protein M569_13218                         504   2e-169   
gb|EYU26273.1|  hypothetical protein MIMGU_mgv1a004412mg                505   3e-169   
ref|XP_009146336.1|  PREDICTED: cytochrome P450 72A15                   504   3e-169   
dbj|BAL45205.1|  cytochrome P450 monooxygenase                          504   4e-169   
ref|XP_006495010.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      504   4e-169   
emb|CDX97589.1|  BnaA05g24900D                                          504   4e-169   
emb|CDX98481.1|  BnaC05g38940D                                          534   5e-169   
ref|XP_006495016.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    504   6e-169   
ref|XP_009394609.1|  PREDICTED: cytochrome P450 72A15-like              503   8e-169   
ref|XP_010065484.1|  PREDICTED: cytochrome P450 CYP72A219-like          503   1e-168   
ref|XP_006477952.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      502   2e-168   
dbj|BAL45201.1|  cytochrome P450 monooxygenase                          502   3e-168   
gb|EYU26274.1|  hypothetical protein MIMGU_mgv1a004552mg                502   3e-168   
ref|XP_010676734.1|  PREDICTED: cytochrome P450 CYP72A219-like          502   4e-168   
ref|XP_006477950.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    497   7e-168   
ref|XP_006442298.1|  hypothetical protein CICLE_v10019876mg             500   7e-168   
ref|XP_010065483.1|  PREDICTED: cytochrome P450 CYP72A219-like          501   8e-168   
ref|XP_006644655.1|  PREDICTED: secologanin synthase-like               501   9e-168   
ref|XP_010676732.1|  PREDICTED: cytochrome P450 CYP72A219-like          500   1e-167   
ref|XP_010501999.1|  PREDICTED: cytochrome P450 72A13-like              499   2e-167   
dbj|BAN19927.1|  cytochrome P450                                        499   4e-167   
ref|XP_010065487.1|  PREDICTED: cytochrome P450 CYP72A219-like          499   5e-167   
emb|CDY65331.1|  BnaC03g73770D                                          496   6e-167   
ref|XP_009135391.1|  PREDICTED: cytochrome P450 72A15-like              498   7e-167   
dbj|BAJ98958.1|  predicted protein                                      499   7e-167   
ref|XP_006299313.1|  hypothetical protein CARUB_v10015468mg             498   7e-167   
ref|XP_003628063.1|  Cytochrome P450 monooxygenase CYP72A65             498   1e-166   
gb|EPS65653.1|  hypothetical protein M569_09124                         498   1e-166   
gb|EYU26264.1|  hypothetical protein MIMGU_mgv1a004586mg                498   1e-166   
ref|XP_003566917.1|  PREDICTED: cytochrome P450 72A15-like              498   2e-166   
ref|XP_003569398.1|  PREDICTED: cytochrome P450 72A15-like              498   2e-166   
gb|EYU26282.1|  hypothetical protein MIMGU_mgv1a026663mg                498   2e-166   
gb|AEI59771.1|  cytochrome P450                                         497   2e-166   
dbj|BAN19913.1|  cytochrome P450                                        498   2e-166   
emb|CDX75784.1|  BnaC03g38670D                                          497   2e-166   
ref|XP_004969232.1|  PREDICTED: secologanin synthase-like               498   2e-166   
ref|XP_010465356.1|  PREDICTED: cytochrome P450 72A13-like              497   2e-166   
gb|KHN44060.1|  Secologanin synthase                                    495   3e-166   
gb|EEE55021.1|  hypothetical protein OsJ_02678                          498   3e-166   
ref|NP_001043631.1|  Os01g0627400                                       498   4e-166   
ref|XP_006646124.1|  PREDICTED: secologanin synthase-like               497   4e-166   
ref|XP_010552411.1|  PREDICTED: cytochrome P450 72A13-like              496   4e-166   
ref|XP_010667328.1|  PREDICTED: cytochrome P450 CYP72A219-like          496   8e-166   
ref|XP_008776863.1|  PREDICTED: cytochrome P450 72A15-like isofor...    496   8e-166   
ref|XP_010667280.1|  PREDICTED: cytochrome P450 CYP72A219-like          495   9e-166   
ref|XP_008784485.1|  PREDICTED: cytochrome P450 CYP72A219-like          495   2e-165   
ref|XP_002455992.1|  hypothetical protein SORBIDRAFT_03g028630          495   2e-165   
ref|XP_006598138.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    491   2e-165   
ref|XP_006348982.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      506   3e-165   



>ref|XP_009617254.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/503 (61%), Positives = 393/503 (78%), Gaps = 1/503 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             I  +VC WRV+NW W RPK LEK LR Q LKGN YR+ YGD KE++ M+ E  SKPMN L
Sbjct  17    ITLVVCIWRVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKELSGMIKEANSKPMN-L  75

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             SD++ PR++P+F ++I+K+GK SFVWLG  P+V + DP+ +KEV SK+  +Q+  ++P+ 
Sbjct  76    SDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFVMDPELIKEVFSKNYLYQKPHSNPLT  135

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L+QGL+  E DKW+KHRKI  PAF LEKLKHM+PA    C+EM+ +WE+IV+   S E
Sbjct  136   KLLAQGLVSQEEDKWAKHRKIVTPAFHLEKLKHMLPAFCLSCTEMLSKWEDIVAVEGSHE  195

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             +D+WP L+ +  +VIS TAFG SYE GRR+FELQ E A+   E   SVYIPG RFLPTK+
Sbjct  196   IDIWPGLQQLTSDVISRTAFGSSYEAGRRIFELQKEQAQFLMEAIRSVYIPGWRFLPTKR  255

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSI  1064
             NRRM  I+K++  +++ II+KR+ +MK GE  + +LL +LLESNFKE++ HGN++FGMSI
Sbjct  256   NRRMKEIEKDVQALVRGIIDKRVKSMKAGEVNNEDLLGILLESNFKEIEQHGNKDFGMSI  315

Query  1065  EDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRL  1244
             E++I ECKLFY AGQETTS LLVWT+ILLSR+Q+WQ LAREEV+ VFG+ KPDFDGLNRL
Sbjct  316   EEVIQECKLFYFAGQETTSVLLVWTLILLSRHQDWQALAREEVLQVFGNQKPDFDGLNRL  375

Query  1245  KIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDAN  1424
             KIVTMIL ESLRLYPPV TL R  KED  LG++SLPAGV + +P+I LHHD E+WG+DA 
Sbjct  376   KIVTMILYESLRLYPPVVTLTRRPKEDTVLGDVSLPAGVLISLPVILLHHDEEIWGKDAK  435

Query  1425  EFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSY  1604
             +F PERFR+GVS AT G+  + PF+ GPRICIG NFAM+EAKT L+ IL+RFSF+LSPSY
Sbjct  436   KFKPERFRDGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKTTLAMILQRFSFELSPSY  495

Query  1605  AHAPYTGLTTNPLYGAPLILQKL  1673
             AHAP + +T  P YGAPLIL K+
Sbjct  496   AHAPQSIITLQPQYGAPLILHKI  518



>ref|XP_009789309.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/503 (61%), Positives = 389/503 (77%), Gaps = 3/503 (1%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             I  +VC WRV+NW W RPK LEK  R Q LKGN YR+ YGD KE++ M+ E  SKPMN L
Sbjct  17    ITLMVCIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSGMIEEANSKPMN-L  75

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             SD++ PR++P+F ++I+K+GK SFVWLG  P+V I DP+ +KEV SK+  +++  ++P+ 
Sbjct  76    SDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFSKNYLYEKPHSNPLT  135

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L+QGL+  EGDKW+KHRKI  PAF LEKLKHM+PA    C+EM+ +WE+IV+   S E
Sbjct  136   KLLAQGLVSQEGDKWAKHRKIITPAFHLEKLKHMLPAFCLSCTEMLSKWEDIVAVEGSHE  195

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             +D+WP L+ ++ +VIS TAFG SYE GRR+FELQ E A+H  +   S+YIPG RFLPTK+
Sbjct  196   IDIWPGLQQLSSDVISRTAFGSSYEEGRRIFELQKEQAQHFMKAIRSIYIPGWRFLPTKR  255

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSI  1064
             NRRM  I+K++   +  II+KR  AMK GE  + +LL +LLESNFKE++ HGN++FGMSI
Sbjct  256   NRRMKEIEKDVQASITGIIDKR--AMKAGEVNNEDLLGILLESNFKEIEQHGNKDFGMSI  313

Query  1065  EDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRL  1244
             E++I ECKLFY AGQETTS LLVWT+ILLSR+Q+WQ  AREEV+ VFG  KPDFDGLNRL
Sbjct  314   EEVIEECKLFYFAGQETTSVLLVWTLILLSRHQDWQAQAREEVLQVFGSQKPDFDGLNRL  373

Query  1245  KIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDAN  1424
             KIV  +L ESLRLYPPV +L R  KED  LG++SLPAGV + +P+I LHHD E+WG+DA 
Sbjct  374   KIVRELLYESLRLYPPVVSLTRRPKEDTVLGDVSLPAGVLISLPVILLHHDEEIWGKDAK  433

Query  1425  EFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSY  1604
             +F PERFR+GVS A  G+  Y PF+ GPRICIGLNFAM+EAKTAL+ IL+RFSF+LSPSY
Sbjct  434   KFKPERFRDGVSSAAKGQVTYFPFTWGPRICIGLNFAMLEAKTALAMILQRFSFELSPSY  493

Query  1605  AHAPYTGLTTNPLYGAPLILQKL  1673
             AHAP + +T  P YGAPLIL K+
Sbjct  494   AHAPQSIITLQPQYGAPLILHKI  516



>ref|XP_009789316.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=516

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/503 (61%), Positives = 390/503 (78%), Gaps = 3/503 (1%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             I  +VC WRV+NW W RPK LEK  R Q LKGN YR+ YGD KE++ M+ E  SKPMN L
Sbjct  17    ITLMVCIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSGMIEEANSKPMN-L  75

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             SD++ PR++P+F ++I+K+GK SFVWLG  P+V I DP+ +KEV SK+  +++  ++P+ 
Sbjct  76    SDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFSKNYLYEKPHSNPLT  135

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L+QGL+  EGDKW+KHRKI  PAF LEKLKHM+PA    C+EM+ +WE+IV+   S E
Sbjct  136   KLLAQGLVSQEGDKWAKHRKIITPAFHLEKLKHMLPAFCLSCTEMLSKWEDIVAVEGSHE  195

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             +D+WP L+ ++ +VIS TAFG SYE GRR+FELQ E A+H  +   S+YIPG RFLPTK+
Sbjct  196   IDIWPGLQQLSSDVISRTAFGSSYEEGRRIFELQKEQAQHFMKAIRSIYIPGWRFLPTKR  255

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSI  1064
             NRRM  I+K  ++ +  II+KR+ AMK GE  + +LL +LLESNFKE++ HGN++FGMSI
Sbjct  256   NRRMKEIEK--DSKVTGIIDKRVKAMKAGEVNNEDLLGILLESNFKEIEQHGNKDFGMSI  313

Query  1065  EDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRL  1244
             E++I ECKLFY AGQETTS LLVWT+ILLSR+Q+WQ  AREEV+ VFG  KPDFDGLNRL
Sbjct  314   EEVIEECKLFYFAGQETTSVLLVWTLILLSRHQDWQAQAREEVLQVFGSQKPDFDGLNRL  373

Query  1245  KIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDAN  1424
             KIV  +L ESLRLYPPV +L R  KED  LG++SLPAGV + +P+I LHHD E+WG+DA 
Sbjct  374   KIVRELLYESLRLYPPVVSLTRRPKEDTVLGDVSLPAGVLISLPVILLHHDEEIWGKDAK  433

Query  1425  EFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSY  1604
             +F PERFR+GVS A  G+  Y PF+ GPRICIGLNFAM+EAKTAL+ IL+RFSF+LSPSY
Sbjct  434   KFKPERFRDGVSSAAKGQVTYFPFTWGPRICIGLNFAMLEAKTALAMILQRFSFELSPSY  493

Query  1605  AHAPYTGLTTNPLYGAPLILQKL  1673
             AHAP + +T  P YGAPLIL K+
Sbjct  494   AHAPQSIITLQPQYGAPLILHKI  516



>ref|XP_009620491.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/516 (57%), Positives = 394/516 (76%), Gaps = 0/516 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME+   + L  F++  ++  W+++NWAW RP+ L++ LR Q LKGN Y+L +GD KE++K
Sbjct  1     MEMAYYIVLSLFAVTSVIYVWKLLNWAWFRPRKLDQCLRQQGLKGNSYKLIFGDLKELSK  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
              + E KSKP+NV  D++ PR++PYF E+I+K+GKNSF+WLG  P+V + DPD +K+VL+K
Sbjct  61    SIEEAKSKPLNVSDDDIPPRILPYFIEAIKKYGKNSFIWLGPNPLVFVRDPDVLKDVLTK  120

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
             H+ +Q+  + P+   L+QG++ YE DKW+KHRKI NPAF +EK+KHM+PA+   CSEMV 
Sbjct  121   HSLYQKPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKHMLPAIQLSCSEMVS  180

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +W+E  S   S ELD+WP L+ ++ + IS TAFG +YE GR++FELQ E AEH   +  +
Sbjct  181   QWKEAASVKGSCELDIWPYLQRLSSDAISRTAFGSNYEEGRKIFELQKEQAEHVIAISST  240

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
             +YIPG RF+PTK+NRRM  I+KE+   ++ II+KR+  MK GE  +++LL +LL+SNFKE
Sbjct  241   LYIPGWRFMPTKRNRRMKEIEKEVQATVRGIIDKRVKTMKAGEANADDLLGILLDSNFKE  300

Query  1026  MKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVF  1205
             ++ HG++ FGMS +++I ECKLFY AGQETTS LLVWTM+LLSR+ EWQ  AREEV+ VF
Sbjct  301   IEQHGSKNFGMSTQEVIEECKLFYFAGQETTSVLLVWTMVLLSRHPEWQARAREEVLQVF  360

Query  1206  GDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIF  1385
             GD   +FDGLNRLKIVTMIL+ESLRLYPPV  L R +    KLG L+LPAGV L +P++ 
Sbjct  361   GDGMLEFDGLNRLKIVTMILHESLRLYPPVGALGRRITTKTKLGELNLPAGVMLSLPMLL  420

Query  1386  LHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSC  1565
             +HHD E+WGEDA EF PERF EGVSKAT G+  + PF  GPRICIGLNFAM+EAK A++ 
Sbjct  421   VHHDEEIWGEDAKEFKPERFSEGVSKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAM  480

Query  1566  ILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             IL+RFSF+LSPSY HAP + +T  P YGAPLIL KL
Sbjct  481   ILQRFSFELSPSYTHAPQSVITMQPQYGAPLILHKL  516



>ref|XP_004243253.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=518

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/511 (59%), Positives = 388/511 (76%), Gaps = 1/511 (0%)
 Frame = +3

Query  144   LFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETK  323
             L  F  +I  ++ AW++++WAW RP+ LEK LR Q LKGN Y+L +GD KE+AK   + K
Sbjct  8     LVSFLLTITSVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELAKSFEDVK  67

Query  324   SKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQ  503
             SKP+NV  D++ PR++PYF ++I+KHGKN F+W+G  PMV++ D + +++V +K+  +Q+
Sbjct  68    SKPLNVFDDDITPRIVPYFVDTIKKHGKNCFIWIGPKPMVLVNDAEVIRDVFNKYVLYQK  127

Query  504   NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIV  683
                 P+   L+QGL  YE DKW+ HRKI NPAF +EK+K+MVPA++  C+EMV +WEE +
Sbjct  128   PKPTPLTKLLAQGLASYEEDKWAMHRKILNPAFHMEKIKNMVPAIHLSCTEMVSQWEESI  187

Query  684   S-RNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPG  860
             S +  S E+D+WP L+ ++ +VIS TAFG +YE GR +FELQ E A+H  E   ++YI G
Sbjct  188   STKGTSCEIDIWPYLQKLSSDVISRTAFGSNYEEGRMIFELQKEQAQHFIEATRTLYILG  247

Query  861   GRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG  1040
              RFLPTKKNRRM  IDK +  +++ II+KR+ A+K GE  +++LL MLLESNFK+++ HG
Sbjct  248   SRFLPTKKNRRMKEIDKNVQAMIRGIIDKRVKALKAGEANTDDLLGMLLESNFKQIEQHG  307

Query  1041  NQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKP  1220
             N++FGMS  +II ECKLFY AGQETTS LLVWTMILLSR+ +WQ  AREEV+ VFGD K 
Sbjct  308   NKDFGMSTREIIEECKLFYFAGQETTSVLLVWTMILLSRHLDWQTRAREEVLQVFGDSKL  367

Query  1221  DFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDP  1400
             +FDGLNRLKIVTMILNESLRLYPP  +L R    + KLG LSLPAGV L++PII LHHD 
Sbjct  368   EFDGLNRLKIVTMILNESLRLYPPADSLNRKTTTNTKLGELSLPAGVMLVLPIILLHHDK  427

Query  1401  EMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRF  1580
             E+WGEDA EF PERF EGVSKAT G+  + PF GGPRICIGLNF M+EAK AL+ IL+ F
Sbjct  428   EIWGEDATEFKPERFSEGVSKATKGQMTFFPFGGGPRICIGLNFTMIEAKMALAMILQHF  487

Query  1581  SFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             SF+LSPSY HAP + +T  P YGAPLIL KL
Sbjct  488   SFELSPSYTHAPQSVITIQPQYGAPLILHKL  518



>ref|XP_009615908.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=514

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/515 (59%), Positives = 390/515 (76%), Gaps = 2/515 (0%)
 Frame = +3

Query  132   VFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMM  311
             + CN        +FLV  W+V+NW W RPK LEK LR + LKGNPY+L YGD  E+ K +
Sbjct  1     MLCNTIAVVSVAIFLVYTWKVLNWVWFRPKKLEKCLRQRGLKGNPYKLLYGDLNELTKSI  60

Query  312   NETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHN  491
              E KSKP+N  SD++  R+IP+F  +I K+GK SFVWLG  P+V+IT P+HVKE+L+K  
Sbjct  61    IEAKSKPIN-FSDDIAQRLIPFFLNAINKNGKTSFVWLGPYPVVLITAPEHVKEILTKSY  119

Query  492   TF-QQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGR  668
              + +Q   +P+   L+Q L+  E +KW+KHRKI NPAF +EKLKHM+PA Y+ CSEM+ +
Sbjct  120   VYLKQTHPNPLTKLLAQSLVNLEEEKWAKHRKIINPAFHVEKLKHMLPAFYQSCSEMLSK  179

Query  669   WEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSV  848
             WEEIV +  S E DVWP+L+ +   VIS TAFG SY+ GR +FELQ E AE+  E   S+
Sbjct  180   WEEIVPKETSFEFDVWPDLQVMTSEVISRTAFGSSYQEGRIVFELQKEQAEYVMEKGRSI  239

Query  849   YIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEM  1028
             Y+PG RFLPTK N+RM  I+KEI T ++RII+KR+ AMK GE  + +LL +LLESN +E+
Sbjct  240   YVPGSRFLPTKTNKRMLEIEKEIQTTIRRIIDKRLRAMKAGETNNEDLLGILLESNLEEI  299

Query  1029  KHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFG  1208
             + HG++EFGM+  ++I ECKLFY AGQETTS LLVWTMILL  + EWQ LAREEV+ VFG
Sbjct  300   ELHGSKEFGMTASEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVLAREEVLQVFG  359

Query  1209  DDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFL  1388
             +DKPD +GLNRLKIVTMIL E+LRL+PP+P   R  KE+ KLG L+LP GV LL+P + +
Sbjct  360   NDKPDLEGLNRLKIVTMILYETLRLFPPLPVFGRRTKEEVKLGELNLPDGVVLLIPAVLV  419

Query  1389  HHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCI  1568
             H+D E+WGEDA EF PERF EGVSKATNG+  Y+PF GGPRICIG NFAM+EAKTA++ I
Sbjct  420   HYDKEIWGEDAKEFKPERFSEGVSKATNGQVSYIPFGGGPRICIGQNFAMLEAKTAITMI  479

Query  1569  LRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             L+RFSF+LSPSY HAP+  +T +P YGAPL+++KL
Sbjct  480   LQRFSFELSPSYTHAPFAVVTIHPQYGAPLLMRKL  514



>ref|XP_009617253.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum]
Length=518

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/503 (60%), Positives = 390/503 (78%), Gaps = 1/503 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             I  +VC WRV+NW W RPK LEK LR Q LKGN Y++ YGD KE++ M+ E  SKPMN L
Sbjct  17    ITLVVCIWRVLNWVWFRPKKLEKLLRKQGLKGNSYKILYGDMKELSGMIKEANSKPMN-L  75

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             SD++ PR++P+F ++I+K+GK SFVWLG  P+V+I DP+ +KE+ SK+  +Q+   +PV 
Sbjct  76    SDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVLIMDPELIKEIFSKYYLYQKPHGNPVT  135

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L QGL+  E DKW+KHRKI NPAF LEKLKHM+PA    C+EM+ +WE+IVS   S E
Sbjct  136   KLLVQGLVSLEEDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEMLCKWEDIVSIKGSHE  195

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             +DVWP L+ ++ +VIS TAFG ++E G+R+FELQ E A++  E   SVYIPG RFLPTK+
Sbjct  196   IDVWPHLEQLSSDVISRTAFGSNFEEGKRIFELQKEQAQYFVEAIRSVYIPGWRFLPTKR  255

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSI  1064
             NRRM  ++K++   ++ II+KR+ AMK GE ++ +LL +LLESNF E + H +++  MSI
Sbjct  256   NRRMKEVEKDVRASIRGIIDKRVKAMKAGEASNEDLLGILLESNFTEAEQHRHKDSAMSI  315

Query  1065  EDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRL  1244
             E++I ECKLFY+AGQETTS LLVWT+ILLSR+Q+WQ  AREEV  VFG+ KPDFDGLNRL
Sbjct  316   EEVIQECKLFYVAGQETTSVLLVWTLILLSRHQDWQSRAREEVFQVFGNQKPDFDGLNRL  375

Query  1245  KIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDAN  1424
             K+VTMIL ESLRLY PV +LIR   EDA LGN+SLP GV L +P+I LHHD E+WG+DA 
Sbjct  376   KVVTMILYESLRLYSPVVSLIRRPNEDAILGNVSLPEGVLLSLPVILLHHDEEIWGKDAK  435

Query  1425  EFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSY  1604
             +FNPERFR+GVS AT G+  + PF+ GPRICIG NFAM+EAKTAL+ IL+RFSF+LSPSY
Sbjct  436   KFNPERFRDGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKTALAMILQRFSFELSPSY  495

Query  1605  AHAPYTGLTTNPLYGAPLILQKL  1673
             AHAP + LT  P +GAPLIL K+
Sbjct  496   AHAPQSILTMQPQHGAPLILHKI  518



>ref|XP_006348910.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/503 (59%), Positives = 394/503 (78%), Gaps = 2/503 (0%)
 Frame = +3

Query  168   MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLS  347
             + LV  WRV+NWAW++PK LEK+LR   LKGNPY+L++GD KE    +NE KSKP+N  S
Sbjct  16    VLLVYTWRVLNWAWLKPKKLEKYLRKSGLKGNPYKLYHGDLKEFTNKLNEAKSKPIN-FS  74

Query  348   DEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNL-ADPVV  524
             D++  R+IP+F +SI K+GK+SFVWLG  P+V+ITDP+HVKE+ +K+  +Q+    +P  
Sbjct  75    DDIAQRLIPFFCDSINKNGKSSFVWLGPYPVVLITDPEHVKEIFTKNYVYQKETHPNPFS  134

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L+ GL K E DKW+KHRKI NPAFQ EKLKHM+PA Y+ CSE++ +WEEI+ +  S E
Sbjct  135   KLLAIGLAKLEEDKWAKHRKIINPAFQTEKLKHMLPAFYQSCSEIISKWEEIIPKETSFE  194

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             LDVWP+L+ +   VIS TAFG SYE GR +FELQ+E AE+ +++  S+YIPG RFLPTK+
Sbjct  195   LDVWPDLQLMTAEVISRTAFGSSYEEGRIVFELQNEQAEYVTDINRSIYIPGSRFLPTKR  254

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSI  1064
              +RM  I+K++ T +KRII+KR+ AM+ GE + N+LL +LLESN KE++ HG+++FGM+ 
Sbjct  255   YKRMLEIEKQVQTTIKRIIDKRLRAMEAGETSKNDLLGILLESNMKEIEQHGSKDFGMTT  314

Query  1065  EDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRL  1244
              ++I ECK FY AGQETT+ LLVWTMILL  + EWQ  AREE + VFG++KP+ +GL+RL
Sbjct  315   TEVIDECKFFYFAGQETTAVLLVWTMILLCLHPEWQARAREEALQVFGNEKPNLEGLSRL  374

Query  1245  KIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDAN  1424
             KIVTMIL+E+LRL+PPVPT  R  K + KLG LSLPAGV L++P I +H+D E+WGEDA 
Sbjct  375   KIVTMILHETLRLFPPVPTYRRRNKHEVKLGELSLPAGVLLVIPAILIHYDKELWGEDAK  434

Query  1425  EFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSY  1604
             EF PERF EGVSKAT G+  ++PF+GGPR+CIG NFAM+EAK  ++ IL++FSF+LSPSY
Sbjct  435   EFKPERFSEGVSKATKGRISFIPFTGGPRVCIGQNFAMMEAKIGIAMILQKFSFELSPSY  494

Query  1605  AHAPYTGLTTNPLYGAPLILQKL  1673
             AHAP+  +T +P YGAPL+++KL
Sbjct  495   AHAPFATITIHPQYGAPLLMRKL  517



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/511 (57%), Positives = 389/511 (76%), Gaps = 1/511 (0%)
 Frame = +3

Query  144   LFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETK  323
             L LF  +I F++ AWR+++WAW  P+ LEK LR Q LKGN Y+L YGD KE++K + + +
Sbjct  8     LVLFLLAITFVIYAWRLLDWAWFMPRKLEKCLRQQGLKGNSYKLIYGDIKELSKSIEDAE  67

Query  324   SKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQ  503
             SKP+NV  D++ PR++PYF ++I+K+GKN F+W+G  P+VI+ DP+ +++V +KH  +Q+
Sbjct  68    SKPLNVSDDDLTPRILPYFVQTIKKYGKNCFIWIGPKPLVIVGDPEVIRDVFNKHALYQK  127

Query  504   NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIV  683
               + P+   L+QG++ YE DKW+KHRKI NPAF +EK+K M+ A+   CSEMV +WEE V
Sbjct  128   PKSTPLTKLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKDMLQAVLLSCSEMVNQWEEAV  187

Query  684   SRNESG-ELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPG  860
             S  ES  ELD+WP L+ +  +VIS TAFG +YE GR++FELQ E AEH  E+  ++YIPG
Sbjct  188   SMKESSTELDIWPYLQRLTSDVISRTAFGSNYEEGRKIFELQKEQAEHVIEVSRTLYIPG  247

Query  861   GRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG  1040
              RFLPTK+NRRM  I++E+   ++ II+KR+  MK GE  +++LL +LLESNFKE++ HG
Sbjct  248   WRFLPTKRNRRMKEIEREVQATIRGIIDKRVKGMKAGEANTDDLLGILLESNFKEIEQHG  307

Query  1041  NQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKP  1220
             N+ FGM+I+++I ECKLFY AGQETTS  LVWTMILLSR+ +WQ  AREEV+ VFGD  P
Sbjct  308   NKNFGMTIKEVIEECKLFYFAGQETTSVWLVWTMILLSRHPDWQVRAREEVLQVFGDGMP  367

Query  1221  DFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDP  1400
              FDGLNRLK+VTMIL+ESLRLYPPV  L R +    KLG L+LPAGV L +P I +HHD 
Sbjct  368   GFDGLNRLKVVTMILHESLRLYPPVSALGRRITTKTKLGELNLPAGVMLSLPTILVHHDK  427

Query  1401  EMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRF  1580
             E+WGEDA EF PERF EG+SKAT G+  + PF  GPRICIGLNFAM+EAK  ++ IL+RF
Sbjct  428   EIWGEDATEFKPERFSEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMTMAMILQRF  487

Query  1581  SFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +F+LSPSY HAP + +T  P YGAPL+L +L
Sbjct  488   AFELSPSYTHAPQSVITMQPKYGAPLVLHRL  518



>ref|XP_006348901.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/506 (58%), Positives = 383/506 (76%), Gaps = 0/506 (0%)
 Frame = +3

Query  156   SFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPM  335
             + +I  L+C WRV+NW W RPK LEK L+ Q +KGN Y + YGDTKE++  + E  SK M
Sbjct  14    AIAITLLLCLWRVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSLRIKEVTSKSM  73

Query  336   NVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLAD  515
             ++  D++  R +P+F ++I+K+GK SF+WLG  P+V I DPD +KEV +K   +Q+   +
Sbjct  74    SLYDDDIAQRSMPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTN  133

Query  516   PVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNE  695
             P+   L+QGL++ EGDKW+KHRKI NPAF LEKLKHM+PA    C+EM+ +WE+IVS   
Sbjct  134   PLTKLLAQGLVREEGDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEMLSKWEDIVSVER  193

Query  696   SGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLP  875
             + E+DVWP L+ +  +VIS TAFG SYE GRR+FELQ E A++  E   SVYIPG  FLP
Sbjct  194   AYEIDVWPHLQQLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPGWSFLP  253

Query  876   TKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFG  1055
             TK+NRRM  I++ +   ++ II+KR+ AMK GE  + +LL +LLESNFKE++ HG++ FG
Sbjct  254   TKRNRRMKEIERHVQATIRGIIDKRVKAMKGGEANNEDLLGILLESNFKEIEQHGDKNFG  313

Query  1056  MSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGL  1235
             +SIE++I ECKLFY AGQETTS LLVWT+ILL R+ +WQ  AREEV+ VFG+ KPDFDGL
Sbjct  314   LSIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDWQTRAREEVLQVFGNRKPDFDGL  373

Query  1236  NRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGE  1415
             N LK+VTMIL ESLRLYPPV T+ R + ED  LG++SLPAGV L +P + LHHD E+WGE
Sbjct  374   NHLKVVTMILYESLRLYPPVMTVTRRLNEDTVLGDMSLPAGVLLSLPAVLLHHDEEIWGE  433

Query  1416  DANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLS  1595
             DA +FNPERFREGVS AT G+  + PF+ GPRICIG NFAM+EAK  L+ IL+RFSF LS
Sbjct  434   DAKKFNPERFREGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKMVLAMILQRFSFDLS  493

Query  1596  PSYAHAPYTGLTTNPLYGAPLILQKL  1673
              SYAHAP++ +TT P YGAPLIL +L
Sbjct  494   SSYAHAPHSVITTQPQYGAPLILHRL  519



>ref|XP_006348908.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/518 (58%), Positives = 396/518 (76%), Gaps = 3/518 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSI-MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             ME+  N  + +  + + LV  W+V+NWAW +PK LEK+LR   LKGNPY+L YGD+KE+ 
Sbjct  1     MEISYNRIIAAICVAILLVYTWKVLNWAWFKPKKLEKYLRKNGLKGNPYKLLYGDSKELT  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
               +NE +SKP+N  +D++  R+IP+F +SI K+GKNSFVWLG  P+V+ITDP+HVK + +
Sbjct  61    NKLNEARSKPIN-FNDDIAQRLIPFFLDSINKNGKNSFVWLGPYPIVLITDPEHVKVIFT  119

Query  483   KHNTFQ-QNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             K+  +Q Q   +P    L+ GL   E DKW+KHRKI NPAF +EKLKHM+PA Y+ CSEM
Sbjct  120   KNYGYQKQAHPNPFAKLLAIGLALLEEDKWAKHRKIINPAFHVEKLKHMLPAFYQSCSEM  179

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             + +WE+IV +  S ELDVWP+L+ +   VIS TAFG SYE GR +FELQ E AE+  ++ 
Sbjct  180   ISKWEDIVPKETSVELDVWPDLQLMTGEVISRTAFGSSYEEGRIVFELQKEQAEYVIDIT  239

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              SVYIPG RFLPTK+N+RM  I+K++ T ++RII+KR+ AM+ GE + N+LL +LLESN 
Sbjct  240   RSVYIPGSRFLPTKRNKRMLAIEKQVQTTIRRIIDKRLRAMEAGETSKNDLLGILLESNM  299

Query  1020  KEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             KE++ HG++EFGM+  ++I ECKLFY AGQE TS LLVWTMILLS + EWQ  AREEV+ 
Sbjct  300   KEIEQHGSKEFGMTTIELIEECKLFYFAGQEATSVLLVWTMILLSLHPEWQVRAREEVLQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             VFG++KP+ +GL+RLKI+TMIL+E+LRL+PPVPT  R  K + KLG LSLP+GV L +P 
Sbjct  360   VFGNEKPNLEGLSRLKIMTMILHETLRLFPPVPTYRRRNKHEVKLGELSLPSGVLLFIPT  419

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             + +H+D E+WGEDA EF PERF EGVSKAT G+  ++PF  GPRICIG NFAM+EAK A+
Sbjct  420   VLIHYDKELWGEDAKEFKPERFSEGVSKATKGQVSFIPFGWGPRICIGQNFAMMEAKMAI  479

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + IL++FSFKLSPSY HAP   +TT P YGAPL+++KL
Sbjct  480   AMILQKFSFKLSPSYTHAPVAIITTQPQYGAPLLMRKL  517



>ref|XP_006348907.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/518 (58%), Positives = 392/518 (76%), Gaps = 3/518 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSI-MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             ME+  N  + +  + + LV  WRV+NWAW +PK LEK+LR   LKGNPY+LFYGD  E+ 
Sbjct  1     MEISYNRIIEAICVAILLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNELT  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
               +NE +SKP+N  SD++  R+IP+F +SI K+GK+SFVWLG  P V+ITDP+HVKE+ +
Sbjct  61    NKLNEARSKPIN-FSDDIAQRLIPFFLDSIYKNGKSSFVWLGPYPAVLITDPEHVKEIFT  119

Query  483   KHNTFQQ-NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             K+  +Q+    +P     ++GL   E DKW+KHRKI NPAF  E LKHM+PA Y+ CSEM
Sbjct  120   KNYGYQKIAHPNPFAKSFAKGLAFLEEDKWAKHRKIINPAFHFENLKHMLPAFYQSCSEM  179

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             + +WE+IV +  S ELDVWP+L+ +   VIS TAFG SYE GR++FELQ E AE+  ++ 
Sbjct  180   ISKWEDIVPKETSVELDVWPDLQLMTGEVISRTAFGSSYEEGRKVFELQKEQAEYVMDMT  239

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
             HSVYIPG RFLPTK+N+RM  I+K+I T ++RII KR+ AM+ GE + N+LL +LLESN 
Sbjct  240   HSVYIPGSRFLPTKRNKRMKEIEKQIQTTIRRIINKRLRAMEAGETSKNDLLGILLESNM  299

Query  1020  KEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             KE++ HGN++FGM+  ++I ECKLFY AGQE  S LL+WTMILL  + EWQ  AREEV+ 
Sbjct  300   KEIEQHGNKDFGMTTIELIEECKLFYFAGQEGNSVLLIWTMILLCLHPEWQVRAREEVLQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             VFG++K + +GL+RL IVTMILNE+LRL+PPV T  R +KE+ KLG+LSLPAGV+L +P 
Sbjct  360   VFGNEKTNLEGLSRLNIVTMILNETLRLFPPVATFRRRIKEEVKLGDLSLPAGVQLFIPT  419

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             + +H+D E+WGEDA EF PERF EGVSKAT G+A + PF  GPRICIG NFAM+EAK A+
Sbjct  420   VLIHYDKELWGEDAKEFKPERFSEGVSKATKGEASFFPFGRGPRICIGQNFAMMEAKMAI  479

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + IL+ FSF+LSPSY HAP   ++T P YGAPL+++KL
Sbjct  480   AMILQNFSFELSPSYTHAPLAIVSTQPQYGAPLLMRKL  517



>ref|XP_004243263.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/504 (59%), Positives = 377/504 (75%), Gaps = 0/504 (0%)
 Frame = +3

Query  162   SIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV  341
             +I  L+C W V+NW W RPK LEK L+ Q +KGN Y + YGDTKE++  + E  SK M+V
Sbjct  16    AITLLLCIWSVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSMRIKEVTSKSMSV  75

Query  342   LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPV  521
               D++ PR +P+F ++I+K+GK SF+WLG  P+V I DPD +KEV +K   +Q+   +P+
Sbjct  76    YDDDIAPRSLPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTNPL  135

Query  522   VYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESG  701
                L+QGL++ EGDKW+KHRKI NPAF LEKLKHM+PA Y  C+EM+ +WE++VS   S 
Sbjct  136   TKLLAQGLVREEGDKWAKHRKIINPAFHLEKLKHMLPAFYLSCTEMLSKWEDVVSVERSH  195

Query  702   ELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTK  881
             E+DVWP L+ +  +VIS TAFG SYE GRR+FELQ E A++  E   SVYIPG  FLPTK
Sbjct  196   EIDVWPHLQQLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPGWSFLPTK  255

Query  882   KNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMS  1061
             +NRRM  I+K +   ++ II+KR+ AM  GE  + +LL +LLESNFKE+K HG+++FG+S
Sbjct  256   RNRRMKEIEKHVQATIRGIIDKRVKAMTGGEANNKDLLGILLESNFKEIKQHGDKDFGLS  315

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             IE++I ECKLFY AGQETTS LLVWT+ILL R+ +WQ  AR EV+ VFG  KPDFDGL  
Sbjct  316   IEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDWQTRARTEVLQVFGSRKPDFDGLTH  375

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LK+VTMIL ESLRLYPPV T+ R + EDA LG++SLPA V L +P + LHHD E+WGEDA
Sbjct  376   LKVVTMILYESLRLYPPVTTVTRRLNEDAVLGDISLPADVLLSLPAVLLHHDEEIWGEDA  435

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
              +FNPERFREGVS AT G+  + PF+ GPRICIG NFAM+EAK  L+ IL+RFS  LS S
Sbjct  436   KKFNPERFREGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKMVLAMILQRFSLDLSTS  495

Query  1602  YAHAPYTGLTTNPLYGAPLILQKL  1673
             Y HA ++ +TT P YGAPLIL KL
Sbjct  496   YTHALHSVITTQPQYGAPLILHKL  519



>ref|XP_004243845.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/511 (57%), Positives = 392/511 (77%), Gaps = 1/511 (0%)
 Frame = +3

Query  144   LFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETK  323
             L LF  +I F++ AWR+++WAW RP+ L+K LR Q LKGN Y+L +GD KE++K + + +
Sbjct  8     LVLFLLAITFVIYAWRLLDWAWFRPRKLDKCLRQQGLKGNSYKLIFGDIKELSKSIEDAE  67

Query  324   SKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQ  503
             SKP++V  D++ PR++PYF ++I+K+GKN F+W+GT P+VI+ DP+ +++V +KH  +Q+
Sbjct  68    SKPLDVSDDDLTPRILPYFVQTIKKYGKNCFIWIGTKPLVIVGDPEVIRDVFNKHALYQK  127

Query  504   NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIV  683
               + P+   L+QG++ YE  KW+KHRKI NPAF +EK+K M+ A++  CSEMV +WEE V
Sbjct  128   PKSTPLTKLLAQGIVSYEEVKWAKHRKILNPAFHMEKIKDMLQAVHLSCSEMVSQWEEAV  187

Query  684   SRNESG-ELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPG  860
             S  ES  ELD+WP L+ +  +VIS TAFG +YE GR++FELQ E AEH   +  ++YIPG
Sbjct  188   SMKESSTELDIWPYLQRLTSDVISHTAFGSNYEEGRKIFELQKEQAEHVIAVSRTLYIPG  247

Query  861   GRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG  1040
              RFLPTK+NRRM  I+ ++ T ++ II+KR+  +K GE  +++LL +LLESNFKE++ HG
Sbjct  248   WRFLPTKRNRRMKEIEGKVQTTIRGIIDKRVKGIKAGEANTDDLLGILLESNFKEIEQHG  307

Query  1041  NQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKP  1220
             N++FGM+I+++I ECKLFY AGQETTS LLVWTMILLSR+ +WQ  AREEV+ VFGD  P
Sbjct  308   NKDFGMTIKEVIEECKLFYFAGQETTSVLLVWTMILLSRHPDWQVRAREEVLQVFGDGMP  367

Query  1221  DFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDP  1400
              FDGLNRLK+VTMIL+ESLRLYPPV  L R +    KLG L+LPAGV L +P I +HHD 
Sbjct  368   GFDGLNRLKVVTMILHESLRLYPPVGALGRRITTKTKLGELNLPAGVMLSLPTILVHHDK  427

Query  1401  EMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRF  1580
             E+WGEDA EF PERF EG+SKAT G+  + PF  GPRICIGLNFAM+EAK A++ IL+RF
Sbjct  428   EIWGEDATEFKPERFNEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQRF  487

Query  1581  SFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +F+LSP Y HAP + +T  P YGAPL+L KL
Sbjct  488   AFELSPLYTHAPQSVITMQPKYGAPLVLHKL  518



>ref|XP_004243255.1| PREDICTED: cytochrome P450 CYP72A219 isoform X1 [Solanum lycopersicum]
Length=526

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/502 (60%), Positives = 384/502 (76%), Gaps = 2/502 (0%)
 Frame = +3

Query  171   FLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSD  350
              L   W+V+NWAW  PK LE  LR + LKGNPY+L YGD  E+ K + E KSKP+N  SD
Sbjct  26    LLFYTWKVLNWAWFGPKKLENCLRQRGLKGNPYKLLYGDLNELTKSIVEAKSKPIN-FSD  84

Query  351   EVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTF-QQNLADPVVY  527
             ++  R+IP+F  SI K+GK+SF+WLG  P+V+IT P+HVKE+ +K+  + +Q   +P   
Sbjct  85    DIAQRLIPFFLNSINKNGKSSFIWLGPYPIVLITKPEHVKEIFTKNYVYLKQTHPNPFTK  144

Query  528   KLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGEL  707
              L++GL+  E DKW+KHRKI NP F +EKLKHM+PA Y  CSEM+ +WEEIV +  S E+
Sbjct  145   LLAKGLVSLEEDKWAKHRKIINPTFHVEKLKHMLPAFYVCCSEMISKWEEIVPKGTSTEI  204

Query  708   DVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKN  887
             DVWP+L+ +   VIS TAFG SYE GR +FELQ E AEH  E+  S+YIPG RFLPTK+N
Sbjct  205   DVWPDLEKMTSEVISRTAFGSSYEEGRIVFELQKEQAEHVMEVARSIYIPGSRFLPTKRN  264

Query  888   RRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIE  1067
             +RM  I+KEI T ++RII+KR+ AM+ GE + ++LL +LLESN KE++ HG+++FGM+  
Sbjct  265   KRMLEIEKEIQTTIRRIIDKRLRAMEGGETSKDDLLGILLESNMKEIEQHGSKDFGMTTV  324

Query  1068  DIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLK  1247
             ++I ECKLFY AGQETTS LLVWTMILL  + EWQ  AREEV+ VFG+DKPD +GL RLK
Sbjct  325   EVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDKPDLEGLGRLK  384

Query  1248  IVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANE  1427
             IVTMIL E+LRL+PP+PT  R  KE+ KLG L+LPAGV L+VP I +H+D E+WGEDA E
Sbjct  385   IVTMILYETLRLFPPLPTFGRTNKEEVKLGELNLPAGVILIVPAILVHYDKEIWGEDAKE  444

Query  1428  FNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYA  1607
             F PERF EGVSKAT G+  ++PF GGPRICIG NFAM+EAK AL+ IL+RFSF+LSPSY 
Sbjct  445   FKPERFSEGVSKATKGQFSFIPFGGGPRICIGQNFAMMEAKMALAMILQRFSFELSPSYT  504

Query  1608  HAPYTGLTTNPLYGAPLILQKL  1673
             HAP+  +T +P YGAPL+++KL
Sbjct  505   HAPFAVVTIHPQYGAPLLMRKL  526



>ref|XP_004243261.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/518 (58%), Positives = 393/518 (76%), Gaps = 3/518 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSI-MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             ME+  N  L +  + + LV  W+V+NWAW RPK LEK+LR   LKGNPY+L YGD KE+ 
Sbjct  1     MEISYNTILTAICVAILLVYTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKELK  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
               +NE KSKP+N  SD +  R+ P+F  +I K+GK+SFVWLG  P+V+IT+P+HVKE+L+
Sbjct  61    NKLNEAKSKPIN-FSDGIAQRINPFFANAIDKNGKSSFVWLGPYPIVLITEPEHVKEILT  119

Query  483   KHNTFQ-QNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             K+  +Q Q  A+P   KL+ GL K E DKW+KHRKI  PAFQ+EKLKHM+PA Y+ CSEM
Sbjct  120   KNYVYQRQTHANPFAKKLALGLAKLEEDKWAKHRKIIQPAFQVEKLKHMLPAFYQSCSEM  179

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             + +WEEI+ +    ELDVWP+L+ I   VIS TAFG SYE GR +FELQ E AE+  ++ 
Sbjct  180   ISKWEEIIPKETPFELDVWPDLQLITAEVISRTAFGSSYEEGRIVFELQKEQAEYVIDII  239

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              SVYIPG RFLPTK+N+RM  I+ ++ T ++ II+KR+ AM+ GE +  +LL +LLESN 
Sbjct  240   RSVYIPGTRFLPTKRNKRMLEIENKVQTTIRSIIDKRLRAMEAGEASKTDLLGILLESNM  299

Query  1020  KEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             +E+K H + +FG++  ++I ECKLFY AGQETTS LL WTMILLS + EWQ  AREEV+ 
Sbjct  300   REIKQHRSNDFGITTAEMIEECKLFYFAGQETTSVLLAWTMILLSLHPEWQARAREEVLQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             VFG++KP+ +GL+RLKIVTMIL+E+LRL+P VPT  R  K + KLG LSLPAGV+L++P 
Sbjct  360   VFGNEKPNSEGLSRLKIVTMILHETLRLFPSVPTYRRRNKHEVKLGELSLPAGVQLIIPT  419

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             I +H+D E+WGEDA EF PERF EGVSKAT G+  ++PF GGPR+CIG NFAM+EAK A+
Sbjct  420   ILIHYDKELWGEDAKEFKPERFSEGVSKATKGQVSFIPFGGGPRVCIGQNFAMMEAKMAI  479

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + IL++FSF+LSPSY HAP   +T +P YGAPL+++KL
Sbjct  480   AMILQKFSFELSPSYTHAPVLTITIHPQYGAPLLMRKL  517



>ref|XP_006348303.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=519

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/519 (56%), Positives = 380/519 (73%), Gaps = 0/519 (0%)
 Frame = +3

Query  117   MMRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKE  296
             M ++++   +     ++   VC W+V+NW W RPK LEK LR Q LKGN YR+ YGD K+
Sbjct  1     MDKIQILVTICCCVIAVALFVCLWKVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKD  60

Query  297   IAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEV  476
              + M+ E  SKPMN+ +D++ PR++P+F E I+K+GK  F W+G  P ++I DP+ +KEV
Sbjct  61    FSGMIKEANSKPMNISNDDLSPRLVPFFLEIIKKYGKKCFTWMGPRPQILIMDPELIKEV  120

Query  477   LSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSE  656
             LSK   +Q+  A+P+     QGL+ YE DKW+KHRKI NPAF LEKLKHM+PA Y  CSE
Sbjct  121   LSKTYVYQKPHANPLGTLFVQGLVTYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSE  180

Query  657   MVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASEL  836
             M+ +WE++V    S E+DVWP L+ +  +VIS TAFG SYE GR++FELQ E  +H  E+
Sbjct  181   MLSKWEDVVQVEGSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQQEQTQHFLEV  240

Query  837   RHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESN  1016
               SVYIPG RFLPTK+NRRM  I K++ + ++ II+KR+ AM+ G   + +LL +LLESN
Sbjct  241   TRSVYIPGWRFLPTKRNRRMKEIKKDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESN  300

Query  1017  FKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
             FKE++ HGN++FGMSIE++I ECKLFY AG ETTS  ++WT++LLSR  +WQ  AREEV+
Sbjct  301   FKEIELHGNKDFGMSIEEVIEECKLFYFAGTETTSVWILWTLVLLSRCPDWQARAREEVL  360

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              V G  KPDFDGLN LK+VTMIL ESLRLY P+  L R + ED  LG +SLP GV + +P
Sbjct  361   QVLGSRKPDFDGLNHLKVVTMILYESLRLYSPITVLTRRIYEDITLGEVSLPTGVLVSLP  420

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
             II LHHD ++WGEDAN+FNPERFREG+S AT G+  Y PF+ GPRICIG NFAM+EAK  
Sbjct  421   IILLHHDKDIWGEDANKFNPERFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAKMT  480

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             L  IL+ FSF+LSPSY HAP + +TT P YGAPLI  KL
Sbjct  481   LCMILQSFSFELSPSYTHAPQSLVTTQPQYGAPLIFHKL  519



>ref|XP_004243260.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=517

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/517 (57%), Positives = 393/517 (76%), Gaps = 3/517 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSI-MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             ME+  N  +    + + LV  WRV+NWAW RPK LE +LR + LKGNPY+L YGD  E+ 
Sbjct  1     MEILYNTIIAIICVAILLVYTWRVLNWAWFRPKKLENFLRQRGLKGNPYKLLYGDLNELT  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
             K + E KSK +N+ SD++  R+IP+F +SI K+GK+SF+WLG  P V+IT+P+HVKE+L+
Sbjct  61    KSIVEAKSKSINI-SDDITQRLIPFFLDSINKNGKSSFMWLGPYPTVLITNPEHVKEILT  119

Query  483   KHNTF-QQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             K+  + +Q   +P    L+QGL+  E DKW+KHRKI NPAF +EKLKHM+PA Y  CSEM
Sbjct  120   KNYVYLKQTHPNPFAKLLAQGLVLVEEDKWAKHRKIINPAFHVEKLKHMLPAFYMSCSEM  179

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             + +WE+IVS+  S ELDVWP+L+ +   VIS TAFG SYE GR +FELQ E AEH  ++ 
Sbjct  180   ISKWEDIVSKETSYELDVWPDLQIMTSEVISRTAFGSSYEEGRIVFELQQEQAEHIMDIS  239

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              S+YIPG RFLPTK+N+RM  I+K+I T ++ II+KR+ AM+ GE + ++LL +LLESN 
Sbjct  240   RSIYIPGSRFLPTKRNKRMLEIEKQIQTTIRHIIDKRLRAMEAGETSKDDLLGILLESNM  299

Query  1020  KEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             KE++ HGN++FG++  ++I ECKLFY AGQETTS LLVWTM+LL  + EWQ  AREEV+ 
Sbjct  300   KEIEQHGNKDFGLTTTEVIEECKLFYFAGQETTSVLLVWTMVLLCLHPEWQVRAREEVLQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             VFG++KPD +GL+ LKIVTMIL E+LRL+PP+P   R  KE+ KLG L LPA V L++P 
Sbjct  360   VFGNEKPDLEGLSHLKIVTMILYETLRLFPPLPVFSRRNKEEVKLGELQLPAEVILIIPA  419

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             IF+H+D E+WGEDA EF PERF EGVSKAT G+  ++PF  GPRICIG NFAM+EAK A+
Sbjct  420   IFIHYDKEIWGEDAKEFKPERFSEGVSKATKGQVSFIPFGWGPRICIGQNFAMMEAKMAI  479

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
             + IL++FSF+LSPSY HAP+  +T +P YGAPL+L+K
Sbjct  480   AMILQKFSFELSPSYTHAPFATITIHPQYGAPLLLRK  516



>ref|XP_004243258.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/504 (58%), Positives = 383/504 (76%), Gaps = 2/504 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             +  LV  WRV+NWAW RPK LEK+LR   LKGNPY+LFYGD  EI   +NE +SKP+N  
Sbjct  15    VTLLVYTWRVLNWAWFRPKKLEKYLRKSGLKGNPYKLFYGDLNEITNKVNEARSKPIN-F  73

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQ-NLADPV  521
             SD++  R+IP+F +SI K+GK SFVWLG  P V+ITDP+HVKE+ +K+  +Q+    +P 
Sbjct  74    SDDIAQRLIPFFLDSINKNGKRSFVWLGPNPAVLITDPEHVKEIFTKNYAYQKIPHPNPF  133

Query  522   VYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESG  701
                 ++GL   E DKW+KHRKI NPAF  EK KHM+PA Y+ CSEM+ +W+EI  +  S 
Sbjct  134   ANSFAKGLAFLEEDKWTKHRKIINPAFHFEKFKHMLPAFYQSCSEMISKWKEINPKGTSV  193

Query  702   ELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTK  881
             ELDVWP+++ +   VIS T+FG  YE GR++FELQ E AE+  ++ HSVYIPG RFLPTK
Sbjct  194   ELDVWPDIQLMTGEVISRTSFGSCYEEGRKVFELQREQAEYVMDMTHSVYIPGSRFLPTK  253

Query  882   KNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMS  1061
             +N+RM  I+K+I T ++ II+KR+ AM+ GE + N+LL +LLESN KE++ HGN++FGM+
Sbjct  254   RNKRMLEIEKQIQTTIRHIIDKRLRAMEAGEASKNDLLGILLESNMKEIEQHGNKDFGMT  313

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
               ++I ECKLFY AGQE  S LLVWTMILL  + EWQ  AREEV+ V G+++P+ +GLNR
Sbjct  314   TTELIEECKLFYFAGQEGNSVLLVWTMILLCLHPEWQVRAREEVLQVLGNERPNLEGLNR  373

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             L IVTMILNE+LR++PPV    R +K++ KLG LSLPAGV L +P + +H+D ++WGEDA
Sbjct  374   LHIVTMILNETLRVFPPVAMFRRRIKDEVKLGELSLPAGVLLFIPTVLIHYDKKLWGEDA  433

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
             NEF PERF EGVSKAT G+A + PF  GPRICIGLNFAM+EAK AL+ IL+ FSF+LSPS
Sbjct  434   NEFKPERFSEGVSKATKGQASFFPFGRGPRICIGLNFAMMEAKMALAMILQNFSFELSPS  493

Query  1602  YAHAPYTGLTTNPLYGAPLILQKL  1673
             YAHAP+  ++T P YGAPL+++KL
Sbjct  494   YAHAPFAVVSTQPQYGAPLLMRKL  517



>ref|XP_004243256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=516

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/517 (57%), Positives = 388/517 (75%), Gaps = 2/517 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME+   +       + L+C W+V+NWAW RPK LEK+     LKG PY+L YGD  E+ K
Sbjct  1     MEMLSKIIATICVAILLICTWKVLNWAWFRPKKLEKYFIQNGLKGKPYKLLYGDLNELTK  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
              + E KSKP+N  SD++  R+IP+F +SI K+GK+SF+WLG  P+++ITDP+HVKE+ +K
Sbjct  61    SIVEAKSKPIN-FSDDIAQRLIPFFLDSINKNGKSSFMWLGPYPVILITDPEHVKEIFTK  119

Query  486   HNTF-QQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMV  662
             +  + +Q   +P+   L+QGL   EGDKW+KHRKI NP F +EKLKHM+PA Y  CSEM+
Sbjct  120   NYVYLKQTHPNPMTKLLAQGLANIEGDKWAKHRKIINPVFHVEKLKHMLPAFYMSCSEML  179

Query  663   GRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRH  842
              +WEEIV    S ELDVWP+L+ +   VIS TAFG SYE GR +FELQ E AE+  E   
Sbjct  180   SKWEEIVPTGTSFELDVWPDLQIMTSEVISRTAFGSSYEEGRTVFELQKEQAEYVIEKGQ  239

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFK  1022
             S+YIPG RFLPTK+N+RM  I+KEI T ++ II+KR+ AM+ G+ + ++LL +LLESN K
Sbjct  240   SIYIPGSRFLPTKRNKRMLEIEKEIQTTIRCIIDKRLRAMEAGDTSKDDLLGILLESNLK  299

Query  1023  EMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             E++ HG ++FGM+I D++ ECKLFY AGQETTS LLVWTMILL  + EWQ  AREEV+ +
Sbjct  300   EIELHGKKDFGMTISDVVDECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQI  359

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG++KPD +GLNRLKIVTMIL E+LRL+PP+P   R  +E+ KL  L+LPAGV L++P I
Sbjct  360   FGNNKPDLEGLNRLKIVTMILYETLRLFPPLPIFGRRTEEEVKLRELNLPAGVLLIIPTI  419

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              +H+D E+WGEDA EF PERF EGVSKAT G+  ++PFS GPR+CIG NFAM+EAK AL+
Sbjct  420   LVHYDKEIWGEDAKEFKPERFSEGVSKATKGQVSFIPFSWGPRVCIGQNFAMMEAKMALA  479

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL+RFSF+LSPSY HAP+  +T +P YGAPL++ KL
Sbjct  480   MILQRFSFELSPSYTHAPFAVVTIHPQYGAPLLMHKL  516



>ref|XP_004243262.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/518 (57%), Positives = 396/518 (76%), Gaps = 3/518 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSI-MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             ME+  N  + +  + + LV   RV+NWAW +PK LEK+LR   LKGNPY+LFYGD  EI 
Sbjct  1     MEISYNRIIEAICVAILLVYTLRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNEIT  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
               +NE +SKP+N  SD++  R+IP+F +SI K+GK+SFVW G  P+V+ITDP+HVKE+ +
Sbjct  61    NKLNEARSKPIN-FSDDIAQRLIPFFIDSINKNGKSSFVWQGPCPIVLITDPEHVKEIFT  119

Query  483   KHNTFQQNL-ADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             K+  +Q++   +P    L+ G+LK E +KW+KHRKI NP FQ+EKLKHM+PA Y+ CSEM
Sbjct  120   KNYVYQKDTHPNPFSKFLAVGILKLEENKWAKHRKIINPVFQVEKLKHMLPAFYQSCSEM  179

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             + +WE+IV +  S ELDVWP+L+ +   +IS TAFG S+E GR +FELQ E AEH  E+ 
Sbjct  180   ISKWEDIVPKETSVELDVWPDLQLMTAEIISRTAFGSSFEEGRIVFELQKEQAEHVMEIS  239

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              ++YIPG RFLPTK+N+RM  I+K++ T ++ II+KR+ AM+ GE + N+LL +LLESN 
Sbjct  240   RTIYIPGSRFLPTKRNKRMLEIEKQVQTTIRHIIDKRLRAMEAGETSKNDLLGILLESNM  299

Query  1020  KEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             KE++ HG+++FGM+  ++I ECK FY AGQETT+ LLVWTMILL  + EWQ  AREE + 
Sbjct  300   KEIEQHGSKDFGMTTTEVIDECKFFYFAGQETTAVLLVWTMILLCLHPEWQARAREEALQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             VFG++KP+ +GL+RLKIVT+IL+E+LRL+PPV T  R  K + KLG LSLPAGV L +P 
Sbjct  360   VFGNEKPNLEGLSRLKIVTIILHETLRLFPPVATYRRRNKHEVKLGELSLPAGVLLFIPT  419

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             + +H+D E+WGEDANEF PERF EGVSKAT G   ++PFSGGPR+CIG NFAM+EAK A+
Sbjct  420   VLIHYDKELWGEDANEFKPERFSEGVSKATKGHFSFIPFSGGPRVCIGQNFAMMEAKLAI  479

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + IL++FSF+LSPSY HAP + +T +P YGAPL+++KL
Sbjct  480   AMILQKFSFELSPSYTHAPSSTITIHPQYGAPLLMRKL  517



>ref|XP_009758460.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=525

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/498 (59%), Positives = 386/498 (78%), Gaps = 2/498 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
              W+V+NWAW RPK +E  LR + LKGNPY+L YGD  E+ K + E KSKP+N  SD++  
Sbjct  29    TWKVLNWAWFRPKKMENCLRQRGLKGNPYKLLYGDLNELTKSVIEAKSKPIN-FSDDIAQ  87

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQ-QNLADPVVYKLSQ  539
             R+IP+F  +I K+GKNSFVWLG  P+V+ITDP+H+KE+ +K+  +Q Q   +P    L+ 
Sbjct  88    RLIPFFLNAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKLLAH  147

Query  540   GLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWP  719
             GL+  E DKW+KHRKI NPAF ++KLKHM+P+ Y  CSEM+ +WEE+V +  S ELD+WP
Sbjct  148   GLISLEEDKWAKHRKIINPAFHVQKLKHMLPSFYLSCSEMISKWEEVVPKETSFELDIWP  207

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
             +L+ +   VIS TAFG SYE GR +FELQ E AE+  E+  S+YIPG RFLPTK+N+RM 
Sbjct  208   DLQIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMEIGRSIYIPGSRFLPTKRNKRML  267

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIIS  1079
              I+K++ T +KRII+KR+ AM+EGE + ++LL +LLESN KE++ HG +EFG++  ++I 
Sbjct  268   EIEKQVQTTIKRIIDKRLKAMEEGETSKDDLLGILLESNLKEIELHGRKEFGITTSEVIE  327

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AGQETTS LLVWTMILL  + EWQ  AREEV+ VFG+DKPD +GL+RLKIVTM
Sbjct  328   ECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDKPDLEGLSRLKIVTM  387

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             IL E+LRL+PP+P   R  KE+ KLG L LPAGV L++P I +H+D E+WGEDA EF PE
Sbjct  388   ILYETLRLFPPLPAFGRRNKEEVKLGKLHLPAGVLLIIPAILVHYDKEIWGEDAKEFKPE  447

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF+EGVSKATNG+  ++PFS GPR+CIG NFAM+EAK A++ IL++FSF+LSPSY HAP+
Sbjct  448   RFKEGVSKATNGQVSFIPFSWGPRVCIGQNFAMMEAKMAVAMILQKFSFELSPSYTHAPF  507

Query  1620  TGLTTNPLYGAPLILQKL  1673
               +T +P YGAPL++++L
Sbjct  508   AIVTIHPQYGAPLLMRRL  525



>ref|XP_006348304.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/519 (56%), Positives = 381/519 (73%), Gaps = 0/519 (0%)
 Frame = +3

Query  117   MMRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKE  296
             M ++E+   +   + +I   VC W+V+NW W  PK LEK LR Q L GN YRL YGD K+
Sbjct  1     MEKIEMIVTICCCATAITLFVCLWKVLNWVWFNPKKLEKLLRKQGLNGNSYRLLYGDMKD  60

Query  297   IAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEV  476
             ++ M+ E  SKPMN+    + PR++P+F E+I+K+GK SF+W+G  P ++I DP+ +KEV
Sbjct  61    LSGMIKEANSKPMNMSDHNLAPRMVPFFLETIKKYGKKSFIWMGPRPQILIMDPELIKEV  120

Query  477   LSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSE  656
             LSK+  +Q+   +P+     QGL+ YE DKW+KHRKI NPAF LEKLKHM+PA Y  CSE
Sbjct  121   LSKNYVYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSE  180

Query  657   MVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASEL  836
             M+ +WE++V    S E+DVWP L+ +  +VIS TAFG SYE GR++FELQ E A+H  E+
Sbjct  181   MLSKWEDVVQVEGSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQQEQAQHFLEV  240

Query  837   RHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESN  1016
               SVYIPG RFLPTK+NRRM  I K++ + ++ II+KR+ AM+ G   + +LL +LLESN
Sbjct  241   IRSVYIPGWRFLPTKRNRRMKEIKKDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESN  300

Query  1017  FKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
             FKE++ HGN++FGMSIE++I ECKLFY AG ETTS  ++WT++LLSR  +WQ  AREEV+
Sbjct  301   FKEIELHGNKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRYPDWQARAREEVL  360

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              VFG  KPDFDGLN LK+VTMIL ESLRLY P+  L R + ED  LG +SLP GV + +P
Sbjct  361   QVFGSRKPDFDGLNHLKVVTMILYESLRLYSPITVLARRIYEDITLGEVSLPTGVLVSLP  420

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
             II LHHD ++WGEDAN+FNPERFREG+S AT G+  Y PF+ GPRICIG NFAM+EAK  
Sbjct  421   IILLHHDKDIWGEDANKFNPERFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAKMT  480

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +  IL+ F F+LSPSY HAP + +TT P YGAPLI  KL
Sbjct  481   VCMILQSFFFELSPSYTHAPQSLVTTQPQYGAPLIFHKL  519



>ref|XP_004243259.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/518 (57%), Positives = 394/518 (76%), Gaps = 3/518 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIM-FLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             ME+  N  + +  ++  LV  WRV+NWAW +PK LEK+LR   LKGNPY+L YGD+KE+ 
Sbjct  1     MEISYNRIIEAICVVTLLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLLYGDSKELT  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
               +NE +SKP+N  SD++  R++P+F +SI K+GK+SFVWLG  P+V+IT P+HVKE+ +
Sbjct  61    NKLNEARSKPIN-FSDDIAQRLVPFFIDSINKNGKSSFVWLGPCPIVLITYPEHVKEIFT  119

Query  483   KHNTFQ-QNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             K+  +Q Q   +P    L+ GL   E DKW+KHRKI NPAF +EKLKHM+PA Y+ C+EM
Sbjct  120   KNCAYQKQAHPNPFAKLLAIGLALLEEDKWAKHRKIINPAFHVEKLKHMLPAFYQSCTEM  179

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             + +WEEI+ +  S ELDVWP+L+ +   VIS TAFG SYE GR +FELQ E AE+  ++ 
Sbjct  180   LSKWEEIIQKETSVELDVWPDLQLMTGEVISRTAFGSSYEEGRIVFELQKEQAEYVIDIT  239

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              SVYIPG RFLPTKKN+RM  I+K++ T ++RII+KR+ AM+ GE + N+LL +LLESN 
Sbjct  240   RSVYIPGSRFLPTKKNKRMLEIEKQVQTTIRRIIDKRLRAMEAGEPSKNDLLGILLESNM  299

Query  1020  KEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             KE++ HG+++FGM+  ++I ECKLFY AGQE TS LLVWTMILLS + EWQ  AREEV+ 
Sbjct  300   KEIEQHGSKDFGMTTIELIEECKLFYFAGQEATSVLLVWTMILLSVHPEWQVRAREEVLQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             VFG++KP+ +GL+RLKIVTMIL+E+LRL+PPVPT  R    + KLG LSLPAGV L +P 
Sbjct  360   VFGNEKPNLEGLSRLKIVTMILHETLRLFPPVPTYRRRNIHEVKLGELSLPAGVLLFIPT  419

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             + +H+D E+WGEDA EF PERF EGVS AT G+  ++PF  GPRICIG NFAM+EAK A+
Sbjct  420   VLIHYDKELWGEDAKEFKPERFSEGVSNATKGQVSFIPFGWGPRICIGQNFAMMEAKMAI  479

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + IL++F F+LSPSY+HAP   +TT P YGAPL+++KL
Sbjct  480   AMILQKFCFELSPSYSHAPVAIITTQPQYGAPLLMRKL  517



>ref|XP_006363756.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=519

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/519 (55%), Positives = 389/519 (75%), Gaps = 1/519 (0%)
 Frame = +3

Query  120   MRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEI  299
             M +  +  L LF  +I F++ AWR+++WAW RP+ LEK LR Q LKGN Y+L YGD KE+
Sbjct  1     MEIVTYHFLALFLLAITFVIYAWRLLDWAWFRPRKLEKCLRKQGLKGNSYKLIYGDIKEL  60

Query  300   AKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVL  479
             +K + + KSKP+N   D++ PR++PYF ++I+K+GKN F+W+G  P+VI+ DP+ +++V 
Sbjct  61    SKSIEDAKSKPLNASDDDLTPRILPYFVQTIKKYGKNCFIWVGPKPLVIVGDPEVIRDVF  120

Query  480   SKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             +KH  +Q+    P    L++G+L YE DKW+KHR+I NPAF +EK+K M+  ++  CSEM
Sbjct  121   NKHALYQKPKYPPQTKLLAKGILSYEDDKWAKHRRILNPAFHMEKIKDMLHTVHLSCSEM  180

Query  660   VGRWEEIVSRNESG-ELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASEL  836
             V +WEE VS  ES  ELD+WP L+ +  +VIS TAFG +YE GR++FELQ E A+H  E+
Sbjct  181   VSQWEEAVSMKESSTELDIWPYLQRLTSDVISRTAFGSNYEEGRKIFELQKEQAKHVIEV  240

Query  837   RHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESN  1016
               ++YI G RFLPTK+NRRM  I++E+   ++ II+KR+  MK GE  +++LL +LLESN
Sbjct  241   SRTLYILGWRFLPTKRNRRMKEIEREVQATIRGIIDKRVKGMKAGEANTDDLLGILLESN  300

Query  1017  FKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
             FKE++ HGN+ FGM+I+D+I ECKLF+ AGQETTS  LVWTMILLSR+ +WQ  AREEV+
Sbjct  301   FKEIEQHGNKNFGMTIKDVIEECKLFFFAGQETTSVWLVWTMILLSRHPDWQVRAREEVL  360

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              +FGD  P+FDGLNRLK+VTMIL+ESLRLYPP   L R +    KLG L+LP GV L +P
Sbjct  361   QLFGDGMPEFDGLNRLKVVTMILHESLRLYPPTAALGRRITTKMKLGKLNLPEGVMLSLP  420

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
              I +HHD E+WGEDA +F PE+F EG+SKAT G+  + PF  GPRICIGLNFAM+EAK A
Sbjct  421   TILVHHDKEIWGEDATKFKPEKFSEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMA  480

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             ++ IL+RF+F+LSPSY HAP + +T  P YGAPL+L KL
Sbjct  481   MAMILQRFAFELSPSYTHAPQSVITMQPKYGAPLMLHKL  519



>ref|XP_006348909.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/518 (58%), Positives = 395/518 (76%), Gaps = 3/518 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSI-MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             ME+  N  + + S+ + LV  W+V+NWAW +PK LEK+LR   LKGN Y+L YGD KE+ 
Sbjct  1     MEISYNRIIAAISVAILLVYTWKVLNWAWFKPKKLEKYLRKSGLKGNKYKLLYGDLKELT  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
               +NE KSKP++  S +V  R+IP+F +SI K+GK+SF+WLG  P+V+ITDP+HVKE+L+
Sbjct  61    NKLNEAKSKPIH-FSGDVPQRLIPFFCDSINKNGKSSFMWLGPYPVVLITDPEHVKEILT  119

Query  483   KHNTFQ-QNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             K+  +Q Q   +P   KL+ GL K E DKW+KHRKI  PAFQLEKLKHM+PA Y+ CSEM
Sbjct  120   KNYVYQRQTHPNPFAKKLALGLAKLEEDKWAKHRKIIQPAFQLEKLKHMLPAFYQSCSEM  179

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             + +WEEI+ +  S ELDVWP+L+ I   VIS TAFG SYE GR +FELQ E AE+   + 
Sbjct  180   ISKWEEIIPKETSFELDVWPDLQLITAEVISRTAFGSSYEEGRIVFELQKEQAEYVINII  239

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              SVYIPG RFLPTK+N+RM  I+K++ T ++RII+KR+ AM+ GE + ++LL +LLESN 
Sbjct  240   RSVYIPGTRFLPTKRNKRMLEIEKQVQTTIRRIIDKRLRAMEAGETSKDDLLGILLESNM  299

Query  1020  KEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             +E++ H +++FG++  ++I ECKLFY AGQET S LLVWTMILLS + EWQ  AREEV+ 
Sbjct  300   REIEQHRSKDFGITTIEMIEECKLFYFAGQETASVLLVWTMILLSLHPEWQARAREEVLQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             VFG++KP+ +GL+ LKI+TMIL+E+LRL+P VPT  R  K + KLG LSLPAGV L++P 
Sbjct  360   VFGNEKPNSEGLSHLKIMTMILHETLRLFPSVPTYRRRNKHEVKLGELSLPAGVLLIIPT  419

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             I +H+D E+WGEDA EF PERF EGVSKAT G+  ++PF GGPR+CIG NFAM+EAK A+
Sbjct  420   ILIHYDKELWGEDAKEFKPERFSEGVSKATKGQVSFIPFGGGPRVCIGQNFAMMEAKMAI  479

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + IL++FSF+LSPSY HAP   +  +P YGAPL+L+KL
Sbjct  480   AMILQKFSFELSPSYTHAPLVTINIHPQYGAPLLLRKL  517



>ref|XP_009615907.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/501 (58%), Positives = 387/501 (77%), Gaps = 2/501 (0%)
 Frame = +3

Query  174   LVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDE  353
             LV  W+V+NWAW  PK +EK LR + LKGNPY+L YGD  E+ K + E KSKP+N  SD+
Sbjct  17    LVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPIN-FSDD  75

Query  354   VVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQ-QNLADPVVYK  530
             +  R+IP+F ++I K+GKNSFVWLG  P+V+ITDP+H+KE+ +K+  +Q Q   +P    
Sbjct  76    IAQRLIPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKL  135

Query  531   LSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELD  710
             L+ GL+  E DKW+KHRKI +PAF +EKLKHM+PA Y  CSEM+ +WEE+V +  S ELD
Sbjct  136   LAHGLVSLEEDKWAKHRKIISPAFHVEKLKHMLPAFYLSCSEMISKWEEVVPKETSFELD  195

Query  711   VWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNR  890
             VWP+L+ +   VIS TAFG SYE GR +FELQ E AE+  ++  S+YIPG RFLPTK+N+
Sbjct  196   VWPDLQIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMDIGRSIYIPGSRFLPTKRNK  255

Query  891   RMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIED  1070
             RM  I+K++ T ++RII+KR+ AM+EGE + ++LL +LLESN KE++ HG  +FG++  +
Sbjct  256   RMLEIEKQVQTTIRRIIDKRLKAMEEGETSKDDLLGILLESNLKEIELHGRNDFGITTSE  315

Query  1071  IISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKI  1250
             +I ECKLFY AGQETTS LLVWTMILL  + EWQ  AR+EV+ +FG+DKPD +GL+RLKI
Sbjct  316   VIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRARKEVLQIFGNDKPDLEGLSRLKI  375

Query  1251  VTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEF  1430
             VTMIL E+LRL+PP+P   R  KE+ KLG L LPAGV L++P I +H+D E+WGEDA EF
Sbjct  376   VTMILYETLRLFPPLPAFGRRNKEEVKLGELHLPAGVLLVIPAILVHYDKEIWGEDAKEF  435

Query  1431  NPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAH  1610
              PERF EGVSKATNG+  ++PFS GPR+CIG NFAM+EAK A++ IL++FSF+LSPSY H
Sbjct  436   KPERFSEGVSKATNGQVSFIPFSWGPRVCIGQNFAMMEAKMAVTMILQKFSFELSPSYTH  495

Query  1611  APYTGLTTNPLYGAPLILQKL  1673
             AP+  +T +P YGAPL++++L
Sbjct  496   APFAIVTIHPQYGAPLLMRRL  516



>gb|ABC69419.1| CYP72A56 [Nicotiana tabacum]
Length=516

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/501 (58%), Positives = 386/501 (77%), Gaps = 2/501 (0%)
 Frame = +3

Query  174   LVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDE  353
             LV  W+V+NWAW  PK +EK LR + LKGNPY+L YGD  E+ K + E KSKP+N  SD+
Sbjct  17    LVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPIN-FSDD  75

Query  354   VVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQ-QNLADPVVYK  530
             +  R+IP+F ++I K+GKNSFVWLG  P+V+ITDP+H+KE+ +K+  +Q Q   +P    
Sbjct  76    IAQRLIPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKL  135

Query  531   LSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELD  710
             L+ GL+  E DKW+KHRKI +PAF +EKLKHM+PA Y  CSEM+ +WEE+V +  S ELD
Sbjct  136   LAHGLVSLEEDKWAKHRKIISPAFHVEKLKHMLPAFYLSCSEMISKWEEVVPKETSFELD  195

Query  711   VWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNR  890
             VWP+L+ +   VIS TAFG SYE GR +FELQ E AE+  ++  S+YIPG RFLPTK+N+
Sbjct  196   VWPDLQIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMDIGRSIYIPGSRFLPTKRNK  255

Query  891   RMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIED  1070
             RM  I+K++ T ++RII+KR+ AM+EGE + ++LL +LLESN KE++ HG  + G++  +
Sbjct  256   RMLEIEKQVQTTIRRIIDKRLKAMEEGETSKDDLLGILLESNLKEIELHGRNDLGITTSE  315

Query  1071  IISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKI  1250
             +I ECKLFY AGQETTS LLVWTMILL  + EWQ  AR+EV+ +FG+DKPD +GL+RLKI
Sbjct  316   VIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRARKEVLQIFGNDKPDLEGLSRLKI  375

Query  1251  VTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEF  1430
             VTMIL E+LRL+PP+P   R  KE+ KLG L LPAGV L++P I +H+D E+WGEDA EF
Sbjct  376   VTMILYETLRLFPPLPAFGRRNKEEVKLGELHLPAGVLLVIPAILVHYDKEIWGEDAKEF  435

Query  1431  NPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAH  1610
              PERF EGVSKATNG+  ++PFS GPR+CIG NFAM+EAK A++ IL++FSF+LSPSY H
Sbjct  436   KPERFSEGVSKATNGQVSFIPFSWGPRVCIGQNFAMMEAKMAVTMILQKFSFELSPSYTH  495

Query  1611  APYTGLTTNPLYGAPLILQKL  1673
             AP+  +T +P YGAPL++++L
Sbjct  496   APFAIVTIHPQYGAPLLMRRL  516



>ref|XP_006348302.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/519 (59%), Positives = 381/519 (73%), Gaps = 1/519 (0%)
 Frame = +3

Query  117   MMRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKE  296
             M ++++   +  F+ +I   VC W+V+NW W  PK LE  LR Q L GN Y++ YGD  +
Sbjct  1     MDKIQILVTVCCFAIAIALFVCLWKVLNWVWFNPKKLENLLRKQGLNGNSYKILYGDLND  60

Query  297   IAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEV  476
                M+ E  SKPMN LSD++ PR++P+F E+I+K+GK  F+WLG  P VII DP  +KEV
Sbjct  61    FIGMIREATSKPMN-LSDDIAPRLVPFFLETIKKYGKKCFIWLGPKPQVIIMDPKLIKEV  119

Query  477   LSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSE  656
             LSK   +Q+   +P    L QGL  YE DKW+KHRKI NPAF LEKLKHM+PA +  C+E
Sbjct  120   LSKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLCCTE  179

Query  657   MVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASEL  836
             M+G+ E+ +    S E+DVWP L+ +  +VIS TAFG SYE GR++FELQ E A++  + 
Sbjct  180   MLGKLEDAIPVGSSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQKEQAQNFIDA  239

Query  837   RHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESN  1016
                VY+PG RFLPTK+NRRM  I  E+ T +K II+KR+ AMK G   + +LL +LLESN
Sbjct  240   VREVYVPGRRFLPTKRNRRMKEIKNEVRTSVKGIIDKRMKAMKAGNADNEDLLGILLESN  299

Query  1017  FKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
             FKE++ HGN++FGMSIE++I ECKLFY AGQETTS LLVWT++LLSRNQ+WQ  AREEV+
Sbjct  300   FKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLVLLSRNQDWQTQAREEVL  359

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              VFG  KPDFDGLN LK+VTMIL ESLRLYPP+ TL R V ED  LG LSLPAGV + +P
Sbjct  360   QVFGSRKPDFDGLNHLKVVTMILYESLRLYPPLITLNRQVNEDIVLGELSLPAGVLVSLP  419

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
             +I LHHD E+WGEDAN+FNPERFREG+S AT G+  Y PFS GPRICIG NFAM+EAK A
Sbjct  420   VILLHHDEEVWGEDANKFNPERFREGLSSATKGQVTYFPFSWGPRICIGQNFAMLEAKMA  479

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             L  IL+ FSF+LSPSY HAP   +T  P +GAPLIL KL
Sbjct  480   LCMILQSFSFELSPSYTHAPKAIVTMQPQFGAPLILHKL  518



>ref|XP_004244272.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=514

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/511 (56%), Positives = 374/511 (73%), Gaps = 0/511 (0%)
 Frame = +3

Query  141   NLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNET  320
              +F  + +I   VC W+V+NW W +PK LEK LR Q L GN YR  YGD K+ +KM+ E 
Sbjct  4     TIFCCAIAITLFVCLWKVLNWVWFQPKKLEKLLRKQGLNGNSYRFLYGDMKDFSKMIKEA  63

Query  321   KSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQ  500
              SKPMN+   ++ PR++P+F E+I+K+GK  F W+G  P ++I DP+ +KEVLSK   +Q
Sbjct  64    NSKPMNMDDHDLAPRMVPFFLETIKKYGKKCFTWMGPRPQILIMDPELIKEVLSKTYVYQ  123

Query  501   QNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEI  680
             +   +P+     QGL+ YE DKW+KHRKI NPAF LEKLKHM+PA Y  CSEM+ +WE++
Sbjct  124   KPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSEMLSKWEDV  183

Query  681   VSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPG  860
             V    S E+DVWP L+ +  +VIS TAFG SYE GR++FELQ E A+H  E+  SVYIPG
Sbjct  184   VRVEGSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQKEQAQHFLEVIRSVYIPG  243

Query  861   GRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG  1040
              RFLPTK+NRRM  +  ++ + ++ II+KR+ AM+ G   + +LL +LLESNFKE++ HG
Sbjct  244   WRFLPTKRNRRMKELKNDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESNFKEIELHG  303

Query  1041  NQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKP  1220
             N++FGMSIE++I ECKLFY AG ETTS  ++WT++LLSR+ +WQE AREEV+ V G  KP
Sbjct  304   NKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRHPDWQERAREEVLQVLGSRKP  363

Query  1221  DFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDP  1400
             DFDGLN LK+VTMIL ESLRLY P+  L R V ED  LG +SLP GV + +P+I LHHD 
Sbjct  364   DFDGLNHLKVVTMILYESLRLYSPITVLTRRVYEDITLGEVSLPTGVLVSLPMILLHHDK  423

Query  1401  EMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRF  1580
             ++WGEDA +FNPERF EG+S AT G+  Y PF+ GPRICIG NFA++EAK  L  IL+ F
Sbjct  424   DIWGEDATKFNPERFSEGISSATKGQVTYFPFAWGPRICIGQNFAILEAKMTLCMILQSF  483

Query  1581  SFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             SF+LSPSY HAP + +TT P YGAPLI  KL
Sbjct  484   SFELSPSYTHAPQSLVTTQPQYGAPLIFHKL  514



>emb|CDP15976.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/523 (56%), Positives = 387/523 (74%), Gaps = 4/523 (1%)
 Frame = +3

Query  126   MEV-FCNLFLFSFSIMFL--VCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKE  296
             ME+ +  + +FS  I+ L  V AWR   WAW+ PK LEK L+ Q L+GNPY+L YGD KE
Sbjct  1     MEIAYSPIAVFSSCILLLISVLAWRAFKWAWLTPKKLEKRLKEQGLRGNPYKLLYGDFKE  60

Query  297   IAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEV  476
             IA    E  SKP+NV S++ +PRVIP+F  +++K+G+N+++W G  PMV+I +P+H++E+
Sbjct  61    IATHFKEAHSKPINV-SEDFIPRVIPHFCAAVKKYGENTYIWHGPKPMVLILNPEHIREI  119

Query  477   LSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSE  656
              +K   FQ+  A+P+   L+ GL+ Y+GDKW+KHRK+  PAF +EKLKHMVP+ Y   SE
Sbjct  120   TTKLYIFQKAPANPLTKLLATGLVSYDGDKWAKHRKLITPAFHVEKLKHMVPSFYASASE  179

Query  657   MVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASEL  836
             M+ +WE IVS N S ELDVWP+++T+  + IS TAFG +Y+ G+R+FELQ E AEH  + 
Sbjct  180   MLDKWEAIVSTNGSCELDVWPDIQTLTSDAISRTAFGSNYQEGKRIFELQREQAEHFLKA  239

Query  837   RHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESN  1016
               SVYIPG RFLPTK NRRM  I K++   ++ II  R+ AMKEGE  +++LL +LLESN
Sbjct  240   VESVYIPGWRFLPTKLNRRMKQIAKDVQESIREIINARLKAMKEGEACADDLLGILLESN  299

Query  1017  FKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
              KE+  HGN++FGM+I D+I ECKLFY AGQETTS +LVWTM+LLSR+  WQ  AREEV+
Sbjct  300   SKEIDDHGNKDFGMTIGDVIEECKLFYFAGQETTSVMLVWTMVLLSRHPNWQARAREEVL  359

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
               FG++KPDF GLN LK+VTMIL+E LRLYPPVP + R   ED +LGNL+LPA V++ +P
Sbjct  360   QHFGNNKPDFKGLNHLKLVTMILHEVLRLYPPVPAIPRRTDEDIQLGNLTLPAQVQVSLP  419

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
              I LH+DPE+WG+D  EF PERF +GVS AT G+  Y PF  GPRICIG NFAM+EAK A
Sbjct  420   AILLHYDPEIWGDDVEEFKPERFADGVSNATKGQTAYFPFGWGPRICIGQNFAMLEAKLA  479

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL*FQN  1685
             ++ +L+RFSF+LSPSY HAP   +T  P YGA LIL KL ++ 
Sbjct  480   VAMLLQRFSFELSPSYTHAPRAVITIQPQYGARLILHKLQYET  522



>gb|ABC69422.1| CYP72A58 [Nicotiana tabacum]
Length=513

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/503 (61%), Positives = 381/503 (76%), Gaps = 1/503 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             I  LVC WRV+NW W RPK LE  LR Q L+GN Y++ YGD KE + M+ E  SKPM+ L
Sbjct  12    ITLLVCIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMIKEAYSKPMS-L  70

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             SD+V PR++P+F E+I+K+GK SF+W G  P+V+I DP+ +KEVLSK + +Q+   +P+ 
Sbjct  71    SDDVAPRLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKIHLYQKPGGNPLA  130

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L QG+  YE DKW+KHRKI NPAF LEKLK M+PA    CSEM+ +WE+IVS + S E
Sbjct  131   TLLVQGIATYEEDKWAKHRKIINPAFHLEKLKLMLPAFRLSCSEMLSKWEDIVSADSSHE  190

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             +DVW  L+ +  +VIS TAFG SYE GR++FELQ E A++  E+  SVYIPG RFLPTK+
Sbjct  191   IDVWSHLEQLTCDVISRTAFGSSYEEGRKIFELQKEQAQYLVEVFRSVYIPGRRFLPTKR  250

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSI  1064
             NRRM  I K++   +K II+KR+ AMK G+  + +LL +LLESN KE++ HGN++FGMSI
Sbjct  251   NRRMKEIKKDVRASIKGIIDKRLKAMKAGDTNNEDLLGILLESNIKEIEQHGNKDFGMSI  310

Query  1065  EDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRL  1244
             E++I ECKLFY AGQETTS LL+W+++LLSR Q+WQ  AREE++ VFG  KPDFDGLN L
Sbjct  311   EEVIEECKLFYFAGQETTSVLLLWSLVLLSRYQDWQARAREEILQVFGSRKPDFDGLNHL  370

Query  1245  KIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDAN  1424
             KIVTMIL ESLRLYP + TL R   ED  LG LSLPAGV + +P+I LHHD E+WGEDA 
Sbjct  371   KIVTMILYESLRLYPSLITLTRRCNEDIVLGELSLPAGVLVSLPLILLHHDEEIWGEDAK  430

Query  1425  EFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSY  1604
             EF PERFREG+S AT G+  Y PFS GPRICIG NFAM+EAK ALS IL+RFSF+LSPSY
Sbjct  431   EFKPERFREGISSATKGQLTYFPFSWGPRICIGQNFAMLEAKMALSMILQRFSFELSPSY  490

Query  1605  AHAPYTGLTTNPLYGAPLILQKL  1673
             AHAP + +T  P YGAPLI  KL
Sbjct  491   AHAPRSIITVQPQYGAPLIFHKL  513



>dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis]
Length=522

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/504 (59%), Positives = 378/504 (75%), Gaps = 2/504 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             ++ +  AWR++NW W+RPK LE+ LR Q L+GNPYRL  GD K++ KM  E KSKPMN L
Sbjct  18    VLAVTWAWRMLNWLWLRPKKLERLLREQGLQGNPYRLIVGDLKDLMKMRKEAKSKPMN-L  76

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             SD+++PRV PY  +S+ KHGKNSF+W G IP V +TDP+ +K+VL+K   F ++  D +V
Sbjct  77    SDDILPRVFPYVQQSVTKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFPKSDGDRLV  136

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L+ GL+ YEG+KWSKHR+I NPAF LEKLK M+P  ++ C++++ +WE ++S + S E
Sbjct  137   KLLATGLVSYEGEKWSKHRRIINPAFNLEKLKIMLPIFFQSCNDLITKWEGMLSSDGSCE  196

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             +D+WP L+ +A +VI+  AFG SYE GRR+F+LQ E  EH   +   VYIPG RFLPT  
Sbjct  197   MDIWPFLQNLASDVIARAAFGSSYEEGRRIFQLQKEQVEHTMSVLVKVYIPGWRFLPTTT  256

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMS  1061
             +RRM  ID+EI   LK +I KR  A+K GE   NNLLD+LLESN KE++ HGN +  GMS
Sbjct  257   HRRMKKIDREIKASLKEMINKRERALKAGEATKNNLLDILLESNHKEVEEHGNNRNVGMS  316

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             +ED+I ECKLFY AGQETTS LLVWTM+LLSR  +WQ  AREEV+ VFG+ KPDFDGL+ 
Sbjct  317   LEDVIEECKLFYFAGQETTSGLLVWTMVLLSRYPDWQARAREEVLQVFGNKKPDFDGLSH  376

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LKIVTMIL E LRLYPPV  L R V +D KLGN +LPAGV+L +PI+  HHD E+WG+DA
Sbjct  377   LKIVTMILYEVLRLYPPVIALARTVHKDVKLGNRTLPAGVQLYLPIVLFHHDRELWGDDA  436

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
               FNPERF EGV KATNGK  + PF  GPRIC+G NF+++EAK A+S IL+ FSF+LSP+
Sbjct  437   EVFNPERFSEGVLKATNGKVSFFPFGWGPRICVGQNFSLLEAKMAVSMILQHFSFELSPA  496

Query  1602  YAHAPYTGLTTNPLYGAPLILQKL  1673
             YAHAP T +T  P YGA +IL+K+
Sbjct  497   YAHAPTTVITLRPQYGAHIILRKV  520



>ref|XP_009797873.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=519

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/503 (61%), Positives = 381/503 (76%), Gaps = 1/503 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             I  LVC WRV+NW W RPK LE  LR Q L+GN Y++ YGD KE + M+ E  SKPM+ L
Sbjct  18    ITLLVCIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMIKEAYSKPMS-L  76

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             SD+V PR++P+F E+I+K+GK SF+W G  P+V+I DP+ +KEVLSK + +Q+   +P+ 
Sbjct  77    SDDVAPRLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKIHLYQKPGGNPLA  136

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L QG+  YE DKW+KHRKI NPAF LEKLK M+PA    CSEM+ +WE+IVS + S E
Sbjct  137   TLLVQGIATYEEDKWAKHRKIINPAFHLEKLKLMLPAFRLSCSEMLSKWEDIVSADSSHE  196

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             +DVW  L+ +  +VIS TAFG SYE GR++FELQ E A++  E+  SVYIPG RFLPTK+
Sbjct  197   IDVWSHLEQLTCDVISRTAFGSSYEEGRKIFELQKEQAQYLVEVFRSVYIPGRRFLPTKR  256

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSI  1064
             NRRM  I K++   +K II+KR+ AMK G+  + +LL +LLESN KE++ HGN++FGMSI
Sbjct  257   NRRMKEIKKDVRASIKGIIDKRLKAMKAGDTNNEDLLGILLESNIKEIEQHGNKDFGMSI  316

Query  1065  EDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRL  1244
             E++I ECKLFY AGQETTS LL+W+++LLSR Q+WQ  AREE++ VFG  KPDFDGLN L
Sbjct  317   EEVIEECKLFYFAGQETTSVLLLWSLVLLSRYQDWQARAREEILQVFGSRKPDFDGLNHL  376

Query  1245  KIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDAN  1424
             KIVTMIL ESLRLYP + TL R   ED  LG LSLPAGV + +P+I LHHD E+WGEDA 
Sbjct  377   KIVTMILYESLRLYPSLITLTRRCNEDIVLGELSLPAGVLVSLPLILLHHDEEIWGEDAK  436

Query  1425  EFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSY  1604
             EF PERFREG+S AT G+  Y PFS GPRICIG NFAM+EAK ALS IL+RFSF+LSPSY
Sbjct  437   EFKPERFREGISSATKGQLTYFPFSWGPRICIGQNFAMLEAKMALSMILQRFSFELSPSY  496

Query  1605  AHAPYTGLTTNPLYGAPLILQKL  1673
             AHAP + +T  P YGAPLI  KL
Sbjct  497   AHAPRSIITVQPQYGAPLIFHKL  519



>ref|XP_006348911.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/511 (58%), Positives = 387/511 (76%), Gaps = 1/511 (0%)
 Frame = +3

Query  144   LFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETK  323
             L  F  +I  ++ AW++++WAW RP+ LEK LR Q LKGN Y+L +GD KE+AK   +  
Sbjct  8     LVSFLLTITIVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELAKSFEDAN  67

Query  324   SKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQ  503
             SKP+ V  D++ PR++PYF ++I+KHGKN F+W+G  PMV++ +P+ +++V +K+  +Q+
Sbjct  68    SKPLKVSDDDICPRIVPYFVDTIKKHGKNCFIWIGPKPMVLVREPEVIRDVFNKYVLYQK  127

Query  504   NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIV  683
               + P+   L+QG+  YE DKW  HRKI NPAF +EK+K MVPA++  C+EMV +WEE +
Sbjct  128   PKSTPITKLLAQGVSSYEEDKWEMHRKILNPAFHMEKIKSMVPAVHLSCTEMVSQWEESI  187

Query  684   S-RNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPG  860
             S +  S E+D+WP L+ +  +VIS TAFG +YE GR++FELQ ELA+H  E   ++YIPG
Sbjct  188   STKGTSCEIDIWPYLQRLTSDVISRTAFGSNYEEGRKIFELQKELAQHVIEATRTLYIPG  247

Query  861   GRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG  1040
              RFLPTKKNRRM  IDK++  +++ II+KR+ A+K GE  +++LL MLLESNFK+++ HG
Sbjct  248   SRFLPTKKNRRMKEIDKKVQAMIRGIIDKRVKALKAGEANTDDLLGMLLESNFKQIEQHG  307

Query  1041  NQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKP  1220
             N++FGM+  +II ECKLFY AGQETTS LL W MILLS++ +WQ  AREEV+ VFGD K 
Sbjct  308   NKDFGMTTREIIEECKLFYFAGQETTSVLLGWAMILLSKHPDWQAHAREEVLQVFGDGKL  367

Query  1221  DFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDP  1400
             +FDGLNRLKIVTMILNE+LRLYPPV    R    + KLG LSLPAGV LL+PII LHHD 
Sbjct  368   EFDGLNRLKIVTMILNETLRLYPPVDATSRKTTTNTKLGELSLPAGVMLLLPIILLHHDK  427

Query  1401  EMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRF  1580
             E+WGEDA EF PERF EGVSKAT G+  + PF GGPRICIGLNFAM+EAK AL+ IL+ F
Sbjct  428   EIWGEDATEFKPERFSEGVSKATKGQMTFFPFGGGPRICIGLNFAMIEAKMALAMILQHF  487

Query  1581  SFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             SF+LSPSY HAP + +T  P YGAPLIL +L
Sbjct  488   SFELSPSYTHAPQSVITIQPQYGAPLILHRL  518



>ref|XP_009796418.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/503 (58%), Positives = 384/503 (76%), Gaps = 2/503 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             I+FL   W+ +NW WI+PK +EK L+ +  KG+ Y+L +GD KEI  M+ E K+KPMN  
Sbjct  17    IIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKEINTMVEEAKTKPMNFT  76

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             +D  V RV+P+F + + ++GKNSF+WLG  P + ITDP+ ++E+LSK   +Q+   +P+ 
Sbjct  77    ND-YVARVLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREILSKSYIYQKIQGNPIT  135

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L+QGL+ YE +KW+KHRKI NPAF L+KLKHM+P+ Y  C +M+ +WE I S +E  E
Sbjct  136   KLLAQGLVSYEAEKWAKHRKIINPAFHLDKLKHMLPSFYLSCCDMLRKWESIAS-SEGSE  194

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             +DVWP L+T+  + IS TAFG +YE GR++FELQ E AE   +    +YIPG RF+PTK+
Sbjct  195   IDVWPFLETLTSDAISRTAFGSNYEDGRQIFELQKEQAELILQAARWLYIPGWRFVPTKR  254

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSI  1064
             N+RM  I KE+ +++  II KRI  MK GE A ++LL +LLESNFKE++ HGN+ FGM+I
Sbjct  255   NKRMKQIAKEVRSLVLGIINKRIREMKAGEAAKDDLLGILLESNFKEIQMHGNKNFGMTI  314

Query  1065  EDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRL  1244
             +++I ECKLFY AGQETTS LLVWT+ILLS++ +WQE AREEV  VFG +KPD+D LN+L
Sbjct  315   DEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDWQERAREEVHQVFGSNKPDYDALNQL  374

Query  1245  KIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDAN  1424
             K+VTMI NE LRLYPP  T+ R V ED KLGNLSLPAG++L++P I+LHHD E+WG+DA 
Sbjct  375   KVVTMIFNEVLRLYPPGITISRTVHEDTKLGNLSLPAGIQLVLPAIWLHHDNEIWGDDAK  434

Query  1425  EFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSY  1604
             EF PERF EGV+KAT GK  Y PFS GPRIC+GLNFAM+EAK AL+ IL+ ++F+LSPSY
Sbjct  435   EFKPERFSEGVNKATKGKFAYFPFSWGPRICVGLNFAMLEAKMALALILQHYAFELSPSY  494

Query  1605  AHAPYTGLTTNPLYGAPLILQKL  1673
             AHAP+T +T  P +GAPLIL+KL
Sbjct  495   AHAPHTIITLQPQHGAPLILRKL  517



>ref|XP_004244273.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/520 (59%), Positives = 379/520 (73%), Gaps = 2/520 (0%)
 Frame = +3

Query  117   MMRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKE  296
             M  +++   +   + +I   VC W+V+NW W+ PK LE  LR Q L GN Y++ YGD  +
Sbjct  1     MDEIQILVRVCCSAIAIALFVCLWKVLNWVWLNPKKLENLLRKQGLNGNSYKILYGDLND  60

Query  297   IAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEV  476
                M+ E  SKPMN LSD++ PR++P+F E+ +K+GK  F+WLG  P VII DP+ +KEV
Sbjct  61    FIGMIREASSKPMN-LSDDIAPRLVPFFLETTKKYGKKCFIWLGPKPQVIIMDPELIKEV  119

Query  477   LSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSE  656
             LSK   +Q+   +P    L QGL  YE DKW+KHRKI NPAF LEKLKHM+PA +  C+E
Sbjct  120   LSKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCTE  179

Query  657   MVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASEL  836
             M+ +WE+ V    S E+DVWP L+ +  +VIS TAFG SYE GR++FELQ E A++  + 
Sbjct  180   MLSKWEDAVPLGSSREIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQTEQAQNFIDA  239

Query  837   RHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASN-NLLDMLLES  1013
                VYIPG RFLPTK+NRRM  I  E+ T +K II+KR+ AMK G   +N +LL +LLES
Sbjct  240   VREVYIPGRRFLPTKRNRRMKEIKNEVRTSVKGIIDKRMKAMKAGNADNNEDLLGILLES  299

Query  1014  NFKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEV  1193
             NFKE++ HGN++FGMSIE++I ECKLFY AGQETTS LLVWT++LLSR Q+WQ  AREEV
Sbjct  300   NFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLVLLSRYQDWQTQAREEV  359

Query  1194  MHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLV  1373
             + VF   KPDFDGLN LK+VTMIL ESLRLYPP+ TL R V ED  LG L LPAGV + +
Sbjct  360   LQVFESRKPDFDGLNHLKVVTMILYESLRLYPPLITLNRQVNEDIVLGELCLPAGVLVSL  419

Query  1374  PIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKT  1553
             P+I LHHD ++WGEDANEFNPERFREG+S AT GK  Y PFS GPRICIG NFAM+EAK 
Sbjct  420   PMILLHHDKDIWGEDANEFNPERFREGISSATKGKVTYFPFSWGPRICIGQNFAMLEAKM  479

Query  1554  ALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             AL  IL+ FSF+LSPSY HAP + +T  P YGAPLIL KL
Sbjct  480   ALCMILQSFSFELSPSYTHAPKSLVTMQPQYGAPLILHKL  519



>gb|ABC69417.1| CYP72A54 [Nicotiana tabacum]
Length=517

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/503 (58%), Positives = 384/503 (76%), Gaps = 2/503 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             I+FL   W+ +NW WI+PK +EK L+ +  KG+ Y+L +GD KEI  M+ E K+KPMN  
Sbjct  17    IIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKEINTMVEEAKTKPMNFT  76

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             +D  V RV+P+F + + ++GKNSF+WLG  P + ITDP+ ++E+LSK   +Q+   +P+ 
Sbjct  77    ND-YVARVLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREILSKSYIYQEIQGNPIT  135

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L+QGL+ YE +KW+KHRKI NPAF L+KLKHM+P+ Y  C +M+ +WE I S +E  E
Sbjct  136   KLLAQGLVSYEAEKWAKHRKIINPAFHLDKLKHMLPSFYLSCCDMLRKWESIAS-SEGSE  194

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             +DVWP L+T+  + IS TAFG +YE GR++FELQ E AE   +    +YIPG RF+PTK+
Sbjct  195   IDVWPFLETLTSDAISRTAFGSNYEDGRQIFELQKEQAELILQAARWLYIPGWRFVPTKR  254

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSI  1064
             N+RM  I KE+ +++  II KRI  MK GE A ++LL +LLESNFKE++ HGN+ FGM+I
Sbjct  255   NKRMKQIAKEVRSLVLGIINKRIREMKAGEAAKDDLLGILLESNFKEIQMHGNKNFGMTI  314

Query  1065  EDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRL  1244
             +++I ECKLFY AGQETTS LLVWT+ILLS++ +WQE AREEV  VFG +KPD+D LN+L
Sbjct  315   DEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDWQERAREEVHQVFGSNKPDYDALNQL  374

Query  1245  KIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDAN  1424
             K+VTMI NE LRLYPP  T+ R V ED KLGNLSLPAG++L++P I+LHHD E+WG+DA 
Sbjct  375   KVVTMIFNEVLRLYPPGITISRTVHEDTKLGNLSLPAGIQLVLPAIWLHHDNEIWGDDAK  434

Query  1425  EFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSY  1604
             EF PERF EGV+KAT GK  Y PFS GPRIC+GLNFAM+EAK AL+ IL+ ++F+LSPSY
Sbjct  435   EFKPERFSEGVNKATKGKFAYFPFSWGPRICVGLNFAMLEAKMALALILQHYAFELSPSY  494

Query  1605  AHAPYTGLTTNPLYGAPLILQKL  1673
             AHAP+T +T  P +GAPLIL+KL
Sbjct  495   AHAPHTIITLQPQHGAPLILRKL  517



>ref|XP_009618785.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=531

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/507 (58%), Positives = 373/507 (74%), Gaps = 4/507 (1%)
 Frame = +3

Query  165   IMFLVC-AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV  341
             I+FLV  AW ++ W WI+PK LE  LR Q LKGN YRLFYGD KE++K + E  SKP+  
Sbjct  25    IIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEINSKPIIN  84

Query  342   LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQ-NLADP  518
             LS+EV PR+IPY+ E IQK+GK  FVW G  P ++IT+P+ +KE+  K+  FQ+ N  +P
Sbjct  85    LSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQKPNNPNP  144

Query  519   VVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNES  698
             +   L++G++ YE +KW+KHRKI NPAF +EKLKHM+PA Y  CSEM+ +WEEI+   ES
Sbjct  145   LTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCSEMLNKWEEIIPVKES  204

Query  699   GELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPT  878
              ELD+WP L+ +  +VIS  AFG SYE GRR+FELQ E AE+ ++  +SVYIPG RF P 
Sbjct  205   NELDIWPHLQRMTSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPN  264

Query  879   KKNRRMNGIDKEINTVLKRIIEKRIGAMKEG--EEASNNLLDMLLESNFKEMKHHGNQEF  1052
             K N+RM   +KE+   + R+I+ R+ A +EG  +  +++LL +LLESN  E++ HGN++F
Sbjct  265   KMNKRMKECEKEVRETITRLIDNRLKAKEEGNGKALNDDLLGILLESNSIEIEEHGNKKF  324

Query  1053  GMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDG  1232
             GMSI ++I ECKLFY AGQETTS LLVWT+ILL RN EWQE AREEV   FG DKP FD 
Sbjct  325   GMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNPEWQERAREEVFQAFGSDKPTFDE  384

Query  1233  LNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWG  1412
             L RLKIVTMIL ESLRLYPP+ T  R   E+ KLG L LP G  L +P I LH D E+WG
Sbjct  385   LYRLKIVTMILYESLRLYPPIATRTRRTNEETKLGELDLPKGALLFIPTILLHLDKEIWG  444

Query  1413  EDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKL  1592
             EDA+EFNPERF EGV+KAT GK  Y PF  GPR CIG NFA++EAK A++ IL+RFSF+L
Sbjct  445   EDADEFNPERFSEGVAKATKGKMTYFPFGAGPRKCIGQNFAILEAKMAIAMILQRFSFEL  504

Query  1593  SPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             SPSY H+PYT +T  P YGAPLI+ +L
Sbjct  505   SPSYTHSPYTVVTLKPKYGAPLIMHRL  531



>gb|ABC69393.1| CYP72A55v2 [Nicotiana tabacum]
Length=521

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/507 (58%), Positives = 372/507 (73%), Gaps = 4/507 (1%)
 Frame = +3

Query  165   IMFLVC-AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV  341
             I+FLV  AW ++ W WI+PK LE  LR Q LKGN YRLFYGD KE++K + E  SKP+  
Sbjct  15    IIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEINSKPIIN  74

Query  342   LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQ-NLADP  518
             LS+EV PR+IPY+ E IQK+GK  FVW G  P ++IT+P+ +KE+  K+  FQ+ N  +P
Sbjct  75    LSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQKPNNPNP  134

Query  519   VVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNES  698
             +   L++G++ YE +KW+KHRKI NPAF +EKLKHM+PA Y  CSEM+ +WEEI+   ES
Sbjct  135   LTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCSEMLNKWEEIIPVKES  194

Query  699   GELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPT  878
              ELD+WP L+ +  +VIS  AFG SYE GRR+FELQ E AE+ ++  +SVYIPG RF P 
Sbjct  195   NELDIWPHLQRMTSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPN  254

Query  879   KKNRRMNGIDKEINTVLKRIIEKRIGAMKEG--EEASNNLLDMLLESNFKEMKHHGNQEF  1052
             K N+RM   +KE+   +  +I+ R+ A +EG  +  +++LL +LLESN  E++ HGN++F
Sbjct  255   KMNKRMKECEKEVRETITCLIDNRLKAKEEGNGKALNDDLLGILLESNSIEIEEHGNKKF  314

Query  1053  GMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDG  1232
             GMSI ++I ECKLFY AGQETTS LLVWT+ILL RN EWQE AREEV   FG DKP FD 
Sbjct  315   GMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNPEWQERAREEVFQAFGSDKPTFDE  374

Query  1233  LNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWG  1412
             L RLKIVTMIL ESLRLYPP+ T  R   E+ KLG L LP G  L +P I LH D E+WG
Sbjct  375   LYRLKIVTMILYESLRLYPPIATRTRRTNEETKLGELDLPKGALLFIPTILLHLDKEIWG  434

Query  1413  EDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKL  1592
             EDA+EFNPERF EGV+KAT GK  Y PF  GPR CIG NFA++EAK A++ IL+RFSF+L
Sbjct  435   EDADEFNPERFSEGVAKATKGKMTYFPFGAGPRKCIGQNFAILEAKMAIAMILQRFSFEL  494

Query  1593  SPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             SPSY H+PYT +T  P YGAPLI+ +L
Sbjct  495   SPSYTHSPYTVVTLKPKYGAPLIMHRL  521



>emb|CDP15978.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/499 (57%), Positives = 370/499 (74%), Gaps = 1/499 (0%)
 Frame = +3

Query  177   VCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEV  356
             V AW+V N  W+ PK LEK L+ Q  +GNPY+L YGD KEI+ +  E  SKP+N L+D+ 
Sbjct  21    VLAWKVFNQVWLTPKKLEKRLKEQGFRGNPYKLLYGDFKEISTLFKEALSKPIN-LTDDF  79

Query  357   VPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLS  536
             VPRVIP+F+ + +K+GK++++W GT   V+I DP+H++EV  K   FQ+  ++P++  L 
Sbjct  80    VPRVIPHFYAATKKYGKHTYLWQGTELTVVIMDPEHIREVTQKVYIFQRPHSNPLLKLLV  139

Query  537   QGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVW  716
             QGL  Y GDKW+KHRK+ NPAF +EKLKHM+P+ Y   SEM+ +WE+IVS N S ELDVW
Sbjct  140   QGLASYNGDKWTKHRKLINPAFHVEKLKHMLPSFYTSASEMMCKWEDIVSSNGSSELDVW  199

Query  717   PELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRM  896
             P+L+T+  + IS TAFG +Y+ G R+FELQ E  EH  E   S+YIPG RF+PTK+N RM
Sbjct  200   PDLQTLTCDAISRTAFGSNYKEGSRIFELQREQTEHFIEAARSLYIPGWRFIPTKRNTRM  259

Query  897   NGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDII  1076
               I +++   +K II  R+ AMK  +   ++LL +LLESN KE+ HHGN+ FGM++ ++I
Sbjct  260   KQIARDVQESIKDIINARLKAMKAAKACDDDLLGILLESNSKEIDHHGNKNFGMTVLEVI  319

Query  1077  SECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVT  1256
              ECKLFY AGQETTS LLVWTMILLSR  EWQ  AREEV+ +FG DKPDFDGLN LK++T
Sbjct  320   EECKLFYFAGQETTSVLLVWTMILLSRYPEWQMRAREEVLQLFGTDKPDFDGLNHLKLIT  379

Query  1257  MILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNP  1436
             MIL+E LRLYPPV  L R   E+ +LGNL+LPAG+ + +P++ LHHDPE+WG+D  EF P
Sbjct  380   MILHEVLRLYPPVTALFRRAAEETRLGNLTLPAGLLVSLPVMLLHHDPEIWGDDVKEFKP  439

Query  1437  ERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAP  1616
             ERF +GVSKAT G+  + PFS GPRICIG NFAM+EAK A++ IL+RFSF+LSPSY HAP
Sbjct  440   ERFADGVSKATKGQFAFFPFSWGPRICIGQNFAMLEAKLAMTMILQRFSFELSPSYTHAP  499

Query  1617  YTGLTTNPLYGAPLILQKL  1673
                 T  P +GA LIL +L
Sbjct  500   RAMATLQPQFGAQLILHRL  518



>ref|XP_004243257.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/507 (57%), Positives = 377/507 (74%), Gaps = 4/507 (1%)
 Frame = +3

Query  162   SIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV  341
             +I+ ++  W+V+NWAW RPK  EK+LR   L GNPY+L YGD KE+   +NE KSKP++ 
Sbjct  18    AILLVIYTWKVLNWAWFRPKKFEKYLRKSGLNGNPYKLLYGDLKELTNKLNEAKSKPIS-  76

Query  342   LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNL-ADP  518
              S +V  R+IP+F +SI K+GKNSF WLG  P+V IT+P  +K++  KH  + +N  ++P
Sbjct  77    FSGDVPQRLIPFFCDSINKNGKNSFAWLGPKPIVFITEPSLIKKIFEKHYVYHKNKHSNP  136

Query  519   VVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNES  698
                 L QGL+  E  KW+KHRKI NPAF  EKLKHMVPA Y+ CSEM+ +WEE V +  S
Sbjct  137   FAKLLVQGLVTLEEQKWAKHRKIINPAFHFEKLKHMVPAFYQSCSEMLRKWEEAVPKETS  196

Query  699   GELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPT  878
              ELDVWP  + +  +VIS TAFG SYE GR +FELQ E AE+  E   S+YIPG RFLP+
Sbjct  197   AELDVWPHFQLMTGDVISRTAFGSSYEEGRIIFELQKEQAEYVMEQIFSIYIPGSRFLPS  256

Query  879   KKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNN--LLDMLLESNFKEMKHHGNQEF  1052
             KK +RM  I+KEI T ++RIIEKR+  MK GE ++NN  LL +LLESN KE++ HGN++F
Sbjct  257   KKKKRMVEIEKEIQTTIRRIIEKRLMTMKAGETSNNNEDLLGILLESNTKEIEQHGNKDF  316

Query  1053  GMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDG  1232
             GM+I ++I ECKLFY AGQ+TTS LLVWTMILL ++ EWQ  AREEV++VFG++KPDF+G
Sbjct  317   GMTITEVIDECKLFYFAGQDTTSVLLVWTMILLCQHPEWQVRAREEVLNVFGNEKPDFEG  376

Query  1233  LNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWG  1412
             L+RLKIVTMIL E+LRL+PP     R  K++ KLG LSLPA V L++P I +H++ E+WG
Sbjct  377   LSRLKIVTMILYETLRLFPPALLYGRTNKDEVKLGELSLPAEVLLIIPAILVHYNKELWG  436

Query  1413  EDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKL  1592
             EDA EF P+RF EGVSKATNG+  ++PF  GPRICIG NF M EAK  ++ IL++FSF+L
Sbjct  437   EDAKEFKPDRFSEGVSKATNGQVSFIPFGWGPRICIGQNFVMTEAKMTIAMILQKFSFEL  496

Query  1593  SPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             SPSY HAP   ++ +P YGAPL ++KL
Sbjct  497   SPSYTHAPVAVVSIHPQYGAPLHMRKL  523



>gb|ABC69392.1| CYP72A55v1 [Nicotiana tabacum]
Length=521

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/507 (58%), Positives = 371/507 (73%), Gaps = 4/507 (1%)
 Frame = +3

Query  165   IMFLVC-AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV  341
             I+FLV  AW ++ W WI+PK LE  LR Q LKGN Y LFYGD KE++K + E  SKP+  
Sbjct  15    IIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYGLFYGDMKELSKSLKEINSKPIIN  74

Query  342   LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQ-NLADP  518
             LS+EV PR+IPY+ E IQK+GK  FVW G  P ++IT+P+ +KE+  K+  FQ+ N  +P
Sbjct  75    LSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQKPNNPNP  134

Query  519   VVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNES  698
             +   L++G++ YE +KW+KHRKI NPAF +EKLKHM+PA Y  CSEM+ +WEEI+   ES
Sbjct  135   LTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCSEMLNKWEEIIPVKES  194

Query  699   GELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPT  878
              ELD+WP L+ +  +VIS  AFG SYE GRR+FELQ E AE+ ++  +SVYIPG RF P 
Sbjct  195   NELDIWPHLQRMTSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPN  254

Query  879   KKNRRMNGIDKEINTVLKRIIEKRIGAMKEG--EEASNNLLDMLLESNFKEMKHHGNQEF  1052
             K N+RM   +KE+   +  +I+ R+ A +EG  +  +++LL +LLESN  E++ HGN++F
Sbjct  255   KMNKRMKECEKEVRETITCLIDNRLKAKEEGNGKALNDDLLGILLESNSIEIEEHGNKKF  314

Query  1053  GMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDG  1232
             GMSI ++I ECKLFY AGQETTS LLVWT+ILL RN EWQE AREEV   FG DKP FD 
Sbjct  315   GMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNPEWQERAREEVFQAFGSDKPTFDE  374

Query  1233  LNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWG  1412
             L RLKIVTMIL ESLRLYPP+ T  R   E+ KLG L LP G  L +P I LH D E+WG
Sbjct  375   LYRLKIVTMILYESLRLYPPIATRTRRTNEETKLGELDLPKGALLFIPTILLHLDREIWG  434

Query  1413  EDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKL  1592
             EDA+EFNPERF EGV+KAT GK  Y PF  GPR CIG NFA++EAK A++ IL+RFSF+L
Sbjct  435   EDADEFNPERFSEGVAKATKGKMTYFPFGAGPRKCIGQNFAILEAKMAIAMILQRFSFEL  494

Query  1593  SPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             SPSY H+PYT +T  P YGAPLI+ +L
Sbjct  495   SPSYTHSPYTVVTLKPKYGAPLIMHRL  521



>ref|XP_011082968.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/517 (57%), Positives = 387/517 (75%), Gaps = 2/517 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             MEV   +   S + + L+ +WRVVNWA+IRPK LEK+LR Q L GN YRL YGD KE+ K
Sbjct  1     MEVVWQILAASSAFVVLMYSWRVVNWAYIRPKRLEKFLRKQGLSGNSYRLVYGDLKEMLK  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             MM + +SKP+N L D++ PRV+ + F+++QK+G  SF+WLG  P V I+DP+ VKEV++K
Sbjct  61    MMEDGRSKPIN-LDDDIKPRVLHFVFKTVQKYGTESFLWLGPRPTVTISDPELVKEVMNK  119

Query  486   HNTFQQ-NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMV  662
             ++ +Q+ N  +P+   L+QG++ YE DKW+KHRK+ NPAF +EKLK M+PA Y  C E++
Sbjct  120   YDIYQKPNNPNPLTKLLAQGVVSYEMDKWAKHRKLINPAFHMEKLKLMIPAFYLSCDEVL  179

Query  663   GRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRH  842
              +WE+ +S   S E+DVWP L+ +  + IS TAFG SY+ G R+FELQ E AEH  +   
Sbjct  180   NKWEKSLSPEGSCEVDVWPYLQNLTSDAISRTAFGSSYQEGTRIFELQREQAEHVIKASQ  239

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFK  1022
             S+YIPG RF+PTK+N+RM  I+KE+ + ++ II +RI AMK GE +S +LL +LLESNF+
Sbjct  240   SIYIPGWRFVPTKRNKRMKEIEKEVQSSIRSIISRRIKAMKAGEASSEDLLGILLESNFQ  299

Query  1023  EMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             E+K HGN+ FGM+I++++ ECKLFY AGQETTS LLVWT+ILLSR  +WQ+ AREEV+ V
Sbjct  300   EIKQHGNKSFGMTIDEVVEECKLFYFAGQETTSVLLVWTLILLSRFPDWQKRAREEVLQV  359

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG   PDFD LN LKIVTMILNE LRLYPPV  L R V E+ KLG L+LPAGV++ +PII
Sbjct  360   FGSQTPDFDSLNHLKIVTMILNEVLRLYPPVVGLGRKVTEETKLGKLTLPAGVQISLPII  419

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              LHH  E+WG+DA +FNPERF EGV+KA   +  + PF  GPRICIG  FAM+EAK AL+
Sbjct  420   LLHHSREIWGDDAMDFNPERFSEGVAKAQKRQGIFFPFGWGPRICIGQMFAMMEAKVALA  479

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL+RFSF+LSPSY HAP T +T  P +GA L+L KL
Sbjct  480   MILQRFSFELSPSYTHAPQTIITLQPQHGAHLLLHKL  516



>emb|CDP15988.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/516 (55%), Positives = 381/516 (74%), Gaps = 1/516 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME+  +L     +   ++ +WR++NWAW +PK LEK LR Q L+GN Y L +GD KE  +
Sbjct  1     MEILYSLVAVLSASFLVILSWRILNWAWFKPKKLEKCLRQQGLRGNSYNLVFGDMKETVR  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M  E KSKPMN  +D +V RV+P+  ++I+ +G+NS+ W G +P V++  P+H+KEV++K
Sbjct  61    MTQEAKSKPMNFTND-IVSRVMPFIDKTIKTYGENSYTWAGPMPAVLLMYPEHIKEVMNK  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
                + +   +P+   L+ GL  YE DKWSKHRK+ +PAF LEK+K M+PA    C EMV 
Sbjct  120   SFNYLKPPGNPLTKLLATGLANYETDKWSKHRKLISPAFHLEKVKFMLPAFRWSCFEMVS  179

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE++VS  ES ELDVWPEL+T+  +VIS TAFG +YE G+++FELQ E AE       S
Sbjct  180   KWEQLVSEKESCELDVWPELQTLTSDVISRTAFGSNYEEGQKIFELQKEQAELILLAARS  239

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
              Y+PG RF+PTK+N+RM GI KE+ +++  +I  R+ AMK GE  +++LLD+LLESNFKE
Sbjct  240   PYVPGWRFVPTKRNKRMKGIAKEVRSLVMDMINNRVKAMKAGEAKNDDLLDILLESNFKE  299

Query  1026  MKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVF  1205
             ++ HG+++FGM+++++I ECKLFY AGQETTS LLVWT+ILLS++Q+WQ+ AR+EV  VF
Sbjct  300   IQQHGDKKFGMTLDEVIEECKLFYFAGQETTSSLLVWTLILLSKHQDWQDRARDEVQQVF  359

Query  1206  GDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIF  1385
             G  KP+F+ LN LK++TMILNE LRLYPP   L R+  E  KLG L+LPAGV+LL+P I 
Sbjct  360   GSKKPEFEDLNHLKVITMILNEVLRLYPPGVMLGRMTTETTKLGELTLPAGVQLLLPAIL  419

Query  1386  LHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSC  1565
             LHHD ++WG+DA EF PERF EG+ KAT G+  Y PF  GPRICIG NFA VE+K AL+ 
Sbjct  420   LHHDSKIWGDDAKEFKPERFSEGILKATKGQLTYFPFGWGPRICIGQNFATVESKLALAM  479

Query  1566  ILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             IL+RFSF+LSP YAHAP+T +T  P +GA LIL+KL
Sbjct  480   ILQRFSFELSPLYAHAPHTIITLQPQHGAQLILRKL  515



>ref|XP_002265455.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/508 (56%), Positives = 385/508 (76%), Gaps = 3/508 (1%)
 Frame = +3

Query  153   FSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             F+F I  L+ AWR++N  W++PK +E++LR Q L GN YRL +GD +E+++M++E  S+P
Sbjct  10    FAF-ITLLIYAWRLLNSVWLKPKKIERYLRQQGLIGNSYRLLHGDFREMSRMIDEANSRP  68

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             ++ LSD++V RV+P+ + SI+K+GKN F+W+G  P+V I +P+ +++VL KHN FQ+   
Sbjct  69    IS-LSDDIVQRVLPFHYHSIKKYGKNCFIWMGPKPVVNIMEPELIRDVLLKHNAFQKPPV  127

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
              P+   L+ G++  EG++W+K RKI NPAF LEKLKHMVPA    CSEMV +WE+ +S++
Sbjct  128   HPLGKLLATGVIALEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSEMVNKWEKKLSKD  187

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
              S ELD+WP+L+ +A +VIS TAFG SYE GRR+F+LQ E A  A ++  S+YIPG RF+
Sbjct  188   GSCELDIWPDLENLAGDVISRTAFGSSYEEGRRIFQLQKEQAHLAVQVSQSIYIPGWRFV  247

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-  1049
             PTK N+RM  I  E+N +LK IIE+R  AMK GE A+++LL +L+ESN+KEM+ HG ++ 
Sbjct  248   PTKTNKRMRQISNEVNALLKGIIERREKAMKVGETANDDLLGLLMESNYKEMQEHGERKN  307

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
              GMS +D+I ECKLFY AGQETTS LL+WTM+LLS++  WQ  AREEV+ VFG+ KPD D
Sbjct  308   VGMSNKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSNWQARAREEVLQVFGNKKPDGD  367

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
             GLN LKIVTMI +E LRLYPP   LIR V  D ++G + LP GV++ +PI+ LHHD E+W
Sbjct  368   GLNHLKIVTMIFHEVLRLYPPASMLIRSVYADTEVGGMYLPDGVQVSLPILLLHHDHEIW  427

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             G+DA +FNPERF EGVSKAT G+  + PF  GPR+CIG NFAM+EAK AL+ IL+RFSF+
Sbjct  428   GDDAKDFNPERFSEGVSKATKGQFAFFPFGYGPRVCIGQNFAMMEAKMALAMILQRFSFE  487

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LSPSYAHAP + +T  P YGA LIL  L
Sbjct  488   LSPSYAHAPISVITIQPQYGAHLILHGL  515



>ref|XP_006598137.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/501 (57%), Positives = 368/501 (73%), Gaps = 4/501 (1%)
 Frame = +3

Query  180   CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVV  359
             C+W+V+NW W+RPK LEK LR Q  +GNPY LF+GD+KE  KM  E  SKPM  LSD++V
Sbjct  19    CSWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPM-TLSDDIV  77

Query  360   PRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQ  539
             PRV  Y   S+ KHGKNSF+W G +P V I DP+ +K+V +K+  F +   +P+V  L+ 
Sbjct  78    PRVSAYVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLAT  137

Query  540   GLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWP  719
             GL  YEG+KWSKHR+I NPAF LEKLK M+P   + C+++V +WE ++S   S E+D WP
Sbjct  138   GLAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFLQSCNDLVSKWEGMLSSEGSCEMDAWP  197

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
              L+ +  +VI+ +AFG SYE GRR+F+LQ E  EH  ++   + IPG RFLPTK +RRM 
Sbjct  198   FLQNLTSDVIARSAFGSSYEEGRRIFQLQREQTEHLMKVILKIQIPGWRFLPTKTHRRMK  257

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN---QEFGMSIED  1070
              ID+EI   LK +I KR  A+K GE   N+LL +LLESN KE++ HGN   +  GMS+ED
Sbjct  258   EIDREIKASLKNMINKREKALKSGEATKNDLLGILLESNHKEIQEHGNRNSKNVGMSLED  317

Query  1071  IISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKI  1250
             +I ECKLFY AGQETTS LLVWTM+LLSR  +WQ  AREE   VFG  KPDFDGL+RLKI
Sbjct  318   VIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEAFQVFGYQKPDFDGLSRLKI  377

Query  1251  VTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEF  1430
             VTMIL E LRLYPP+  + R+V++D KLGNL+LPAGV++ +P + +HHD E+WGEDA +F
Sbjct  378   VTMILYEVLRLYPPLIGMNRLVEKDVKLGNLTLPAGVQVFLPTVLIHHDSELWGEDAKQF  437

Query  1431  NPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAH  1610
             NPERF EGV KATNG+  + PF  GPRICIG NF+++EAK ALS IL+ F F+LSP+YAH
Sbjct  438   NPERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQNFLFELSPAYAH  497

Query  1611  APYTGLTTNPLYGAPLILQKL  1673
             AP   +TT P YGA +IL+K+
Sbjct  498   APTMSITTQPQYGAHIILRKV  518



>sp|H2DH21.1|C7A29_PANGI RecName: Full=Cytochrome P450 CYP72A219; AltName: Full=Cytochrome 
P450 CYP72A129 [Panax ginseng]
 gb|AEY75218.1| cytochrome P450 CYP72A129 [Panax ginseng]
Length=518

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/521 (57%), Positives = 387/521 (74%), Gaps = 8/521 (2%)
 Frame = +3

Query  114   VMMRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTK  293
             V+  +  FC +      ++ ++  WR+ NW W+RP+ LEK+LR Q   GN YRLF+GD K
Sbjct  4     VLKLISSFCAI------VVVILLGWRIFNWVWLRPRKLEKYLRNQGFNGNSYRLFFGDVK  57

Query  294   EIAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKE  473
             E+  M+ E KSKP+N L D+++PR+IP   + I  +GKNSF+WLG  PMV I +PDH+K+
Sbjct  58    EMIVMLKEAKSKPIN-LYDDIIPRIIPLNQKIITNYGKNSFLWLGPKPMVHIMNPDHIKD  116

Query  474   VLSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICS  653
             VLSK   FQ+   +P+   L+ G+   EGD+W+KHRK+ NPAF LEKLK+M+PA+Y   S
Sbjct  117   VLSKFYQFQKPRHNPLTKLLATGVADAEGDRWAKHRKLINPAFHLEKLKNMLPAIYLSSS  176

Query  654   EMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASE  833
             E+V +WEE+VS     ELDV P L+T+  +VIS TAFG SYE GR++F+LQ E AE   +
Sbjct  177   EIVTKWEEMVSTKGQFELDVLPYLETLTSDVISRTAFGSSYEEGRKIFQLQREQAELIIQ  236

Query  834   LRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEAS-NNLLDMLLE  1010
                ++Y+PG RFLPTK+N+RM  I KE+   LK II KR+ AM+ GE +S ++LL +LLE
Sbjct  237   ASQTIYLPGMRFLPTKRNKRMKEIAKEVKIALKSIINKRLKAMEAGERSSHDDLLGILLE  296

Query  1011  SNFKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREE  1190
             SN KE+K HGN  FG++++++I ECKLF+ AGQETTS+LLVWTMILLS++Q+WQ+ A+EE
Sbjct  297   SNSKEIKQHGNTNFGLTVDEVIEECKLFFFAGQETTSNLLVWTMILLSQHQDWQKRAKEE  356

Query  1191  VMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLL  1370
             V+  FG++KPDFDGLN LK+V MIL E LRLYPP+ +L R + E+ KLG +SLPAGV LL
Sbjct  357   VLRTFGNNKPDFDGLNHLKVVNMILLEVLRLYPPILSLDRTIYEEIKLGEISLPAGVILL  416

Query  1371  VPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAK  1550
             +PII LH+D E+WG+DA EFNPERF EGV KAT G+  Y PFS GPRICIG NFAM+EAK
Sbjct  417   LPIILLHYDQEIWGDDAKEFNPERFSEGVLKATKGRVTYFPFSWGPRICIGQNFAMLEAK  476

Query  1551  TALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              A++ IL+RFSF LSPSYAHAP+  +T  P YGA LIL  L
Sbjct  477   MAMAMILQRFSFVLSPSYAHAPHAIITLQPQYGAHLILHSL  517



>ref|XP_004244274.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/507 (60%), Positives = 371/507 (73%), Gaps = 4/507 (1%)
 Frame = +3

Query  156   SFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPM  335
             + +I   VC W+V+NW W RPK LEK LR Q L GN YRL YGD K+ +KM+ E  SKPM
Sbjct  10    AITITLFVCLWKVLNWVWFRPKKLEKLLRKQGLNGNSYRLLYGDMKDFSKMIKEANSKPM  69

Query  336   NVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLAD  515
             N LS+++ PR++P+F E+I+K+GK SF+WL   P V+I DP+ +KEV SK+  +Q+   +
Sbjct  70    N-LSNDITPRLVPFFLETIKKYGKKSFIWLCPKPQVLIMDPELIKEVFSKNYFYQKPHGN  128

Query  516   PVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNE  695
             P    L QGL  YE DKW+KHRKI NPAF LEKLKHM+PA +  CSEM+ +WE+ V    
Sbjct  129   PFAALLVQGLAAYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCSEMLSKWEDAVEG--  186

Query  696   SGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLP  875
             S E+DVWP L+ +  +VIS TAFG SYE GR++FELQ E A+H  +   SV IP  RFLP
Sbjct  187   SCEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQREQAQHFIDTVRSVNIPRWRFLP  246

Query  876   TKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASN-NLLDMLLESNFKEMKHHGNQEF  1052
             TK+NRRM  I  E+ T +K II+KR+ AMK G +A N +LL +LLESNFKE++ HGN++F
Sbjct  247   TKRNRRMKEIKNEVRTSMKGIIDKRMKAMKAGHDADNEDLLGVLLESNFKEIEQHGNKDF  306

Query  1053  GMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDG  1232
             GMSIE++I ECKLFY AGQET + LLVWT++LLSR Q+WQ  AREEV+ VFG  KPDFDG
Sbjct  307   GMSIEEVIEECKLFYFAGQETIAVLLVWTLVLLSRYQDWQTQAREEVLQVFGSRKPDFDG  366

Query  1233  LNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWG  1412
             LN LK+VTMIL ESLRLY P+ T  R   ED  L  L LPA V + +P I LHHD ++WG
Sbjct  367   LNHLKVVTMILYESLRLYSPLFTHNRQASEDTVLVELCLPADVLVSLPTIILHHDKDIWG  426

Query  1413  EDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKL  1592
             EDAN+FNPERFREG+S AT GK  Y PFS GPRICIG NFAM+EAK  L  IL+ FSF+L
Sbjct  427   EDANKFNPERFREGISSATMGKVTYFPFSWGPRICIGQNFAMLEAKMTLCMILQSFSFEL  486

Query  1593  SPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             SPSY HAP   LT +P YGAPLI  KL
Sbjct  487   SPSYTHAPQPLLTIHPQYGAPLIFHKL  513



>gb|KEH38478.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/517 (56%), Positives = 375/517 (73%), Gaps = 2/517 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             M     + LF    + L+ AW+++NW W++PK LEK+LR Q LKGN YRL  GD +++ K
Sbjct  1     MATTTAIVLFILMTLSLIWAWKILNWLWLKPKKLEKFLREQGLKGNSYRLLVGDIRDLLK  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M  ET SKPMN LSD++ PRV  YF  S+ K+GKNSF+W G  P V I+DP+ +K VL+K
Sbjct  61    MRKETTSKPMN-LSDDIAPRVFSYFHHSVAKYGKNSFMWFGPTPRVNISDPELIKYVLNK  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
                FQ+  A P+V  L+ GL+  EG+KWSKHRK+ NPAF +EKLK M+P  +K C +++ 
Sbjct  120   IYDFQKPNASPLVRLLANGLVNLEGEKWSKHRKLINPAFNIEKLKIMLPIFFKSCDDLIT  179

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE ++S + S ELDVWP L+ +A +VIS TAFG SYE G+R+F+LQ E AE   ++   
Sbjct  180   KWERMLSSDGSCELDVWPFLQNLASDVISRTAFGSSYEEGKRIFQLQIEQAELTKKVMIQ  239

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
             V+IPG RFLPT  +RRM  ID+EI   L  +I KR  A+K GE   ++LL +LLE N KE
Sbjct  240   VFIPGWRFLPTSTHRRMKEIDREIKASLTDMINKREIALKAGEATKDDLLGILLELNHKE  299

Query  1026  MKHH-GNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             M+ H  N++ GMS++D+I ECKLFY AGQETTS LLVW M+LLSR  +WQ  AREEV+ V
Sbjct  300   MEEHDNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWAMMLLSRYPDWQARAREEVLQV  359

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG+ KPDFDGLN+LKIVTMIL E LRLYPP     R   +D KLGNL+LPAGV++ +PI+
Sbjct  360   FGNKKPDFDGLNQLKIVTMILYEVLRLYPPAIATSRSTHKDVKLGNLTLPAGVQITLPIV  419

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              +HHD E+WGEDA  FNPERF  G+SKATNG+  + PF GGPRICIG NF+M+EAK A++
Sbjct  420   LVHHDSELWGEDAKVFNPERFSGGISKATNGRFSFFPFGGGPRICIGQNFSMLEAKMAMA  479

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL++FSF+LSPSYAHAP   +T  P YG  LIL+K+
Sbjct  480   MILKKFSFELSPSYAHAPTQVITLQPKYGVHLILRKV  516



>ref|XP_004307203.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=543

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/538 (55%), Positives = 383/538 (71%), Gaps = 13/538 (2%)
 Frame = +3

Query  84    HTLI---LQFAGQVMMRMEVFCNLFLFSFSIMFLV----CAWRVVNWAWIRPKTLEKWLR  242
             HT I   LQ A     +ME+    F+ + SI+ L     CAWRV+NW W++PK LEK LR
Sbjct  9     HTFIPEALQGAVCSYRQMELS---FIIALSIVLLSIASSCAWRVLNWVWLKPKKLEKCLR  65

Query  243   GQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVW  422
              Q L GN YR+  GD KE  ++M E  SKPMN LSD+  PRV+P+  ++I KHGKNSF W
Sbjct  66    QQGLAGNSYRVLIGDVKESFRVMKEACSKPMN-LSDDAAPRVLPFLHQTITKHGKNSFTW  124

Query  423   LGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAF  602
              GT P V I +PD++ E+L+K++ F++    PVV  LS GL   EG+KW K RKI NPAF
Sbjct  125   FGTTPRVTIMNPDYLNEILTKYDDFRRPHTAPVVKLLSYGLANLEGEKWVKQRKIINPAF  184

Query  603   QLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYET  782
              +EKLK+M+PA+Y+ C++M+ +WE +VS+  S ELD+WP L+ ++ +VIS TAFG SYE 
Sbjct  185   HIEKLKNMLPAIYQSCTDMITKWEIMVSKEGSCELDIWPFLQNLSGDVISRTAFGSSYEE  244

Query  783   GRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAM  962
             GR +FELQ E  E   +   S YIPG RFLPTK NRRM  I KE+   +KRII  ++ A+
Sbjct  245   GRTIFELQKEQTELLIKALFSAYIPGFRFLPTKLNRRMKAISKEVEATMKRIISNKVEAI  304

Query  963   KEGEE-ASNNLLDMLLESNFKEMKHHG-NQEFGMSIEDIISECKLFYLAGQETTSDLLVW  1136
             + G+E A N+LL +LLESN+KE++ +G N+  GMSIE++I ECKLFYLAG ETTS LL W
Sbjct  305   RAGDEDAKNDLLGILLESNWKEIRQYGGNKNLGMSIEEVIGECKLFYLAGAETTSILLTW  364

Query  1137  TMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIV  1316
             TMILL R   WQ  AR+EV+ VFG +KPDFDGL  LK+VTMI+ E LRLYPPVP + R V
Sbjct  365   TMILLCRYPNWQARARQEVLQVFGSNKPDFDGLIHLKVVTMIIYEVLRLYPPVPMMTRAV  424

Query  1317  KEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPF  1496
             +++ +LGNL LP+GV+L +PI  +  D  +WGEDANEFNP+RF EG+SKAT G+  Y+PF
Sbjct  425   QKETQLGNLLLPSGVQLSLPIFLIQRDQTLWGEDANEFNPQRFSEGISKATKGQVSYIPF  484

Query  1497  SGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
               GPRICIG NF ++EAK ALS +L  F+F+LSPSY H P T +TT P YGA +IL K
Sbjct  485   GWGPRICIGQNFGLMEAKMALSLMLHSFTFELSPSYIHGPMTIITTQPQYGAHIILHK  542



>ref|XP_006360179.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=514

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/517 (57%), Positives = 374/517 (72%), Gaps = 4/517 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME    +       + +   W+V+NW W  PK LE  LR Q LKGN YRL YGD K++ +
Sbjct  1     METIQMIVTICCCAIAITLLWKVLNWVWFNPKKLENLLRKQGLKGNSYRLLYGDMKDVTR  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M+ E  SKPMN+   ++ PR++P+F E+I K+GK  F W+G  P V+I DP+ +KEVLSK
Sbjct  61    MIKEANSKPMNMSDHDLAPRMMPFFLETINKYGKKCFTWMGPKPQVLIMDPELIKEVLSK  120

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
                +Q+   +P+     QGL+ YE DKW+K+RKI NPAF LEKLKHM+PA Y  CSEM+ 
Sbjct  121   TYLYQKPGGNPLGSLFVQGLVSYEKDKWAKNRKIINPAFHLEKLKHMLPAFYLSCSEMLS  180

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE++     S E+DVWP L+ +  +VIS TAFG SYE GR++FELQ+E   H  E   S
Sbjct  181   KWEDV---EGSHEIDVWPHLQQLTSDVISRTAFGSSYEEGRKIFELQNEQVPHFIEAMRS  237

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
             VYIPG RFLPTK+NRRM  I K++ ++++ II+KR+ AM+ G+  + +LL +LLESNFKE
Sbjct  238   VYIPGWRFLPTKRNRRMKEIKKDVRSLIRGIIDKRLKAMEAGDADNEDLLGILLESNFKE  297

Query  1026  MKHHG-NQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             ++  G N++FGMSI++II ECKLFY AG ETTS  L+WT++LLSR Q+WQ  AREEV+ V
Sbjct  298   IEQQGGNKDFGMSIDEIIEECKLFYFAGSETTSVWLLWTLVLLSRYQDWQAQAREEVLQV  357

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG  KPDF+GLNRLK+VTMIL ESLRLY PV TL R+  ED  LG +SLPAGV + +P +
Sbjct  358   FGSRKPDFNGLNRLKVVTMILYESLRLYSPVTTLTRLAIEDITLGEVSLPAGVLVSLPTV  417

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              LHHD E+WGEDAN+FNPERFREG+S AT G+  Y PFS GPRICIG NFAM+EAK ALS
Sbjct  418   ILHHDKEIWGEDANKFNPERFREGISSATKGQVTYFPFSWGPRICIGQNFAMLEAKMALS  477

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL+ FSF+LSPSY HAP   +T  P YGAPLI  KL
Sbjct  478   MILQTFSFELSPSYTHAPQYSVTVQPQYGAPLIFHKL  514



>ref|XP_002268319.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/508 (57%), Positives = 381/508 (75%), Gaps = 3/508 (1%)
 Frame = +3

Query  153   FSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             F+F I+ L+ AWR++NW W+RPK LE+ LR Q L GN YRL +GD +E+++M+NE  S+P
Sbjct  10    FAF-IVLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSEMINEANSRP  68

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             ++  SD++V RV+P+   SIQK+GKNSF W G  P+V I +P+ +++VL KHN FQ+   
Sbjct  69    IS-FSDDIVQRVLPFHDHSIQKYGKNSFTWFGPKPVVYIMEPELIRDVLLKHNVFQKPPP  127

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
              P+   L+ G++  EG++W+K RKI NPAF LEKLKHMV A    CS+MV +WE+ +S +
Sbjct  128   HPLSKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKKLSLD  187

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
              S ELDVWP L+ +A +VIS TAFG SYE GRR+F+LQ E A  A ++  S+Y+PG RF 
Sbjct  188   GSCELDVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVPGWRFF  247

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-  1049
             PTK NRRM  I  E+N +LK IIEKR  AMK GE A+++LL +L+ESN+++M+ +  ++ 
Sbjct  248   PTKTNRRMRQISNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYRDMQENDERKN  307

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
              GMSI+D+I ECKLFYLAGQETTS LL+WTM+LLS++  WQ  AREEV+ VFG+ KPD D
Sbjct  308   VGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTHAREEVLRVFGNKKPDGD  367

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
             GLN LKIVTMI +E LRLYPPV  L+R V  D+++G L LP GV++ +PI+ LHHD E+W
Sbjct  368   GLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILLLHHDHEIW  427

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             GEDA EFNP RF EGVSKA   +  + PF  GPRIC+G NFAM+EAK AL+ IL+RFSF+
Sbjct  428   GEDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFE  487

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LSPSYAHAP + LTT+P YGA LIL  L
Sbjct  488   LSPSYAHAPISLLTTHPQYGAHLILHGL  515



>emb|CDP15975.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/517 (55%), Positives = 381/517 (74%), Gaps = 2/517 (0%)
 Frame = +3

Query  126   MEV-FCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             ME+ +  +   S   + LV AWRV+NWAW+RPK LEK L+ Q LKGNPYRL YGD KEI+
Sbjct  1     MEIGYIRIAAISSCAVILVLAWRVLNWAWLRPKKLEKQLKEQGLKGNPYRLLYGDFKEIS  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
              ++ E +SKP+N LSD+++PR++P F ++++K+GK+++VWLG  PMV I +P+ ++EV+ 
Sbjct  61    TLIREAQSKPIN-LSDDILPRILPAFPDALKKYGKSTYVWLGPTPMVYILEPELIREVMQ  119

Query  483   KHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMV  662
             K   FQ+   +P+   L +GL+ Y+GDKW+K RK+ NPAF +EKLKHM+P+ Y   S+++
Sbjct  120   KIYLFQKPRLNPLSLLLIEGLVNYDGDKWAKQRKLINPAFHVEKLKHMLPSFYTSASDIL  179

Query  663   GRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRH  842
              +W+E+V+ N S ELDVWP+L+T+  + IS TAFG +YE GRR+FELQ E +E+  ++  
Sbjct  180   NKWKEVVAPNGSSELDVWPDLETLTSDAISRTAFGSNYEEGRRIFELQREQSEYWLKVVQ  239

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFK  1022
             SV IPG RF+PTK+NRRM  I K +   +  II  RI A++EG+   ++LL +LLESNFK
Sbjct  240   SVDIPGWRFVPTKRNRRMKQIAKAVQDTILEIINSRIKAVREGKAYGDDLLGILLESNFK  299

Query  1023  EMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             E+ +HG    GM+I ++I ECKLFY AGQETTS LLVWTMILLSR  +WQ  AREEV+ +
Sbjct  300   EINNHGQDGAGMTIREVIEECKLFYFAGQETTSVLLVWTMILLSRYPDWQARAREEVLQL  359

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG  KPDFDGLNRL +VTMIL+E LRLY PVP L R V E+ KLG++ LPA V L +P++
Sbjct  360   FGTRKPDFDGLNRLNLVTMILHEVLRLYAPVPALSRRVAEETKLGSMRLPADVLLSLPVM  419

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              LHHD E+WG+DA EF PERF EGV  AT G+  + PF  GPR+CIG +FAM+EAK  L 
Sbjct  420   VLHHDTEIWGDDAKEFKPERFAEGVPHATKGQVAFFPFGWGPRVCIGQHFAMLEAKLVLV  479

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              ILR FSF+LSPSY+HAP   +T  P +GA LIL KL
Sbjct  480   MILRSFSFELSPSYSHAPRAIITLQPQHGAHLILHKL  516



>ref|XP_007149364.1| hypothetical protein PHAVU_005G064100g [Phaseolus vulgaris]
 gb|ESW21358.1| hypothetical protein PHAVU_005G064100g [Phaseolus vulgaris]
Length=520

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/517 (57%), Positives = 370/517 (72%), Gaps = 1/517 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME  C   L    I+ L+ AW ++NW W  PK LE+ LR Q L+GNPY L  GDTK+ AK
Sbjct  1     MEAACTTILMLILILVLIWAWMMLNWVWFTPKRLERLLREQGLQGNPYTLLVGDTKDFAK  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M  E  SKPMN+ S ++VPRV  +F  SI  HGKNSF+W G +P V +TDP+ +K+V +K
Sbjct  61    MRKEAFSKPMNLFSHDIVPRVFSFFHHSINTHGKNSFIWFGPVPRVTLTDPELIKDVFNK  120

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
              + FQ+   +P ++ L  GLL + G+KWSKHRKI NPAF LEKLK+M+P   K   +++G
Sbjct  121   THDFQKINMNPQIWLLGPGLLSHHGEKWSKHRKIINPAFNLEKLKNMLPLFIKCGDDLIG  180

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WEE++S + S E+DVWP L+ +  + IS TAFG SYE GRR+F+L  E +E   +L   
Sbjct  181   KWEEMLSLDGSSEMDVWPFLQNLTSDAISRTAFGSSYEEGRRIFQLLKEQSELTVQLMLE  240

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
             VYIPG RF+PT  +R+MN ID++I   LK II  R  A+K GE + N LLD LLESN KE
Sbjct  241   VYIPGWRFVPTATHRKMNAIDRKIKASLKDIINSREKALKAGEASKNYLLDTLLESNQKE  300

Query  1026  MKHHG-NQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             ++  G N+  GM+IED+I ECKLFY AGQETTS LLVWTMILLS   +WQ  AREEV+ V
Sbjct  301   IQEQGNNKNVGMNIEDVIGECKLFYFAGQETTSSLLVWTMILLSMYPDWQTRAREEVLQV  360

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG+ KPDFDGLN LKIVTM+LNE LRLYPP+  L R V +D KLGNLSL AG+++ + II
Sbjct  361   FGNGKPDFDGLNHLKIVTMVLNEVLRLYPPIIGLAREVCKDVKLGNLSLAAGMQVYISII  420

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              +HHD E+WG+DA EF PERF EGV KATNGK    PF  GPRICIG NF+++EAK ALS
Sbjct  421   LVHHDCELWGDDAKEFKPERFAEGVLKATNGKVALFPFGWGPRICIGQNFSLLEAKVALS  480

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              ILR FSF+LSP+Y HAP T +T  P YGA LIL+K+
Sbjct  481   MILRHFSFELSPTYTHAPTTVITLQPQYGAQLILRKV  517



>ref|XP_006348906.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/518 (54%), Positives = 377/518 (73%), Gaps = 2/518 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSI-MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             ME   N+ + + S+ + LV  W+V+NWAW RPK LEK+LR Q L GN YRL +GD KE +
Sbjct  1     METLSNIIIATISVAILLVYTWKVLNWAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFS  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
             K + E +SKP++ LS+++ PR+IPYF ++I K+GK  FVW G  PM++I + + ++E+ +
Sbjct  61    KSIKEAQSKPIDNLSNDIAPRIIPYFIQTISKYGKKCFVWFGPKPMILIMESEQIREIFA  120

Query  483   KHNTFQQ-NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             K+  +Q+ + ++PV   L++G+  YE DKW+KHRKI  PAF +EKLK M+PA Y  C EM
Sbjct  121   KNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFHMEKLKLMLPAFYLSCIEM  180

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             +  WE+IV    S ELD+WP+ + +  ++IS TAFG SYE GRR+FELQ E AE   +  
Sbjct  181   LKEWEKIVPDERSKELDIWPQFQKLTSDMISRTAFGSSYEEGRRIFELQKEQAEIIMKQF  240

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
             +S+YIPG RFLPTK N++M   +KE+   ++R+I+ R+ A + G+E  ++LL  LLESN 
Sbjct  241   NSIYIPGSRFLPTKSNKKMKETEKEVQESIRRLIDNRLKAKEAGQEFGDDLLGTLLESNS  300

Query  1020  KEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
              E++  G++EFG++I+++I ECKLFY AGQETTS  LVWTMILLSR+Q+WQ  AREEV+ 
Sbjct  301   NEIEEQGSKEFGLTIDEVIRECKLFYFAGQETTSVWLVWTMILLSRHQDWQAKAREEVLQ  360

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
              FG D+P FD L+RLKIVTMIL ESLRLYPP+ T IR   E+ +LGNL LP G  + +P 
Sbjct  361   AFGSDQPAFDELSRLKIVTMILYESLRLYPPLATRIRRTNEETRLGNLYLPNGSLIFIPT  420

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             I LHHD E+WGEDA EF PERF+EGV KAT G+  + PF  GPRICIG NFAM+EAK A+
Sbjct  421   ILLHHDKEIWGEDAEEFKPERFKEGVLKATKGQMIFFPFGAGPRICIGHNFAMLEAKMAV  480

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + IL+RF F+LSPSY H P+  +   P +GAPL+LQ+L
Sbjct  481   ALILQRFVFELSPSYTHVPHCIVALQPKFGAPLLLQRL  518



>ref|XP_004243254.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/518 (54%), Positives = 373/518 (72%), Gaps = 2/518 (0%)
 Frame = +3

Query  126   MEVFCNLFLFS-FSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             ME   N+ + + F  + LV  W+V+NWAW RPK LEK+ R Q L GN YRL +GD KE +
Sbjct  1     METLNNIIIATIFVTILLVHTWKVLNWAWFRPKKLEKFFRQQGLCGNSYRLLHGDLKEFS  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
             K + E +SKP+N LS+++ PR+IPYF ++I K+GKN FVW G  PM++I + + ++E+ +
Sbjct  61    KSIKEAQSKPINNLSNDIAPRIIPYFIQTISKYGKNCFVWFGPKPMILIMESEQIREIFA  120

Query  483   KHNTFQQ-NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             K+  +Q+ + ++PV   L++G+  YE DKW+KHRKI  PAF +EKLK M+PA Y  C EM
Sbjct  121   KNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFHMEKLKLMLPAFYLSCIEM  180

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             +  WE+I+    S ELD+WP+ + +  ++IS TAFG SYE GRR+FELQ E AE   +  
Sbjct  181   LKEWEQIIPYEGSKELDIWPQFQKLTSDMISRTAFGSSYEEGRRIFELQKEQAEIIMKQF  240

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
             +S+YIPG RFLPTK N++M   +KE+   ++R+I+ R+ A + G+E  ++LL  LLESN 
Sbjct  241   NSIYIPGSRFLPTKSNKKMKETEKEVQESIRRLIDNRLKAKEAGQEFGDDLLGTLLESNS  300

Query  1020  KEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
              E++  G++EFG++I+++I ECKLFY AGQETTS  LVWTMILLSR+Q WQ  AREEV+ 
Sbjct  301   NEIEEQGSKEFGLTIDEVIRECKLFYFAGQETTSVWLVWTMILLSRHQNWQAKAREEVLQ  360

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
              FG D+P FD L+RLKIVTMIL ESLRLYPP+ T IR   E+ KLGN+ LP G  L +P 
Sbjct  361   AFGSDQPAFDELSRLKIVTMILYESLRLYPPLATRIRRTNEETKLGNMYLPNGSLLFIPT  420

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             I LHHD E+WGEDA EF PERF EGV  AT G+  + PF  GPRICIG NFAM+EAK A+
Sbjct  421   ILLHHDKEIWGEDAEEFKPERFSEGVLNATKGQMTFFPFGAGPRICIGQNFAMLEAKMAI  480

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + IL+RF F+LSPSY H P+  +   P YGAPL+LQKL
Sbjct  481   ALILQRFEFELSPSYIHVPHCIVALQPKYGAPLLLQKL  518



>gb|KHN44056.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/501 (57%), Positives = 367/501 (73%), Gaps = 4/501 (1%)
 Frame = +3

Query  180   CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVV  359
             C+W+V+NW W+RPK LEK LR Q  +GNPY LF+GD+KE  KM  E  SKPM  LSD++V
Sbjct  19    CSWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPM-TLSDDIV  77

Query  360   PRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQ  539
             PRV  Y   S+ KHGKNSF+W G +P V I DP+ +K+V +K+  F +   +P+V  L+ 
Sbjct  78    PRVSAYVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLAT  137

Query  540   GLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWP  719
             GL  YEG+KWSKHR+I NPAF LEKLK M+P   + C+++V +WE ++S   S E+D WP
Sbjct  138   GLAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFLQSCNDLVSKWEGMLSSEGSCEMDAWP  197

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
              L+ +  +VI+ +AFG SYE GRR+F+LQ E  E   ++   + IPG RFLPTK +RRM 
Sbjct  198   FLQNLTSDVIARSAFGSSYEEGRRIFQLQREQTELLMKVILKIQIPGWRFLPTKTHRRMK  257

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN---QEFGMSIED  1070
              ID+EI   LK +I KR  A+K GE   N+LL +LLESN KE++ HGN   +  GMS+ED
Sbjct  258   EIDREIKASLKNMINKREKALKSGEATKNDLLGILLESNHKEIQEHGNRNSKNVGMSLED  317

Query  1071  IISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKI  1250
             +I ECKLFY AGQETTS LLVWTM+LLSR  +WQ  AREE   VFG  KPDFDGL+RLKI
Sbjct  318   VIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEAFQVFGYQKPDFDGLSRLKI  377

Query  1251  VTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEF  1430
             VTMIL E LRLYPP+  + R+V++D KLGNL+LPAGV++ +P + +HHD E+WGEDA +F
Sbjct  378   VTMILYEVLRLYPPLIGMNRLVEKDVKLGNLTLPAGVQVFLPTVLIHHDSELWGEDAKQF  437

Query  1431  NPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAH  1610
             NPERF EGV KATNG+  + PF  GPRICIG NF+++EAK ALS IL+ F F+LSP+YAH
Sbjct  438   NPERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQNFLFELSPAYAH  497

Query  1611  APYTGLTTNPLYGAPLILQKL  1673
             AP   +TT P YGA +IL+K+
Sbjct  498   APTMSITTQPQYGAHIILRKV  518



>emb|CDP19599.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/516 (54%), Positives = 379/516 (73%), Gaps = 1/516 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             MEV  +L     +   ++ +WR++NWAW +PK  EK LR Q L+GN Y L  GD KE  +
Sbjct  1     MEVLYSLVAVLSASFLVILSWRILNWAWFKPKKREKCLRQQGLRGNSYNLVLGDMKETVR  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M  E KSKP+N  +D +V RV+P+  ++I+ +G+NS+ W G +P V++ DP+H+KEV++K
Sbjct  61    MTQEAKSKPINFTND-IVSRVMPFIDKTIKTYGENSYAWAGPMPAVLLMDPEHIKEVMNK  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
                + +   +P+   L+ GL+ YE DKWSKHRK+ NPAF LEK+K M+PA    C EMV 
Sbjct  120   SFNYLKPPGNPLSKLLATGLVSYETDKWSKHRKLINPAFHLEKVKLMLPAFRLSCFEMVS  179

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE+++S   S ELDVWPEL+ +  +VIS TAFG +YE G+++FELQ E AE       S
Sbjct  180   KWEQLISEKGSCELDVWPELQALTSDVISRTAFGSNYEEGQKIFELQKEQAELILLAARS  239

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
              Y+PG RF+PTK+N+RM GI KE+ +++  +I  R+ AMK GE  +++LL +LLESNFKE
Sbjct  240   PYVPGWRFVPTKRNKRMKGIAKEVRSLVMDMINNRVKAMKAGEAKNDDLLAILLESNFKE  299

Query  1026  MKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVF  1205
             ++ H +++FGM+++++I ECKLFY AGQETTS LLVWT+ILLS++Q+WQ+ AR+EV  VF
Sbjct  300   IQEHEDKKFGMTLDEVIEECKLFYFAGQETTSSLLVWTLILLSKHQDWQDRARDEVQQVF  359

Query  1206  GDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIF  1385
             G  KP+F+ LN LK++TMILNE LRLYPPV  L R+  E  KLG L+LPAGV+LL+P I 
Sbjct  360   GSKKPEFEDLNHLKVITMILNEVLRLYPPVVMLGRMTPETTKLGELTLPAGVQLLLPAIL  419

Query  1386  LHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSC  1565
             LHHD ++WG+DA EF PERF EG+ KAT G+  Y PF  GPRICIG NFAMVE+K AL+ 
Sbjct  420   LHHDSKIWGDDAKEFKPERFSEGILKATKGQLTYFPFGWGPRICIGQNFAMVESKLALAM  479

Query  1566  ILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             IL+RFSF+LSP YAHAP+T +T  P +GA LIL+KL
Sbjct  480   ILQRFSFELSPLYAHAPHTIITLQPQHGAQLILRKL  515



>emb|CDP19609.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/502 (56%), Positives = 365/502 (73%), Gaps = 4/502 (1%)
 Frame = +3

Query  177   VCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEV  356
               +W+ +NW W RPK LEK L+ Q  +GNPY+L +GD KE++ +  E +SK +N LSD++
Sbjct  24    AVSWKALNWVWFRPKKLEKRLKEQRFRGNPYKLLHGDFKEMSTLYTEAQSKNLN-LSDDI  82

Query  357   VPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLS  536
             VPRVIP +  +++K+GKN+++W G  P ++I DP+ +K V  K + FQ+   +P+   L+
Sbjct  83    VPRVIPQYLGAVKKYGKNTYLWFGPRPALVIMDPNLIKAVTQKVDVFQKPRVNPLGRLLA  142

Query  537   QGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVW  716
             QGL+ YEG+KW+K RK+ NPAF +EKLK M+PA YK  SEMV +WE +VS     E+DVW
Sbjct  143   QGLVSYEGEKWAKQRKLLNPAFHVEKLKLMLPAFYKSASEMVTKWENVVSPKGLAEVDVW  202

Query  717   PELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYI--PGGRFLPTKKNR  890
             P L+ +  + IS TAFG +YE GRR+FELQ E  EH  +L  SVYI  PG RFLPTK+NR
Sbjct  203   PNLQALTSDAISRTAFGSNYEEGRRIFELQREQTEHLMQLARSVYINIPGFRFLPTKRNR  262

Query  891   RMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIED  1070
             RM  I +E+N  ++ +I  R  AM+ GE  S++LL ++L+SN +E++ HGN++ GM+ E+
Sbjct  263   RMKQIAREVNGSVREMINTRRKAMRAGEAGSDDLLGLMLQSNSQEIEKHGNKDSGMTTEE  322

Query  1071  IISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKI  1250
             I+ ECKLFY AGQETTS LLVWTM+LL R  EWQ  AREEV+  FG   PDFDGLN LKI
Sbjct  323   IVDECKLFYFAGQETTSALLVWTMVLLCRYPEWQARAREEVLQQFGTKDPDFDGLNHLKI  382

Query  1251  VTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEF  1430
             VTMIL+E LRLYPPV T+ R   E+ KLGNL+LPAGV+L +PI+ +HHDP++WGED  EF
Sbjct  383   VTMILHEVLRLYPPVATMSRRTIEETKLGNLTLPAGVQLTLPILLMHHDPDIWGEDVKEF  442

Query  1431  NPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAH  1610
              PERF EGVS AT G   Y PF  GPRICIG NFAM+EAK A+S IL+RFSF+LSPSY H
Sbjct  443   KPERFAEGVSHATKGHVAYFPFGWGPRICIGQNFAMLEAKLAMSMILQRFSFELSPSYTH  502

Query  1611  APYTGLT-TNPLYGAPLILQKL  1673
             AP T      P YGA LILQK+
Sbjct  503   APGTATALVQPQYGAHLILQKI  524



>ref|XP_009607556.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/507 (56%), Positives = 379/507 (75%), Gaps = 2/507 (0%)
 Frame = +3

Query  153   FSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             F   I+FL   W+ +NW WI+PK +EK L+ +  KG+ Y+L  GD KEI  M+ E K+KP
Sbjct  12    FVIMIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLLGDMKEINTMVEEAKTKP  71

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             MN  +D  V RV+P+F + + ++GKN F+WLG  P + ITDP+ ++E+LSK   +Q+   
Sbjct  72    MNFTND-YVARVLPHFTKLMLQYGKNCFMWLGPKPTMFITDPELIREILSKSYIYQKIQG  130

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
             +P+   L+QGL  YE +KW+KHR+I NPAF L+KLKHM+P+ Y  C +M+ +WE IVS +
Sbjct  131   NPITKLLAQGLASYETEKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMLRKWESIVS-S  189

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
             E  E+DVWP L+T+  + IS TAFG +YE GR++FELQ E AE   +    +YIPG RF+
Sbjct  190   EGSEIDVWPFLQTLTSDAISRTAFGSNYEEGRQIFELQKEQAELILQAARWLYIPGWRFV  249

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEF  1052
             PTK+N+RM  I KE+ +++  II KRI  MK GE A ++LL +LLESNFKE++ H N+ F
Sbjct  250   PTKRNKRMKQIAKEVRSLVLGIINKRIREMKAGEAAKDDLLGILLESNFKEIQMHRNKNF  309

Query  1053  GMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDG  1232
             GM+I+++I ECKLFY AGQETTS LLVWT+ILLS++ +WQE AREEV  VFG +KPD++ 
Sbjct  310   GMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDWQERAREEVRQVFGSNKPDYET  369

Query  1233  LNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWG  1412
             L +LK+VTMI NE LRLYPP   + R V E+ KLGNLSLPAG+ L++P I+LHHD E+WG
Sbjct  370   LKQLKVVTMIFNEVLRLYPPGIMIGRTVHEETKLGNLSLPAGMLLMLPAIWLHHDNEIWG  429

Query  1413  EDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKL  1592
             +DA EF PERF EGV+KAT GK  Y PFS GPRICIGLNFAM+EAK A++ IL+ ++F+L
Sbjct  430   DDAKEFKPERFGEGVNKATKGKFAYFPFSWGPRICIGLNFAMLEAKMAVAMILQHYAFEL  489

Query  1593  SPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             SPSYAHAP+T +T  P +GAPLIL+KL
Sbjct  490   SPSYAHAPHTIITLQPQHGAPLILRKL  516



>ref|XP_003546751.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/501 (58%), Positives = 367/501 (73%), Gaps = 4/501 (1%)
 Frame = +3

Query  180   CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVV  359
             CAW+V+ W W+RPK LEK LR Q L+GNPY LF GD+KE  KM  E  SKPMN LSD+++
Sbjct  19    CAWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMN-LSDDII  77

Query  360   PRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQ  539
             PRV  Y   S+ KHGKNSF+WLG IP V I DP+ +K+V +K   F +   +P+V  L+ 
Sbjct  78    PRVSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLAT  137

Query  540   GLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWP  719
             GL  YEG+KWSKHR+I NPAF LEKLK M+P  +K C+++V +WE ++S   S E+D WP
Sbjct  138   GLAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCNDLVSKWEGMLSSEGSCEMDAWP  197

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
              L+ +A +VI+ +AFG SYE GRR+F+LQ E AE   ++   + IPG RFLPT  +RRM 
Sbjct  198   FLQNLASDVIARSAFGSSYEEGRRIFQLQREQAELLIKVLLKIQIPGWRFLPTNTHRRMK  257

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN---QEFGMSIED  1070
              ID++I   LK +I KR  A+K GE   N+LL +LLESN KE++ HGN   +  GMS+E+
Sbjct  258   EIDRDIKASLKDMINKREKALKAGEATKNDLLGILLESNHKEIQEHGNRNNKNVGMSLEE  317

Query  1071  IISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKI  1250
             +I ECKLFY AGQETTS LLVWTM+LLSR  +WQ  AREEV  VFG  KPDFDGL+RLKI
Sbjct  318   VIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVFQVFGYQKPDFDGLSRLKI  377

Query  1251  VTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEF  1430
             VTMIL E LRLYPPV  + R +++D KLG L+LPAGV +L+P I +HHD + WGEDA +F
Sbjct  378   VTMILYEVLRLYPPVAGMTRSIEKDVKLGTLTLPAGVHVLLPTILIHHDRKFWGEDAKQF  437

Query  1431  NPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAH  1610
             NPERF EGV KATNG+  + PF  GPRICIG NF+++EAK ALS IL+ FSF+LSP+YAH
Sbjct  438   NPERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYAH  497

Query  1611  APYTGLTTNPLYGAPLILQKL  1673
             AP   +T  P YGA +IL+K+
Sbjct  498   APTALITIQPQYGAHIILRKV  518



>ref|XP_004166892.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=516

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/498 (57%), Positives = 360/498 (72%), Gaps = 2/498 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
              W++ +W W RPK LEK LR Q   GN YR+ +GD KE A M  E  SKPMN  S+ + P
Sbjct  20    GWKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKERAAMREEAMSKPMN-FSNHIAP  78

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RVIP  + +IQ++GKNSF+WLG IP V I DP+ +K V S +N FQ+   +P    L QG
Sbjct  79    RVIPSIYHTIQRYGKNSFMWLGPIPRVHIMDPEQLKTVFSFYNDFQKPTMNPFTKLLVQG  138

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             ++  +G+KW KHRKI NPAF LEKLK MVPA Y  C+EMV +WE +VS+  S ELDV P 
Sbjct  139   IVNLDGEKWVKHRKIINPAFHLEKLKDMVPAFYHSCNEMVSKWESMVSKEGSCELDVMPY  198

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             LK +A +VIS TAFG SYE G+++F+LQ EL     +    +YIPG RFLPTK NR+M  
Sbjct  199   LKXMASDVISRTAFGSSYEKGKKIFKLQTELTNFVIQTTLGIYIPGWRFLPTKLNRKMKE  258

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-FGMSIEDIIS  1079
             I KEI T++  I+++R  +MK GE    +LL +L+ESN  E+K HGN++  GMSIED+I 
Sbjct  259   ISKEITTLILGIMDEREKSMKAGEAIQTDLLSILMESNMNEIKQHGNKKXIGMSIEDVIE  318

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY+AGQETT+ LLVWTMILLS   EWQE AR EV  +FG+ +P++DGLNRLK+VTM
Sbjct  319   ECKLFYIAGQETTATLLVWTMILLSSYSEWQERARAEVFEIFGNKQPNYDGLNRLKVVTM  378

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             I NE LRLYPP    +RIV+++ +LGNL+LP GV L +PI+ +  DPE+WGEDA+EFNPE
Sbjct  379   IFNEVLRLYPPGSLFVRIVRKETRLGNLTLPGGVMLGLPIVLIQRDPELWGEDAHEFNPE  438

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF  GVSKAT   + ++PF  GPRICIG  FAM+EAK ALS IL+RFSF+LSPSY H+P 
Sbjct  439   RFSGGVSKATKNPSAFIPFGWGPRICIGQTFAMIEAKMALSMILQRFSFELSPSYTHSPI  498

Query  1620  TGLTTNPLYGAPLILQKL  1673
               LTT P +GA +IL KL
Sbjct  499   ASLTTQPQHGAHIILHKL  516



>ref|XP_002262693.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/519 (56%), Positives = 379/519 (73%), Gaps = 5/519 (1%)
 Frame = +3

Query  120   MRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEI  299
             M++      F+F   I  L+ AWR++NW W+RPK LE+ LR Q L GN Y   YGD KE+
Sbjct  1     MKLSSVAISFVF---ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYSCLYGDFKEM  57

Query  300   AKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVL  479
             ++M+NE  S+P++  SD++V RV+P+   SIQK+GKNSF WLG  P+V I +P+ +++V 
Sbjct  58    SRMINEANSRPIS-FSDDIVQRVLPFHDHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVF  116

Query  480   SKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
              KHN FQ+    P+   L+ G++  EG++W+K RKI NPAF LEKLKHMV A    CS+M
Sbjct  117   LKHNAFQKVPPHPLGKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDM  176

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             V +WE+ +S + S ELDVWP L+ +A +VIS TAFG SYE GRR+F+LQ E A  A ++ 
Sbjct  177   VNKWEKKLSLDGSCELDVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVT  236

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              S+Y+PG RF PTK NRRM  I  E+N +LK IIEKR  AMK GE A+++LL +L+ESN+
Sbjct  237   RSIYVPGWRFFPTKTNRRMRQISNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNY  296

Query  1020  KEMKHHGNQE-FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
             ++M+ +  ++  GMSI+D+I ECKLFYLAGQETTS LL+WTM+LLS++  WQ  AREEV+
Sbjct  297   RDMQENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTRAREEVL  356

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              VFG+ KPD DGLN LKIVTMI +E LRLYPPV  L+R V  D+++G L LP GV++ +P
Sbjct  357   RVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALP  416

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
             I+ LHHD E+WGEDA EFNP RF EGVSKA   +  + PF  GPRIC+G NFAM+EAK A
Sbjct  417   ILLLHHDHEIWGEDAKEFNPGRFSEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMA  476

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             L+ IL+RFSF+LSPSYAHAP + +T  P YGA LIL  L
Sbjct  477   LAMILQRFSFELSPSYAHAPISLITMQPQYGAHLILHGL  515



>gb|KEH38475.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/517 (55%), Positives = 378/517 (73%), Gaps = 2/517 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             M     + LF+   + L+ AWR++NW W++PK LEK LR Q LKGN YRL  GD K++ K
Sbjct  1     MATTTAIILFTLMTLSLIWAWRILNWIWLKPKKLEKELREQGLKGNSYRLLVGDIKDLLK  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             +  E  SKPMN LSD++VPRV  +  +++ KHGKNSF+W G  P V ITDP+ +K+V++K
Sbjct  61    IRKEATSKPMN-LSDDIVPRVYSFVQQTVAKHGKNSFIWFGPTPRVNITDPEQIKDVINK  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
                FQ+   +P+V  L  GL+  EG++WSKHRKI NPAF LEKLK ++P  +K C +++ 
Sbjct  120   IYDFQKPNVNPLVRLLGCGLVCLEGEQWSKHRKIINPAFHLEKLKIILPIFHKSCDDLIS  179

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE+++S + S E+DVWP L+ +A ++IS  AFG SYE G+R+F+LQ E AE  +++   
Sbjct  180   KWEKMLSSDGSCEMDVWPFLQNLASDLISRAAFGSSYEEGKRIFQLQTEQAELTTKIIEK  239

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
             VYIPG RFLPT   RRM  I++++   L  +I  R  A+  GE   ++LL +LLESN KE
Sbjct  240   VYIPGWRFLPTTTPRRMKEIERDVRASLTDMINTRERALMAGEATKDDLLGILLESNHKE  299

Query  1026  MKHH-GNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             M+ H  N+  GMS++D+I ECKLFY AG ETTS LLVWT++LLSR  +WQ  AREEV+ V
Sbjct  300   MEEHDNNKNVGMSLDDVIEECKLFYFAGAETTSVLLVWTIVLLSRYPDWQARAREEVLQV  359

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG++KPDFDGL+ LKIVTMIL E LRLYPPV  L R V +D KLGNL+LPAGV++ +PI+
Sbjct  360   FGNNKPDFDGLSHLKIVTMILYEVLRLYPPVIELARSVHKDVKLGNLTLPAGVQITLPIV  419

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              +HHD E+WG+DA  FNPERF EGV KATNG+  ++PF GGPRICIG NF+M+EAK A++
Sbjct  420   LVHHDSELWGDDAKVFNPERFSEGVLKATNGRNSFVPFGGGPRICIGQNFSMLEAKMAIA  479

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL+RFSF+LSPSYAHAP   +T  P YGA +IL+K+
Sbjct  480   MILQRFSFELSPSYAHAPTALITLQPQYGAHIILRKV  516



>dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=518

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/501 (59%), Positives = 376/501 (75%), Gaps = 2/501 (0%)
 Frame = +3

Query  174   LVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDE  353
             L+ AWR++NW W++PK LEK LR Q LKGN YRL  GD K++ K+  E  +KPMN LSD+
Sbjct  17    LIWAWRILNWLWLKPKKLEKLLREQGLKGNSYRLLVGDIKDLLKIRKEATTKPMN-LSDD  75

Query  354   VVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKL  533
             +VPRV  +  +S+ KHGKNSF+W G  P V ITDPD +K+VL+K   FQ+  A+P+V  L
Sbjct  76    IVPRVYSFVHQSVTKHGKNSFIWFGPTPRVNITDPDQIKDVLNKIYDFQKPNANPLVRLL  135

Query  534   SQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDV  713
             + GL+  EG++WSKHRKI NPAF LEKLK M+P  +K C +M+ +WE+++S + S E+DV
Sbjct  136   ANGLVSLEGEQWSKHRKIINPAFHLEKLKIMLPIFHKSCDDMISKWEKMLSSDGSCEMDV  195

Query  714   WPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRR  893
             WP L+  A +VIS  AFG SYE G+R+F+LQ E AE  +++   VYIPG RFLPT   RR
Sbjct  196   WPFLQNFASDVISRAAFGSSYEEGKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRR  255

Query  894   MNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIED  1070
             M  ID++I   L  +I  R  A+K GE   ++LL +LLESN KEM+ HGN ++ GMS++D
Sbjct  256   MKEIDRDIKASLTDMINNRERALKAGEATKDDLLGILLESNHKEMEEHGNNKDVGMSLDD  315

Query  1071  IISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKI  1250
             +I ECKLFY AGQETTS LLVWTM+LLSR  +WQ  AREEV+ VFG++KPDFDGL+ LKI
Sbjct  316   VIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKI  375

Query  1251  VTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEF  1430
             VTMIL E LRLYPPV  L R V +D KLGNL+LPAGV++ + II +HHD E+WGEDA  F
Sbjct  376   VTMILYEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHHDIELWGEDAKVF  435

Query  1431  NPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAH  1610
             NPERF EGV KATNG+  + PF+GGPRICIG NF+M+EAK A++ IL+RFSF+LSPSYAH
Sbjct  436   NPERFSEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAH  495

Query  1611  APYTGLTTNPLYGAPLILQKL  1673
             AP T +T  P YGA +IL KL
Sbjct  496   APATVITLQPQYGAHIILHKL  516



>ref|XP_002265784.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=526

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/528 (55%), Positives = 384/528 (73%), Gaps = 5/528 (1%)
 Frame = +3

Query  93    ILQFAGQVMMRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYR  272
             +L+ + +V M++      F+F   I  L+ AWR++NW W+RPK LE+ LR Q L GN YR
Sbjct  3     LLEVSSKVEMKLSSVAISFVF---ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYR  59

Query  273   LFYGDTKEIAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIIT  452
             L +GD +E+++M+NE  S+P++  SD++V RV+P+   SIQK+GKN+F+WLG  P+V I 
Sbjct  60    LLHGDFREMSRMINEANSRPIS-FSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIM  118

Query  453   DPDHVKEVLSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVP  632
              P+ + +VL KHN FQ+    P+   L+ G+   EG++W+K RKI NPAF LEKLKHMV 
Sbjct  119   QPELISDVLLKHNAFQKAPRHPLRKLLASGIASLEGEQWTKRRKIINPAFHLEKLKHMVS  178

Query  633   AMYKICSEMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHE  812
             A    CS+MV +WE+ +S + S ELD+WP L+ +  +VIS TAFG SYE GRR+F+LQ E
Sbjct  179   AFQLSCSDMVNKWEKQLSLDGSCELDIWPYLQNLTGDVISRTAFGSSYEEGRRIFQLQKE  238

Query  813   LAEHASELRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNL  992
              A  A ++  SVY+PG RF PTK NRRM  I  E++ +LK IIEKR  AM+ GE A+++L
Sbjct  239   QALLAVQVTRSVYVPGWRFFPTKTNRRMRQISSEVDALLKGIIEKREKAMQAGETANDDL  298

Query  993   LDMLLESNFKEMKHHGNQE-FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEW  1169
             L +L+ESN++EM+ +  ++  GMSI+D+I ECKLFYLAGQETTS LL+WTM+LLS++  W
Sbjct  299   LGLLMESNYREMQENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNW  358

Query  1170  QELAREEVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSL  1349
             Q  AREEV+ VFG+ KPD D LN LKIVTMI +E LRLYPPVP L R V  D+++G L L
Sbjct  359   QACAREEVLRVFGNKKPDGDDLNHLKIVTMIFHEVLRLYPPVPMLTRAVFADSQVGGLYL  418

Query  1350  PAGVRLLVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLN  1529
             P GV++ +PI+ +HHD ++WGEDA EFNP RF EGVSKA   +  + PF  GPRIC+G N
Sbjct  419   PDGVQIALPILLIHHDDKIWGEDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQN  478

Query  1530  FAMVEAKTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             FAM+EAK AL+ IL+RFSF+LSPSYAHAP + LT  P +GA LIL  L
Sbjct  479   FAMMEAKMALAMILQRFSFELSPSYAHAPISLLTMQPQHGAHLILHGL  526



>ref|XP_004166890.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=524

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/498 (58%), Positives = 356/498 (71%), Gaps = 2/498 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
              W++V+W W RPK LEK LR Q   GN YR+ +GD KE A M  E  SKPMN  S+ + P
Sbjct  28    GWKIVDWIWFRPKKLEKLLRRQGFTGNSYRILHGDLKESAAMRKEAMSKPMN-FSNHIAP  86

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RVIP  + +IQ +GKNSF+WLG +P V I DP+ +K V S  N FQ+   +P+   L QG
Sbjct  87    RVIPSVYHTIQIYGKNSFMWLGPMPRVHIMDPEQIKTVFSFINDFQKPTMNPLTRLLVQG  146

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             +   EG+KW+KHRKI NPAF LEKLK MVPA Y  C+EMV +WE +VSR  S ELDV P 
Sbjct  147   IANLEGEKWAKHRKIINPAFHLEKLKDMVPAFYHSCNEMVSKWESMVSREGSCELDVMPC  206

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             LK +A +VIS TAFG SYE G ++F+LQ EL     +    +YIPG  FLPTK NR+M  
Sbjct  207   LKNMASDVISRTAFGSSYEKGXKIFKLQTELGNLVIQASLGIYIPGWSFLPTKSNRKMKE  266

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIEDIIS  1079
             I KEI T++  I+ +R  +M  GE    +LL +L+ESN  E+K HGN ++ GMSIE++I 
Sbjct  267   ISKEITTLILGIMNEREKSMNAGEAIQTDLLSILMESNMNEIKQHGNNKDIGMSIEEVIE  326

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY+AGQETT+ LLVWTM+LLS   EWQE AR EV  +FG+ KP++DGLNRLK+VTM
Sbjct  327   ECKLFYIAGQETTATLLVWTMVLLSSYSEWQERARAEVFEIFGNKKPNYDGLNRLKVVTM  386

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             I NE LRLYPPV    RIV+++ KLGNL+LP GV L +PI+ +  DPE+WGEDA+EFNPE
Sbjct  387   IFNEVLRLYPPVSIFGRIVRKETKLGNLTLPKGVMLGLPIVLIQRDPELWGEDAHEFNPE  446

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EGVSKAT     ++PF  GPRICIGLNF M+EAK  LS IL+RFSF+LSPSY H+P 
Sbjct  447   RFSEGVSKATKNPCAFIPFGWGPRICIGLNFTMIEAKMTLSMILQRFSFELSPSYTHSPS  506

Query  1620  TGLTTNPLYGAPLILQKL  1673
               LTT P +GA +IL KL
Sbjct  507   ASLTTQPQHGAHIILHKL  524



>gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
Length=518

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/501 (59%), Positives = 375/501 (75%), Gaps = 2/501 (0%)
 Frame = +3

Query  174   LVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDE  353
             L+ AWR++NW W++PK LEK LR Q LKGN YRL  GD  ++ KM  E  SKPMN LSD+
Sbjct  17    LIWAWRILNWLWLKPKKLEKLLREQGLKGNSYRLLVGDMNDLLKMRKEATSKPMN-LSDD  75

Query  354   VVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKL  533
             +VPRV  +  +S+ KHGKNSF+W G  P V ITDPD +K+VL+K   FQ+  A+P+V  L
Sbjct  76    IVPRVYSFVHQSVTKHGKNSFIWFGPTPRVNITDPDQIKDVLNKIYDFQKPNANPLVRLL  135

Query  534   SQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDV  713
             + GL+  EG++WSKHRKI NPAF LEKLK M+P  +K C +++ +WE+++S + S E+DV
Sbjct  136   ANGLVSLEGEQWSKHRKIINPAFHLEKLKIMLPIFHKSCDDLISKWEKMLSSDGSCEMDV  195

Query  714   WPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRR  893
             WP L+  A +VIS  AFG SYE G+R+F+LQ E AE  +++   VYIPG RFLPT   RR
Sbjct  196   WPFLQNFASDVISRAAFGSSYEEGKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRR  255

Query  894   MNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIED  1070
             M  ID++I   L  +I  R  A+K GE   ++LL +LLESN KEM+ HGN ++ GMS++D
Sbjct  256   MKEIDRDIKASLTDMINNRERALKAGEATKDDLLGILLESNHKEMEEHGNNKDVGMSLDD  315

Query  1071  IISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKI  1250
             +I ECKLFY AGQETTS LLVWTM+LLSR  +WQ  AREEV+ VFG++KPDFDGL+ LKI
Sbjct  316   VIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKI  375

Query  1251  VTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEF  1430
             VTMIL E LRLYPPV  L R V +D KLGNL+LPAGV++ + II +HHD E+WGEDA  F
Sbjct  376   VTMILYEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHHDIELWGEDAKVF  435

Query  1431  NPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAH  1610
             NPERF EGV KATNG+  + PF+GGPRICIG NF+M+EAK A++ IL+RFSF+LSPSYAH
Sbjct  436   NPERFSEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAH  495

Query  1611  APYTGLTTNPLYGAPLILQKL  1673
             AP T +T  P YGA +IL KL
Sbjct  496   APATVITLQPQYGAHIILHKL  516



>gb|KHN44057.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/501 (58%), Positives = 366/501 (73%), Gaps = 4/501 (1%)
 Frame = +3

Query  180   CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVV  359
             CAW+V+ W W+RPK LEK LR Q L+GNPY LF GD+KE  KM  E  SKPMN LSD+++
Sbjct  19    CAWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMN-LSDDII  77

Query  360   PRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQ  539
             PRV  Y   S+ KHGKNSF+WLG IP V I DP+ +K+V +K   F +   +P+V  L+ 
Sbjct  78    PRVSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLAT  137

Query  540   GLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWP  719
             GL  YEG+KWSKHR+I NPAF LEKLK M+P  +K C+++V +WE ++S   S E+D WP
Sbjct  138   GLAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCNDLVSKWEGMLSSEGSCEMDAWP  197

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
              L+ +A +VI+ +AFG SYE GRR+F+LQ E AE   ++   + IPG RFLPT  +RRM 
Sbjct  198   FLQNLASDVIARSAFGSSYEEGRRIFQLQREQAELLIKVLLKIQIPGWRFLPTNTHRRMK  257

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN---QEFGMSIED  1070
              ID++I   LK +I KR  A+K GE   N+LL +LL SN KE++ HGN   +  GMS+E+
Sbjct  258   EIDRDIKASLKDMINKREKALKAGEATKNDLLGILLASNHKEIQEHGNRNNKNVGMSLEE  317

Query  1071  IISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKI  1250
             +I ECKLFY AGQETTS LLVWTM+LLSR  +WQ  AREEV  VFG  KPDFDGL+RLKI
Sbjct  318   VIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVFQVFGYQKPDFDGLSRLKI  377

Query  1251  VTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEF  1430
             VTMIL E LRLYPPV  + R +++D KLG L+LPAGV +L+P I +HHD + WGEDA +F
Sbjct  378   VTMILYEVLRLYPPVAGMTRSIEKDVKLGTLTLPAGVHVLLPTILIHHDRKFWGEDAKQF  437

Query  1431  NPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAH  1610
             NPERF EGV KATNG+  + PF  GPRICIG NF+++EAK ALS IL+ FSF+LSP+YAH
Sbjct  438   NPERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYAH  497

Query  1611  APYTGLTTNPLYGAPLILQKL  1673
             AP   +T  P YGA +IL+K+
Sbjct  498   APIALITIQPQYGAHIILRKV  518



>ref|XP_009339349.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=532

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/500 (57%), Positives = 360/500 (72%), Gaps = 2/500 (0%)
 Frame = +3

Query  177   VCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEV  356
              CAWRV+NW W+RPK LEK LR Q L GN YRL+ GD KEI+ M+ E  SKPMN  S + 
Sbjct  34    ACAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMN-HSHDT  92

Query  357   VPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLS  536
              PRV+PY  +S+  +GKNSF+W+G  P V IT+P+ +K + +KH  F +  A+P+V  L 
Sbjct  93    APRVLPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKLTANPLVKLLL  152

Query  537   QGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVW  716
              GL  Y G+KW+KHRKI NPAF  EKLK M+PA+Y+ CSEM+  WE +VS+  S ELDVW
Sbjct  153   TGLANYGGEKWAKHRKIINPAFHSEKLKRMLPAIYQSCSEMIEEWESLVSKESSYELDVW  212

Query  717   PELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRM  896
             P L+ +  +VIS T+FG SY+ GR +F+L     E   + + SVYIPG RFLPTK N+R+
Sbjct  213   PYLQNMTADVISRTSFGSSYKEGREIFQLLKLQIELTMKTKQSVYIPGWRFLPTKMNKRL  272

Query  897   NGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQ-EFGMSIEDI  1073
              G+DKEI  +L  II KR  A+K GE A ++LL +LLESN KE+K HGN+ E GMSI+DI
Sbjct  273   KGVDKEIRELLMGIINKREEAIKAGEAAKDDLLGLLLESNNKEIKEHGNKKEVGMSIQDI  332

Query  1074  ISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIV  1253
             + ECKLFY AGQETTS LLVWTM+LLS NQ WQ+ AREEV+ VFG +KPD DGLN LK+V
Sbjct  333   LGECKLFYFAGQETTSTLLVWTMVLLSENQNWQDRAREEVLQVFGGEKPDVDGLNHLKVV  392

Query  1254  TMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
             T IL E+LRLYP + TL R++ +  +    SLPAGV + +P + +HHD E+WG+DA +F 
Sbjct  393   TTILLEALRLYPSIVTLSRMIHKKTQFTEFSLPAGVEISLPTVLIHHDKELWGDDATQFK  452

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             P RF EGVSKAT  K  Y PF GG RICIG NFAM+EAK A++ IL+ F+FKLSPSYAHA
Sbjct  453   PMRFAEGVSKATKNKLTYFPFGGGARICIGQNFAMMEAKLAVALILQHFTFKLSPSYAHA  512

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P    T  P +GA ++L KL
Sbjct  513   PSGITTLQPQFGAHIVLHKL  532



>ref|XP_008226215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Prunus 
mume]
Length=518

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/503 (56%), Positives = 367/503 (73%), Gaps = 2/503 (0%)
 Frame = +3

Query  168   MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV-L  344
             M +  AWRV+NW W+RPK LEK LR Q L GN YRL +GDTK+++KM+ +T+SKP+ +  
Sbjct  15    MVIAWAWRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQTQSKPIKLST  74

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             S ++ P V P+F +++  +GKNSFVW+G IP V I +P+ +K+  ++H+ F + + +P++
Sbjct  75    SHDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNRHDDFHKVVKNPIM  134

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L QG++  EG++W+KHRKI NPAF LEKLK MVP  Y+ CSEM+ +WE +VS+  S E
Sbjct  135   KSLPQGIVGIEGEQWAKHRKIINPAFHLEKLKGMVPIFYRSCSEMINKWESLVSKESSCE  194

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             LDVWP L+    +VIS  AFG SYE GR++F+L  E A+  +    SVYIPG RFLPTK+
Sbjct  195   LDVWPYLENFTSDVISRAAFGSSYEEGRKIFQLLREEAKIYTVAMRSVYIPGWRFLPTKQ  254

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMS  1061
             N++   I  EI  +LK II KR  AMK GE   ++LL +L+ESNF+E++ HGN +  GMS
Sbjct  255   NKKAKEIHNEIKGLLKGIINKREEAMKAGEATKDDLLGILMESNFREIQEHGNNKNAGMS  314

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             IED+I ECKLFY AGQETTS LLVWTM+LLS+NQ+WQ  AREEV+ VFG + P ++ L++
Sbjct  315   IEDVIGECKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEVLQVFGSNIPTYEELSQ  374

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LK+VTMIL E LRLYP V  L R   +  +LG LSLPAGV + +PI+ +HHD E+WGEDA
Sbjct  375   LKVVTMILLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLPILLVHHDKELWGEDA  434

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
             NEF PERF EGVSKAT  +  Y PF GGPRICIG NFAM+EAK ALS ILR F+ +LSP 
Sbjct  435   NEFKPERFSEGVSKATKNQFTYFPFGGGPRICIGQNFAMMEAKLALSLILRHFALELSPL  494

Query  1602  YAHAPYTGLTTNPLYGAPLILQK  1670
             YAHAP   +T  P YGA +IL K
Sbjct  495   YAHAPSVTITLQPQYGAHIILHK  517



>gb|KHN14193.1| Secologanin synthase [Glycine soja]
Length=518

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/517 (56%), Positives = 371/517 (72%), Gaps = 2/517 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME    + L    I+ L  AWRV+NW W+RPK LE+ LR Q L+GNPYRL  GD KEI  
Sbjct  1     MEEASCVCLVVILILALTLAWRVLNWLWLRPKRLERLLREQGLQGNPYRLLVGDLKEIMN  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M  E  SKPMN LS ++VPRV  +   ++  HGKNSF+W G  P VIIT+P+ +K+VL+K
Sbjct  61    MQKEVTSKPMN-LSHDIVPRVFSFLQHTLNTHGKNSFIWFGRKPRVIITEPELIKDVLNK  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
              + F +    P+V  L+ GLL +EG+KW+KHR+I +PAF LEKLK+M+P  YK C++++ 
Sbjct  120   MHDFPKPDTSPLVKLLATGLLNHEGEKWNKHRRIISPAFNLEKLKNMLPIFYKSCNDLII  179

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WEE++S + S E+DVWP L+ ++ + I+ TAFG SYE GR++F+L  E AE A +    
Sbjct  180   KWEEMLSSDGSCEIDVWPFLQNLSSDAIARTAFGSSYEEGRKIFQLLKEQAELAMKAIMK  239

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
             +YIPG RFLPT  +RRM  ID+EI   L  +I  R  A+K GE   N+LL +LLESN KE
Sbjct  240   LYIPGWRFLPTANHRRMKEIDREIKASLTDMISNREKALKAGEATENDLLGILLESNHKE  299

Query  1026  MKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
              + HGN +  GMS+ED+I ECKLFY AGQETTS LLVWTM+LLSR  +WQ  AREEV+ V
Sbjct  300   TEEHGNSKNVGMSLEDVIEECKLFYFAGQETTSALLVWTMVLLSRYPDWQARAREEVLQV  359

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG  KP+FDGL+ LKIV+MILNE LRLYPP   L R V  D KLGNLSLPAGV++ +P  
Sbjct  360   FGKQKPNFDGLSHLKIVSMILNEVLRLYPPAVGLNRNVDRDMKLGNLSLPAGVQVSLPTT  419

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              +HHD E+WG+D NEF PERF EGV KATNG+  + PF  GPRICIG NF+++EAK ALS
Sbjct  420   MVHHDRELWGDDVNEFKPERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALS  479

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL+ FSF+LSP+YAHAP T  T  P YGA +IL+K+
Sbjct  480   TILQHFSFELSPAYAHAPVTVFTLQPQYGAHVILRKV  516



>ref|XP_007149362.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
 gb|ESW21356.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
Length=523

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/498 (58%), Positives = 359/498 (72%), Gaps = 1/498 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AW ++NW W  PK LE+ LR Q L+GNPY L  GDTK+ AKM  E  SKPMN+ S ++VP
Sbjct  24    AWMMLNWVWFTPKRLERLLREQGLQGNPYTLLVGDTKDFAKMRKEAFSKPMNLFSHDIVP  83

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RV  +F  SI  HGK SF+W G  P V ITDP+ +K+VL+K   F++   +P V  L+ G
Sbjct  84    RVFSFFHHSINTHGKKSFMWFGPAPRVTITDPELIKDVLNKTYDFEKINMNPQVRLLAPG  143

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L+ +EG+KWSKHRKI NPAF LEKLK M+P   K C +++G WE++ S + S E+DVWP 
Sbjct  144   LVSHEGEKWSKHRKIINPAFNLEKLKDMLPLFVKCCDDLIGNWEKMSSSDGSSEMDVWPF  203

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +A + IS TAFG S+E GRR+F+L  E  E   +L   VYIPG RF+PT  +RRM  
Sbjct  204   LQNLARDAISRTAFGSSFEEGRRIFQLLKEQTELTVQLMLKVYIPGWRFVPTPTHRRMKA  263

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG-NQEFGMSIEDIIS  1079
             IDKEI   L  II  +  A+K GE   N+LL +LLESN KE++ HG N+  GM+IED+I 
Sbjct  264   IDKEIKASLMDIINNKEKALKAGEATKNDLLGILLESNHKEIQEHGNNKNVGMNIEDVIG  323

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AGQETTS LLVWTMILLS   +WQ  AREEV+ VFG+ KPDFDGLN LKIVTM
Sbjct  324   ECKLFYFAGQETTSSLLVWTMILLSMYPDWQTRAREEVLQVFGNRKPDFDGLNHLKIVTM  383

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             ILNE  RLYPPV  L R V +D KLGNLSL AG+++ +PII +HHD E+WG+DA EF PE
Sbjct  384   ILNEVFRLYPPVIGLARKVSKDVKLGNLSLVAGMQVSIPIILVHHDCELWGDDAKEFKPE  443

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EGV KAT G+A  +PF GGPRICIG NF+++EAK ALS IL+RFSF+LS +Y HAP 
Sbjct  444   RFAEGVLKATKGRASLIPFGGGPRICIGQNFSLMEAKIALSMILQRFSFELSSTYTHAPT  503

Query  1620  TGLTTNPLYGAPLILQKL  1673
               +T  P YGA LIL+K+
Sbjct  504   PVITIQPQYGANLILRKV  521



>gb|AFO64616.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=515

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/517 (54%), Positives = 373/517 (72%), Gaps = 3/517 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME   + F    + +F+   +R+ NW W +PK +EK+LR Q L G  Y+  +GD KE+ +
Sbjct  1     MESPTSFFALGVASIFIYLIYRIANWLWFKPKKIEKFLRKQGLNGTSYKFMFGDLKELVQ  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M NE KSKPM+ L+ ++  RV+P+++ ++  HGK  F WLG  P+V +++P  ++EVL+ 
Sbjct  61    MSNEAKSKPMS-LNHDIANRVLPFYYNALSTHGKTCFTWLGIKPVVHLSEPTMIREVLNN  119

Query  486   HNTFQQNLA-DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMV  662
             +N +Q+  A +P+   L++G+   E D+W KHRKI NPAF +EKLKHMVPA Y  CSEM+
Sbjct  120   YNQYQKPRAGNPLTKLLARGVADAEADQWVKHRKIINPAFHVEKLKHMVPAFYVSCSEML  179

Query  663   GRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRH  842
              +W E V++  SGE+DVW  L T + +VIS TAFG SYE GR++FELQ E A    +   
Sbjct  180   DKWGETVTKESSGEVDVWTYLSTFSADVISRTAFGSSYEEGRKIFELQREQAVLIIKASQ  239

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFK  1022
             SVYIPG RFLPTK N+RM  ID+EI   +K II+KR+ AMK  E ++++LL +LL+SN K
Sbjct  240   SVYIPGLRFLPTKSNKRMKEIDREIKASIKNIIDKRVVAMKAKETSNDDLLGILLDSNDK  299

Query  1023  EMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             E+K HG++ +G+SIED+I ECKLFY AGQETT  +LVWTMILL  + +WQ  AREEV+HV
Sbjct  300   EIKQHGSK-YGLSIEDVIEECKLFYFAGQETTGTMLVWTMILLGHHTDWQRRAREEVLHV  358

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FGD  PD DGL+ LK++ +I +E LRLYPP   L R++ E+ KLGNL+LPAG  + + I+
Sbjct  359   FGDKTPDIDGLSHLKVINIIFHEVLRLYPPAQLLRRMIHEETKLGNLTLPAGTLVQLNIL  418

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
               HHD + WGED +EFNPERF EGVSKAT G+A YLPF GGPRIC+G NFAM+EAK AL+
Sbjct  419   LSHHDKDTWGEDVHEFNPERFSEGVSKATKGRATYLPFGGGPRICMGQNFAMLEAKMALA  478

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL+RFSF++SPSY HAP++  T  P +GA LIL K+
Sbjct  479   MILQRFSFEVSPSYTHAPHSIFTLQPQFGAHLILHKV  515



>ref|XP_002271303.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/508 (56%), Positives = 378/508 (74%), Gaps = 3/508 (1%)
 Frame = +3

Query  153   FSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             F+F I  L+ AWR++NW W+RPK LE+ LR Q L GN YRL +GD +E+ +M++E  S+ 
Sbjct  10    FAF-ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMLRMISEANSRS  68

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             ++ LSD++V RV+P+   SI+K+GKN F+W+G  P+V I DP+ +++V  K+N F++   
Sbjct  69    IS-LSDDIVQRVLPFHCHSIKKYGKNYFIWMGPKPVVNIMDPELIRDVFLKYNAFRKPPP  127

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
              P+   L+ GL+  EG++W+K RKI NPAF LEKLKHMVPA    CS+MV +WE+ +S++
Sbjct  128   HPLGKLLATGLVTLEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSDMVNKWEKKLSKD  187

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
              S ELD+WP+L+ +A + IS TAFG SYE GRR+F+LQ E A  A ++  SVYIPG RF+
Sbjct  188   GSCELDIWPDLENLAGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIPGWRFV  247

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-  1049
             PTK N+RM  I  E++ +LK IIE+R  AMK GE A+++LL +L+ESNF+EM+ H  ++ 
Sbjct  248   PTKTNKRMRQISNEVHALLKGIIERREKAMKVGETANDDLLSLLMESNFREMQEHDERKN  307

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
              GMSI+D+I ECKLFY AGQETTSDLL+WTM+LLS++  WQ  AREEV+ VFG+ KPD D
Sbjct  308   VGMSIKDVIEECKLFYFAGQETTSDLLLWTMVLLSKHSNWQARAREEVLQVFGNKKPDGD  367

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
             GLN LKIVT+I +E LRLYPPV  LIR V  D+++G    P G  + +PI+ +HHD E+W
Sbjct  368   GLNHLKIVTIIFHEVLRLYPPVSMLIRTVVADSQVGGWYFPDGALITLPILLIHHDHEIW  427

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             GEDA EFNPERF EGVSKAT G+  + PF  GPR+CIG NFAM+EAK AL+ IL+RFSF+
Sbjct  428   GEDAKEFNPERFSEGVSKATKGQFAFYPFGYGPRVCIGQNFAMMEAKMALAMILQRFSFE  487

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LSPSYAHAP   +T  P YGA LIL  L
Sbjct  488   LSPSYAHAPSNIITIQPQYGAYLILHGL  515



>ref|XP_011082965.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=514

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/514 (56%), Positives = 380/514 (74%), Gaps = 3/514 (1%)
 Frame = +3

Query  132   VFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMM  311
             +  +L L S ++  LV AW+++NWAW RP+ LEK LR Q  KGN Y+LF+GD  E+  M 
Sbjct  4     LLSSLALISCAVA-LVYAWKILNWAWFRPRKLEKILRQQGFKGNSYKLFFGDFNEMKAMT  62

Query  312   NETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHN  491
              E KSKPM+  S E+VPRV P   ++++ +G+ SF+W G  P VI+ DP+ V+E+LSK  
Sbjct  63    KEAKSKPMS-FSHEIVPRVAPSIIKTVKNYGEQSFLWFGPRPAVIVLDPEMVREILSKSY  121

Query  492   TFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRW  671
              FQ+   +P    L++G+  YE DKW+KHR++ NPAF +EKLKHMVPA Y  C++M+ +W
Sbjct  122   VFQKPGGNPTSRMLARGIASYETDKWAKHRRLINPAFHVEKLKHMVPAFYLSCADMLSKW  181

Query  672   EEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVY  851
             E+IV R    ELDVWP L+T+  + IS TAFG SYE GRR+FELQ E AE   E   +VY
Sbjct  182   EKIVPREGLCELDVWPYLQTLTSDAISRTAFGSSYEEGRRIFELQKEQAELIMEALRTVY  241

Query  852   IPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMK  1031
             IPG RFLPTK N+RMN I +E+ + +  II KR+ A+K GE A ++LL +LLESN KE++
Sbjct  242   IPGSRFLPTKNNKRMNKIVREVESSVLGIINKRMKAIKAGETAGDDLLGLLLESNLKEIE  301

Query  1032  HHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGD  1211
              HGN+ FGMS++++I ECKLFY AGQETTS LLVWTMILLS++++WQE AR+EV+ +FG 
Sbjct  302   QHGNK-FGMSLKEVIEECKLFYFAGQETTSTLLVWTMILLSKHKDWQERARDEVLQLFGR  360

Query  1212  DKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLH  1391
             DKPD+  LN LKIV+MI +E LRLYPP   L RI  +++ LG ++LPAGV+LL+P + LH
Sbjct  361   DKPDYQELNHLKIVSMIFHEVLRLYPPGVMLNRITMKESTLGKVTLPAGVQLLMPAVLLH  420

Query  1392  HDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCIL  1571
             HD ++WG+DA EF PERF EGVSKAT G+  Y PF  GPRICIG +FAM+EAK A++ IL
Sbjct  421   HDRKIWGDDAEEFKPERFSEGVSKATQGQLVYFPFGWGPRICIGQSFAMLEAKLAMAMIL  480

Query  1572  RRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + +SF+LSPSY+HAP T +T  P +GA LIL+KL
Sbjct  481   QHYSFELSPSYSHAPATVITLQPQHGAHLILRKL  514



>ref|XP_008226213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/513 (55%), Positives = 369/513 (72%), Gaps = 2/513 (0%)
 Frame = +3

Query  138   CNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNE  317
             C      +  + +  AWRV+NW W+RPK LEK LR Q L GN YRL +GDTK+++KM+ +
Sbjct  8     CVALCVVWVSIVITWAWRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQ  67

Query  318   TKSKPMNV-LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNT  494
             T+SKP+ +  S ++ P V P+F +++  +GKNSFVW+G IP V I +P+ +K+  ++H+ 
Sbjct  68    TQSKPIKLSTSHDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNRHDD  127

Query  495   FQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWE  674
             F + + +P++  L QG++  EG++W+KHRKI NPAF LEKLK MVP  Y+ CSEM+ +WE
Sbjct  128   FHKVVKNPIMKSLPQGIVGIEGEQWAKHRKIINPAFHLEKLKGMVPIFYRSCSEMINKWE  187

Query  675   EIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYI  854
              +VS+  S ELDVWP L+    +VIS  AFG SYE GR++F+L  E A+  +    SVYI
Sbjct  188   SLVSKESSCELDVWPYLENFTSDVISRAAFGSSYEEGRKIFQLLREEAKIYTVAMRSVYI  247

Query  855   PGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKH  1034
             PG RFLPTK+N++   I  EI  +LK II KR  AMK GE   ++LL +L+ESNF+E++ 
Sbjct  248   PGWRFLPTKQNKKAKEIHNEIKGLLKGIINKREEAMKAGEATKDDLLGILMESNFREIQE  307

Query  1035  HGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGD  1211
             HGN +  GMSIED+I ECKLFY AGQETTS LLVWTM+LLS+NQ+WQ  AREEV+ VFG 
Sbjct  308   HGNNKNAGMSIEDVIGECKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEVLQVFGS  367

Query  1212  DKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLH  1391
             + P ++ L++LK+VTMIL E LRLYP V  L R   +  +LG LSLPAGV + +PI+ +H
Sbjct  368   NIPTYEELSQLKVVTMILLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLPILLVH  427

Query  1392  HDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCIL  1571
             HD E+WGEDANEF PERF EGVSKAT  +  Y PF GGPRICIG NFAM+EAK ALS IL
Sbjct  428   HDKELWGEDANEFKPERFSEGVSKATKNQFTYFPFGGGPRICIGQNFAMMEAKLALSLIL  487

Query  1572  RRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
             R F+ +LSP YAHAP   +T  P YGA +IL K
Sbjct  488   RHFALELSPLYAHAPSVTITLQPQYGAHIILHK  520



>ref|XP_008386388.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/500 (57%), Positives = 359/500 (72%), Gaps = 2/500 (0%)
 Frame = +3

Query  177   VCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEV  356
              CAWRV+NW W+RPK LEK LR Q L GN YRL+ GD KEI+ M+ E  SKPMN LS + 
Sbjct  21    ACAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMN-LSHDT  79

Query  357   VPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLS  536
              PRV+PY  +S+  +GKNSF+W+G  P V IT+P+ +K + +KH  F +    P+V  L 
Sbjct  80    APRVVPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKPALSPLVKLLL  139

Query  537   QGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVW  716
              GL  Y G+KW+KHRKI  PAF  EKLK M+PA+Y+ CSEM+  WE +VS+  S ELDVW
Sbjct  140   TGLANYGGEKWAKHRKIIKPAFHSEKLKRMLPAIYQSCSEMIEEWESLVSKESSYELDVW  199

Query  717   PELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRM  896
             P L+ +  +VIS T+FG SY+ GR +F+L     E   +++HSVYIPG RFLPTK N+R+
Sbjct  200   PYLQNMTADVISRTSFGSSYKEGREIFQLLKLQIELTVKMKHSVYIPGWRFLPTKTNKRL  259

Query  897   NGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-FGMSIEDI  1073
               +DKEI  +   II KR  A+K GE A ++LL +LLESN KE+K HGN++  GMSI+D+
Sbjct  260   KEVDKEIRELFMGIINKREEAIKAGEAAKDDLLGLLLESNNKEIKEHGNKKKVGMSIQDV  319

Query  1074  ISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIV  1253
             + ECKLFY AGQETTS LLVWTM+LLS NQ WQ+ AREEV+ VFG +KPDFDGLN LK+V
Sbjct  320   LGECKLFYFAGQETTSILLVWTMVLLSENQNWQDRAREEVLQVFGGNKPDFDGLNHLKVV  379

Query  1254  TMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
             TMIL E+LRLYP   TL R++ +  +    SLPAGV + +P I +HHD E+WG+DA +F 
Sbjct  380   TMILLEALRLYPSSFTLSRMIHKKTQFAEFSLPAGVGISLPTILIHHDKELWGDDATQFK  439

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             PERF EGVSKAT  K  Y PF GG RICIG NFAM+EAK A++ IL+ F+FKLSPSYAHA
Sbjct  440   PERFAEGVSKATKNKLTYFPFGGGARICIGQNFAMMEAKLAVALILQHFTFKLSPSYAHA  499

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P       P +GA ++L KL
Sbjct  500   PSGITLLQPQFGAHIVLHKL  519



>ref|XP_006594768.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/514 (56%), Positives = 379/514 (74%), Gaps = 9/514 (2%)
 Frame = +3

Query  156   SFSIMFLVC-------AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMN  314
             S SI+F++        AWR++NW WIRPK LE+ LR Q L+GNPYR+  GD KEI K+  
Sbjct  9     SSSIVFVIVILALTSWAWRMLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQM  68

Query  315   ETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNT  494
             E +SKPMN LS ++VPRV  +  +S+ KHGKNSF+W G  P V +TDP+ +K+VL+K + 
Sbjct  69    EARSKPMN-LSHDIVPRVFAHLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISD  127

Query  495   FQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWE  674
             F++  A+P+   L+ GL+ Y+G+KW+KHR++ NPAF LEKLK M+P  +K C++++ +WE
Sbjct  128   FRKPEANPLAKLLATGLVNYDGEKWNKHRRLINPAFSLEKLKIMLPIFFKSCNDLIIKWE  187

Query  675   EIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYI  854
              ++S + S E+DVWP L+ +A +VI+ TAFG S+E G+R+F+LQ ELAE   ++   VYI
Sbjct  188   GMLSYDGSCEMDVWPFLQNLASDVIARTAFGSSFEEGKRIFQLQKELAELTMKVIMKVYI  247

Query  855   PGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKH  1034
             PG RF+PT  NRRM  ID+ I   L  +I+KR  A K GE   ++LL +LLESN KE++ 
Sbjct  248   PGWRFVPTATNRRMKEIDRYIKASLTDMIKKREKAPKTGEATRDDLLGILLESNHKEIQE  307

Query  1035  HGNQE-FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGD  1211
             H N E  GM++ D+I ECKLFY AGQETTS LLVWTM+LLSR  +WQ  AREEV+ VFG 
Sbjct  308   HRNNENVGMNLNDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQSRAREEVLQVFGK  367

Query  1212  DKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLH  1391
               P+FDGL+ LKIVTMIL E LRLYPP   L R V  D KLGNL+LPAGV++ +PII +H
Sbjct  368   QAPNFDGLSHLKIVTMILYEVLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQVSLPIIMVH  427

Query  1392  HDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCIL  1571
             HD E+WG+DA EFNPERF EGVSKATNG+  + PF  GPRICIG NF+++EAK ALS IL
Sbjct  428   HDRELWGDDAKEFNPERFSEGVSKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMIL  487

Query  1572  RRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + FSF+LSP+Y HAP+T +T  P YGA +IL+K+
Sbjct  488   QHFSFELSPAYTHAPFTVITLQPQYGAHVILRKV  521



>emb|CDP11335.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/523 (54%), Positives = 376/523 (72%), Gaps = 12/523 (2%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             + V C+  L    + FL+ AW+V N AW+ PK LEK L+ Q L+GNPY+  +GD K+I+ 
Sbjct  8     IAVLCSCIL----LYFLMLAWKVFNCAWLTPKRLEKRLKEQGLRGNPYKFLHGDFKQIST  63

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGK-------NSFVWLGTIPMVIITDPDH  464
             ++ E  SK +N LSD++ PRVIP+  E+++K+GK       N+++WLG    V+I +P+H
Sbjct  64    LLKEAHSKTIN-LSDDLFPRVIPHLHEAVKKYGKYYLLFNYNTYIWLGPKLRVVIMNPEH  122

Query  465   VKEVLSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYK  644
             ++E+ SK + FQ+    P    L QGL  Y+GDKW+KHRK+  PAF +EKLKHMVP+   
Sbjct  123   IREITSKLSIFQKPGGTPDTKLLVQGLASYDGDKWAKHRKLITPAFHVEKLKHMVPSFCT  182

Query  645   ICSEMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEH  824
                EM+ +WE+IVS N S ELDVWP+L+T+  + IS TAFG +Y+ G R+FELQ E A++
Sbjct  183   CAGEMLSKWEKIVSTNGSCELDVWPDLRTLTCDAISRTAFGSNYKEGTRIFELQTEQAQY  242

Query  825   ASELRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDML  1004
               +   SVY PG RFLPTK+NRRM  I K+++  +++II  R+ AM+ G+  +++LL +L
Sbjct  243   HLKAVQSVYFPGWRFLPTKRNRRMKQIAKDVHESIRKIINARLEAMEAGDACADDLLSIL  302

Query  1005  LESNFKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAR  1184
             LESN KE+ +HGN+ FGMSI ++I ECKLFY AGQETTS LLVWTMILLSR   WQ  AR
Sbjct  303   LESNSKEIDYHGNKGFGMSIREVIEECKLFYFAGQETTSVLLVWTMILLSRYPNWQARAR  362

Query  1185  EEVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVR  1364
             EEV+  FG +KPD DGLN LK+VTMIL+E LRLYPPVP L R   E+ +LGNL+LP+ V+
Sbjct  363   EEVLQHFGTNKPDLDGLNHLKLVTMILHEVLRLYPPVPELARKAAEETQLGNLTLPSQVQ  422

Query  1365  LLVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVE  1544
             + +P + LH+ PE+WG+D  EF PERF +GVS ATNGK  + PF  GPRIC+G NFAM+E
Sbjct  423   VSLPAMLLHYAPEIWGDDVKEFKPERFADGVSNATNGKVAFFPFGWGPRICVGQNFAMLE  482

Query  1545  AKTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             AK AL+ IL+RFSF+LSPSY HAP   LT  P YGA LIL KL
Sbjct  483   AKVALAMILQRFSFELSPSYRHAPRVVLTLQPQYGAHLILHKL  525



>emb|CDP15983.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/512 (54%), Positives = 378/512 (74%), Gaps = 5/512 (1%)
 Frame = +3

Query  150   LFSFSIMFLVC--AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETK  323
             ++S  ++ +V   +W+ +NW W RP+ LEK L+ Q  +GNPY+L +GD KE++ +  E +
Sbjct  11    VYSSCLLLVVVGVSWKALNWVWFRPRKLEKRLKEQGFRGNPYKLLHGDIKEMSTLHKEAQ  70

Query  324   SKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQ  503
             SK +N LSD++VPRVIP +  +++K+GK +++WLG  P ++I DP+ VKE+  K   FQ+
Sbjct  71    SKNLN-LSDDIVPRVIPQYLGAVKKYGKKTYLWLGPKPAMVIMDPEQVKEITQKVYVFQK  129

Query  504   NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIV  683
                +P+   L+ G++ YEGDKW++HRK+ NPAF +EKLK M+PA +K  SE+V +WE++V
Sbjct  130   PHGNPLRRMLTPGIVMYEGDKWTQHRKLLNPAFHIEKLKLMLPAFHKSASEVVNKWEKVV  189

Query  684   SRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYI--P  857
             S   S E+DVWP L+ +  + IS TAFG +YE GRR+FELQ E AEH  E   SVYI  P
Sbjct  190   SPKGSAEVDVWPNLQALTSDAISRTAFGSNYEEGRRIFELQREQAEHIVEAGGSVYIYIP  249

Query  858   GGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHH  1037
             G RFLPTK++RRM  I KE+N  ++ +I+ R  AM+ GE  ++NLL ++L+SN +E++ H
Sbjct  250   GFRFLPTKRHRRMKQITKEVNDSIREMIDTRKKAMRAGEARTDNLLGLMLQSNSQEIEKH  309

Query  1038  GNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDK  1217
             GN+++GM+ E+II ECKLFYLAGQETTS LLVWTMI LSR  +WQ  AREEV+  FG + 
Sbjct  310   GNKDYGMTTEEIIDECKLFYLAGQETTSALLVWTMIYLSRYPDWQARAREEVLQHFGAND  369

Query  1218  PDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHD  1397
             P+FDGLN+LKIV MIL+E LRL PP+    R + E+ KLGNL++P GV L++PI+ +HHD
Sbjct  370   PEFDGLNQLKIVNMILHEVLRLCPPITATARRIAEETKLGNLTIPVGVLLVLPIMLMHHD  429

Query  1398  PEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRR  1577
             P++WGED  EF PERF EGVS AT G+  + PF  GPRICIG NFAM+EAK A+S IL+R
Sbjct  430   PDIWGEDVKEFKPERFAEGVSHATKGRLAFWPFGWGPRICIGQNFAMLEAKLAMSMILQR  489

Query  1578  FSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             FSF+LSPSYAH+P   +T  P YGA LIL+K+
Sbjct  490   FSFELSPSYAHSPRVAVTLRPQYGAHLILRKV  521



>ref|XP_002270326.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=516

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/518 (55%), Positives = 380/518 (73%), Gaps = 4/518 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME+      F+F I  L+ AWR++NW W+RPK LE+ LR Q + GN YRL +GD +E+ +
Sbjct  1     MELISVAISFAF-ITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLR  59

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M++E  S+P++ LSDE+V RV+P+ + S++K+GKN F+W+G  P+V I DP+ +++V  +
Sbjct  60    MISEANSRPIS-LSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFLR  118

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
             +N F +    P+   L+ GL+  EG++W+KHRKI NPAF LEKLKHMVPA    C +MV 
Sbjct  119   YNAFHKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFHLEKLKHMVPAFQLSCGDMVN  178

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE+ +S++ S ELD+WP+L+ +  + IS TAFG SYE GRR+F+LQ E A  A ++  S
Sbjct  179   KWEKKLSKDGSCELDIWPDLENLTGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRS  238

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
             VYIPG RF+PTK N+R+  I  E++ +LK IIEKR  AM  GE A+++LL +L+ESNF+E
Sbjct  239   VYIPGWRFVPTKTNKRIRQIRNELHALLKGIIEKREKAMLVGETANDDLLSLLMESNFRE  298

Query  1026  MKHHGNQE-FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             M+ H  ++  GMSI+D+I ECKLFY AGQETTSDLL+WTMILLS++  WQ  AREE++ V
Sbjct  299   MQEHDERKNVGMSIDDVIEECKLFYFAGQETTSDLLLWTMILLSKHSNWQARAREEILQV  358

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG+ KPD +GLN LKIVTMI +E LRLYPPV  LIR V  D+++G    P G  + +PI+
Sbjct  359   FGNKKPDGNGLNHLKIVTMIFHEVLRLYPPVSMLIRTVFVDSQVGRWYFPVGSHVALPIL  418

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKAT-NGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
              +HHD E+WGEDA EFNPERF EGVSKAT  G+  + PF  GPR CIG NFAM+EAK AL
Sbjct  419   LIHHDHEIWGEDAKEFNPERFSEGVSKATKGGQFAFFPFGYGPRACIGQNFAMMEAKMAL  478

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + IL+RFSF+LSPSYAHAP+  +T  P YGA LIL  L
Sbjct  479   AMILQRFSFELSPSYAHAPFNVITVQPQYGAHLILHGL  516



>ref|XP_009356840.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/497 (56%), Positives = 362/497 (73%), Gaps = 2/497 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWRVVNW W+RPK LE++LR Q L GN YR   GD KEI+    +  SKPM+ LS ++ P
Sbjct  20    AWRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMS-LSHDIAP  78

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RVIP+    +  +GKNSFVW+G+IP VIIT+P+ +K +L+K   F Q   +P+V  L+ G
Sbjct  79    RVIPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLATG  138

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             +  YEG+KW+KHR+I NP F LEKLK M+PA Y+ CSEM+  WE +V +  S ELDVWP 
Sbjct  139   IAFYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLVLKESSCELDVWPY  198

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
              + +  +VIS TAFG SY+ GR++F+L  E  +  +++  SVYIPG RFLPTK N++M G
Sbjct  199   FQNLTADVISRTAFGSSYKEGRKIFQLLKEQVQLVTKVVQSVYIPGWRFLPTKTNKKMKG  258

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIEDIIS  1079
             ID+EI  +L  II KR GA+K G+   ++LL +L+ESN KE++ HGN ++ GMS+ D+I 
Sbjct  259   IDREIRALLMGIINKREGAIKAGKATKDDLLGVLMESNVKEIREHGNNKKVGMSMHDVIE  318

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AGQETTS LLVWTM+LL + Q+WQ+ AREEV+ VFG +KPDFDGL  LK+VTM
Sbjct  319   ECKLFYFAGQETTSGLLVWTMVLLGQYQDWQDHAREEVIEVFGSNKPDFDGLIHLKVVTM  378

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             IL+E LRLYP +  + RI  +  +L N SLPAGV + +P + +HHD ++WG+DA EF PE
Sbjct  379   ILHEVLRLYPALSLMTRITSKKTQLANYSLPAGVEVALPTLLVHHDKQLWGDDAQEFKPE  438

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EGV KAT  K  Y PF GGPRICIG NFAMVEAK ALS IL+ F+F+LSPSYAHAP 
Sbjct  439   RFSEGVLKATKNKFTYFPFGGGPRICIGQNFAMVEAKVALSLILQHFTFELSPSYAHAPS  498

Query  1620  TGLTTNPLYGAPLILQK  1670
             + LT  P +GA +IL K
Sbjct  499   SHLTIRPQFGAHIILHK  515



>gb|KHN47456.1| Secologanin synthase [Glycine soja]
Length=537

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/497 (57%), Positives = 362/497 (73%), Gaps = 0/497 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AW+++NW W+RPK LE+ LR Q L+GN Y LF GD KE  KM NE  SKPMN+ S ++ P
Sbjct  39    AWKMLNWLWLRPKRLERLLREQGLQGNSYTLFVGDLKEFGKMRNEALSKPMNLFSHDIAP  98

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RV+ +   ++ KHGKNSF+W G IP V +TDP+ +K+VL+K   F +   +P V  L+ G
Sbjct  99    RVLSFIQHTVNKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFGKPDMNPHVRLLAPG  158

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L+ +EG+KWSKHRKI NPAF LEKLK+M+P   K C +++ +WE ++S + + E D+WP 
Sbjct  159   LVSHEGEKWSKHRKIINPAFNLEKLKNMLPLFIKCCDDLISKWEGMLSSDGTSETDIWPF  218

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
              + +A +VIS TAFG SYE GRR+F+L  E  E   +    V IPG RF+PT  +RRM  
Sbjct  219   FQNLASDVISRTAFGSSYEEGRRIFQLLKEQTELTIQTFLKVNIPGWRFVPTTTHRRMKE  278

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
             I+K+I   L  +I KR  A+K GE   NNLLD+LLESN KE++  GN+  GM++E++I E
Sbjct  279   INKDIEASLMDMINKRETALKAGEATKNNLLDILLESNHKEIQEQGNKNVGMNLEEVIEE  338

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTMILLS   +WQ  AREEV+ VFG+ KP+F+GLN LKIVTMI
Sbjct  339   CKLFYFAGQETTSVLLVWTMILLSMYPDWQTRAREEVLQVFGNRKPNFEGLNHLKIVTMI  398

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             LNE LRLYPPV  L R V ED KLGNLSLPAGV++ +PI+ +HHD E+WG+DA EF PER
Sbjct  399   LNEVLRLYPPVVGLARKVNEDVKLGNLSLPAGVQISLPIVLVHHDCELWGDDAKEFKPER  458

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F EG+ KATNG+  +  F GGPRICIG NF+ +EAK ALS IL+RFSF+LSP+Y HAP +
Sbjct  459   FSEGLLKATNGRVSFFAFGGGPRICIGQNFSFLEAKIALSMILQRFSFELSPTYTHAPTS  518

Query  1623  GLTTNPLYGAPLILQKL  1673
              +T  P +GA LIL K+
Sbjct  519   VITLQPQHGAHLILHKV  535



>ref|XP_003543171.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=537

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/497 (57%), Positives = 362/497 (73%), Gaps = 0/497 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AW+++NW W+RPK LE+ LR Q L+GN Y LF GD KE  KM NE  SKPMN+ S ++ P
Sbjct  39    AWKMLNWLWLRPKRLERLLREQGLQGNSYTLFVGDLKEFGKMRNEALSKPMNLFSHDIAP  98

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RV+ +   ++ KHGKNSF+W G IP V +TDP+ +K+VL+K   F +   +P V  L+ G
Sbjct  99    RVLSFIQHTVNKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFGKPDMNPHVRLLAPG  158

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L+ +EG+KWSKHRKI NPAF LEKLK+M+P   K C +++ +WE ++S + + E D+WP 
Sbjct  159   LVSHEGEKWSKHRKIINPAFNLEKLKNMLPLFIKCCDDLISKWEGMLSSDGTSETDIWPF  218

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
              + +A +VIS TAFG SYE GRR+F+L  E  E   +    V IPG RF+PT  +RRM  
Sbjct  219   FQNLASDVISRTAFGSSYEEGRRIFQLLKEQTELTIQTFLKVNIPGWRFVPTTTHRRMKE  278

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
             I+K+I   L  +I KR  A+K GE   NNLLD+LLESN KE++  GN+  GM++E++I E
Sbjct  279   INKDIEASLMDMINKRETALKAGEATKNNLLDILLESNHKEIQEQGNKNVGMNLEEVIEE  338

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTMILLS   +WQ  AREEV+ VFG+ KP+F+GLN LKIVTMI
Sbjct  339   CKLFYFAGQETTSVLLVWTMILLSMYPDWQTRAREEVLQVFGNRKPNFEGLNHLKIVTMI  398

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             LNE LRLYPPV  L R V ED KLGNLSLPAGV++ +PI+ +HHD E+WG+DA EF PER
Sbjct  399   LNEVLRLYPPVVGLARKVNEDVKLGNLSLPAGVQISLPIVLVHHDCELWGDDAKEFKPER  458

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F EG+ KATNG+  +  F GGPRICIG NF+ +EAK ALS IL+RFSF+LSP+Y HAP +
Sbjct  459   FSEGLLKATNGRVSFFAFGGGPRICIGQNFSFLEAKIALSMILQRFSFELSPTYTHAPTS  518

Query  1623  GLTTNPLYGAPLILQKL  1673
              +T  P +GA LIL K+
Sbjct  519   VITLQPQHGAHLILHKV  535



>ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=521

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/500 (58%), Positives = 357/500 (71%), Gaps = 3/500 (1%)
 Frame = +3

Query  180   CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVV  359
             C WR +NW W+ PK LEK LR Q   GN YRL+ GD K++  M  E KSKPMN  S ++ 
Sbjct  23    CGWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMN-FSHDIA  81

Query  360   PRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQ  539
             PRVIP    +I+K+GKNSFVWLG IP V I DP+ +K  LS +N FQ+   +P+V  L  
Sbjct  82    PRVIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFD  141

Query  540   GLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWP  719
             GL+ +EG+KW KHRKI N AF  EKLK MVP M++ C+EM+  WE++VS++ S ELDV P
Sbjct  142   GLINHEGEKWVKHRKIVNHAFHFEKLKDMVPTMFESCNEMINTWEKMVSKDGSCELDVMP  201

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
              L+ +A +VIS TAFG +YE G+ +F    EL     +  + VYIPG RFLPTK N RM 
Sbjct  202   YLQNLAADVISRTAFGSTYEEGKVIFNHFKELICLTIQASNIVYIPGRRFLPTKSNNRMK  261

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEE-ASNNLLDMLLESNFKEMKHHGNQEFGMSIEDII  1076
              I KEI T+L  +I+KR   MKEGE   S++LL +LLESNF E+K HGN   GMSI D+I
Sbjct  262   KITKEIKTMLMNVIDKRQRTMKEGETMQSDDLLGILLESNFNEIKEHGNVNLGMSINDLI  321

Query  1077  SECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVT  1256
              ECK+FY AGQETT+ LLVWTMILL    +WQ+ AR EV+ VFG++KPDFDGLNRLKIVT
Sbjct  322   EECKIFYFAGQETTAVLLVWTMILLGSYTKWQDRARAEVLQVFGNNKPDFDGLNRLKIVT  381

Query  1257  MILNESLRLYPPVPTLIR-IVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
             MILNE LRLY P   L R +VK + KLGN + P+GV L  P+I +H D E+WGEDANEFN
Sbjct  382   MILNEVLRLYSPASVLSRKLVKRETKLGNFTFPSGVMLSFPVILIHLDKEIWGEDANEFN  441

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             PERF EGVSKAT  +  + PF  GPRICIG NFAM+EAK ALS IL+ FSF+LSPSY HA
Sbjct  442   PERFAEGVSKATKNQTGFFPFGWGPRICIGQNFAMIEAKIALSIILQHFSFELSPSYTHA  501

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P + LTT P +GA +IL KL
Sbjct  502   PISILTTQPQHGAHIILHKL  521



>ref|XP_004488668.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=519

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/515 (57%), Positives = 380/515 (74%), Gaps = 2/515 (0%)
 Frame = +3

Query  132   VFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMM  311
             V   + LF+ +I+ L  AWR++NW W++PK LEK LR Q  KGN YRL  GD +++ K  
Sbjct  4     VTTAIILFTLTILSLTWAWRMLNWLWLKPKKLEKLLREQGFKGNSYRLLVGDVRDLLKTR  63

Query  312   NETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHN  491
              E  SKPMN LSD++ PRV  Y   S+ K+GKNSF+W G IP V ITDP+ +K+VL+K  
Sbjct  64    KEATSKPMN-LSDDIGPRVFSYVHHSVTKYGKNSFMWFGPIPRVNITDPEQIKDVLNKIY  122

Query  492   TFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRW  671
              F++  ++P+V  L+ GL+ YEG+KW+KHRKI NPAF LEKLK M+P  +K C +++ +W
Sbjct  123   DFRKPNSNPLVRLLANGLVSYEGEKWNKHRKIINPAFHLEKLKIMLPIFFKSCDDLISKW  182

Query  672   EEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVY  851
             E+++S   S E+DVWP L+ +A +VIS TAFG S+E G+R+F+LQ E AE   ++   VY
Sbjct  183   EKMLSLEGSCEMDVWPFLQNLASDVISRTAFGSSFEEGKRIFQLQIEQAELTKQIMMKVY  242

Query  852   IPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMK  1031
             IPG RFLPT  ++RM  ID++I   L  +I KR  A+K GE   ++LL +LLESN +EM+
Sbjct  243   IPGWRFLPTTTHKRMKEIDRDIKASLTDMINKREKALKAGEATKDDLLGILLESNHREME  302

Query  1032  HHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFG  1208
              HGN +  GMS+ED+I ECKLFY AGQETTS LLVWTM+ LSR  +WQ  AREEV  VFG
Sbjct  303   EHGNNKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVCLSRYPDWQARAREEVFQVFG  362

Query  1209  DDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFL  1388
             + KPDFDGL+ LKIVTMILNE LRLYPPV  L R V +D KLGN++LPAGV++ +P++ +
Sbjct  363   NKKPDFDGLSHLKIVTMILNEVLRLYPPVIALARSVHKDVKLGNITLPAGVQVSLPVVLV  422

Query  1389  HHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCI  1568
             HHD E+WG+DA  FNPERF EGV KATNGK  + PF GGPRICIG NF+M+EAK A++ I
Sbjct  423   HHDCELWGDDAKVFNPERFSEGVLKATNGKVSFFPFGGGPRICIGQNFSMLEAKMAMAMI  482

Query  1569  LRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             L+ FSF+LSPSYAHAP T +T  P YGA +IL+K+
Sbjct  483   LQHFSFELSPSYAHAPATVITLQPQYGAHIILRKV  517



>emb|CBI22134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/509 (55%), Positives = 377/509 (74%), Gaps = 4/509 (1%)
 Frame = +3

Query  153   FSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             F+F I  L+ AWR++NW W+RPK LE+ LR Q + GN YRL +GD +E+ +M++E  S+P
Sbjct  23    FAF-ITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMISEANSRP  81

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             ++ LSDE+V RV+P+ + S++K+GKN F+W+G  P+V I DP+ +++V  ++N F +   
Sbjct  82    IS-LSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFLRYNAFHKPAP  140

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
              P+   L+ GL+  EG++W+KHRKI NPAF LEKLKHMVPA    C +MV +WE+ +S++
Sbjct  141   HPLGKLLATGLVTLEGEQWTKHRKIINPAFHLEKLKHMVPAFQLSCGDMVNKWEKKLSKD  200

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
              S ELD+WP+L+ +  + IS TAFG SYE GRR+F+LQ E A  A ++  SVYIPG RF+
Sbjct  201   GSCELDIWPDLENLTGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIPGWRFV  260

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-  1049
             PTK N+R+  I  E++ +LK IIEKR  AM  GE A+++LL +L+ESNF+EM+ H  ++ 
Sbjct  261   PTKTNKRIRQIRNELHALLKGIIEKREKAMLVGETANDDLLSLLMESNFREMQEHDERKN  320

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
              GMSI+D+I ECKLFY AGQETTSDLL+WTMILLS++  WQ  AREE++ VFG+ KPD +
Sbjct  321   VGMSIDDVIEECKLFYFAGQETTSDLLLWTMILLSKHSNWQARAREEILQVFGNKKPDGN  380

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
             GLN LKIVTMI +E LRLYPPV  LIR V  D+++G    P G  + +PI+ +HHD E+W
Sbjct  381   GLNHLKIVTMIFHEVLRLYPPVSMLIRTVFVDSQVGRWYFPVGSHVALPILLIHHDHEIW  440

Query  1410  GEDANEFNPERFREGVSKAT-NGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSF  1586
             GEDA EFNPERF EGVSKAT  G+  + PF  GPR CIG NFAM+EAK AL+ IL+RFSF
Sbjct  441   GEDAKEFNPERFSEGVSKATKGGQFAFFPFGYGPRACIGQNFAMMEAKMALAMILQRFSF  500

Query  1587  KLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +LSPSYAHAP+  +T  P YGA LIL  L
Sbjct  501   ELSPSYAHAPFNVITVQPQYGAHLILHGL  529



>emb|CDP15973.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/508 (58%), Positives = 377/508 (74%), Gaps = 3/508 (1%)
 Frame = +3

Query  156   SFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPM  335
             S ++   V AWRV+N  W+RPK LEK LR   L GN YRL  GD K+IA M+ E  SKP+
Sbjct  16    SCAVALAVFAWRVLNCMWLRPKKLEKRLRNLGLNGNSYRLVCGDFKDIAVMLKEANSKPI  75

Query  336   NVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLAD  515
             N LSD++VPRVIP+F E I+K+GKNSFVWLG  P V+I DP  ++E+L K+  F++    
Sbjct  76    N-LSDDIVPRVIPFFIEIIKKYGKNSFVWLGLNPSVVILDPVLMREILLKNYIFKKPRPH  134

Query  516   PVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNE  695
             P+V  L+QG++  EGDKW+KHRKI + AF L+KLKHM+PA Y   SEM+ +WEE VS   
Sbjct  135   PIVKLLAQGVIFSEGDKWAKHRKIISSAFHLQKLKHMLPAFYSSASEMLSKWEERVSPEG  194

Query  696   SGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLP  875
             S ELDVWP L+T+  + IS TAFG +YE GRR+FELQ E A++A     SVY PG RFLP
Sbjct  195   SCELDVWPYLQTLGADSISRTAFGSNYEEGRRIFELQMEQAQYAVRATRSVYFPGLRFLP  254

Query  876   TKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFG  1055
             T++N+RM  I+KEI   ++ II KR+ A+K GE ++++LL ++LESNFKE+  HG++ FG
Sbjct  255   TRRNKRMKDIEKEIQAKIRDIINKRVKALKAGETSNDDLLGIMLESNFKEIDLHGDKSFG  314

Query  1056  MSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGL  1235
             M+++D+I ECKLFY AGQE++S LLVWT++LL R++EWQ  AR+EV  VFG +KP F+GL
Sbjct  315   MTMQDVIDECKLFYFAGQESSSTLLVWTLVLLGRHREWQSKARDEVSQVFGRNKPHFEGL  374

Query  1236  NRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGE  1415
             N LKIVTMILNE LRLYPP   L R V ++ K+G LSLPAGV L +P+I LHHD E+WG+
Sbjct  375   NHLKIVTMILNEVLRLYPPAVALNRRVHQETKVGKLSLPAGVMLWLPVILLHHDREIWGD  434

Query  1416  DANEFNPERFREGVSKATNG--KACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             D  EF PERF EGVSKA NG  +A + PF  GPRIC+G NFAM+EAK ALS IL+ FSF+
Sbjct  435   DVKEFKPERFSEGVSKAANGQSQAPFFPFGWGPRICLGQNFAMLEAKLALSMILQHFSFQ  494

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LSPSY HAPYT  T  P +GA L+L KL
Sbjct  495   LSPSYVHAPYTVFTLQPQHGALLVLHKL  522



>ref|XP_007149376.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
 gb|ESW21370.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
Length=523

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/498 (57%), Positives = 358/498 (72%), Gaps = 1/498 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AW ++NW W  PK LE+ LR Q L+GNPY L  GDT E AKM  E  SKPM++ S+++V 
Sbjct  24    AWMMLNWLWFTPKRLERLLREQGLQGNPYTLLVGDTNEFAKMRKEAFSKPMDLFSNDIVQ  83

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RV P+F  SI  HGKNSF+W G  P VI+TDP+ +K+V +K   FQ+   +P V  L+ G
Sbjct  84    RVYPFFRHSINTHGKNSFIWFGPAPRVILTDPELIKDVFNKTFDFQKIYLNPQVRLLTPG  143

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L+ +EG+KW KHRKI  P F LEKLK M+P + K C +++ +WEE++S + S E+DVWP 
Sbjct  144   LVSHEGEKWRKHRKIITPVFNLEKLKDMLPVLIKCCDDLISKWEEMLSLDGSSEMDVWPF  203

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +    IS TAFG SYE GRR+F+L  E +E  ++L + VYIPG RF+PT  +RRM  
Sbjct  204   LQNLTSEAISRTAFGSSYEEGRRIFQLLKEQSELTAQLVYKVYIPGWRFVPTTTHRRMKE  263

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG-NQEFGMSIEDIIS  1079
             IDKE    L  II  +  A+K GE   N+LLD+LLESN KE++ HG N+  G++IED+I 
Sbjct  264   IDKETKASLMDIINNKEKALKAGEATKNDLLDILLESNHKEIQEHGNNKNVGLNIEDVIE  323

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AGQ++TS LLVWTMILLS   +WQ  AREEV+ VFG+ KPDFDGLN LKIV M
Sbjct  324   ECKLFYFAGQDSTSSLLVWTMILLSMYPDWQTRAREEVLQVFGNHKPDFDGLNHLKIVPM  383

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             ILNE  RLYPPV  L R V +D KLGNLSL AG+++ +PII +HHD E+WG+DA EF PE
Sbjct  384   ILNEVFRLYPPVIGLPRKVLKDVKLGNLSLVAGMQVSIPIILVHHDCELWGDDAKEFKPE  443

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EGV KATNG+A  +PF GGPRIC G NF+ +EAK ALS IL+RFSF+LS SY HAP 
Sbjct  444   RFAEGVLKATNGRASLIPFGGGPRICTGRNFSFLEAKIALSMILQRFSFELSSSYTHAPI  503

Query  1620  TGLTTNPLYGAPLILQKL  1673
             T +T  P YGA LIL K+
Sbjct  504   TAITLQPQYGAHLILHKV  521



>ref|XP_002270501.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/519 (55%), Positives = 378/519 (73%), Gaps = 5/519 (1%)
 Frame = +3

Query  120   MRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEI  299
             M++      F+F   I  L+ AWR++NW W+RPK LE+ LR Q L GN YRL +GD +E+
Sbjct  1     MKLSSVAISFVF---ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREM  57

Query  300   AKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVL  479
             ++M+NE  S+P++  SD++V RV+P+   SIQK+GKN+F+WLG  P+V I  P+ +++VL
Sbjct  58    SRMINEANSRPIS-FSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELIRDVL  116

Query  480   SKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
              KHN FQ+    P+   L+ G+   EG++W+K RKI NPAF LEKLKHMV A    CS+M
Sbjct  117   LKHNAFQKPPRHPLGKLLASGVASLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDM  176

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             V +WE+ +S + S ELD+WP L+ +  +VIS TAFG SYE GRR+F+LQ E A    ++ 
Sbjct  177   VNKWEKQLSLDGSCELDIWPYLQNLTGDVISRTAFGSSYEEGRRIFQLQKEQALLTVQVT  236

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              SVY+PG RF PTK NRRM  I  E++ +LK IIEKR  AM+ GE A+++LL +L+ESN+
Sbjct  237   RSVYVPGWRFFPTKTNRRMRQISSEVDALLKGIIEKREKAMQAGETANDDLLGLLMESNY  296

Query  1020  KEMKHHGNQE-FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
             +EM+ +  ++  GMSI+D+I ECKLFYLAGQETTS LL+WTM+LLS++  WQ  AREEV+
Sbjct  297   REMQENDERKNVGMSIKDVIEECKLFYLAGQETTSALLLWTMVLLSKHSNWQARAREEVL  356

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              VFG+ KPD DGLN LKIVTMI +E LRLYPP P L R V  D+++G L LP GV++ +P
Sbjct  357   RVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPAPMLTRAVFADSQVGGLYLPDGVQIALP  416

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
             I+ +HHD ++WG+DA EFNP RF EGVSKA   +  + PF  GPRIC+G NFAM+EAK A
Sbjct  417   ILLIHHDDKIWGDDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMA  476

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             L+ IL+RFSF+LSPSYAHAP + LT  P +GA LIL  L
Sbjct  477   LAMILQRFSFELSPSYAHAPISLLTMQPQHGAHLILHGL  515



>ref|XP_009343587.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/497 (56%), Positives = 361/497 (73%), Gaps = 2/497 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWRVVNW W+RPK LE++LR Q L GN YR   GD KEI+    +  SKPM+ LS ++ P
Sbjct  20    AWRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMS-LSHDIAP  78

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RVIP+    +  +GKNSFVW+G+IP VIIT+P+ +K +L+K   F Q   +P+V  L+ G
Sbjct  79    RVIPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLATG  138

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             +  YEG+KW+KHR+I NP F LEKLK M+PA Y+ CSEM+  WE +V +  S ELDVWP 
Sbjct  139   IAFYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLVLKESSCELDVWPY  198

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
              + +  +VIS TAFG SY+ GR++F+L  E  +  +++  SVY PG RFLPTK N++M G
Sbjct  199   FQNLTADVISRTAFGSSYKEGRKIFQLLKEQVQLVTKVVQSVYTPGWRFLPTKTNKKMKG  258

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIEDIIS  1079
             ID+EI  +L  II KR GA+K G+   ++LL +L+ESN KE++ HGN ++ GMS+ D+I 
Sbjct  259   IDREIRALLMGIINKREGAIKAGKATKDDLLGVLMESNVKEIREHGNNKKVGMSMHDVIE  318

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AGQETTS LLVWTM+LL + Q+WQ+ AREEV+ VFG +KPDFDGL  LK+VTM
Sbjct  319   ECKLFYFAGQETTSGLLVWTMVLLGQYQDWQDHAREEVIEVFGSNKPDFDGLIHLKVVTM  378

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             IL+E LRLYP +  + RI  +  +L N SLPAGV + +P + +HHD ++WG+DA EF PE
Sbjct  379   ILHEVLRLYPALSLMTRITSKKTQLANYSLPAGVEVALPTLLVHHDKQLWGDDAQEFKPE  438

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EGV KAT  K  Y PF GGPRICIG NFAMVEAK ALS IL+ F+F+LSPSYAHAP 
Sbjct  439   RFSEGVLKATKNKFTYFPFGGGPRICIGQNFAMVEAKVALSLILQHFTFELSPSYAHAPS  498

Query  1620  TGLTTNPLYGAPLILQK  1670
             + LT  P +GA +IL K
Sbjct  499   SHLTIRPQFGAHIILHK  515



>ref|XP_008452438.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=521

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/499 (58%), Positives = 358/499 (72%), Gaps = 3/499 (1%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
              W++V+W W RPK LEK LR Q   GN YR+ +GD KE A M  E  SKPMN  S+ + P
Sbjct  24    GWKLVDWIWFRPKKLEKILRRQGFAGNSYRILHGDLKESAAMREEAMSKPMN-FSNHIAP  82

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RVIP  + +IQ +GK S +WLG +P V I DP+ +K V S  N FQ+   +P+   L QG
Sbjct  83    RVIPSVYHTIQLYGKKSMMWLGPMPRVHIMDPEQLKIVFSSINDFQKPTMNPLTRLLVQG  142

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKIC-SEMVGRWEEIVSRNESGELDVWP  719
             L   EG KW KHRKI NPAF +EKLK MVPA Y  C +EMV +WE +VSR  S ELDV P
Sbjct  143   LASLEGQKWVKHRKIINPAFHVEKLKDMVPAFYHSCYNEMVSKWEGMVSREGSCELDVMP  202

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
              L+ +A +VIS TAFG SYE G+++FELQ ELA    +    +YIPG RFLPTK NR+M 
Sbjct  203   YLQNMASDVISRTAFGSSYEKGKKIFELQTELANLVIQANLGIYIPGWRFLPTKSNRKMK  262

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIEDII  1076
              I KEI T++  I+ ++  ++K GE    +LL +L+ESN  E+K HGN +  GMSIED+I
Sbjct  263   EISKEITTLILGIMNEKEKSIKAGEAIQTDLLSILMESNMNEIKQHGNNKNIGMSIEDVI  322

Query  1077  SECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVT  1256
              ECKLFY+AGQETT+ LLVWTM+LLS   EWQE AR EV  +FG+ KPD+DGLNRLK+VT
Sbjct  323   EECKLFYIAGQETTATLLVWTMVLLSSYSEWQERARAEVFEIFGNKKPDYDGLNRLKVVT  382

Query  1257  MILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNP  1436
             MI NE LRLYPPV    RI++++ +LGNL+LP GV L +P++ +H DPE+WGEDA+EFNP
Sbjct  383   MIFNEVLRLYPPVNMFGRIIRKETRLGNLTLPEGVMLGLPVVLIHLDPELWGEDAHEFNP  442

Query  1437  ERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAP  1616
             ERF EG+SKAT   + ++PF  GPRICIG NFAM+EAK ALS IL+RFSF+LSPSY HAP
Sbjct  443   ERFSEGISKATKNPSAFIPFGWGPRICIGQNFAMIEAKMALSIILQRFSFELSPSYTHAP  502

Query  1617  YTGLTTNPLYGAPLILQKL  1673
                LTT P +GA +IL KL
Sbjct  503   IAVLTTQPQHGAHIILHKL  521



>emb|CDP19600.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/517 (54%), Positives = 382/517 (74%), Gaps = 2/517 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             M++F ++     S+   + AW ++NW W +PK LEK+LR Q L G+ YRL +GD KE A+
Sbjct  1     MDMFYSIIGVLCSVFLTIWAWIILNWVWFKPKKLEKYLRQQGLGGSHYRLLFGDMKETAQ  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M+ +  SKP+N  +D +VPR++P+  + I+  G N+  W+G  P +++ DP+ VKEVL+K
Sbjct  61    MVKQAYSKPINFTND-IVPRILPFVDKLIRSSGTNTLTWMGPSPALLLIDPELVKEVLTK  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
             +  +Q+   +P+   L++G   Y+ DKW+K+R+I +PAF LEKLKHMVPA    CSEM+ 
Sbjct  120   NYVYQKPRNNPLGKLLAEGFATYDTDKWAKNRRIISPAFHLEKLKHMVPAFCLSCSEMLS  179

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE     + S ELDVWP+++T+A ++IS TAFG +YE GR++FELQ + +E   +   S
Sbjct  180   KWENGALADGSLELDVWPDIRTLAGDMISRTAFGSNYEEGRKIFELQMQQSELFEQAIQS  239

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
             +Y+PG RFLPTK+N++M  I K++ +++  II KR+ AM+EGE   ++LL +LLESNFKE
Sbjct  240   IYVPGWRFLPTKRNKKMKKIFKDVRSLILGIINKRVRAMQEGEATHSDLLGLLLESNFKE  299

Query  1026  MKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVF  1205
             ++ HGN+ FGM+ E++I ECKLFY AG ETT+ LLVWT+ILLS++ +WQ  AR+EV+ VF
Sbjct  300   IQEHGNERFGMTSEEVIQECKLFYFAGHETTAILLVWTLILLSKHSDWQARARDEVLQVF  359

Query  1206  GDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIF  1385
             G++ PDF+ LNRLKIVTMILNE LRLY P   + R V ED KLG LSLP+G+ +L+P I 
Sbjct  360   GNNIPDFEELNRLKIVTMILNEVLRLYTPGVMISRRVNEDTKLGELSLPSGMFVLMPSIL  419

Query  1386  LHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSC  1565
             LHHDP +WG+DA EFNPERF EGV+KAT G+ C+LPF GGPRICIG NFA++EAK AL+ 
Sbjct  420   LHHDPSLWGDDAKEFNPERFSEGVAKATKGQPCFLPFGGGPRICIGQNFALLEAKMALAL  479

Query  1566  ILRRFSFKLSPSYAHAPYTGLT-TNPLYGAPLILQKL  1673
             IL+RFSF+LSP Y HAPY  LT   P YGA LI++KL
Sbjct  480   ILQRFSFELSPLYTHAPYLFLTLLQPQYGAQLIMKKL  516



>ref|XP_007149361.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
 gb|ESW21355.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
Length=516

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/498 (57%), Positives = 356/498 (71%), Gaps = 1/498 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWR+VNW W+ PK LE+ LR Q L+G PY+ F GDTKEI KM  E  SKPM++ S ++VP
Sbjct  17    AWRMVNWLWLTPKRLERLLREQGLEGKPYKFFVGDTKEIEKMKKEGLSKPMDLFSHDIVP  76

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RV  +F  SI  HGK  F W G IP VI+TDPD +K+VL+K N F +    P +  L  G
Sbjct  77    RVFSFFHHSINTHGKICFTWFGPIPRVILTDPDLIKDVLNKMNEFGRINMHPQLKFLVPG  136

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L+ +EG++WSKHRKI NPAF LEKLK+M P   K C +++ +WEE++  + S E+DVWP 
Sbjct  137   LVSHEGERWSKHRKIINPAFNLEKLKNMFPPFIKCCDDLISKWEEMLGSDGSSEIDVWPF  196

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L  +A + IS TAFG S+E GRR+F+L  E  E   E+   VYIPG RF+PT K RRM  
Sbjct  197   LHNMASDAISRTAFGSSFEEGRRIFQLLKEQIELTVEIISKVYIPGWRFVPTTKQRRMKA  256

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG-NQEFGMSIEDIIS  1079
             IDKEI   L  II  R+ A++ GE    +LL +LLESN KE++  G N+  GM+ ED+I+
Sbjct  257   IDKEIKCSLTDIINNRVKALETGEATKMDLLGILLESNQKEIEEQGNNKNIGMNNEDVIA  316

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AG ET S LLVWTMILLS   +WQ  AR+E++ VFG+ KPDFDGL+ LKIVTM
Sbjct  317   ECKLFYFAGHETVSSLLVWTMILLSMYPDWQTRARKEILQVFGNRKPDFDGLSHLKIVTM  376

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             ILNE LRLYPPV +L R V++D KLGNLSLP+ V++ +PI+ +HHD E+WG+DA EF PE
Sbjct  377   ILNEVLRLYPPVLSLARKVRKDVKLGNLSLPSEVQVFLPILLVHHDCEVWGDDAKEFKPE  436

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EGV KATNG+    PF GGPRICIG NFA++E K ALS IL+RFSF+LSP+Y HAP 
Sbjct  437   RFSEGVLKATNGRVSLFPFGGGPRICIGQNFALLEVKIALSIILQRFSFQLSPTYTHAPT  496

Query  1620  TGLTTNPLYGAPLILQKL  1673
               LT  P YGA LIL KL
Sbjct  497   AWLTLQPQYGAHLILHKL  514



>ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=587

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/500 (58%), Positives = 357/500 (71%), Gaps = 3/500 (1%)
 Frame = +3

Query  180   CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVV  359
             C WR +NW W+ PK LEK LR Q   GN YRL+ GD K++  M  E KSKPMN  S ++ 
Sbjct  89    CGWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMN-FSHDIA  147

Query  360   PRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQ  539
             PRVIP    +I+K+GKNSFVWLG IP V I DP+ +K  LS +N FQ+   +P+V  L  
Sbjct  148   PRVIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFD  207

Query  540   GLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWP  719
             GL+ +EG+KW KHRKI N AF  EKLK MVP M++ C+EM+  WE++VS++ S ELDV P
Sbjct  208   GLINHEGEKWVKHRKIVNHAFHFEKLKDMVPTMFESCNEMINTWEKMVSKDGSCELDVMP  267

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
              L+ +A +VIS TAFG +YE G+ +F    EL     +  + VYIPG RFLPTK N RM 
Sbjct  268   YLQNLAADVISRTAFGSTYEEGKVIFNHFKELICLTIQASNIVYIPGRRFLPTKSNNRMK  327

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEE-ASNNLLDMLLESNFKEMKHHGNQEFGMSIEDII  1076
              I KEI T+L  +I+KR   MKEGE   S++LL +LLESNF E+K HGN   GMSI D+I
Sbjct  328   KITKEIKTMLMNVIDKRQRTMKEGETMQSDDLLGILLESNFNEIKEHGNVNLGMSINDLI  387

Query  1077  SECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVT  1256
              ECK+FY AGQETT+ LLVWTMILL    +WQ+ AR EV+ VFG++KPDFDGLNRLKIVT
Sbjct  388   EECKIFYFAGQETTAVLLVWTMILLGSYTKWQDRARAEVLQVFGNNKPDFDGLNRLKIVT  447

Query  1257  MILNESLRLYPPVPTLIR-IVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
             MILNE LRLY P   L R +VK + KLGN + P+GV L  P+I +H D E+WGEDANEFN
Sbjct  448   MILNEVLRLYSPASVLSRKLVKRETKLGNFTFPSGVMLSFPVILIHLDKEIWGEDANEFN  507

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             PERF EGVSKAT  +  + PF  GPRICIG NFAM+EAK ALS IL+ FSF+LSPSY HA
Sbjct  508   PERFAEGVSKATXNQTGFFPFGWGPRICIGQNFAMIEAKIALSIILQHFSFELSPSYTHA  567

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P + LTT P +GA +IL KL
Sbjct  568   PISILTTQPQHGAHIILHKL  587



>ref|XP_003617766.1| Cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
 gb|AET00725.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=516

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/502 (56%), Positives = 375/502 (75%), Gaps = 5/502 (1%)
 Frame = +3

Query  174   LVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDE  353
             L+ AWR++NW W+RPK LEK LR Q L+GNPYR+ YGD K++ KM  E +SK MN L+D+
Sbjct  16    LIWAWRILNWLWLRPKKLEKLLREQGLQGNPYRILYGDIKDLLKMEKEARSKSMN-LTDD  74

Query  354   VVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKL  533
             ++PRVIPY   +++ HGKNSF+W GT P VI+T+P+ + +VL+  + F +N  +  ++KL
Sbjct  75    IMPRVIPYIQHNVKIHGKNSFMWFGTKPRVILTEPEQIIDVLNNISDFPKN--NHKIFKL  132

Query  534   -SQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELD  710
                GL   EG+KWSKHR++ NPAF  EKLK M P  +  C++++ +WEE++S + S E+D
Sbjct  133   LVSGLASLEGEKWSKHRRLINPAFHSEKLKVMTPTFFTSCNDLIRKWEEMLSPDGSCEID  192

Query  711   VWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNR  890
             +WP L+ +A +VIS T FG SYE GRR+F+LQ E AE  ++++ + YIP  RF+PT  NR
Sbjct  193   IWPSLQNLASDVISRTTFGSSYEEGRRIFQLQIEQAELMTKVQMNFYIPLWRFVPTMVNR  252

Query  891   RMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQ-EFGMSIE  1067
             R+N I K+I + LK +I KR+  +KEG E  N+LL +L+E+N KE+K HGN    GM+IE
Sbjct  253   RINEIGKDIKSSLKDMINKRVKILKEGGENKNDLLGILIETNHKEIKEHGNNVNVGMNIE  312

Query  1068  DIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLK  1247
             D+I ECKLFY AGQETTS LLVWTM+LLSR  EWQ  AREEV+ +FG+ KP+FDGLN LK
Sbjct  313   DVIQECKLFYFAGQETTSTLLVWTMVLLSRYPEWQARAREEVLQIFGNKKPNFDGLNNLK  372

Query  1248  IVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANE  1427
             IVTMIL E +RLYPP+  L R V+++ KLGNL+L AGV + +PII LHHD E+WG+DA  
Sbjct  373   IVTMILYEVMRLYPPIIELSRNVEKNVKLGNLTLSAGVEVFMPIILLHHDCELWGDDAKM  432

Query  1428  FNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYA  1607
             FNPERF  G+SKATNG+  + PF  GPRICIG NF+++EAK A++ IL+ FSF+LSP+YA
Sbjct  433   FNPERFSGGISKATNGRVSFFPFGWGPRICIGQNFSLLEAKMAMTLILQHFSFQLSPAYA  492

Query  1608  HAPYTGLTTNPLYGAPLILQKL  1673
             HAP T +   P YGA +IL+KL
Sbjct  493   HAPATVIALKPQYGAHIILRKL  514



>ref|XP_008450754.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=517

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/518 (56%), Positives = 365/518 (70%), Gaps = 3/518 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             M+   ++  F F +  L C WR +NW W+ PK LEK LR Q   GNPYRL+ GD  ++  
Sbjct  1     MDFRNSMIWFVFMVCLLRCGWRFLNWIWLTPKKLEKCLREQGFAGNPYRLYSGDLNDVVA  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M  E KSKPMN  S ++VPRVIP    +I+K+GKNSF+WLG  P V+I DP+ +K  LS 
Sbjct  61    MEEEAKSKPMN-FSHDIVPRVIPSMHHTIKKYGKNSFMWLGPNPRVLIMDPEQLKAALSL  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
             +N FQ+   +P+V  L  GL+ +EG+KW KHRKI N AF  EKLK MVP M++ C+EM+ 
Sbjct  120   YNDFQKPTTNPLVRLLFDGLINHEGEKWVKHRKIINHAFHFEKLKDMVPTMFESCNEMIS  179

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE++ S++ S ELDV P L+++  +VIS TAFG +YE G+ +F    EL     +  ++
Sbjct  180   KWEKMTSKDGSCELDVVPYLQSLTADVISRTAFGSTYEEGKIIFNHFKELIRLVLQASNT  239

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEA-SNNLLDMLLESNFK  1022
             VY+PG RFLPTK N RM  I KEI T+L  II+KR   MKE E   S++LL +LLESN  
Sbjct  240   VYLPGWRFLPTKSNNRMKKITKEIKTILMNIIDKRQRTMKEDETMHSDDLLGILLESNSN  299

Query  1023  EMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             E+K HGN   GMSI D+I ECK+FY AGQETT+ LLVWTM+LL    +WQ+ AR EV+ V
Sbjct  300   EIKEHGNVNIGMSINDLIEECKIFYFAGQETTAVLLVWTMVLLGSYTKWQDRARAEVLQV  359

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIR-IVKEDAKLGNLSLPAGVRLLVPI  1379
             FG+DKPDFDGLNRLKIVTMILNE LRLYPP   + R +VK++ +LGNL   +GV L  PI
Sbjct  360   FGNDKPDFDGLNRLKIVTMILNEVLRLYPPGSAVSRNLVKKETRLGNLKFSSGVTLSFPI  419

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             I +H D E+WGEDA+EFNPERF EGVSKAT  +  + PF  GPRIC+G NFAM+EAK AL
Sbjct  420   ILIHRDKELWGEDADEFNPERFAEGVSKATKNQTAFFPFGWGPRICVGQNFAMIEAKIAL  479

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             S IL+ FSF+LSPSY HAP + LT  P +GA +IL KL
Sbjct  480   SIILQHFSFELSPSYTHAPISILTIQPQHGAHIILHKL  517



>gb|AAZ07706.1| cytochrome P450 monooxygenase [Sesamum indicum]
Length=514

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/514 (55%), Positives = 377/514 (73%), Gaps = 3/514 (1%)
 Frame = +3

Query  132   VFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMM  311
             +  +L L S ++  LV AW+++NW W RP+ LEK LR Q  KGN Y+LF+GD  E+  M 
Sbjct  4     LLSSLALISCAVA-LVYAWKILNWVWFRPRKLEKILRQQGFKGNSYKLFFGDFNELKAMT  62

Query  312   NETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHN  491
              E KSKPM+  S E+VPRV P   ++++ +G+ SF+W G  P VI+ DP+ V+E+LSK  
Sbjct  63    KEAKSKPMS-FSHEIVPRVAPSIIKTVKNYGEQSFLWFGPRPAVIVLDPEMVREILSKSY  121

Query  492   TFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRW  671
              FQ    +P    L++G+  YE DKW+KHR++ NPAF +EKLKHMVPA Y  C++M+ +W
Sbjct  122   VFQMPGGNPTSRMLARGIASYETDKWAKHRRLINPAFHVEKLKHMVPAFYLSCADMLSKW  181

Query  672   EEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVY  851
             E+IV R    ELDVWP L+T+  + IS TAFG SYE GRR+FELQ E AE   E   +V 
Sbjct  182   EKIVPREGLCELDVWPYLQTLTSDAISRTAFGSSYEEGRRIFELQKEQAELIMEALRTVC  241

Query  852   IPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMK  1031
             IPG RFLPTK N+RMN I +E+ + +  II KR+ A+K GE A ++LL +LLESN KE++
Sbjct  242   IPGSRFLPTKNNKRMNKIVREVESSVLGIINKRMKAIKAGETAGDDLLGLLLESNLKEIE  301

Query  1032  HHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGD  1211
              HGN+ FGMS++++I ECKLFY AGQETTS LLVWTMILLS++++WQE AR+EV+ +FG 
Sbjct  302   QHGNK-FGMSLKEVIEECKLFYFAGQETTSTLLVWTMILLSKHKDWQERARDEVLQLFGR  360

Query  1212  DKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLH  1391
             DKPD+  LN LKIV+MI +E LRLYPP   L RI  +++ LG ++LPAGV+LL+P + LH
Sbjct  361   DKPDYQELNHLKIVSMIFHEVLRLYPPGVMLNRISMKESTLGKVTLPAGVQLLMPAVLLH  420

Query  1392  HDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCIL  1571
             HD ++WG+DA EF PERF EGVSKAT G+  Y PF  GPRICIG +FAM+EAK A++ IL
Sbjct  421   HDRKIWGDDAEEFKPERFSEGVSKATQGQLVYFPFGWGPRICIGQSFAMLEAKLAMAMIL  480

Query  1572  RRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + +SF+LSPSY+HAP T +T  P +GA LIL+KL
Sbjct  481   QHYSFELSPSYSHAPATVITLQPQHGAHLILRKL  514



>ref|XP_006477949.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=517

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/518 (55%), Positives = 378/518 (73%), Gaps = 3/518 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVC-AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             ME+      F+  I+ LV  AW V+NW W+RPK LEK+LR Q LKGN YRL +GD KE +
Sbjct  1     MELTLKSIAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESS  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
              M+ + K++P++ L D+   RV P+  +  + +GKNSF+W G  P V IT+PD +KE+ +
Sbjct  61    IMLKKAKARPLS-LDDDAAVRVNPFLPKLFKDYGKNSFMWFGPTPRVNITNPDQIKEIFT  119

Query  483   KHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMV  662
             K N F +  ++P+   L  GL+ YEG++W+KHRKI NPAF+ EKLK M+PA  +  S+++
Sbjct  120   KINDFPKINSNPLARILGVGLVNYEGEQWAKHRKIINPAFRQEKLKLMLPAFCQSSSDII  179

Query  663   GRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRH  842
               WE+++S   S ELDVWP L  +  +VIS TAFG +YE GRR+F+LQ ELAE   ++  
Sbjct  180   TEWEKLMSTEGSCELDVWPYLANLTGDVISRTAFGSNYEEGRRIFQLQSELAELTIQVIR  239

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFK  1022
             SVYIPG RFLPTK+N+RM  +DKEI+T L  II+ R  AMK GE A+++LL +L+++NF+
Sbjct  240   SVYIPGWRFLPTKRNKRMKELDKEISTALMGIIKNREKAMKAGEAANDDLLGILMDTNFR  299

Query  1023  EMKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             E++ HGN +  GMS  D++ ECKLFY AGQETTS LL WTM+LLS++Q+WQE AR+EV+ 
Sbjct  300   EIEEHGNNKNVGMSFNDVMEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             VFG++KPD+DGLN LKIV MI NE LRLYPP   L R V ++ KLGNL L AGV++ +P+
Sbjct  360   VFGNNKPDYDGLNHLKIVQMIFNEVLRLYPPAVMLARAVNKETKLGNLILLAGVQISLPV  419

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             I +HHDPE+WG+DA EF PERF EG+SK    +  Y PF+ GPRICIGLNFA+VEAK AL
Sbjct  420   IMVHHDPELWGDDAIEFKPERFSEGISKVNRNQVSYFPFAWGPRICIGLNFALVEAKIAL  479

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + IL+ FSF+LSPSY HAP   LT +P +G  LIL+KL
Sbjct  480   AMILQNFSFELSPSYVHAPTAVLTLHPEFGTHLILRKL  517



>ref|XP_008452436.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=529

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/500 (57%), Positives = 354/500 (71%), Gaps = 4/500 (1%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
              W++V+W W RPK LEK LR Q   GN YR+ YGD KE A M ++  SKPMN  S+ + P
Sbjct  27    GWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILYGDLKERAAMRDQAISKPMN-FSNHIAP  85

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA--DPVVYKLS  536
             RVIP    +IQ +GKNSF+W+G IP V I DP+ +K V S  N +Q+  A  +P+   L+
Sbjct  86    RVIPSVHHTIQHYGKNSFMWIGPIPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLA  145

Query  537   QGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVW  716
              GLL +EG KW KHRKI NPAF LEKLK MVPA Y  C EM+ +WE +VS   S ELDV 
Sbjct  146   DGLLNHEGHKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVQGSCELDVM  205

Query  717   PELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRM  896
             P L+ +  +VIS TAFG SYE G+++F+LQ ELAE        +YIPG RFLPTK N +M
Sbjct  206   PYLQNMTADVISRTAFGSSYEKGKKIFKLQTELAEMVIRSTLGIYIPGWRFLPTKSNNKM  265

Query  897   NGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIEDI  1073
               I KEI+T++  II +R  +MK GE    +LL +L+ESN  E+K HGN ++ GMSIED+
Sbjct  266   KVISKEISTLIMGIINERETSMKAGEATQTDLLSILMESNLNEIKQHGNNKDIGMSIEDV  325

Query  1074  ISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIV  1253
             I ECKLFY+AGQETT+ LL WTM+LLS   EWQE AR EV  +FG+ KPD+DGL+RLK+V
Sbjct  326   IDECKLFYIAGQETTATLLTWTMVLLSSYSEWQERARAEVFEIFGNKKPDYDGLSRLKVV  385

Query  1254  TMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
             TMILNE LRLYPPV    R +K++ KLG L+LPAGV L +P + +  DPE+WGEDA+EF 
Sbjct  386   TMILNEVLRLYPPVSMFGRFIKKETKLGKLTLPAGVMLGLPTVLIQCDPELWGEDAHEFK  445

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             PERF EGVSKAT     ++PF  GPRICIGLNFAM+EAK  LS IL+RFS +LS SY HA
Sbjct  446   PERFFEGVSKATKNSGAFVPFGWGPRICIGLNFAMIEAKMTLSMILQRFSLELSSSYTHA  505

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P   +TT P +GA +IL KL
Sbjct  506   PIVAITTQPQHGAHIILHKL  525



>ref|XP_010092742.1| Secologanin synthase [Morus notabilis]
 gb|EXB52087.1| Secologanin synthase [Morus notabilis]
Length=518

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/518 (55%), Positives = 373/518 (72%), Gaps = 4/518 (1%)
 Frame = +3

Query  126   MEV-FCNLFLFSFSIMFLVC-AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEI  299
             MEV F  L    F+I+ +   AWRV+NW W+RPK LE  LR Q LKGN YRL+ GD KE 
Sbjct  1     MEVSFLKLSSVVFAILLITTWAWRVLNWVWLRPKRLENCLRKQGLKGNSYRLWSGDLKES  60

Query  300   AKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVL  479
             + M+ E  SKP+N LS+++  R+ P+   ++  +GK+SF+W+G  P V IT+P+++K++ 
Sbjct  61    SLMIKEASSKPIN-LSEDITARIFPFGLHTVNNYGKDSFMWIGPTPRVSITNPEYIKDIF  119

Query  480   SKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             +K   F +  + P+V  L+ G+  YEG+KW++HRKI NPAF +EKLK +VPA Y  CSEM
Sbjct  120   NKLGDFPKPQSIPLVKLLATGVATYEGEKWTRHRKIINPAFHMEKLKRLVPAFYLSCSEM  179

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             + +WE +++   S ELDVW  L+ +  +VIS TAFG SYE GRR+F+LQ E  E A +  
Sbjct  180   LNKWERLLNSEGSCELDVWSYLQNMTGDVISRTAFGSSYEEGRRIFQLQKEQGELAIKSL  239

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              +VYIPG RF+PTK NRRM  I  EI  ++K II KR GAM+ GE  +++LL +L+ESN 
Sbjct  240   QTVYIPGWRFVPTKLNRRMKKIYNEIEALVKNIIHKREGAMRAGEAPNDDLLGILMESNL  299

Query  1020  KEMKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
             KE++ HGN +  G+SI D+I ECKLFY+AGQETTS LLVWTM+LLSR   WQ+ AREEV+
Sbjct  300   KEIQEHGNNKNMGISIRDVIEECKLFYIAGQETTSTLLVWTMVLLSRFPSWQDRAREEVL  359

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              +FG++KP FDGL +LK+VTMI  E LRLYPP+    R V++  +LGNLSLPAGV + +P
Sbjct  360   QIFGNNKPGFDGLTQLKVVTMIFYEVLRLYPPLILFTRKVEKKTQLGNLSLPAGVEVSIP  419

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
              I +H D E+WGEDA +F PERF EG+SK T G+  + PF  GPRIC+G NFAMVEAK A
Sbjct  420   TILVHRDTELWGEDAKDFKPERFAEGMSKVTKGQVSFFPFGWGPRICVGQNFAMVEAKMA  479

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
             L+ IL+RF+F+LSPSYAHAP T LT  P YGA +IL K
Sbjct  480   LALILQRFTFELSPSYAHAPLTILTLQPQYGAHIILHK  517



>ref|XP_010644729.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=514

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/508 (56%), Positives = 372/508 (73%), Gaps = 4/508 (1%)
 Frame = +3

Query  153   FSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             F+F I  L+ AWR++NW W+RPK LE+ LR Q L GN YRL +GD +E+++M NE  S P
Sbjct  10    FAF-ITLLIFAWRLLNWVWLRPKKLERCLRKQGLTGNSYRLLHGDFREMSRMNNEANSGP  68

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             ++  SD++V RV+P+F  SIQK+GKNSF WLG  P+V I +P+ +++VL KHN FQ+   
Sbjct  69    IS-FSDDIVKRVLPFFNHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVLLKHNVFQKPPP  127

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
              P+   L+ G++  EG++W+K RKI NPAF LEKLKHMV A    CS+MV +WE+ +S +
Sbjct  128   HPLGKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKKLSMD  187

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
             +S ELD+WP L+ +  +VIS TAFG SYE GRR+F+LQ E A   +++  SVY+PG RF 
Sbjct  188   DSCELDIWPYLQILTGDVISRTAFGSSYEEGRRIFQLQKEQAHLVAQVTQSVYVPGWRFF  247

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-  1049
             PTK NRRM  I  E+N +LK IIEKR  AMK GE A+++LL +L+ESN++EM+ +  ++ 
Sbjct  248   PTKINRRMRQIRNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYREMQENDERKN  307

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
              GMSI+D+I ECKLFY AGQETTS LL+WTM+LLS++  WQ  AREEV+ VFG+ KPD D
Sbjct  308   VGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSNWQARAREEVLQVFGNKKPDGD  367

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
             GLN LKIVTMI +E LRLYPP   LIR V  D+++G L L  GV + +PI+ +HH+ E+W
Sbjct  368   GLNHLKIVTMIFHEVLRLYPPASMLIRTVFADSQVGGLYLSDGVLIALPILLIHHNHEIW  427

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             GEDA EFNP RF EGVSKA   +  + PF  GPRIC+G NFAM+EAK AL+ IL+RFSF 
Sbjct  428   GEDAKEFNPGRFSEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFD  487

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LSPSYAHAP + L   P +GA LIL  L
Sbjct  488   LSPSYAHAP-SSLLMQPQHGAHLILHGL  514



>gb|KHN36820.1| Secologanin synthase [Glycine soja]
Length=496

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/495 (57%), Positives = 369/495 (75%), Gaps = 2/495 (0%)
 Frame = +3

Query  192   VVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPRVI  371
             ++NW WIRPK LE+ LR Q L+GNPYR+  GD KEI K+  E +SKPMN LS ++VPRV 
Sbjct  1     MLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQMEARSKPMN-LSHDIVPRVF  59

Query  372   PYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGLLK  551
              +  +S+ KHGKNSF+W G  P V +TDP+ +K+VL+K + F++  A+P+   L+ GL+ 
Sbjct  60    AHLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDFRKPEANPLAKLLATGLVN  119

Query  552   YEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPELKT  731
             Y+G+KW+KHR++ NPAF LEKLK M+P  +K C++++ +WE ++S + S E+DVWP L+ 
Sbjct  120   YDGEKWNKHRRLINPAFSLEKLKIMLPIFFKSCNDLIIKWEGMLSSDGSCEMDVWPFLQN  179

Query  732   IAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNGIDK  911
             +A +VI+ TAFG S+E G+R+F+LQ ELAE   ++   VYIPG RF+PT  NRRM  ID+
Sbjct  180   LASDVIARTAFGSSFEEGKRIFQLQKELAELTMKVIMKVYIPGWRFVPTATNRRMKEIDR  239

Query  912   EINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMK-HHGNQEFGMSIEDIISECK  1088
              I   L  +I+KR  A K GE   ++LL +LLESN KE++ H  N+  GM++ D+I ECK
Sbjct  240   YIKASLMDMIKKREKAPKTGEATRDDLLGILLESNHKEIQEHRNNKNVGMNLNDVIEECK  299

Query  1089  LFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMILN  1268
             LFY AGQETTS LLVWTM+LLSR  +WQ  AREEV+ VFG   P+FDGL+ LKIVTMIL 
Sbjct  300   LFYFAGQETTSVLLVWTMVLLSRYPDWQSRAREEVLQVFGKQAPNFDGLSHLKIVTMILY  359

Query  1269  ESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPERFR  1448
             E LRLYPP   L R V  D KLGNL+LPAGV++ +PII +HHD E+WG+DA EFNPERF 
Sbjct  360   EVLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQVSLPIIMVHHDRELWGDDAKEFNPERFS  419

Query  1449  EGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYTGL  1628
             EGVSKATNG+  + PF  GPRICIG NF+++EAK ALS IL+ FSF+LSP+Y HAP+T +
Sbjct  420   EGVSKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYTHAPFTVI  479

Query  1629  TTNPLYGAPLILQKL  1673
             T  P YGA +IL+K+
Sbjct  480   TLQPQYGAHVILRKV  494



>ref|XP_004166891.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=523

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/498 (56%), Positives = 355/498 (71%), Gaps = 2/498 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
              W++ +W W RPK LEK LR Q   GN YR+ +GD KE A M  E  SKPMN  S+ + P
Sbjct  27    GWKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKESAAMREEAMSKPMN-FSNHIAP  85

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RVIP   ++IQ +GKNSF+W+GT+P V I DP+ +K V S  N FQ+   +P++   + G
Sbjct  86    RVIPSVHQTIQHYGKNSFMWIGTVPRVHIMDPEQLKTVFSFINDFQRPTMNPLLKLFTNG  145

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  +EG KW KHRKI +PAF L+KLK M+P  Y  C+EMV +WE +VS   S ELDV P 
Sbjct  146   LFSHEGQKWVKHRKIISPAFHLKKLKDMIPEFYHSCNEMVSKWESMVSEEGSCELDVMPY  205

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +A +VIS TAFG SYE G+++FELQ +L   A +    +YIPG RFLPTK N +M  
Sbjct  206   LQNMASDVISRTAFGSSYEKGKKIFELQSKLGAFAIQSSLGIYIPGWRFLPTKSNNKMKE  265

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-FGMSIEDIIS  1079
             I KEI+T++  ++ ++  +MK GE    +LL +L+ESN  E+K HGN +  G+SI+D+I 
Sbjct  266   ISKEISTLILGVMNEKEKSMKAGEAIQTDLLSILIESNLNEIKEHGNNKGMGLSIQDVID  325

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY+ GQETT+ LL+WTM++LS   EWQE AR+EV  +FG+ KPD+DGL+RLK+VTM
Sbjct  326   ECKLFYITGQETTATLLIWTMVMLSSYSEWQERARKEVFEIFGNKKPDYDGLSRLKVVTM  385

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             I NE LRLYPPV    R V ++ KLGNL+LPAGV L +PII +  D E+WG+DA+EFNP 
Sbjct  386   IFNEVLRLYPPVSMYARTVNKETKLGNLTLPAGVMLSLPIILIQTDRELWGQDAHEFNPN  445

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EGVSKAT     Y+PF  GPRICIGLNFAM+EAK ALS IL+RFSF+LSPSY H P 
Sbjct  446   RFSEGVSKATKNPCAYVPFGWGPRICIGLNFAMIEAKMALSMILQRFSFQLSPSYTHTPI  505

Query  1620  TGLTTNPLYGAPLILQKL  1673
              GLTT P +GA +IL KL
Sbjct  506   AGLTTQPQHGAHIILHKL  523



>ref|XP_009339350.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=519

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/500 (56%), Positives = 363/500 (73%), Gaps = 2/500 (0%)
 Frame = +3

Query  177   VCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEV  356
              CAWRV+NW W+RPK LEK LR Q L GN YRL+ GD +E + M+ E  SKPMN LS + 
Sbjct  21    ACAWRVLNWVWLRPKDLEKCLRQQGLAGNSYRLWSGDLRESSIMLKEAMSKPMN-LSHDT  79

Query  357   VPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLS  536
              PRV+P+  +S+  +GKNSF+W+G  P V IT+P+ +K++ +KH  F +   +P+V  L+
Sbjct  80    APRVLPFVHQSVSTYGKNSFMWIGPTPRVNITNPEDLKDIFTKHEDFPKPALNPLVKLLA  139

Query  537   QGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVW  716
              GL  YEGDKW+KHR+I NPAF  EKLK M+P+ Y+ CSEM+  WE +VS++ S ELDVW
Sbjct  140   TGLANYEGDKWAKHRRIVNPAFHSEKLKRMLPSFYQSCSEMIEEWESLVSKDSSCELDVW  199

Query  717   PELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRM  896
             P L+ +  +VIS T+FG SY+ GR +F+L     E A +   SVYIPG RFLPTK N+ M
Sbjct  200   PYLQNVTADVISRTSFGSSYKEGREIFQLLKVQTELAIKTIQSVYIPGWRFLPTKMNKSM  259

Query  897   NGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQ-EFGMSIEDI  1073
              G+DK+I  +L  II KR  A+K G+   ++LL +LL+SNFKE+K HGN+ + GMS +D+
Sbjct  260   KGVDKKIRELLMGIINKREEAIKAGKATKDDLLGLLLDSNFKEIKEHGNKRKVGMSTQDV  319

Query  1074  ISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIV  1253
             + ECKLFY AGQETTS LLVWTM+LLS NQ WQ+ AREEV+ VFG +KPDFDGLN LK+V
Sbjct  320   LEECKLFYFAGQETTSVLLVWTMVLLSENQNWQDRAREEVLQVFGGNKPDFDGLNHLKVV  379

Query  1254  TMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
             TMIL E+LRLYPPV  L R++ +  +    SLPAGV + +P + +HHD E+W +DA +F 
Sbjct  380   TMILLEALRLYPPVVMLTRMIHKKTQFVEFSLPAGVEISLPTVLVHHDKELWCDDATQFK  439

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             PERF +GVSKAT  K  Y PF GG RICIG NFAM+EAK AL+ IL+ F+F+LSPSYAHA
Sbjct  440   PERFSDGVSKATKNKLIYFPFGGGARICIGQNFAMMEAKLALALILQHFTFELSPSYAHA  499

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P   LT  P +GA +IL KL
Sbjct  500   PSRKLTLQPQFGAHIILHKL  519



>ref|XP_004294187.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/508 (55%), Positives = 363/508 (71%), Gaps = 4/508 (1%)
 Frame = +3

Query  159   FSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMN  338
             F  + +  AW V++W W++PK LE+ LR Q  KGN YR+ YGDTKE   M+ + KSKPMN
Sbjct  15    FVSIVVRLAWSVLDWVWLKPKKLERCLRKQGFKGNSYRILYGDTKENVIMLKKAKSKPMN  74

Query  339   V-LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLAD  515
             +  S ++ PRV P   ++++ +GKNS VW+G IP V I +P+ +K+V ++ + FQ+  ++
Sbjct  75    LSTSHDIAPRVTPLLHQTVKTYGKNSLVWMGPIPQVNIMNPEDLKDVFTELSDFQKPHSN  134

Query  516   PVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNE  695
             P+V  L+ GL+ +EG+KW+KHR+I NP F  EKLK M+PA Y+ C EM+  WE +VS+  
Sbjct  135   PLVKFLATGLVIHEGEKWAKHRRIINPTFHFEKLKRMLPAFYQSCDEMIKEWETVVSKES  194

Query  696   SG-ELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
             S  E+DVWP L+ +  +VIS TAFG SY+ GR++FEL  E A +A +   SVYIPG RF+
Sbjct  195   SSHEIDVWPSLQNVTADVISRTAFGSSYQEGRKIFELLKEQAVYAMKSIQSVYIPGWRFV  254

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG--NQ  1046
             PTK N+RM  IDKEI  VL  II KR  A++ GE   ++LL  L+ESN KE++ HG  N+
Sbjct  255   PTKMNKRMKQIDKEIRNVLMGIISKREQAIEVGEAIKDDLLGALMESNLKEIRDHGKNNK  314

Query  1047  EFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDF  1226
             + GMSIED+I ECKLFY AGQETTS LLVWTM+LL +NQ WQ LAREEV+ VFG +KP+F
Sbjct  315   DVGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLCQNQNWQHLAREEVLQVFGMNKPEF  374

Query  1227  DGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEM  1406
             DGL  LK+VTMIL E LRLYP V  L R   +  +LG  SLPAGV + +P + +HHD E+
Sbjct  375   DGLTHLKVVTMILLEVLRLYPAVVVLSRTTHKKTQLGKFSLPAGVEVELPTLLIHHDKEL  434

Query  1407  WGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSF  1586
             WG+DA EF PERF EGVSKAT G   + PF  GPRICIG NFAM+EAK AL+ IL+ F+F
Sbjct  435   WGDDAKEFRPERFSEGVSKATKGHLSFFPFGAGPRICIGQNFAMMEAKLALALILQHFTF  494

Query  1587  KLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
             +LSPSY HAP   +T  P +GAP+IL K
Sbjct  495   ELSPSYTHAPSNLVTLQPQFGAPIILHK  522



>ref|XP_007149353.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
 gb|ESW21347.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
Length=520

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/500 (56%), Positives = 364/500 (73%), Gaps = 4/500 (1%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AW+++NW W  PK LEK LR Q  +GNPY+L  GD+KE  KM  E  SKPM+ LSD++VP
Sbjct  20    AWKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMD-LSDDIVP  78

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RV  Y   S++ HGKNSF+WLG  P V I DP+ +K++ +K   F +   +P+   L+ G
Sbjct  79    RVSSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLFKLLATG  138

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  YEG+KWSKHR++ NPAF LEKLK M+P  ++ C+++V +WE ++S + S E+D WP 
Sbjct  139   LAGYEGEKWSKHRRLINPAFNLEKLKAMLPLFFESCNDLVNKWERMLSSDGSCEIDAWPF  198

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +  +VI+ +AFG S+E GRR+F+LQ E  + A ++   V IPG RFLPTK +RRM  
Sbjct  199   LQNMTSDVIARSAFGSSFEEGRRIFQLQREQTKLALQVILKVQIPGWRFLPTKSHRRMKE  258

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG---NQEFGMSIEDI  1073
             ID++I   LK +I KR  A+K+GE  +++LL +LLESN KE++ H    N+  GMS+ED+
Sbjct  259   IDRDIKASLKDMIYKREKALKKGEAINDDLLGILLESNHKEIQEHAKGDNKNVGMSLEDV  318

Query  1074  ISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIV  1253
             I ECKLFY AGQETTS LLVWTM+LLSR  +WQE AREEV+ VFG+ KP FDGLNRLKIV
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQERAREEVLQVFGNQKPSFDGLNRLKIV  378

Query  1254  TMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
             TMILNE LRLYPP   + R+ K D KLGN++LPAGV++ +P + +HHD E WGEDA +FN
Sbjct  379   TMILNEVLRLYPPALGMNRLAKRDLKLGNITLPAGVQIFLPTVLVHHDCEFWGEDAKQFN  438

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             PERF EGV KAT G+  + PF  GPRICIG NF+++EAK ALS IL+ FSF+LSP+YAHA
Sbjct  439   PERFSEGVLKATKGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYAHA  498

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P   +T  P YGA +IL K+
Sbjct  499   PAMLITLQPQYGAHIILHKV  518



>emb|CDP19601.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/516 (54%), Positives = 373/516 (72%), Gaps = 2/516 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             M+ F +L   S  I+ L+ AWR +NWAWI PK +EK LR Q L+GN YR  +GDT+++ +
Sbjct  1     MDFFYSLIGVSSVIVLLIGAWRFLNWAWITPKKMEKRLRRQGLQGNSYRFLFGDTRDMGR  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M+ E KSKP++ L+D++ PR++P   E++Q  GKNSF WLG  P ++I DP+ VKEV +K
Sbjct  61    MLEEAKSKPIS-LTDDIFPRIMPLINETMQHKGKNSFFWLGPRPAMVILDPEQVKEVFTK  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
             + T+Q+  A+P+   L+ GL   + +KW+KHR++ NPAF +EKLK+MVPA Y  C+EM+ 
Sbjct  120   NFTYQKPRANPISKLLALGLASLDTEKWAKHRRLLNPAFHVEKLKYMVPAFYLSCNEMLS  179

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE +     S ELDVWP L+    +VIS TAFG +YE GRR+FELQ E A +  ++  S
Sbjct  180   KWENLAPAEGSFELDVWPYLQIFTSDVISRTAFGSNYEKGRRIFELQSEQALYFEQVMQS  239

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
             +Y+PG  F+PTK+N+RM  I KE+N+++  II +R+  ++ GE  S++LL +LLESN  E
Sbjct  240   IYLPGWSFVPTKRNKRMQKIFKEVNSLVMGIINERLKEIQTGEATSDDLLGILLESNLNE  299

Query  1026  MKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVF  1205
             ++ HGN+  G+S+E++I ECKLFYLAGQETTS LLVWT+ILLS++ +WQ  AR+EV+ VF
Sbjct  300   IRQHGNKN-GLSLEEVIEECKLFYLAGQETTSGLLVWTLILLSQHFDWQARARDEVLQVF  358

Query  1206  GDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIF  1385
              +++PD   LN LKIVTMILNE LRLYPP     R+  E+ KLG+LSLP G+ + V  I 
Sbjct  359   DNNEPDISKLNHLKIVTMILNEVLRLYPPAANFFRMNPEETKLGDLSLPEGMFIFVAPIL  418

Query  1386  LHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSC  1565
             L  D ++WG+DA EF PERF EGVSKAT G   + PF  GPR CIG NFAM+EAK AL+ 
Sbjct  419   LQQDKDLWGDDAKEFKPERFSEGVSKATKGNLSFFPFGWGPRTCIGQNFAMLEAKMALAL  478

Query  1566  ILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             ILRRFS++LSPSYAHAP   LT  P YGA LIL+KL
Sbjct  479   ILRRFSWELSPSYAHAPQVVLTLQPQYGAQLILKKL  514



>ref|XP_007149352.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
 gb|ESW21346.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
Length=520

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/500 (55%), Positives = 365/500 (73%), Gaps = 4/500 (1%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AW+++NW W  PK LEK LR Q  +GNPY+L  GD+KE  KM  E  SKPM+ LSD++VP
Sbjct  20    AWKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMD-LSDDIVP  78

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RV  Y   S++ HGKNSF+WLG  P V I DP+ +K++ +K   F +   +P++  L+ G
Sbjct  79    RVSSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLLKLLATG  138

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  YEG+KWSKHR++ NPAF LEKLK M+P  ++ C+++V +WE ++S + S E+D WP 
Sbjct  139   LADYEGEKWSKHRRLINPAFNLEKLKAMLPLFFESCNDLVNKWERMLSSDGSCEIDAWPF  198

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +  +VI+ +AFG S+E GRR+F+LQ E A+ A ++   + IPG RFLPTK +RRM  
Sbjct  199   LQNMTSDVIARSAFGSSFEEGRRIFQLQREQAKLALQVILKIQIPGWRFLPTKSHRRMKE  258

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG---NQEFGMSIEDI  1073
             ID++I   LK +I KR  A+K+GE  +++LL +LLESN KE++ H    N+  GMS+ED+
Sbjct  259   IDRDIKASLKDMIYKREKALKKGEAINDDLLGILLESNHKEIQEHAKGDNKNVGMSLEDV  318

Query  1074  ISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIV  1253
             I ECKLFY AGQETTS LLVWTM+LLSR  +WQE AREEV+ VFG+ KP FDGLNRLKIV
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQERAREEVLQVFGNQKPSFDGLNRLKIV  378

Query  1254  TMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
             TMILNE LRLYPP   + R+ K D KLGN+ LPAGV++ +P + +HH+ E WGEDA +FN
Sbjct  379   TMILNEVLRLYPPALGMNRLAKRDLKLGNIILPAGVQIFLPTVLVHHNCEFWGEDAKQFN  438

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             PERF EGV KAT G+  + PF  GPRICIG NF+++EAK ALS IL+ FSF+LSP+YAHA
Sbjct  439   PERFSEGVLKATKGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYAHA  498

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P   +T  P YGA +IL K+
Sbjct  499   PAMLITLQPQYGAHIILHKV  518



>gb|EYU31636.1| hypothetical protein MIMGU_mgv1a004595mg [Erythranthe guttata]
Length=519

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/522 (55%), Positives = 383/522 (73%), Gaps = 9/522 (2%)
 Frame = +3

Query  126   MEVFCNLF-----LFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDT  290
             MEV   L+       +F ++F    WR++NWA+IRPK LEK LR Q L GN Y   YGD 
Sbjct  1     MEVILILYKIIGACLAFVVLFYT--WRILNWAYIRPKRLEKSLRKQGLIGNTYNFLYGDL  58

Query  291   KEIAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVK  470
             KE+  M+N  KS P+N L D++ PRV+ +  ++  K+GK SF+WLG  P V+IT+P+ +K
Sbjct  59    KEMLNMINHAKSHPIN-LDDDIKPRVLAFIHKTFLKYGKGSFIWLGPRPAVMITEPELIK  117

Query  471   EVLSKHNTFQQ-NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKI  647
             EV++K N +Q+   ++P+   L+QG++ YEGDKW+KHRKI NPAF  EKLK M+PA Y  
Sbjct  118   EVMTKINLYQKPKNSNPLTKLLAQGVVAYEGDKWAKHRKIINPAFHFEKLKLMIPAFYLS  177

Query  648   CSEMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHA  827
             C E++ +WE+ +S   SGE+DVWP L+ ++ + IS TAFG SY+ GR++FELQ E AE+ 
Sbjct  178   CDEVLNKWEKSLSGKGSGEVDVWPYLQNLSSDAISRTAFGSSYKEGRKVFELQREQAEYI  237

Query  828   SELRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLL  1007
              +   ++YIPG RF+PTK N RM  I+KE+ + ++ +I KR+ AMK GE ++ +LL +LL
Sbjct  238   IKASQTIYIPGWRFMPTKGNNRMKEIEKEVQSSIRGMINKRVKAMKAGEASNEDLLGLLL  297

Query  1008  ESNFKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELARE  1187
             ESN+KE++ +GN+ FGM+I++++ ECKLFY AGQETTS LLVW ++LLS+  EWQ  ARE
Sbjct  298   ESNYKEIEQYGNKSFGMTIDEVVEECKLFYFAGQETTSVLLVWALVLLSQYPEWQTKARE  357

Query  1188  EVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRL  1367
             EV+  FG+  P+FDGLN LKIV MIL E LRLYPPV  L RIV E+ KLG L+LPAGV++
Sbjct  358   EVLQSFGNQIPEFDGLNHLKIVNMILYEVLRLYPPVVALGRIVSEETKLGKLTLPAGVQV  417

Query  1368  LVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEA  1547
              +PIIFLHH+ E+WG+DA EF PERF EGVSKA  G+  + PF  GPRIC+G  FAM+EA
Sbjct  418   SLPIIFLHHNREIWGDDAMEFKPERFSEGVSKAQKGQGIFFPFGWGPRICVGQTFAMLEA  477

Query  1548  KTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             K ALS IL+RFSF+LSPSYAHAP+T +T  P +GA L+L KL
Sbjct  478   KVALSMILQRFSFELSPSYAHAPHTVITLQPQHGAHLLLHKL  519



>ref|XP_004146075.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=551

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/490 (56%), Positives = 350/490 (71%), Gaps = 2/490 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
              W++ +W W RPK LEK LR Q   GN YR+ +GD KE A M  E  SKPMN  S+ + P
Sbjct  36    GWKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKESAAMREEAMSKPMN-FSNHIAP  94

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RVIP   ++IQ +GKNSF+W+GT+P V I DP+ +K V S  N FQ+   +P++   + G
Sbjct  95    RVIPSVHQTIQHYGKNSFMWIGTVPRVHIMDPEQLKTVFSFINDFQRPTMNPLLKLFTNG  154

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  +EG KW KHRKI +PAF L+KLK M+P  Y  C+EMV +WE +VSR  S ELDV P 
Sbjct  155   LFSHEGQKWVKHRKIISPAFHLKKLKDMIPEFYHSCNEMVSKWESMVSREGSCELDVMPY  214

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             LK +A +VIS TAFG SYE G+++FELQ +L   A +    +YIPG RFLPTK N +M  
Sbjct  215   LKNMASDVISRTAFGSSYEKGKKIFELQSKLGAFAIQSSLGIYIPGWRFLPTKSNNKMKE  274

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-FGMSIEDIIS  1079
             I KEI+T++  ++ ++  +MK GE    +LL +L+ESN  E+K HGN +  G+SI+D+I 
Sbjct  275   ISKEISTLILGVMNEKEKSMKAGEAIQTDLLSILIESNLNEIKEHGNNKGMGLSIQDVID  334

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY+ GQETT+ LL+WTM+LLS   EWQE AR+EV  +FG+ KPD+DGL+RLK+VTM
Sbjct  335   ECKLFYITGQETTATLLIWTMVLLSSYSEWQERARKEVFEIFGNKKPDYDGLSRLKVVTM  394

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             I NE LRLYPPV    R V ++ KLGNL+LPAGV L +PII +  D E+WG+DA+EFNP 
Sbjct  395   IFNEVLRLYPPVSMYARTVNKETKLGNLTLPAGVMLSLPIILIQTDRELWGQDAHEFNPN  454

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EGVSKAT     Y+PF  GPRICIGLNFAM+EAK ALS IL+RFSF+LSPSY H P 
Sbjct  455   RFSEGVSKATKNPCAYVPFGWGPRICIGLNFAMIEAKMALSMILQRFSFQLSPSYTHTPI  514

Query  1620  TGLTTNPLYG  1649
              GLTT P +G
Sbjct  515   AGLTTQPQHG  524



>emb|CDP15981.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/510 (55%), Positives = 366/510 (72%), Gaps = 5/510 (1%)
 Frame = +3

Query  144   LFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETK  323
             + L S  ++  V AW+V++W W +P+ LEK L+ Q  KGNPY+LFYGD KEI  +  E  
Sbjct  9     IVLVSSCLVLSVLAWKVLSWVWFKPRKLEKHLKQQGFKGNPYKLFYGDFKEIGTLFQEAY  68

Query  324   SKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQ  503
             SKP++ LSD++VPRVIP+F  ++ K+GKN+++W G  P ++I DP+  ++V  K   FQ+
Sbjct  69    SKPIS-LSDDIVPRVIPHFLGTVNKYGKNAYLWFGPKPTMLIMDPELTRKVTQKMEIFQK  127

Query  504   NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIV  683
                 P+   L+QG L YEGDKW+KHRK+ N AF +EKLK MVPA Y   SEM+ +WEE +
Sbjct  128   PQFHPLSKLLAQGTLVYEGDKWAKHRKLLNQAFHMEKLKLMVPAFYTSASEMLSKWEEGI  187

Query  684   SRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGG  863
             S   S ELDVWP L+T+  + IS TAFG  YE GRR+FELQ E A+H  +   S+YIPG 
Sbjct  188   SAKGSIELDVWPHLQTMTGDAISRTAFGSKYEKGRRIFELQTEQAQHLVKAVQSMYIPGL  247

Query  864   RFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN  1043
             RFLPTK+NRRM  I  E+N  +  II  R+ A++ GE + +++L +LLES+ +E     +
Sbjct  248   RFLPTKRNRRMKQIATEVNDSIGEIIRTRLNALRTGEASDDDMLSLLLESSSQET----D  303

Query  1044  QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPD  1223
             +EFGM+ ++I+ ECKLFY AGQETT+ LLVWTMILLS   +WQE AREEV+  FG + PD
Sbjct  304   KEFGMTTKEIVEECKLFYFAGQETTAVLLVWTMILLSMYPDWQEHAREEVLQHFGTNIPD  363

Query  1224  FDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPE  1403
             FDGLNRL+IVTMIL+E LRLYPP P L + V E+ KLGNL+ P+G  L VP I LHHDPE
Sbjct  364   FDGLNRLRIVTMILHEVLRLYPPFPILGQTVAEETKLGNLTFPSGQLLTVPTILLHHDPE  423

Query  1404  MWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFS  1583
             +WGED  EF PERF +GVS AT G+  + PF  GPRICIG NFAM+EAK  L+  L+RFS
Sbjct  424   IWGEDVKEFKPERFADGVSHATKGQVVFFPFGWGPRICIGQNFAMLEAKLVLAMALQRFS  483

Query  1584  FKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             F+LSPSY+HAPY+ +T  P +GA LIL K+
Sbjct  484   FELSPSYSHAPYSAVTLQPQFGAHLILHKM  513



>ref|XP_010644780.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Vitis vinifera]
Length=518

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/513 (55%), Positives = 373/513 (73%), Gaps = 3/513 (1%)
 Frame = +3

Query  141   NLFLFSFS-IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNE  317
             NL   SF+ I  L+ AWRV+NW W+RPK LE+ L+ Q L GN YRL YGD KE++ M+ E
Sbjct  7     NLVALSFAFITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIKE  66

Query  318   TKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTF  497
               S+P+++ SD++V RV P+ + SI+K+GK+SF+W+G  P V I +P+ +++VLS H  F
Sbjct  67    ATSRPISI-SDDIVQRVAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVF  125

Query  498   QQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEE  677
             ++     +V  L  GLL  +G+KW+KHRKI NPAF+LEKLK+M+PA +  CS+M+ +WE 
Sbjct  126   RKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWEG  185

Query  678   IVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIP  857
              +S   S ELDVWP L+ +  + IS TAFG +YE GR +FELQ E A+   +   S +IP
Sbjct  186   KLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIP  245

Query  858   GGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHH  1037
             G RFLPTK N+RM  I KE+N +L  II+KR  AMK GE  +++LL +LLESNFKE++ H
Sbjct  246   GWRFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQEH  305

Query  1038  GN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDD  1214
              N +  GMSI+D+I ECKLFY AGQETTS LL+WTM+LLS++  WQ  AREEV+HVFG++
Sbjct  306   ENDKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVFGNN  365

Query  1215  KPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHH  1394
             KP+ DGLN LKIV MIL+E LRLYPPVP L R V ED ++G++ LPAGV + +P I +HH
Sbjct  366   KPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHH  425

Query  1395  DPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILR  1574
             D E+WGEDA EFNPERF +GV KAT     + PF  G R+CIG NFA++EAK  L+ IL+
Sbjct  426   DHEIWGEDAREFNPERFSQGVLKATKSPVSFFPFGWGSRLCIGQNFAILEAKMVLAMILQ  485

Query  1575  RFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             RFSF LSPSY+HAP + +T  P YGA LIL  +
Sbjct  486   RFSFSLSPSYSHAPCSLVTLKPQYGAHLILHGI  518



>ref|XP_008226214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=518

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/503 (55%), Positives = 366/503 (73%), Gaps = 2/503 (0%)
 Frame = +3

Query  168   MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV-L  344
             M +  AWRV+NW W+RPK LE+ LR Q L GN Y+L +GDTKE + M+++ +SKP+ +  
Sbjct  15    MVIAWAWRVLNWVWLRPKKLERSLREQGLTGNSYKLLFGDTKESSMMLDQAQSKPIKLST  74

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             S ++ PRV+P+  +++  +GKNSFVW+G IP V I +P+ +KE+ +K   F++  A+P++
Sbjct  75    SHDIAPRVMPFVHQTVNTYGKNSFVWMGPIPKVNIMNPEDLKEIFNKDQNFRRPSANPMI  134

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L+QGLL +E  KW+KHRKI +PAF LEKLK M+P  Y+ CSEM+  WE +VS+  S E
Sbjct  135   DLLAQGLLAFEDGKWAKHRKIIHPAFHLEKLKGMLPTFYQSCSEMINEWERLVSKEGSCE  194

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             LDVWP L+T++ ++IS  AFG SY+ GR++F+L  E  +  +    SVYIPG RFLPTK+
Sbjct  195   LDVWPCLQTLSADMISRAAFGSSYQEGRKIFQLLREQEKFYATAIQSVYIPGSRFLPTKQ  254

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMS  1061
             N+RM  I +EI+ +LK II KR  AMK GE + ++LL +L+ESN KE++ HGN +  GMS
Sbjct  255   NKRMKKIYEEISVLLKGIINKREEAMKLGEASKHDLLGILMESNLKEIREHGNHRNTGMS  314

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             +ED+I ECKLFYLAGQETTS LLVW M+LLS+NQ WQ  AREEV  VF  + P +D L+ 
Sbjct  315   LEDVIEECKLFYLAGQETTSVLLVWAMVLLSQNQNWQARAREEVSQVFESNPPTYDTLSH  374

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LK+VTM+L E LRLYP    L+R  ++  +LG  SLPAGV + + I+  HHD E+WGEDA
Sbjct  375   LKVVTMVLLEVLRLYPAAVELLRTSRKKTQLGKFSLPAGVEVSIHIMLAHHDKELWGEDA  434

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
             +EF PERF EGV+KAT  +  Y PF  GPRICIG NFAM+EAK ALS IL+ F+F+LSPS
Sbjct  435   DEFKPERFSEGVAKATKNQFAYFPFGAGPRICIGQNFAMLEAKLALSLILQHFTFELSPS  494

Query  1602  YAHAPYTGLTTNPLYGAPLILQK  1670
             YAHAP T +T  P YGA +IL K
Sbjct  495   YAHAPLTLITLQPQYGAHIILSK  517



>ref|XP_006364091.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=510

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/509 (55%), Positives = 382/509 (75%), Gaps = 10/509 (2%)
 Frame = +3

Query  156   SFSIMFLV-CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             +F+I+ ++   WR++NW W++P+ LEK LR    +GN YRL  GD  E+ KM  E KSKP
Sbjct  9     AFAIILVIFLRWRLLNWLWLQPRPLEKCLRELGFRGNSYRLLVGDMNEVVKMDEEAKSKP  68

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             +   S ++VPR++P+  ++I  +GKNSF+WLG  P ++I +P+H++E+LSK N FQ+   
Sbjct  69    IK-FSHDIVPRLMPFIHKTIIDYGKNSFIWLGPNPAMLIMEPEHIREILSKSNIFQK--P  125

Query  513   DPVVYKL-SQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSR  689
              P + KL ++G+L YE DKW+KHR+I NPAF L+KLKHMVP+ +    EM+ +WE+IVS 
Sbjct  126   PPALTKLLAEGILSYEADKWAKHRRIINPAFHLDKLKHMVPSFHLTTCEMLSKWEKIVS-  184

Query  690   NESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRF  869
              E  E+DVWP L+T+  + IS TAFG SYE GR++ ELQ ELA+   +   + YI   RF
Sbjct  185   TEGSEVDVWPYLQTLTSDAISRTAFGSSYEEGRKIHELQQELAKIIVKETEASYI---RF  241

Query  870   LPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEA-SNNLLDMLLESNFKEMKHHGNQ  1046
             LPTK+ RRMN + +E+ +++ RII KR+  ++ GE + S++LL +LLESN KE++ HGN+
Sbjct  242   LPTKEKRRMNRLHQEVRSLVLRIINKRMNEIEAGETSNSDDLLGILLESNLKEIQEHGNK  301

Query  1047  EFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDF  1226
             +FGMSI+++I ECKLFYLAGQETTS LLVW+MILLS++ +WQ  AREEV+ VFG++ PD+
Sbjct  302   KFGMSIDEVIEECKLFYLAGQETTSALLVWSMILLSKHSDWQARAREEVLQVFGNNIPDY  361

Query  1227  DGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEM  1406
             D L++LK+VTMI+ E LRLYPP+  + R V ++ KLGNLS+P+GV+LL+P I LHHD E+
Sbjct  362   DKLSQLKVVTMIMQEVLRLYPPIFLMGREVHKETKLGNLSIPSGVQLLLPTILLHHDQEI  421

Query  1407  WGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSF  1586
             WGED  EFNPERF EGV++AT GK  Y PFS GPR CIG NFAM+EAK AL+ IL++F+F
Sbjct  422   WGEDVKEFNPERFSEGVNRATKGKFAYFPFSWGPRNCIGQNFAMLEAKMALAMILQQFAF  481

Query  1587  KLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             ++SPSYAH PY+  T  P YGA LIL KL
Sbjct  482   EVSPSYAHVPYSVFTLLPQYGAQLILNKL  510



>ref|XP_008452437.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=522

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/498 (55%), Positives = 355/498 (71%), Gaps = 2/498 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
              W++V+W W RPK LE+ LR Q   GN YR+ +GD KE A M  E  SKPM   S+ + P
Sbjct  26    GWKLVDWIWFRPKRLERVLRRQGFAGNSYRILHGDLKESAAMREEAMSKPMK-FSNHIAP  84

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RVIP  + +IQ +GKNSF+W+GT+P V I DP+ +K V S  N FQ+    P++   + G
Sbjct  85    RVIPSVYHTIQLYGKNSFMWIGTMPRVHIMDPEQLKTVFSLINDFQRPTMSPLLKLFANG  144

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  YEG KW KHRKI +PAF L+KLK M+P  Y   +EMVG+WE ++SR  S ELDV P 
Sbjct  145   LFSYEGQKWVKHRKIISPAFHLKKLKDMIPEFYHSSNEMVGKWESMISREGSCELDVMPY  204

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +A +VIS TAFG SYE G+++FELQ EL     +    +YIPG RFLPTK NR+M  
Sbjct  205   LQNMASDVISRTAFGSSYEKGKKIFELQSELGALVIQSSLGIYIPGWRFLPTKSNRKMKE  264

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMK-HHGNQEFGMSIEDIIS  1079
             + K+I+T++  ++ ++  +MK GE    +LL +L+ESN  E+K H  N+  G+SI+DII 
Sbjct  265   LSKKISTLILGVMNEKEKSMKAGEAIQTDLLSILIESNLDEIKDHRNNKGMGLSIQDIID  324

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY+ GQETT+ LL+WTM+LLS   +WQE AR EV  +FG+ KPD+DGL+RLK+VTM
Sbjct  325   ECKLFYITGQETTATLLIWTMVLLSSYSKWQERARAEVFEIFGNKKPDYDGLSRLKVVTM  384

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             I NE LRLYPPV    R V ++ KLG L+LPAGV L +PII +  DPE+WG+DA EFNP+
Sbjct  385   IFNEVLRLYPPVSMYARTVNKETKLGKLTLPAGVMLSLPIILIQTDPELWGQDAYEFNPD  444

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EGVSKAT     ++PF  GPRICIGLNFAM+EAK ALS IL+RFSF+LSPSY H P+
Sbjct  445   RFSEGVSKATKNPFAFVPFGWGPRICIGLNFAMIEAKMALSMILQRFSFELSPSYTHTPH  504

Query  1620  TGLTTNPLYGAPLILQKL  1673
             TGLTT P +GA +IL KL
Sbjct  505   TGLTTQPQHGAHIILHKL  522



>ref|XP_004169020.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=530

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/500 (56%), Positives = 353/500 (71%), Gaps = 4/500 (1%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
              W++V+W W RPK LEK LR Q   GN YR+ +GD KE A M ++  SKPMN  S+ + P
Sbjct  28    GWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDLKERAAMRDQAISKPMN-FSNYIAP  86

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA--DPVVYKLS  536
             RVIP    +IQ +GKNSF+W+G +P V I DP+ +K V S  N +Q+  A  +P+   L+
Sbjct  87    RVIPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLA  146

Query  537   QGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVW  716
              GLL +EG KW KHRKI NPAF LEKLK MVPA Y  C EM+ +WE +VS     ELDV 
Sbjct  147   DGLLNHEGQKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVEGFCELDVM  206

Query  717   PELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRM  896
             P L+ +  +VIS TAFG SYE G+R F+LQ EL E   +    +YIPG RFLPTK N +M
Sbjct  207   PYLQNMTADVISRTAFGSSYEKGKRXFKLQTELGEMVMQSTLGIYIPGWRFLPTKSNNKM  266

Query  897   NGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIEDI  1073
               I KEI+T++  II +R  +MK GE    +LL +L+ESN  E+K HGN ++ GMSIED+
Sbjct  267   KVISKEISTLIMDIINERETSMKSGEAIQTDLLSILMESNLNEIKQHGNNKDIGMSIEDV  326

Query  1074  ISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIV  1253
             I ECKLFY+AGQETT+ LL WTM+LLS   EWQE AR EV  +FG+ KPD+DGL+RLK+V
Sbjct  327   IDECKLFYIAGQETTATLLTWTMVLLSSYSEWQERARAEVFEIFGNKKPDYDGLSRLKVV  386

Query  1254  TMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
             TMILNE LRLYPPV    R+VK++ KLG L+LPAGV L +P++ +  DPE+WGEDA+EF 
Sbjct  387   TMILNEVLRLYPPVSMFGRLVKKETKLGKLTLPAGVMLGLPVVLMQCDPELWGEDAHEFK  446

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             PERF EGVSKA      ++PF  GPRICIGLNFAM+EAK  LS IL+RFS +LS SY HA
Sbjct  447   PERFSEGVSKAAKNPGAFVPFGWGPRICIGLNFAMIEAKMTLSMILQRFSLELSSSYTHA  506

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P   +TT P +GA +IL KL
Sbjct  507   PIAAITTQPQHGAHIILHKL  526



>ref|XP_002263609.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/508 (55%), Positives = 375/508 (74%), Gaps = 3/508 (1%)
 Frame = +3

Query  153   FSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             F F  + + C WR++NW W+RPK LE+ LR Q L GN YRL  GD+KE+++MM E  S+P
Sbjct  10    FGFLTVLISCVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRMMKEAYSRP  69

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             ++ LSD++V RV+P+    I+K+GKN F W+G  P V I +P+ +++VL K N FQ+  +
Sbjct  70    IS-LSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSNIFQKTPS  128

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
              P+V  L  GL+  EG++W+K RKI NPAF  EKLK+M+ A +  CS+MV +W+++ S  
Sbjct  129   HPLVKLLVSGLVALEGEQWAKRRKIINPAFHPEKLKNMLSAFHLSCSDMVNKWKKL-SVE  187

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
              S ELDVWP L+ +  +VIS TAFG SYE G R+F+LQ E    A ++  SVYIPG RF 
Sbjct  188   GSCELDVWPYLENLTGDVISRTAFGSSYEEGIRIFQLQKEQTYLAIKVAMSVYIPGWRFF  247

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMK-HHGNQE  1049
             PTK N+RM  I KE++ +L  II KR  AM+ GE A+++LL +L+ESNF+E++ H  N +
Sbjct  248   PTKTNKRMKQISKEVHALLGGIINKREKAMEAGETANSDLLGILMESNFREIQEHQNNTK  307

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
              GMS +D+I ECKLFYLAGQETTS LL+WTM+LLS++ +WQ  AREEV+ VFG++KP+ D
Sbjct  308   IGMSAKDVIDECKLFYLAGQETTSVLLLWTMVLLSQHPDWQARAREEVLQVFGNNKPEND  367

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
             GLN LKIVTMI +E LRLYPPV  L R+V +D ++G++  PAGV++ +P I +HHD E+W
Sbjct  368   GLNHLKIVTMIFHEVLRLYPPVTVLTRMVSKDTQVGDMYFPAGVQVSLPTILVHHDHEIW  427

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             G+DA EFNPERF EGVSKAT  +  +LPF  GPR+CIG NFAM+EAK AL+ IL+RFSF+
Sbjct  428   GDDAKEFNPERFAEGVSKATKNQVSFLPFGWGPRVCIGQNFAMMEAKIALAMILQRFSFE  487

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LSPSYAHAPY+ +T  P YGA LIL+ L
Sbjct  488   LSPSYAHAPYSLITIQPQYGAHLILRGL  515



>ref|XP_007212438.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
 gb|EMJ13637.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
Length=506

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/497 (57%), Positives = 366/497 (74%), Gaps = 2/497 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWRV+NW W+RPK LE+ LR Q L GN YRL  GDTKE + M+ E KSKPMN LS ++ P
Sbjct  10    AWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMVKEAKSKPMN-LSHDITP  68

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RV+P+  +S+  +GKN F+W+G  P V I++P  VK+V + +  FQ+ + +P+V  L+ G
Sbjct  69    RVLPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFTNYEDFQKPVINPLVKFLATG  128

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  YEG+KW+KHRKI NPAF LEKLK M+PA ++ CSEM+ +WE +VS+  S ELDVWP 
Sbjct  129   LPNYEGEKWAKHRKIINPAFHLEKLKRMLPAFHQSCSEMIEKWERLVSKEGSCELDVWPY  188

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+++A +VIS  +FG SY+ GR++F+L  E A+       S YIPG RFLPT+ N+RM  
Sbjct  189   LESLAADVISRASFGSSYQEGRKIFQLLKEQAKLTIRALQSFYIPGWRFLPTRSNKRMKA  248

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIEDIIS  1079
             IDKEI   L+ II  R  A++ GE A ++LL +L+ESN KE++ +GN +  GMSIED+I 
Sbjct  249   IDKEIKGSLRDIISTREEAIRMGEAAKDDLLGILMESNLKEIRENGNTKNVGMSIEDVIE  308

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AGQETTS LL+WT++LLS+NQ WQ  AR+EV+ VFG +KPDFDGL+ LK+VTM
Sbjct  309   ECKLFYFAGQETTSVLLLWTLVLLSQNQNWQARARDEVLQVFGSNKPDFDGLSHLKVVTM  368

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             IL E LRLYP V  L R   +  +LG LSLPAGV + +PI+ LHHD E+WGEDA EFNPE
Sbjct  369   ILLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLPILLLHHDKELWGEDAIEFNPE  428

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EGVSKA+  +  Y PF GGPRICIG NFAM+EAK A S +L+RF+F+LSPSYAHAP 
Sbjct  429   RFSEGVSKASKNQFAYFPFGGGPRICIGQNFAMLEAKLAFSLLLQRFTFELSPSYAHAPS  488

Query  1620  TGLTTNPLYGAPLILQK  1670
               ++  P YGA +IL K
Sbjct  489   LIISLQPQYGAHIILHK  505



>gb|EYU31635.1| hypothetical protein MIMGU_mgv1a025572mg [Erythranthe guttata]
Length=515

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/516 (54%), Positives = 370/516 (72%), Gaps = 3/516 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME+  +      +++ L+  W+++N  W RP+ +EK LR Q   G  YR   GD  E+  
Sbjct  1     MELLQSFLALCCTVVVLIYGWKIMNLVWFRPRKMEKILRQQGFGGKSYRFLIGDLNEMKN  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M  E  SKP++  SD+ VPR I +  +++  HG+NSFVWLG    VII+DP++V+EVLSK
Sbjct  61    MGEEALSKPID-FSDDFVPRTISFIHKTVTNHGENSFVWLGPYAAVIISDPENVREVLSK  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
                FQ+   +P+   ++QGL  YE DKW+KHR++ NPAF L+K+KHM+P+ +K C+EM+ 
Sbjct  120   SYVFQKPY-NPLGKLVAQGLASYETDKWAKHRRLINPAFHLDKVKHMLPSFHKSCAEMLS  178

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE+IV      ELDVWP L+T+  + ISLTAFG SYE G ++FELQ E A    +   S
Sbjct  179   KWEKIVPSEGCFELDVWPYLQTMTSDAISLTAFGSSYEQGIKIFELQKEQAALLIKAILS  238

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
              +IPG RFLPTK NRRM  I  E+ ++L  II+KR  A++ GE  SN+LLD+LLESN KE
Sbjct  239   AFIPGWRFLPTKTNRRMKHIITEVESLLLAIIDKRTKAIEAGEATSNDLLDILLESNSKE  298

Query  1026  MKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVF  1205
             +K +G++ FGMS++D+I ECKLFYLAGQETTS LLVWTMILLS++ +WQ  AREEV+HVF
Sbjct  299   IKQNGHK-FGMSLQDVIEECKLFYLAGQETTSSLLVWTMILLSKHLDWQARAREEVLHVF  357

Query  1206  GDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIF  1385
                 PDF  L+RLKIV+MI  E LRLYPP   + R V ++  LGN+ LPAGV+LL+P+I 
Sbjct  358   RSGTPDFQDLSRLKIVSMIFQEVLRLYPPGLLISRAVHKETALGNIVLPAGVQLLLPVIL  417

Query  1386  LHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSC  1565
             LHHD ++WGEDA +FNPERF EGVS+AT G   Y PF  GPRICIG NFAM+EAK AL+ 
Sbjct  418   LHHDCKIWGEDAKDFNPERFSEGVSEATGGSLSYFPFGWGPRICIGQNFAMLEAKMALAM  477

Query  1566  ILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             IL+ +SF+LSPSY+HAP+T LT  P +GA LIL+KL
Sbjct  478   ILQHYSFELSPSYSHAPHTVLTLQPQHGAHLILRKL  513



>emb|CDP15982.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/514 (54%), Positives = 365/514 (71%), Gaps = 6/514 (1%)
 Frame = +3

Query  135   FCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMN  314
             F    + S  ++  V AWR +NWAW +PK L+K L+ Q  KGNPY+L YGD K+I+ +  
Sbjct  7     FMIALVSSCCVVLSVLAWRALNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDFKQISSLFQ  66

Query  315   ETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNT  494
             E  SKP++ LSD++VPR++P+F E++ K+GKN+++W G  PM++I DP+ +++V  K + 
Sbjct  67    EANSKPIS-LSDDIVPRIVPHFLEAVNKYGKNTYLWFGPRPMMLIMDPELIRKVTHKMDI  125

Query  495   FQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWE  674
             FQ+    P    L  G+L YEG+KW+K RK+ N AF  EKLK MVPA YK  SEM+ +WE
Sbjct  126   FQKVRFRPQARLLIGGILVYEGEKWAKQRKLLNQAFHTEKLKLMVPAFYKSASEMLSKWE  185

Query  675   EIVSRNESGEL-DVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVY  851
             E++S   S E+ DVWP ++T+  + IS TAFG  YE GR++FELQ E A H  E   S+Y
Sbjct  186   EMISVKGSFEVVDVWPNIQTMTSDAISRTAFGSRYEEGRKIFELQREQARHLVEATRSIY  245

Query  852   IPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMK  1031
             IPG RFLPTK+NRRM  I KE+   ++ II  R+ A++ GE    ++L +LLES  +E  
Sbjct  246   IPGSRFLPTKRNRRMKQIAKEVEGSIREIINARLKALRAGEAIDADMLGILLESTSQET-  304

Query  1032  HHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGD  1211
                + E GM+  +II ECKLFY AGQETT+ LLVWTMILLS + +WQE AREEV+  FG 
Sbjct  305   ---DGESGMTTGEIIQECKLFYFAGQETTAVLLVWTMILLSMHPDWQERAREEVLQHFGT  361

Query  1212  DKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLH  1391
             D P+FDGLN+LKIVTMIL+E LRLYPP P + R V E+ K+GNL++PAG  L +P+I LH
Sbjct  362   DMPNFDGLNQLKIVTMILHEVLRLYPPFPNIGRSVAEETKIGNLTIPAGQLLTLPMILLH  421

Query  1392  HDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCIL  1571
             HDPE+WG+D  EF PERF +GVS AT G+  Y PF  GPRICIG NFAM+EAK AL+ IL
Sbjct  422   HDPEIWGQDVKEFKPERFADGVSSATKGQIVYFPFGWGPRICIGQNFAMLEAKLALAMIL  481

Query  1572  RRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +RFSF+LSPSY+HAP+  +   P +GA L+L KL
Sbjct  482   QRFSFELSPSYSHAPHLTIAIQPQFGAHLMLHKL  515



>ref|XP_008226211.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/521 (56%), Positives = 370/521 (71%), Gaps = 5/521 (1%)
 Frame = +3

Query  111   QVMMRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDT  290
             +V +   V   +FL S  I     AWRV+NW W+RPK LE+ LR Q L GN YRL  GDT
Sbjct  2     EVSVVASVALRVFLVSTVITL---AWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDT  58

Query  291   KEIAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVK  470
             KE + M+ E KSKPMN LS ++ PRV+P+  +S+  +GKN F+W+G  P V I++P  VK
Sbjct  59    KESSMMVKEAKSKPMN-LSHDITPRVLPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVK  117

Query  471   EVLSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKIC  650
             +V + +  FQ+ + +P+V  L+ GL  YEG+KW+KHRKI NPAF LEKLK M+PA +  C
Sbjct  118   DVFTNYEDFQKPVINPLVKLLATGLPNYEGEKWAKHRKIINPAFHLEKLKRMLPAFHLSC  177

Query  651   SEMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHAS  830
             SEM+  WE +VS+  S ELDVWP L+++A +VIS  +FG SY+ GR++F+L  E A+   
Sbjct  178   SEMIEEWERLVSKEGSCELDVWPYLESLAADVISRASFGSSYQEGRKIFQLLKEQAKLTI  237

Query  831   ELRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLE  1010
                 SVYIPG RFLPT+ N+RM  IDKEI   L+ II  R  A++ GE   ++LL +LLE
Sbjct  238   RALQSVYIPGWRFLPTRSNKRMKAIDKEIKGSLRDIISTREEAIRMGEATKDDLLGILLE  297

Query  1011  SNFKEMKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELARE  1187
             SN KE++ +GN +  GMSIED+I ECKLFY AGQETTS LL+WT++LLS+NQ WQ  AR+
Sbjct  298   SNLKEIRENGNTKNVGMSIEDVIEECKLFYFAGQETTSVLLLWTLVLLSQNQNWQARARD  357

Query  1188  EVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRL  1367
             EV+ VFG +KPDFDGLN LK+VTMIL E LRLYP V  L R       LG LSLPAGV +
Sbjct  358   EVLQVFGSNKPDFDGLNHLKVVTMILLEVLRLYPSVVALPRTTHNKTHLGKLSLPAGVEV  417

Query  1368  LVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEA  1547
              +PI+ LHHD E+WGEDA  FNPERF EGVSKA+  +  Y PF GGPRICIG NFAM+EA
Sbjct  418   SLPILLLHHDKELWGEDAIGFNPERFSEGVSKASKNQFAYFPFGGGPRICIGQNFAMLEA  477

Query  1548  KTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
             K A S +L+RF+F+LSPSYAHAP   ++  P YGA +IL K
Sbjct  478   KLAFSLLLQRFTFELSPSYAHAPSLIISLQPQYGAHIILHK  518



>emb|CBI39886.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/508 (55%), Positives = 375/508 (74%), Gaps = 3/508 (1%)
 Frame = +3

Query  153   FSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             F F  + + C WR++NW W+RPK LE+ LR Q L GN YRL  GD+KE+++MM E  S+P
Sbjct  10    FGFLTVLISCVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRMMKEAYSRP  69

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             ++ LSD++V RV+P+    I+K+GKN F W+G  P V I +P+ +++VL K N FQ+  +
Sbjct  70    IS-LSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSNIFQKTPS  128

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
              P+V  L  GL+  EG++W+K RKI NPAF  EKLK+M+ A +  CS+MV +W+++ S  
Sbjct  129   HPLVKLLVSGLVALEGEQWAKRRKIINPAFHPEKLKNMLSAFHLSCSDMVNKWKKL-SVE  187

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
              S ELDVWP L+ +  +VIS TAFG SYE G R+F+LQ E    A ++  SVYIPG RF 
Sbjct  188   GSCELDVWPYLENLTGDVISRTAFGSSYEEGIRIFQLQKEQTYLAIKVAMSVYIPGWRFF  247

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMK-HHGNQE  1049
             PTK N+RM  I KE++ +L  II KR  AM+ GE A+++LL +L+ESNF+E++ H  N +
Sbjct  248   PTKTNKRMKQISKEVHALLGGIINKREKAMEAGETANSDLLGILMESNFREIQEHQNNTK  307

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
              GMS +D+I ECKLFYLAGQETTS LL+WTM+LLS++ +WQ  AREEV+ VFG++KP+ D
Sbjct  308   IGMSAKDVIDECKLFYLAGQETTSVLLLWTMVLLSQHPDWQARAREEVLQVFGNNKPEND  367

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
             GLN LKIVTMI +E LRLYPPV  L R+V +D ++G++  PAGV++ +P I +HHD E+W
Sbjct  368   GLNHLKIVTMIFHEVLRLYPPVTVLTRMVSKDTQVGDMYFPAGVQVSLPTILVHHDHEIW  427

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             G+DA EFNPERF EGVSKAT  +  +LPF  GPR+CIG NFAM+EAK AL+ IL+RFSF+
Sbjct  428   GDDAKEFNPERFAEGVSKATKNQVSFLPFGWGPRVCIGQNFAMMEAKIALAMILQRFSFE  487

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LSPSYAHAPY+ +T  P YGA LIL+ L
Sbjct  488   LSPSYAHAPYSLITIQPQYGAHLILRGL  515



>ref|XP_011082966.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=515

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/518 (52%), Positives = 380/518 (73%), Gaps = 5/518 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME+  +L    F +   V AWR +NW W+ P+ +EK LR Q   GN YR   GD+KE++ 
Sbjct  1     MEILYSLVAVIFGVFVSVNAWRFLNWVWLEPRKVEKRLREQGFNGNSYRFLVGDSKEMSS  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M  E +SKP+N  S+++V RV+P+   S+ K+G+N F+W G  P  +I+DP+ +KE++SK
Sbjct  61    MGEEAQSKPIN-FSNDIVHRVMPFIHHSLHKYGENCFIWFGPKPAALISDPEMIKEIMSK  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
             +  FQ+ +++P+   L++G+  YE DKW KHR++ NPAF LEKLKHMVP+ Y  C++M+ 
Sbjct  120   NYVFQK-ISNPLDQLLAKGVAAYEADKWDKHRRLINPAFHLEKLKHMVPSFYLSCADMLS  178

Query  666   RWEE-IVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRH  842
             +W+E IV++  S E+DVWP L++++ +VIS TAFG +YE GR++FELQ E  EH  +   
Sbjct  179   KWDEKIVAKEGSCEVDVWPYLQSMSSDVISRTAFGSNYEEGRKIFELQREQEEHLLQALQ  238

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFK  1022
             ++YIPG RFLPTK+NRRM  I KE+ + +  II+KR+  ++ GE  S++LL +LLESNF+
Sbjct  239   TLYIPGWRFLPTKRNRRMKEIVKEVESTILGIIKKRMQMIEAGESNSDDLLGILLESNFR  298

Query  1023  EMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             E++ +G Q  GMS++++I ECKLFY+AGQETTS L+ WTMILLS++  WQ  AR+EV+ V
Sbjct  299   EIQQNGTQS-GMSMKEVIDECKLFYIAGQETTSSLITWTMILLSKHSGWQARARDEVLQV  357

Query  1203  FGD-DKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
              G   KPDF  LNRLKIV MI +E +RLYPP   L R + ++  LGN++LPAG++LL+P 
Sbjct  358   LGTAGKPDFQHLNRLKIVNMIFHEVMRLYPPAVMLGRAIHKETPLGNVTLPAGLQLLLPT  417

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             + +HHDP++WG+DA EF PERF +GV+KATN +  Y PF GGPRICIG NFAM+EAK AL
Sbjct  418   VAVHHDPKIWGDDAKEFKPERFSDGVAKATNVQFSYFPFGGGPRICIGQNFAMLEAKMAL  477

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + IL+R+SF+LSPSYAHAP   +T  P +GA LIL+KL
Sbjct  478   AMILQRYSFELSPSYAHAPNMIVTLQPQFGAHLILRKL  515



>gb|AGX93057.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Cinchona calisaya]
Length=519

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/516 (54%), Positives = 365/516 (71%), Gaps = 4/516 (1%)
 Frame = +3

Query  135   FCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMN  314
             F ++ +  F  + +   +RV++W W+RPK LEK LR Q  +GNPYRLF GD  E  K++ 
Sbjct  5     FTSIAILGFIGLSIYWFYRVLDWVWLRPKKLEKCLREQGFRGNPYRLFLGDQYESGKLIR  64

Query  315   ETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNT  494
             E  SKP+ V  ++V  R+ P+  +++Q HGKNSF+W+G IP V +TDP+ ++EVL+K+  
Sbjct  65    EAMSKPIPV-DEDVRKRIAPHILKTVQTHGKNSFMWVGRIPRVNVTDPELIREVLTKYYK  123

Query  495   FQQNL--ADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGR  668
             FQ+N    DP+   L  G+   EGD WS+ RKI N AFQ EKLK M+PA Y  C +MV +
Sbjct  124   FQKNHHDLDPITKLLLTGIGSLEGDPWSRRRKIINSAFQFEKLKLMLPAFYLSCRDMVSK  183

Query  669   WEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSV  848
             W+  V  ++S ELDVW +++T+  +VIS T FG ++E GRR+FEL  EL     ++  SV
Sbjct  184   WDNKVPEDDSAELDVWHDIETLTGDVISRTLFGSNFEEGRRIFELMKELTSLTIDVIRSV  243

Query  849   YIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEM  1028
             YIPG RFLPTK+N RM  ID+E+   +  II K++ AMK GE   ++ L +LLE N  E+
Sbjct  244   YIPGQRFLPTKRNNRMRAIDREVRVRITEIINKKMRAMKAGEATGDDFLGILLECNLNEI  303

Query  1029  KHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVF  1205
             K  GN +  GMSIE+II ECKLFY AGQ+TTS L+VWTM+LLSR  EWQ+ AREEV+ VF
Sbjct  304   KEQGNNKSAGMSIEEIIGECKLFYFAGQDTTSTLIVWTMVLLSRFPEWQQHAREEVLQVF  363

Query  1206  GDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIF  1385
             GD KPD+DG++RLKIVTMIL E LR+Y PV  L ++  ED +LG   +PAGV+L++P I 
Sbjct  364   GDRKPDYDGISRLKIVTMILYEVLRIYTPVSELTKVAHEDTQLGKYFIPAGVQLMMPQIL  423

Query  1386  LHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSC  1565
             LHHDPE+WG+D  EF P+RF EGV KAT  +  Y PFS GPR+CIG NFA++EAK A++ 
Sbjct  424   LHHDPEIWGDDVMEFKPQRFSEGVLKATKSQGSYFPFSLGPRMCIGQNFALLEAKMAMAL  483

Query  1566  ILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             ILRRFSF+LSPSY HAP+T +T  P YGA LIL KL
Sbjct  484   ILRRFSFELSPSYVHAPFTLITMQPQYGAHLILHKL  519



>ref|XP_011009101.1| PREDICTED: cytochrome P450 CYP72A219-like [Populus euphratica]
Length=547

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/522 (54%), Positives = 372/522 (71%), Gaps = 6/522 (1%)
 Frame = +3

Query  120   MRMEVFCNLFLFSFS-IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKE  296
             ++M V     L S   +  L  AWRV+NW W RPK +E+ LR Q   G PYRL  GD KE
Sbjct  28    VKMTVIVTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLLGDWKE  87

Query  297   IAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEV  476
              + M+ E ++KP+  LS+ ++PRV+P+  + ++ +GKNSF+W+G  P V I +PD +++V
Sbjct  88    SSDMLKEARTKPLG-LSEALLPRVMPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIRDV  146

Query  477   LSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSE  656
               K N +Q+  + P++  L+ GL  +EG+KW+KHRKI NPAF  EKLK M+PA Y+ CS 
Sbjct  147   FMKINEYQKA-SHPLLKALACGLASHEGEKWAKHRKIINPAFHQEKLKLMIPAFYESCSG  205

Query  657   MVGRWEEIVSRNE-SGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASE  833
             M+ +WE++VS +E S ELDVWP+L+ +  + IS T+FG +YE G+R+F+L  E  +    
Sbjct  206   MINKWEKLVSADEGSCELDVWPDLRGLTCDAISRTSFGSNYEEGKRIFDLLKEFTDLTVH  265

Query  834   -LRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLE  1010
              +  ++ IPG RFLP   NRR+  IDKEI   L  +I KR  AM  GE+A N+LLD+LLE
Sbjct  266   VIMKAIVIPGYRFLPIPSNRRLKAIDKEIKASLNALISKREKAMSAGEDAKNDLLDLLLE  325

Query  1011  SNFKEMKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELARE  1187
             SNF+E++ HGN +  GMSIED+I ECK+FY AGQETTS LL WTM+LL++   WQ   RE
Sbjct  326   SNFREIQEHGNTKSVGMSIEDVIDECKIFYFAGQETTSVLLTWTMVLLAQYPNWQARGRE  385

Query  1188  EVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRL  1367
             EV+ VFG+ KPDFDGLN LK+VTMIL E LRLYPPV  L R V E+ KLGNL LPAGV++
Sbjct  386   EVVQVFGNKKPDFDGLNHLKVVTMILYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQI  445

Query  1368  LVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEA  1547
              VP I LH D E+WG+DA+EF PERF EGVSKAT  +  +LPF  GPRIC+G NFAM+EA
Sbjct  446   SVPTILLHQDRELWGDDASEFKPERFAEGVSKATKSQVSFLPFGWGPRICVGQNFAMIEA  505

Query  1548  KTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             K AL+ IL+R SF+LSPSY HAP+T +T  P +GAP+IL+KL
Sbjct  506   KMALAMILQRCSFELSPSYVHAPHTVITLQPQHGAPMILRKL  547



>ref|XP_006343585.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/521 (52%), Positives = 384/521 (74%), Gaps = 6/521 (1%)
 Frame = +3

Query  114   VMMRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTK  293
             V + M++  +L +    I+FL   W+ ++W WI PK +EK L+ +  KG+ Y+   GD K
Sbjct  2     VQINMKIAISLVIV---IIFLRWIWKFLDWVWIHPKKMEKRLKLEGFKGSSYKFLLGDMK  58

Query  294   EIAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKE  473
             E+  M+ E KSKP+N  +++ + RV P+F + + ++GKN ++WLG  P ++I++P+ ++E
Sbjct  59    EMNSMVEEAKSKPIN-FTNDYISRVFPHFNKFMMQYGKNCYIWLGPKPTMLISEPEFIRE  117

Query  474   VLSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICS  653
             +LSK   +Q+   +P+   L+QGL  YE +KW+KHR+I NPAF L+KLKHM+P+ Y  C 
Sbjct  118   ILSKSYIYQKIQGNPITKLLAQGLASYETEKWAKHRRIINPAFHLDKLKHMLPSFYLSCC  177

Query  654   EMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASE  833
             +M+ +W+ IVS ++  E+DVWP L+T+  + IS TAFG +YE GR++FELQ E A+   +
Sbjct  178   DMINKWDNIVS-SKGSEVDVWPFLQTLTSDAISRTAFGSNYEEGRQIFELQKEQADLIIQ  236

Query  834   LRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLES  1013
                 +YIPG RF+PTK+N+R+  I  E+ +++  II  RI  MKEGE   ++LL +LLES
Sbjct  237   AARWIYIPGWRFVPTKRNKRIKQIANEVRSLVLGIINNRIKEMKEGEATKDDLLGILLES  296

Query  1014  NFKEMK-HHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREE  1190
             NFKE++ HH N+ FGM+I+++I ECKLFY AGQETTS LLVWT+ILLS++ +WQE AR+E
Sbjct  297   NFKEIQIHHENKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHLDWQERARQE  356

Query  1191  VMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLL  1370
             V  VFG +KPD+D LN+LK+VTMI NE LRLYPP   + R V+++ KLGNLSLPAG+ LL
Sbjct  357   VHQVFGSNKPDYDMLNQLKVVTMIFNEVLRLYPPGAMIGRRVQKETKLGNLSLPAGMLLL  416

Query  1371  VPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAK  1550
             +P I+L HD E+WG+DA EFNP+RF EGV+KAT GK  Y PFS GPRICIG NFAM+EAK
Sbjct  417   LPTIYLQHDNEIWGDDAKEFNPKRFSEGVNKATKGKFAYFPFSWGPRICIGQNFAMLEAK  476

Query  1551  TALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              AL+ IL+ ++ +LSPSY+HAP+T +T  P +GAPLIL+KL
Sbjct  477   MALAMILQHYALELSPSYSHAPHTIITLQPQHGAPLILRKL  517



>ref|XP_004146005.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=530

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/500 (56%), Positives = 354/500 (71%), Gaps = 4/500 (1%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
              W++V+W W RPK LEK LR Q   GN YR+ +GD KE A M ++  SKPMN  S+ + P
Sbjct  28    GWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDLKESAAMRDQAISKPMN-FSNYIAP  86

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA--DPVVYKLS  536
             RVIP    +IQ +GKNSF+W+G +P V I DP+ +K V S  N +Q+  A  +P+   L+
Sbjct  87    RVIPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLA  146

Query  537   QGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVW  716
              GLL +EG KW KHRKI NPAF LEKLK MVPA Y  C EM+ +WE +VS     ELDV 
Sbjct  147   DGLLNHEGQKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVEGFCELDVM  206

Query  717   PELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRM  896
             P L+ +  +VIS TAFG SYE G+++F+LQ EL E   +    +YIPG RFLPTK N +M
Sbjct  207   PYLQNMTADVISRTAFGSSYEKGKKIFKLQTELGEMVMQSTLGIYIPGWRFLPTKSNNKM  266

Query  897   NGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIEDI  1073
               I KEI+T++  II +R  +MK GE    +LL +L+ESN  E+K HGN ++ GMSIED+
Sbjct  267   KVISKEISTLIMDIINERETSMKSGEAIQTDLLSILMESNLNEIKQHGNNKDIGMSIEDV  326

Query  1074  ISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIV  1253
             I ECKLFY+AGQETT+ LL WTM+LLS   +WQE AR EV  +FG+ KP++DGL+RLK+V
Sbjct  327   IDECKLFYIAGQETTATLLTWTMVLLSSYSDWQERARAEVFEIFGNKKPNYDGLSRLKVV  386

Query  1254  TMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
             TMILNE LRLYPPV    R+VK++ KLG L+LPAGV L +P++ +  DPE+WGEDA+EF 
Sbjct  387   TMILNEVLRLYPPVSMFGRLVKKETKLGKLTLPAGVMLGLPVVLMQCDPELWGEDAHEFK  446

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             PERF EGVSKA      ++PF  GPRICIGLNFAM+EAK  LS IL+RFS +LS SY HA
Sbjct  447   PERFSEGVSKAAKNPGAFVPFGWGPRICIGLNFAMIEAKMTLSMILQRFSLELSSSYTHA  506

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P   +TT P +GA +IL KL
Sbjct  507   PIAAITTQPQHGAHIILHKL  526



>ref|XP_011009102.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Populus euphratica]
 ref|XP_011009103.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Populus euphratica]
Length=542

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/522 (55%), Positives = 375/522 (72%), Gaps = 6/522 (1%)
 Frame = +3

Query  120   MRMEVFCNLFLFSFS-IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKE  296
             ++M V     L S   +  L  AWRV+NW W RPK +E+ LR Q   G PYRL +GD KE
Sbjct  23    VKMTVTVTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKE  82

Query  297   IAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEV  476
              + M+ E ++KP+  LSD ++PRV+P+  + ++ +GKNSF+W+G  P V I +PD +++V
Sbjct  83    NSDMLKEARTKPLG-LSDALLPRVVPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIRDV  141

Query  477   LSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSE  656
               K N +Q+  + P++  L+ GL  +EG+KW+KHRKI NPAF  EKLK M+PA  + CS 
Sbjct  142   FMKINEYQKP-SHPLLKPLACGLASHEGEKWAKHRKIINPAFHQEKLKLMIPAFCESCSG  200

Query  657   MVGRWEEIVSRNE-SGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAE-HAS  830
             M+ +WE++VS +E S ELDVWP+L+ +A + IS T+FG +YE G+R+F+L  EL +   +
Sbjct  201   MINKWEKLVSVDEGSCELDVWPDLQGLACDAISRTSFGSNYEEGKRIFDLLKELTDLTVN  260

Query  831   ELRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLE  1010
              +  +V IPG RFLP   NRR+  IDKEI   L  +I KR  AM  GE+A N+LLD+LLE
Sbjct  261   VIIKAVVIPGYRFLPIPSNRRLKAIDKEIKASLNALINKREKAMSAGEDAKNDLLDLLLE  320

Query  1011  SNFKEMKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELARE  1187
             SNF+E++ HGN +  GMSIED+I ECK+FY AGQETTS LL WTM+LL++   WQ  ARE
Sbjct  321   SNFREIQEHGNSKSAGMSIEDVIDECKIFYFAGQETTSVLLTWTMVLLAQYPNWQARARE  380

Query  1188  EVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRL  1367
             EV+ VFG+ KPDFDGLN LK+VTMIL E LRLYPPV  L R V E+ KLGNL +PAGV++
Sbjct  381   EVVQVFGNKKPDFDGLNHLKVVTMILYEVLRLYPPVIMLNRDVHEEIKLGNLLVPAGVQI  440

Query  1368  LVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEA  1547
              VP I LH D E+WG+DA+EF PERF EGVSKAT  +  +LPF  GPRIC+G NFAM+EA
Sbjct  441   SVPTILLHQDRELWGDDASEFKPERFAEGVSKATKSQVSFLPFGWGPRICVGQNFAMIEA  500

Query  1548  KTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             K AL+ IL+R SF+LSPSY HAP T +T  P +GAP+IL+KL
Sbjct  501   KMALAMILQRCSFELSPSYIHAPRTVITLQPQHGAPMILRKL  542



>ref|XP_004488669.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=518

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/517 (55%), Positives = 381/517 (74%), Gaps = 2/517 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME    +F     ++ LV AW++++W W+RPK LEK LR Q LKGNPYRL  GD KE  K
Sbjct  1     MEATSAIFGCIILLIMLVWAWKMLHWLWLRPKKLEKLLREQGLKGNPYRLLVGDMKEFFK  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
                + +SKPMN LSD++V RV PY  +++ KHGKNSF+W G  P VI+TDP+ VK+V +K
Sbjct  61    SEMKARSKPMN-LSDDIVSRVFPYGQQTVTKHGKNSFIWFGPTPRVILTDPELVKDVFNK  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
                FQ+  ++P++  L+ GL+ +E +KW  HRKI NPAF LEKLK M+P +++ C++M+ 
Sbjct  120   MYDFQKPNSNPLIRLLATGLITHEEEKWRMHRKIINPAFHLEKLKMMLPVIFESCNDMIN  179

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE ++S + S E+DVWP ++ +A +VI+ TAFG SYE G R+F+LQ E AE   E+   
Sbjct  180   KWERMLSSDGSCEIDVWPSIQNLASDVIARTAFGSSYEEGIRIFQLQKEQAEITMEILMK  239

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
             VYIPG RFLPT  NRR+  ID+ I   L +II KR  A+K GE   N+LL +LLESN KE
Sbjct  240   VYIPGWRFLPTTTNRRLKEIDRVIIASLTKIINKRENAIKAGETPKNDLLGILLESNHKE  299

Query  1026  MKHHGNQE-FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             +K + N +  GM+I+D+I ECKLFYLAG+ETTS LLVWTMILLSR+  WQ  AREEV+ V
Sbjct  300   IKENNNNKNVGMNIDDVIKECKLFYLAGEETTSVLLVWTMILLSRHPNWQARAREEVLQV  359

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG+ KPDFDGL+ LKI+TMIL E LRLYPP+  L R V+++ ++GNL+LPAGV++ +PI+
Sbjct  360   FGNKKPDFDGLSHLKIITMILYEVLRLYPPLIVLPRAVQKNVRVGNLTLPAGVQIGLPIV  419

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
             +LHH+ E+WG+DA  FNPERF EG+ KATNGK  + PF  GPRICIG NF+++EAK A++
Sbjct  420   WLHHECELWGDDAKVFNPERFSEGILKATNGKISFFPFGWGPRICIGQNFSLLEAKMAIA  479

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL+ FSF+LSP+YAHAP   +T  P +GA +IL+KL
Sbjct  480   LILQHFSFELSPTYAHAPAMIITLQPQHGAHIILRKL  516



>ref|XP_002263652.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=516

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/517 (54%), Positives = 367/517 (71%), Gaps = 2/517 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME+  +  L   +   L  AWR     W+RP+ LE+ LR Q L GN YR  +GD K+++ 
Sbjct  1     MEIAYDSVLIFCAFALLSLAWRAFYLVWLRPRRLERCLRRQGLMGNSYRPLHGDAKKVSI  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M+ E  S+P+N LSD++VPRVIP+ +++IQ++GKNSF W+G IP V I  P+ ++EV  +
Sbjct  61    MLKEANSRPIN-LSDDIVPRVIPFLYKTIQQYGKNSFTWVGPIPRVNIMKPELIREVFLE  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
                FQ+   +P+   L  GL+ YEG+KW+KHRK+ NPAF +EKLK M PA +  C +M+ 
Sbjct  120   AGRFQKQKPNPLANFLLTGLVSYEGEKWAKHRKLLNPAFHVEKLKLMSPAFHLSCRQMIS  179

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             + EE+VS   S ELDVWP LK +  + +S TAFG SYE GRRLF+L  E      E+  S
Sbjct  180   KMEEMVSPEGSCELDVWPFLKNLTADALSRTAFGSSYEEGRRLFQLLQEQTYLTMEVFQS  239

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
             VYIPG  +LPTK+N+RM  IDKE+NT+L  II KR  AMK+G+ A+ +LL +L+ESN KE
Sbjct  240   VYIPGWWYLPTKRNKRMKKIDKEMNTLLNDIITKRDKAMKDGKTANEDLLGILMESNSKE  299

Query  1026  MKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             ++  GN +  G+S++++I ECKLFYLAGQETTS+LL+WTM+LLS++  WQ LAREEV  V
Sbjct  300   IQEGGNSKNAGISMQEVIEECKLFYLAGQETTSNLLLWTMVLLSKHPNWQTLAREEVFQV  359

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG +KP+F GL+RLK+VTMI  E LRLYPP  TL R V ED  LG L LP+GV +++P I
Sbjct  360   FGKNKPEFAGLSRLKVVTMIFYEVLRLYPPGATLNRAVYEDINLGELYLPSGVEIVLPTI  419

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              +HHDPE+WG+D  EF PERF EGV KAT G+  Y PF  GPRICIG NFAM EAK AL+
Sbjct  420   LVHHDPEIWGDDVKEFKPERFSEGVMKATKGQVSYFPFGWGPRICIGQNFAMAEAKMALA  479

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL+ F+F+LSPSY HAP + LT  P YGA LIL K+
Sbjct  480   MILQCFTFELSPSYTHAPTSVLTLQPQYGAHLILHKI  516



>ref|XP_010644781.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Vitis vinifera]
Length=518

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/513 (55%), Positives = 372/513 (73%), Gaps = 3/513 (1%)
 Frame = +3

Query  141   NLFLFSFS-IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNE  317
             NL   SF+ I  L+ AWR++NW W+RPK LE+ L+ Q L GN YRL +GD KE+  M+ E
Sbjct  7     NLVALSFAFITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDLKEMFMMIKE  66

Query  318   TKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTF  497
               S+P+++ SD++V R+ P+ + SI+K+GK+SF+W+G  P V I +P+ +++VLS H  F
Sbjct  67    ASSRPISI-SDDIVQRIAPFQYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVF  125

Query  498   QQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEE  677
             ++     +V  L  GLL  +G+KW+KHRKI NPAF+LEKLK+M+PA +  CS+M+ +WE 
Sbjct  126   RKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWEG  185

Query  678   IVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIP  857
              +S   S ELDVWP L+ +  + IS TAFG +YE GR +FELQ E A+   +   S +IP
Sbjct  186   KLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIP  245

Query  858   GGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHH  1037
             G RFLPTK N+RM  I KE+N +L  II+KR  AMK GE  +++LL +LLESNFKE++ H
Sbjct  246   GWRFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQEH  305

Query  1038  GN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDD  1214
              N +  GMSI+D+I ECKLFY AGQETTS LL+WTM+LLS++  WQ  AREEV+HVFG++
Sbjct  306   ENDKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVFGNN  365

Query  1215  KPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHH  1394
             KP+ DGLN LKIV MIL+E LRLYPPVP L R V ED ++G++ LPAGV + +P I +HH
Sbjct  366   KPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHH  425

Query  1395  DPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILR  1574
             D E+WGEDA EFNPERF +GV KAT     + PF  G R+CIG NFA++EAK  L+ IL+
Sbjct  426   DHEIWGEDAREFNPERFSQGVLKATKSPVSFFPFGWGSRLCIGQNFAILEAKMVLAMILQ  485

Query  1575  RFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             RFSF LSPSY+HAP + +T  P YGA LIL  +
Sbjct  486   RFSFSLSPSYSHAPCSLVTLKPQYGAHLILHGI  518



>ref|XP_006477946.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/508 (55%), Positives = 366/508 (72%), Gaps = 2/508 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             +  L  AWRV+NW W+RPK LEK+LR Q LKGN YRL +GD KE +  + E K++P++ L
Sbjct  15    VTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLS-L  73

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
              D++  RV P+  + +  +GKNSF+W G  P V I +PD +K + +K N FQ+  + P+ 
Sbjct  74    DDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTKINDFQKVNSIPLA  133

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L  GL   EG+KW+KHRK+ NPAF  EKLK M+PA Y  C E++ +WE+ +S   S E
Sbjct  134   RLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSCIEIITKWEKQMSVEGSSE  193

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             LDVWP L  +  +VIS TAFG SYE GRR+F+LQ ELAE   ++  SV+IPG RFLPTK+
Sbjct  194   LDVWPYLANLTSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRSVHIPGWRFLPTKR  253

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMS  1061
             NRRM  IDKEI   L  II+ R  AM+ GE A+N+LL +L+E++F+E++ HGN +  G S
Sbjct  254   NRRMKEIDKEIRASLMGIIKNREKAMRAGEAANNDLLGILMETSFREIEEHGNNKNVGFS  313

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             + D+I ECKLFY AGQETTS LL WTM+LLS++Q+WQE AR+EV+ VFG++KPD+DGLN 
Sbjct  314   MNDVIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPDYDGLNH  373

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LKIV MIL E LRLYPPV  L R V ++ KLGNL+LPAGV++ +P+I +H DPE+WG+DA
Sbjct  374   LKIVQMILYEVLRLYPPVTVLSRAVFKETKLGNLTLPAGVQIGLPMILVHQDPELWGDDA  433

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
              EF PERF EG+SKA   +  Y PF+ GPRIC+G NFA+VEAK A + IL+ +SF+LSPS
Sbjct  434   VEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMATAMILQNYSFELSPS  493

Query  1602  YAHAPYTGLTTNPLYGAPLILQKL*FQN  1685
             Y HAP    T +P  G  LIL+KL  +N
Sbjct  494   YVHAPTAVPTLHPELGTQLILRKLWCKN  521



>ref|XP_004248201.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=510

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/499 (56%), Positives = 373/499 (75%), Gaps = 9/499 (2%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             +WR++NW W++P+ LEK LR    +GN Y+   GD  E+ KM  E KSKP+   S ++V 
Sbjct  19    SWRLMNWLWLQPRCLEKCLRELGFRGNSYKFLVGDMNEVVKMDEEAKSKPIK-FSHDIVK  77

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKL-SQ  539
             R++P+  ++I  +GKNSF+WLG  P ++I DP+H++E+LSK N FQ+    P + KL ++
Sbjct  78    RLMPFIHKTIIDYGKNSFIWLGPNPAMLIMDPEHIREILSKSNIFQK--PPPALTKLLAE  135

Query  540   GLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWP  719
             G+L YEGDKW+KHR+I NPAF L+KLKHMVP+ +    EM+ +WE+IVS  E  E+DVWP
Sbjct  136   GILSYEGDKWAKHRRIINPAFHLDKLKHMVPSFHLTTCEMLSKWEKIVS-TEGSEVDVWP  194

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
              L+T+  + IS TAFG SYE GR++ ELQ ELA+   +   + YI   RFLPTK+ RRMN
Sbjct  195   YLQTLTSDAISRTAFGSSYEEGRQIHELQQELAKIILKETEASYI---RFLPTKEKRRMN  251

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEEA-SNNLLDMLLESNFKEMKHHGNQEFGMSIEDII  1076
              I +E+ +++ RII KR+  ++ G+ + S++LL +LLESN KE++ HGN++FGMSI+++I
Sbjct  252   RIHQEVRSLVLRIINKRMNKIEAGDTSNSDDLLGILLESNMKEIQEHGNKKFGMSIDEVI  311

Query  1077  SECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVT  1256
              ECKLFYLAGQETTS LLVW+MILLS++ +WQ  AREEV  VFG++ PD+D LN+LK+VT
Sbjct  312   EECKLFYLAGQETTSALLVWSMILLSKHSDWQARAREEVSQVFGNNVPDYDKLNQLKVVT  371

Query  1257  MILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNP  1436
             MI+ E LRLYPP   + R V ++ KLGNLS+P+GV+LL+P I LHHD E+WGED  EFNP
Sbjct  372   MIIQEVLRLYPPNFLMGREVHKETKLGNLSIPSGVQLLLPTILLHHDQEIWGEDVEEFNP  431

Query  1437  ERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAP  1616
             ERF EGV++AT GK  Y PFS GPR CIG NFAM+EAK AL+ IL++F+F++SPSYAH P
Sbjct  432   ERFSEGVNRATKGKFAYFPFSWGPRNCIGQNFAMLEAKMALAMILQQFAFEVSPSYAHVP  491

Query  1617  YTGLTTNPLYGAPLILQKL  1673
             Y+  T  P YGA LIL KL
Sbjct  492   YSVFTLLPQYGAQLILHKL  510



>ref|XP_004295683.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/500 (54%), Positives = 361/500 (72%), Gaps = 4/500 (1%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV-LSDEVV  359
             AW +++W W +PK LE+ LR Q  +GN YRLFYGD KE A M+ E KSKPMN+  S ++ 
Sbjct  23    AWSLLDWVWFKPKKLERCLRQQGFQGNAYRLFYGDMKENAIMVKEAKSKPMNLSTSHDIS  82

Query  360   PRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQ  539
             PRVIP   ++++ +GKNSFVW+G +P V I +P+ +K+V +K + F + +++P++  LS 
Sbjct  83    PRVIPLLDQTVKTYGKNSFVWVGPLPRVNIMNPEDLKDVFAKPSDFPKPVSNPLIKLLST  142

Query  540   GLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSR-NESGELDVW  716
             GL  YEG+KW+KHR+I NP F  EK+K M+PA Y+ C++M+  WE +VS+   S E+DVW
Sbjct  143   GLANYEGEKWAKHRRIINPTFHSEKVKRMLPAFYQSCNDMIKEWETVVSKEGSSCEIDVW  202

Query  717   PELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRM  896
             P L+ +  +VIS TAFG SY+ G+++FEL  E A +A +    VYIPG RF+PTK N+RM
Sbjct  203   PSLQNLTADVISRTAFGSSYQEGQKIFELLKEQAVYAMKTVQRVYIPGWRFVPTKMNKRM  262

Query  897   NGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG--NQEFGMSIED  1070
               I +EI  +++ II KR  A+K GE   ++LL  LLESN K+++ HG  N+  GMSIED
Sbjct  263   KQIHEEIRGLVEGIINKREQAIKAGEATKDDLLGALLESNMKDIQDHGKNNKNVGMSIED  322

Query  1071  IISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKI  1250
             +I ECKLFY AGQETTS LLVWTM+LL +NQ WQ+ AREEV+ VFG +KPDFDGL  LK 
Sbjct  323   VIEECKLFYFAGQETTSVLLVWTMVLLCQNQNWQDQAREEVLQVFGMNKPDFDGLTHLKA  382

Query  1251  VTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEF  1430
             VTM+L E LRLYP +  + R  ++  + G  SLPAGV++ +P + +HHD E+WG+DA EF
Sbjct  383   VTMVLLEVLRLYPALVVVSRTTRKKTQFGKFSLPAGVQVGLPALLIHHDKELWGDDAKEF  442

Query  1431  NPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAH  1610
              PERF EGVSKAT G+  + PF  GPRICIG NFAM EAK AL+ IL+ F+F+LSPSYAH
Sbjct  443   KPERFSEGVSKATKGQLSFFPFGAGPRICIGQNFAMTEAKLALALILQHFTFELSPSYAH  502

Query  1611  APYTGLTTNPLYGAPLILQK  1670
             AP   +T  P YGAP++L K
Sbjct  503   APSALITLQPQYGAPVMLHK  522



>ref|XP_004242635.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/508 (54%), Positives = 375/508 (74%), Gaps = 3/508 (1%)
 Frame = +3

Query  153   FSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             F   I+FL   W+ ++W WI PK LEK L+ + LKG+ Y+   GD KEI  M+ E KSKP
Sbjct  12    FVIVIIFLRWIWKFLDWVWIHPKKLEKRLKLEGLKGSSYKFLLGDMKEINSMVEEAKSKP  71

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             +N  +++ + RV P+F + + ++GKN + WLG  P ++I++P+ V+E+LSK   +Q+   
Sbjct  72    IN-FTNDYISRVFPHFNKLMMQYGKNCYTWLGPKPTMLISEPEFVREILSKSYIYQKIQG  130

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
             +P+   L+QGL  YE DKW+KHR+I NPAF L+KLKHM+P+ Y  C +M+ + + IVS +
Sbjct  131   NPITKLLAQGLASYETDKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMINKLDNIVS-S  189

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
             +  E+DVWP L+T+  + IS TAFG +YE GR++FELQ E A+   +    +YIPG RF+
Sbjct  190   KGSEIDVWPFLQTLTSDAISRTAFGSNYEEGRQIFELQKEQADLIIQAARWIYIPGWRFV  249

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMK-HHGNQE  1049
             PTK+N+R+  I  E+ +++  II  RI  MKEGE   ++LL +LLESNFKE++ HH N+ 
Sbjct  250   PTKRNKRIKQIANEVRSLVLGIINNRIKEMKEGEATKDDLLGILLESNFKEIQIHHENKN  309

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
             FGM+I+++I ECKLFY AGQETTS LLVWT+ILLS++ +WQE AR+EV  VFG +KP++D
Sbjct  310   FGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHLDWQEKARQEVHQVFGSNKPNYD  369

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
              LN+LK+VTMI NE LRLYPP   + R V+++ KLG+LSLPAG+ LL+P I+L HD E+W
Sbjct  370   MLNQLKVVTMIFNEVLRLYPPGTMIGRRVQKETKLGHLSLPAGMLLLLPTIYLQHDNEIW  429

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             G+DA EFNP RF EGV+KAT GK  Y PFS GPRICIG NFAM+EAK AL+ IL+ ++ +
Sbjct  430   GDDAKEFNPMRFSEGVNKATKGKFAYFPFSWGPRICIGQNFAMLEAKMALAMILQHYALE  489

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LSPSY+HAP+T +T  P +GAPLIL+KL
Sbjct  490   LSPSYSHAPHTIITLQPQHGAPLILRKL  517



>gb|KEH38469.1| cytochrome P450 family 709 protein [Medicago truncatula]
Length=516

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/502 (55%), Positives = 371/502 (74%), Gaps = 5/502 (1%)
 Frame = +3

Query  174   LVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDE  353
             L+ AW+V++  W+RPK LEK LR Q  +GN YR+  GD K++ KM  E KSK MN LSD+
Sbjct  16    LIWAWKVLSLLWLRPKKLEKLLREQGFQGNSYRILLGDIKDLFKMEKEAKSKSMN-LSDD  74

Query  354   VVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKL  533
             + PRVIPY   S++ HGKNS++W G  P V +T+P+ +K+VL+K + F +   +  ++KL
Sbjct  75    ITPRVIPYIQHSVKIHGKNSYIWFGIKPRVTLTEPEQIKDVLNKMSEFPK--PNYKIFKL  132

Query  534   -SQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELD  710
              +  L  YEG+KWSKHRK+ NPAF LEKLK M PA +  C++++ +WE+++S + S E+D
Sbjct  133   LANALANYEGEKWSKHRKLINPAFHLEKLKIMTPAFFTSCNDLINKWEKMLSSDGSCEID  192

Query  711   VWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNR  890
             +WP L+ +A + IS TAFG SYE G+R+F+LQ E AE   ++     IP   FLPT  +R
Sbjct  193   IWPSLQNLASDAISRTAFGSSYEEGKRIFQLQREQAELIVKVVTKSIIPLWMFLPTIVHR  252

Query  891   RMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEM-KHHGNQEFGMSIE  1067
             +MN IDKEI + LK +I KR  A+K GE   N+LL +LLESN KE+ ++  N++ GMS++
Sbjct  253   KMNKIDKEITSSLKDMINKREKALKAGEPTRNDLLSILLESNRKEIDENENNKDVGMSLD  312

Query  1068  DIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLK  1247
             D++ ECKLF+ AGQETTS LLVWTMILLSR  +WQ  AREEV+HVFG+ KPDFDGLN LK
Sbjct  313   DVVEECKLFHFAGQETTSVLLVWTMILLSRYPDWQTRAREEVLHVFGNRKPDFDGLNNLK  372

Query  1248  IVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANE  1427
             IVTMIL E LRLYPPV  L R V++D KLGNL+LPAGV + +PI+ +HHD E+WG+DA  
Sbjct  373   IVTMILYEVLRLYPPVIGLARNVEKDVKLGNLTLPAGVEIFLPILLIHHDCELWGDDAKM  432

Query  1428  FNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYA  1607
             FNPERF  G+SKATNG+  + PF  GPRICIG NF+++EAK A++ IL+ FSF+LSP+YA
Sbjct  433   FNPERFFGGISKATNGRVSFFPFGWGPRICIGQNFSLMEAKMAMTLILQHFSFELSPTYA  492

Query  1608  HAPYTGLTTNPLYGAPLILQKL  1673
             HAP + +T  P YGA +I++KL
Sbjct  493   HAPSSMITLQPQYGAHIIIRKL  514



>ref|XP_008226210.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/505 (56%), Positives = 368/505 (73%), Gaps = 2/505 (0%)
 Frame = +3

Query  159   FSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMN  338
             ++ + +  AWRV+NW W+RPK LE+ LR Q L GN YRL  GDTKE + M+ ETKSKPM+
Sbjct  15    WASVIITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMVKETKSKPMD  74

Query  339   VLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADP  518
             +  D + PRV+P+  +S+  +GKN F+W+G  P V I++PD +K++ +K+  FQ+   +P
Sbjct  75    LCHD-LAPRVLPFVHQSMNTYGKNFFIWIGPTPRVNISNPDDMKDIFAKYEDFQKPATNP  133

Query  519   VVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNES  698
             +V  L+ GL  YEG+KW+KHRKI NPAF  EKLK M+PA ++ CSEM+ +WE + S+  S
Sbjct  134   LVNLLATGLSSYEGEKWAKHRKIINPAFHSEKLKRMLPAFHQSCSEMIEKWESLASKEGS  193

Query  699   GELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPT  878
              ELDVWP L+ +  +VIS TAFG SYE GR++F+L  +  +   +   SVYIPG  FLPT
Sbjct  194   CELDVWPYLQNLTADVISRTAFGSSYEEGRKIFQLLKDQGQLTMKTIQSVYIPGWWFLPT  253

Query  879   KKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFG  1055
             + N+RM  IDKEI   L  II KR  A++ GE   ++LL +L+ SN KE++ +GN + FG
Sbjct  254   RMNKRMKEIDKEIKGSLMGIINKREEAIRVGEATKDDLLGILMASNLKEIRENGNTKNFG  313

Query  1056  MSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGL  1235
             MSIED+I ECKLFY AGQETTS LLVWT++LLS+NQ+WQ  AR+EV+ VFG +KPDFDGL
Sbjct  314   MSIEDVIEECKLFYFAGQETTSVLLVWTLVLLSQNQDWQARARDEVLQVFGSNKPDFDGL  373

Query  1236  NRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGE  1415
             + +K+VTMIL E LRLYP V  L R + ++ +LG LSLPAGV + +  + +HHD E+WGE
Sbjct  374   SHVKVVTMILLEVLRLYPAVVVLSRAIHKNTQLGKLSLPAGVEVSLNTLLVHHDKELWGE  433

Query  1416  DANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLS  1595
             DANEF PERF EGVSKAT  K  Y PF GGPRICIG NFAMVEAK AL+ IL+ F+F+LS
Sbjct  434   DANEFKPERFSEGVSKATKNKFAYFPFGGGPRICIGQNFAMVEAKLALALILQHFAFELS  493

Query  1596  PSYAHAPYTGLTTNPLYGAPLILQK  1670
             PSYAHAP   +T  P +GA +IL K
Sbjct  494   PSYAHAPSAEITLQPQFGAHIILHK  518



>ref|XP_003634773.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
 emb|CBI22132.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/513 (54%), Positives = 371/513 (72%), Gaps = 3/513 (1%)
 Frame = +3

Query  141   NLFLFSFS-IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNE  317
             NL   SF+ I  L+ AWR++NW W+RPK LE+ L+ Q L GN YRL +GD KE+  M+ E
Sbjct  7     NLVALSFTFITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIKE  66

Query  318   TKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTF  497
               S+P+++ SD++V R+ P+ + SI+K+GK+SF+W+G  P V I +P+ +++VLS H  F
Sbjct  67    ATSRPISI-SDDIVQRIAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVF  125

Query  498   QQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEE  677
             ++     +V  L  GLL  +G+KW+KHRKI NPAF+LEK+K+M+PA +  CS+M+ +WE 
Sbjct  126   RKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAFRLEKVKNMLPAFHLSCSDMISKWEG  185

Query  678   IVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIP  857
              +S   S ELDVWP L+ +  + IS TAFG +YE GR +FELQ E A+   +   S +IP
Sbjct  186   KLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIP  245

Query  858   GGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHH  1037
             G RFLPTK N+RM    KE+N +L  II+KR  AMK GE  +++LL +LLESNFKE++ H
Sbjct  246   GWRFLPTKSNKRMKQNRKEVNELLWGIIDKREKAMKAGETLNDDLLGILLESNFKEIQEH  305

Query  1038  GN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDD  1214
             GN +  GMSI+D+I ECK+FY AGQETTS LL+WTMILLS++  WQ  AREEV+HVFG++
Sbjct  306   GNDKNVGMSIKDVIDECKIFYFAGQETTSVLLLWTMILLSKHPNWQARAREEVLHVFGNN  365

Query  1215  KPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHH  1394
             KP+ DGLN LKIV MIL+E LRLYPPVP L R V ED ++G++ LPAGV + +P I +HH
Sbjct  366   KPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHH  425

Query  1395  DPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILR  1574
             D E+WGEDA EFNPERF +G  KAT     + PF  G R+CIG NFA++EAK  L+ IL+
Sbjct  426   DHEIWGEDAREFNPERFSQGALKATKSLVSFFPFGWGSRLCIGQNFAILEAKMVLAMILQ  485

Query  1575  RFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             RFSF LSPSY+HAP + +T  P YGA LIL  +
Sbjct  486   RFSFSLSPSYSHAPCSLVTLKPQYGAHLILHGI  518



>gb|EYU30744.1| hypothetical protein MIMGU_mgv1a004594mg [Erythranthe guttata]
Length=519

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/504 (53%), Positives = 372/504 (74%), Gaps = 6/504 (1%)
 Frame = +3

Query  174   LVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDE  353
             +V AW+V+NW W RP+ LEKWLR    +GN YR+ +GD+KE++ M+ E KSKP++  S++
Sbjct  17    IVYAWKVLNWVWFRPRNLEKWLRQLGFEGNSYRVLFGDSKEMSNMIKEAKSKPISAFSND  76

Query  354   VVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKL  533
             +V RVIP    ++  +G+   +W G  P V++TD + ++E+LSK   FQ+N ++P+  +L
Sbjct  77    IVARVIPAIHHAVSMYGEKCILWFGPKPAVLVTDTELIREILSKSYVFQKN-SNPLGRQL  135

Query  534   SQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDV  713
             ++G+  YE DKW+KHR++ NPAFQ +K+K M+P+ Y  C +M+ +WEE +++  S E+DV
Sbjct  136   ARGVATYETDKWAKHRRLINPAFQPDKIKQMLPSFYLSCCDMLSKWEEKLAKEGSSEVDV  195

Query  714   WPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSV--YIPGGRFLPTKKN  887
             WP L+T+  + IS TAFG SYE GR++FELQ E AE   +   S+   IPG RFLPTK N
Sbjct  196   WPYLQTLTSDAISRTAFGSSYEEGRKIFELQKEQAELIMQAVQSINFQIPGWRFLPTKMN  255

Query  888   RRMNGIDKEINTVLKRIIEKRIGAM--KEGEEASNNLLDMLLESNFKEMKHHGNQEFGMS  1061
              RM  I KE+ + ++ II+KR+  M  +EG  +S++LL +LL+SNF+E+K +GN+ FGMS
Sbjct  256   IRMKQIVKEVESSIRGIIDKRMKEMEAREGSYSSDDLLGILLDSNFREIKQNGNK-FGMS  314

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             ++++I ECKLFY AGQETTS LLVWTMILLS++ +WQ  ARE+V+  FG  KPDF  LN 
Sbjct  315   LDEVIEECKLFYFAGQETTSSLLVWTMILLSKHSDWQSRAREDVLQTFGTRKPDFQELNH  374

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LKIVTMIL+E LRLYP    L R  +++  LG  +LPAGV+L++P++ LHHD +MWG+DA
Sbjct  375   LKIVTMILHEVLRLYPAGVNLGRTTRKETPLGKSTLPAGVQLILPVLLLHHDSKMWGDDA  434

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
              EF+P RF EGVSKATNGK  Y PF  GPRIC+G +FA++EAK AL+ IL+R+SF+LSPS
Sbjct  435   KEFDPNRFSEGVSKATNGKLSYFPFGWGPRICLGQSFAILEAKMALAMILQRYSFQLSPS  494

Query  1602  YAHAPYTGLTTNPLYGAPLILQKL  1673
             Y+HAPYT +T  P +GA LIL KL
Sbjct  495   YSHAPYTVITLQPQHGAHLILTKL  518



>ref|XP_006477948.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/508 (55%), Positives = 366/508 (72%), Gaps = 2/508 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             +  L  AWRV+NW W+RP+ LEK+LR Q LKGN YRL +GD KE +  + E K++P++ L
Sbjct  15    VTVLTWAWRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLS-L  73

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
              D++  RV P+  + +  +GKNSF+W G  P V I +PD +K + +K N FQ+  + P+ 
Sbjct  74    DDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTKINDFQKVNSIPLA  133

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L  GL   EG+KW+KHRK+ NPAF  EKLK M+PA Y  C E++ +WE+ +S   S E
Sbjct  134   RLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSCIEIITKWEKQMSVEGSSE  193

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             LDVWP L  +  +VIS TAFG SYE GRR+F+LQ ELAE   ++  SV+IPG RFLPTK+
Sbjct  194   LDVWPYLANLTSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRSVHIPGWRFLPTKR  253

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMS  1061
             NRRM  IDKEI   L  II+ R  AM+ GE A+++LL +L+E++F+E++ HGN +  G S
Sbjct  254   NRRMKEIDKEIRASLMGIIKNREKAMRAGEAANDDLLGILMETSFREIEEHGNNKNVGFS  313

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             + D+I ECKLFY AGQETTS LL WTM+LLS++Q+WQE AR+EV+ VFG++KPD+DGLN 
Sbjct  314   MNDVIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPDYDGLNH  373

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LKIV MIL E LRLYPPV  L R V ++ KLGNL+LPAGV++ +P+I +H DPE+WG+DA
Sbjct  374   LKIVQMILYEVLRLYPPVTVLSRAVFKETKLGNLTLPAGVQIGLPMILVHQDPELWGDDA  433

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
              EF PERF EG+SKA   +  Y PF+ GPRIC+G NFA+VEAK A + IL+ +SF+LSPS
Sbjct  434   VEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMATAMILQNYSFELSPS  493

Query  1602  YAHAPYTGLTTNPLYGAPLILQKL*FQN  1685
             Y HAP    T +P  G  LIL+KL  +N
Sbjct  494   YVHAPTAVPTLHPELGTQLILRKLWCKN  521



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/504 (53%), Positives = 367/504 (73%), Gaps = 3/504 (1%)
 Frame = +3

Query  168   MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLS  347
             + ++C W+++NWAW+ PK LEK LR Q   GN YRL +G+ KE+  M  + +S+PM+ L+
Sbjct  19    VLILCGWKILNWAWLTPKKLEKCLRQQGFNGNSYRLLFGEIKEMFTMTRQARSRPMS-LT  77

Query  348   DEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVY  527
             D++ P VIPY+ +++  +GKNS  W G  P V I DP+ ++E+ +K N FQ+   +P++ 
Sbjct  78    DDIAPYVIPYYHQTVTNYGKNSIRWFGPSPRVTIMDPELIREIFNKFNEFQKPRINPLIT  137

Query  528   KLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGEL  707
              L  G+L  EG++W+KHRKI  P+F L+KLK+M+PA Y+ C+EM+ +WEE VS N S E+
Sbjct  138   LLFSGILTLEGERWAKHRKIITPSFHLDKLKNMLPAFYECCTEMIEKWEEAVSVNGSSEV  197

Query  708   DVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKN  887
             DVWP L  +  +VIS  AFG SYE GRR+F L  E     +E   S+Y+PG RFLPTK N
Sbjct  198   DVWPCLVNLTRDVISRAAFGSSYEEGRRIFLLLDEQTNLLTETVQSLYVPGWRFLPTKTN  257

Query  888   RRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-FGMSI  1064
             +++  +DKEI   L+ +++ R  A+K GE  +++LL +L+ESNFKE++ HG+++  GMSI
Sbjct  258   KKLKLMDKEIKDSLRELVKNREKAVKAGEVKNDDLLGILVESNFKEIEEHGDRKNMGMSI  317

Query  1065  EDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRL  1244
             +D++ ECKLFY+AGQETTS LLVWTM+LL+RN +WQ  AREEV  VF D KPD DGL+ L
Sbjct  318   QDVVDECKLFYIAGQETTSVLLVWTMVLLARNPDWQTKAREEVFQVFSDGKPDPDGLSHL  377

Query  1245  KIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDAN  1424
             K++TMILNE LRLYPPV  L R + +D KLG L LPAG  + +P++ +HHD E+WG+DA+
Sbjct  378   KVMTMILNEVLRLYPPVVMLGRSMAKDMKLGKLLLPAGAVISIPVLLIHHDQEIWGDDAH  437

Query  1425  EFNPERFREGVSKAT-NGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
             EF PERF EGVSKAT + +  + PF GGPRICIG NFA++EAK  L+ IL+RF F+LSPS
Sbjct  438   EFRPERFAEGVSKATKSNQLAFFPFGGGPRICIGQNFALMEAKMVLAMILKRFRFELSPS  497

Query  1602  YAHAPYTGLTTNPLYGAPLILQKL  1673
             YAH+P T +T  P +GA LIL KL
Sbjct  498   YAHSPITVITLRPQHGAHLILHKL  521



>ref|XP_006495013.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=536

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/498 (54%), Positives = 363/498 (73%), Gaps = 2/498 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AW+++NWAW++PK +EK LR Q  KGN YR  +GD +E A +  + KSKP++   D++ P
Sbjct  40    AWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSKQAKSKPIS-FEDDIAP  98

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RV+P + + ++ +GK  + W+G IPM+ I DPD +KEV +K N FQ+  ++P+   L+ G
Sbjct  99    RVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTG  158

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  +EG+KW+KHRKI NPAF  EKLK M+PA  + CSE++ +WE ++S   S ELDVWP 
Sbjct  159   LASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSCELDVWPY  218

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             +  +  +VIS TAFG +YE G R+F+LQ ELA+ A +   SVYIPG R++PTK+NRRM  
Sbjct  219   IVNLTSDVISRTAFGSNYEEGIRIFQLQTELADLALQALQSVYIPGWRYVPTKRNRRMKE  278

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEF-GMSIEDIIS  1079
             +DKEI   L  II KR  AMK GE A ++LL +L+ESN KE+K HGN +  G+S +D+I 
Sbjct  279   LDKEIRVRLADIIRKREIAMKTGEAAKDDLLGLLMESNLKEIKEHGNNKLKGISRDDVID  338

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AGQETTS LL+WTM+LLS++Q+WQ  AREEV+ VFGD KPDFDGLNRLKIV M
Sbjct  339   ECKLFYFAGQETTSVLLLWTMVLLSKHQDWQAHAREEVLQVFGDKKPDFDGLNRLKIVQM  398

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             I  E LRLYPP+P L R V+++ K+G+L LPA   + +  + +HHD ++WG+DA EF PE
Sbjct  399   IFYEVLRLYPPLPVLSRYVEKETKIGDLILPAESVIALQTLLVHHDKKLWGDDAKEFKPE  458

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EG+SKAT  +  Y PF+ GPRICIG NFA+VEAK A++ IL+ FSF+LS SY HAP+
Sbjct  459   RFSEGISKATKNQVSYFPFAWGPRICIGQNFALVEAKMAMAMILQNFSFELSASYVHAPH  518

Query  1620  TGLTTNPLYGAPLILQKL  1673
               +   P +GA LIL+KL
Sbjct  519   AFIFLQPQHGAHLILRKL  536



>gb|EYU31630.1| hypothetical protein MIMGU_mgv1a004628mg [Erythranthe guttata]
Length=517

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/517 (53%), Positives = 366/517 (71%), Gaps = 4/517 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME+  +      +++ ++ AW+++N+ W RPK +EK LR Q   G PYR   GD  E+  
Sbjct  1     MELIHSFLSLCCTVVVVIYAWKIMNFVWFRPKKMEKILRQQGFVGKPYRFLVGDLNEMKN  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M NE  SKP++  SD+ VPR+IP+  +++  HG+N F+WLG  P V+I DPD V+EVLSK
Sbjct  61    MGNEALSKPID-FSDDFVPRIIPFIHKTVTNHGENCFIWLGPYPAVLIFDPDIVREVLSK  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
                FQ+   +P+   L++GL  YE DKW+KHR++ NPAF L+K+KHM+P+ +K C+EM+ 
Sbjct  120   TYVFQKPY-NPLANVLARGLASYETDKWAKHRRLINPAFHLDKVKHMIPSFHKCCAEMLS  178

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR-H  842
             +WE+IV      ELDVWP L+T+  + ISLTAFG SYE GR++FELQ E A   ++    
Sbjct  179   KWEKIVPSEGCFELDVWPYLQTMTSDAISLTAFGTSYEQGRKIFELQKEQATLITKSNLF  238

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFK  1022
             S +I   R+LPTK NRRM  I  E+ ++L+ II++R  A++ GE  SN+LLD+LLESN K
Sbjct  239   STFILAWRYLPTKTNRRMKRIITELESLLRAIIDQRTKAIEAGEATSNDLLDILLESNSK  298

Query  1023  EMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             E+K +G++ FGMS++D+I ECKLFYLAGQETTS LLVWTMILLS+  +WQ  AREEV+HV
Sbjct  299   EIKQNGHK-FGMSLQDVIEECKLFYLAGQETTSSLLVWTMILLSKYLDWQARAREEVLHV  357

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             F  + P+F  L RLKIV+MI+NE LRLY P     R V ++  LGN+ LP G  LL+P I
Sbjct  358   FRSETPNFQDLGRLKIVSMIINEVLRLYSPGLLFSRTVNKETALGNIVLPKGAYLLLPAI  417

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              LHHD ++WGED  +FNPERF  GV++AT GK  Y PF  GPRICI  NFAM+EAKTAL+
Sbjct  418   LLHHDVKLWGEDVKDFNPERFSGGVTEATGGKLSYFPFGWGPRICIAQNFAMLEAKTALA  477

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              ILR +SF+LSPSY+HAP   L   P +GA LIL+KL
Sbjct  478   MILRNYSFELSPSYSHAPRIALNLQPQHGAHLILRKL  514



>ref|XP_007213922.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
 gb|EMJ15121.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
Length=519

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/497 (56%), Positives = 364/497 (73%), Gaps = 2/497 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWRV+NW W+RPK LE+ LR Q L GN YRL  GDTKE + M+ E KSKPM++  D + P
Sbjct  23    AWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMLKEAKSKPMDLFHD-LAP  81

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RV+P+  +S+  +GKNSF+W+G  P V I++P+ +K++ +K+  FQ+ + +P+V  L+ G
Sbjct  82    RVLPFVHQSMNTYGKNSFIWIGPTPRVNISNPEDMKDIFAKYEDFQKPVKNPLVKLLATG  141

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  YEG+KW+KHRKI NPAF  EKLK M+PA ++ CSE++  WE + S+  S ELDVWP 
Sbjct  142   LANYEGEKWAKHRKIINPAFHSEKLKRMLPAFHQSCSELIEEWESLASKEGSCELDVWPY  201

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +  +VIS TAFG SYE GR++F+L  + A+   +   SVYIPG RFLPT+ N+RM  
Sbjct  202   LQNLTADVISRTAFGSSYEEGRKIFQLLKDQAQLTIKAIQSVYIPGWRFLPTRMNKRMKE  261

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIEDIIS  1079
             IDKEI   L  II KR  A++  E   ++LL +L++SN KE++ +GN +  GMSIED+I 
Sbjct  262   IDKEIKGSLMGIINKREEAIRVREATRDDLLGILMDSNLKEIRENGNTKNVGMSIEDVIE  321

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AGQETTS LLVWT++LLS+NQ+WQ  AR+EV+ VFG +KPDFDGL+ LK+VTM
Sbjct  322   ECKLFYFAGQETTSVLLVWTLVLLSQNQDWQARARDEVLQVFGSNKPDFDGLSHLKVVTM  381

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             IL E LRLYP V  L R + ++ +LG LSLPAGV + +  + +HHD E+WGEDANEF PE
Sbjct  382   ILLEVLRLYPAVVVLSRAIHKNTQLGKLSLPAGVEVSLNTLLVHHDKELWGEDANEFKPE  441

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF  GVSKAT  K  Y PF GGPRICIG NFAMVEAK AL+ IL+ F+F+LSPSYAHAP 
Sbjct  442   RFSSGVSKATKNKFAYFPFGGGPRICIGQNFAMVEAKLALALILQHFAFELSPSYAHAPS  501

Query  1620  TGLTTNPLYGAPLILQK  1670
               +T  P +GA +IL K
Sbjct  502   ADITLQPQFGAHIILHK  518



>ref|XP_006364092.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=521

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/512 (54%), Positives = 371/512 (72%), Gaps = 4/512 (1%)
 Frame = +3

Query  141   NLFLFSFSIMFLV-CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNE  317
             NL LFS +I+ ++  AWR++NW W +PK LEK LR Q  KGN Y+  +GD KE+ KM  E
Sbjct  11    NLVLFSCAIILVLRWAWRILNWVWFKPKKLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKE  70

Query  318   TKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTF  497
               SKP++   D + PRV+P+F ++I  +GKN F W G  P V+I DP+ ++EVL+K+  +
Sbjct  71    ALSKPIDFSHDMIWPRVMPFFHKTINNYGKNCFAWYGPRPAVVIVDPELIREVLTKNYIY  130

Query  498   QQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEE  677
             Q+   +P+    + GL  YE DKW+KHR+I NPAF L+KLKHM+PA     SE++ +W+E
Sbjct  131   QKPPGNPLTRLAANGLAGYEADKWAKHRRIVNPAFHLDKLKHMLPAFQLTSSELLKKWKE  190

Query  678   IVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIP  857
             I+S+ E  E+DVWP L+T+  + IS TAFG SYE G+++FELQ E      ++  S+YIP
Sbjct  191   IISK-EGSEIDVWPYLQTLTSDAISRTAFGSSYEEGKKIFELQKEQMGLLLQVARSLYIP  249

Query  858   GGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHH  1037
             G RF+PTK NRRM  I  E+  ++  II+KRI  +++GE   ++LL +LL SN +E++ H
Sbjct  250   GWRFVPTKTNRRMKQIFNEVGALILGIIKKRIKMIEDGE-IHDDLLSILLTSNLQEIQQH  308

Query  1038  GNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDK  1217
             G+++FGMSI+++I ECKLFYLAGQETTS LLVWTMILLS+   WQE AREEV+ VF  D+
Sbjct  309   GHKKFGMSIDEVIEECKLFYLAGQETTSALLVWTMILLSKYPIWQERAREEVLQVFESDE  368

Query  1218  PDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHD  1397
              D+D LN LK VTMILNE LRLYP    + R+V +D KLGN+ LP+GV+LL+  I LHHD
Sbjct  369   FDYDKLNHLKSVTMILNEVLRLYPSGYFINRVVTKDTKLGNVCLPSGVQLLLGTILLHHD  428

Query  1398  PEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRR  1577
              E+WG+DA EFNPERF +GV+KAT G+  + PFS GPRICIG NFAM+EAK A++ IL+ 
Sbjct  429   TEIWGDDAMEFNPERFSDGVAKATKGQLVFFPFSWGPRICIGQNFAMLEAKMAIAMILKH  488

Query  1578  FSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +SF+LSPSYAHAP+  L   P YGA LIL KL
Sbjct  489   YSFELSPSYAHAPHP-LLLQPQYGAHLILYKL  519



>ref|XP_004168302.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=523

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/494 (55%), Positives = 348/494 (70%), Gaps = 2/494 (0%)
 Frame = +3

Query  195   VNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPRVIP  374
              +W W  P+ LE+ LR Q   GN Y++ +GD KE A M  E  SKPM   S+ + PRVIP
Sbjct  31    ADWIWFGPRRLEQLLRRQGFTGNSYKILHGDMKESAAMRKEALSKPMK-FSNHIAPRVIP  89

Query  375   YFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGLLKY  554
               + +IQ++GKNS +WLG +P V I DP+ +K V S  N FQ+   DP +  L  GL+  
Sbjct  90    SVYHTIQRYGKNSMMWLGPLPRVHIMDPEQLKTVFSFFNDFQRPTTDPFIRLLIHGLVSL  149

Query  555   EGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPELKTI  734
             EG+KW KHRKI NPAF LEKLK MVPA Y  C+EMV +WE +VSR  S ELDV P L+ +
Sbjct  150   EGEKWVKHRKIINPAFHLEKLKAMVPAFYHSCNEMVSKWESMVSREGSCELDVMPYLQNM  209

Query  735   AVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNGIDKE  914
             A +VIS TAFG SYE G+++F+LQ EL     +     YIPG RFLPTK NR++   ++E
Sbjct  210   AADVISRTAFGSSYERGKKIFKLQTELTNLVIQASLETYIPGWRFLPTKSNRKIKETNRE  269

Query  915   INTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIEDIISECKL  1091
             I T++  II ++  +MK GEE   +LL +L+ESN  E+KH  N ++ GMSI+ +I EC+L
Sbjct  270   ITTLVLGIINEKEKSMKAGEEIQTDLLSILMESNMNEIKHGRNSKDVGMSIQAVIEECRL  329

Query  1092  FYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMILNE  1271
             FY+AGQETT+ LL+WTM+LLS   +WQE AR EV  +FG+ KPD+DGLNRLK+VTMI NE
Sbjct  330   FYIAGQETTATLLIWTMVLLSSYSDWQERARAEVFEIFGNKKPDYDGLNRLKVVTMIFNE  389

Query  1272  SLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPERFRE  1451
              LRLYPPV  L R  +++ KLGN++LP G+ L +PII +  DPE+WGEDA+EFNPERF E
Sbjct  390   VLRLYPPVSMLGRTTRKETKLGNMTLPGGIMLSLPIILIQRDPELWGEDAHEFNPERFSE  449

Query  1452  GVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYTGLT  1631
             GV KAT     ++PF  GPRICIG NFAM+EAK ALS IL+ FSF+LSPSY H P+  LT
Sbjct  450   GVFKATKNPGAFMPFGWGPRICIGQNFAMIEAKMALSMILQHFSFELSPSYTHTPFAALT  509

Query  1632  TNPLYGAPLILQKL  1673
             T P +GA +IL KL
Sbjct  510   TQPQHGAHIILHKL  523



>gb|ABC69389.1| CYP72A52v1 [Nicotiana tabacum]
Length=518

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/512 (54%), Positives = 372/512 (73%), Gaps = 5/512 (1%)
 Frame = +3

Query  144   LFLFSFSIMFLV-CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNET  320
             L +FSF+I+F++  AW+++N+ W++PK LEK +R Q  KGN Y+  +GD KEI KM  E 
Sbjct  10    LTIFSFAIIFVLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMKEIKKMGEEA  69

Query  321   KSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQ  500
              SKP+N   D + PRV+P+  ++I  +GKN FVW G  P V+ITDP+ VKEVL+K+  +Q
Sbjct  70    MSKPINFSHDMIWPRVMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKEVLTKNFVYQ  129

Query  501   QNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEI  680
             +    P+    + G+  YE DKW+ HR++ NPAF L+KLKHM+PA      EM+ + E++
Sbjct  130   KPPGTPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTACEMLSKLEKV  189

Query  681   VSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPG  860
             VS N + E+DVWP L+T+  + IS TAFG SYE GR+LFELQ E      E+  ++YIPG
Sbjct  190   VSPNGT-EIDVWPYLQTLTSDAISRTAFGSSYEEGRKLFELQKEQLSLILEVSRTIYIPG  248

Query  861   GRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG  1040
              RFLPTK+N+RM  I  E+  ++  II+KR+  ++ GE A ++LL +LL SN KE++ HG
Sbjct  249   WRFLPTKRNKRMKQIFNEVRALVLGIIKKRLSMIENGE-APDDLLGILLASNLKEIQQHG  307

Query  1041  N-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDK  1217
             N ++FGMSI+++I ECKLFY AGQETTS LLVWTMILL ++  WQ+ AREEV+ VFG  +
Sbjct  308   NNKKFGMSIDEVIEECKLFYFAGQETTSSLLVWTMILLCKHPSWQDKAREEVLQVFGSRE  367

Query  1218  PDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHD  1397
              D+D LN+LKIVTMILNE LRLYP    + R+V ++ KLGNL LPAGV+LL+P I L HD
Sbjct  368   VDYDKLNQLKIVTMILNEVLRLYPAGYAINRMVTKETKLGNLCLPAGVQLLLPTILLQHD  427

Query  1398  PEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRR  1577
              E+WG+DA EFNPERF +G+SKAT GK  + PFS GPRICIG NFAM+EAK A++ IL+ 
Sbjct  428   TEIWGDDAMEFNPERFSDGISKATKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKN  487

Query  1578  FSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             ++F+LSPSYAHAP+  L   P YGA LIL KL
Sbjct  488   YAFELSPSYAHAPHP-LLLQPQYGAQLILYKL  518



>ref|XP_004295684.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/508 (53%), Positives = 366/508 (72%), Gaps = 4/508 (1%)
 Frame = +3

Query  159   FSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMN  338
             F  + +  AW V++W W++PK LE+ LR Q  KGN YR+ YGDTK+ + M  E KSKPMN
Sbjct  15    FVSIVVRLAWSVLDWVWLKPKKLERCLREQGFKGNSYRILYGDTKDESIMRAEAKSKPMN  74

Query  339   V-LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLAD  515
             +  S ++ P++  +  ++++ +GKNSFVW+G IP V + +P+ +KEV ++H  F++ + +
Sbjct  75    ISTSHDIGPQLDAFVDKTVKSYGKNSFVWIGPIPRVNVMNPEELKEVFTRHEEFRRPITN  134

Query  516   PVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSR-N  692
             P++  L+ GL   EG+KW+KHR+I NPAF  EKLK M+PA ++   EM+  WE  VS+  
Sbjct  135   PLILLLTSGLNFCEGEKWAKHRRIINPAFHFEKLKLMIPAFHQSFDEMIKEWESAVSKEG  194

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
              S ELDVWP L+++  +VIS TAFG +Y+ GR++FEL  E   H ++  HS+YIPG RFL
Sbjct  195   SSAELDVWPSLQSMTADVISRTAFGTNYQEGRQMFELLREQTIHVTKALHSIYIPGWRFL  254

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG--NQ  1046
             PTK+N R+N I+KEIN +++ IIE R  A + GE + ++LL  L+ESN K ++ +G  N+
Sbjct  255   PTKRNMRINKINKEINGIVRGIIENREQATRAGEASGDDLLGALMESNLKHIQENGKNNK  314

Query  1047  EFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDF  1226
               GMSI+D++ ECKLFY AGQETTS +LVWTMILLS+NQ WQ+ AR+EV+ V G  KPD+
Sbjct  315   NVGMSIQDVMQECKLFYFAGQETTSVMLVWTMILLSQNQNWQDPARQEVLQVSGSKKPDY  374

Query  1227  DGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEM  1406
             DGL+ LK+VTMIL E LRLYP      RIV ++ +LG  SLPAGV + VPI+ +HHD E+
Sbjct  375   DGLSHLKVVTMILLEVLRLYPAGGATNRIVPKNTQLGKYSLPAGVEVRVPILLIHHDKEL  434

Query  1407  WGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSF  1586
             WG+DANEF PERF EGVSKAT  +  Y+PF  GPRICIG NF+M E K AL+ IL+ F+F
Sbjct  435   WGDDANEFKPERFAEGVSKATKNQLSYIPFGAGPRICIGQNFSMTEGKLALALILQHFTF  494

Query  1587  KLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
             +LSPSYAH+P+   T  P YGAP+IL +
Sbjct  495   ELSPSYAHSPFYLFTLQPQYGAPIILHR  522



>ref|XP_009790240.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=512

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/508 (54%), Positives = 370/508 (73%), Gaps = 6/508 (1%)
 Frame = +3

Query  153   FSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             F   I+     WR +NW W++PK LEK LR    +GN Y+L YGD KE+  M  E KSKP
Sbjct  10    FVIIIILYRWGWRFMNWLWLQPKCLEKCLRELGFRGNSYKLLYGDMKEVVMMDEEAKSKP  69

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             +   S ++VPR++P+  ++I  +GK SF+WLG  P ++I DP+ ++E+LSK N FQ+   
Sbjct  70    IK-FSHDIVPRIMPFIQKTIIDYGKKSFIWLGPTPALLIMDPELIREILSKSNIFQKPPP  128

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
                   L++G+L YE DKW+KHR+I N AF L+KLKHMVP+ +    EM+ +WE+IVS  
Sbjct  129   TAQTKLLAEGILSYEADKWAKHRRIINHAFHLDKLKHMVPSFHLCTCEMLSKWEKIVSA-  187

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
             E  E+DVWP L+++  + IS TAFG SYE GR++FELQ ELA+   ++  S YI   +FL
Sbjct  188   EGSEVDVWPYLQSLTSDAISRTAFGNSYEEGRKMFELQQELAKIILKVTESSYI---KFL  244

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNN-LLDMLLESNFKEMKHHGNQE  1049
             P K++RRM  I +E+ +++  II KR+ A++ GE ++N+ LL +LLESN KE++ H N++
Sbjct  245   PNKEDRRMKQIYQEVRSLVLGIINKRMNAIEAGEASNNDDLLGILLESNLKEIQEHRNKK  304

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
             FGMS++++I ECKLFY AGQETTS LL W+MI+LS++ EWQ  AREEV+ VFG++KPD+D
Sbjct  305   FGMSMDEVIEECKLFYFAGQETTSALLTWSMIVLSKHSEWQARAREEVLQVFGNNKPDYD  364

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
              LN+LK+VTMI+ E LRLYPP+  + R V  + KLGNLSLP+GV+LL+P I L+HD E+W
Sbjct  365   MLNQLKVVTMIIQEVLRLYPPLLLMGREVHTETKLGNLSLPSGVQLLLPTIMLYHDQEIW  424

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             GED  EFNPERF EGV+KAT GK  Y PFS GPRICIG NFAM+EAK AL+ IL+ ++F 
Sbjct  425   GEDIKEFNPERFSEGVNKATKGKFAYFPFSWGPRICIGQNFAMLEAKMALAMILQHYAFD  484

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +SPSYAH PY+ LT  P +GA LIL KL
Sbjct  485   VSPSYAHVPYSVLTLQPQHGAQLILHKL  512



>ref|XP_009594690.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/509 (54%), Positives = 369/509 (72%), Gaps = 8/509 (2%)
 Frame = +3

Query  153   FSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             F   I+ L   WR +NW W++PK LEK L+    +GN Y+L YGD KE+  M  E KSKP
Sbjct  11    FVIIIILLRWGWRFMNWLWLQPKCLEKCLKELGFRGNSYKLLYGDMKEVVMMDEEAKSKP  70

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             +   S ++VPR++P+  ++I  +GKNSF+WL   P ++ITDP+ ++E+LSK N FQ+   
Sbjct  71    IK-FSHDIVPRIMPFIHKTIIDYGKNSFIWLWPTPAMLITDPELIREILSKSNIFQKPPP  129

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
                   L +G+L YE DKW+KHR+I NPAF L+KLKHM+P+ +    EM+  WE++ S  
Sbjct  130   TAHTKLLVEGILSYEADKWAKHRRIINPAFHLDKLKHMIPSFHLSTCEMLSEWEKVASA-  188

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
             E  E+DVWP L+++  + IS TAFG SYE GR++FELQ ELA+   ++  S YI    FL
Sbjct  189   EGSEVDVWPYLQSLTSDAISRTAFGSSYEEGRKIFELQQELAKIILKVTESSYI---MFL  245

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNN--LLDMLLESNFKEMKHHGNQ  1046
             PTK+NRRM  I +E+ +++  II KR+ A+ E  EA NN  LL +LL+SN KE+K HGN+
Sbjct  246   PTKENRRMKQIYQEVRSLVLGIINKRMDAI-EAREAFNNDDLLGILLDSNLKEIKEHGNK  304

Query  1047  EFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDF  1226
             +FGMS++++I ECKLFY AGQETTS LL W+MI+LS++ +WQ  AREEV+ VFG+++PD+
Sbjct  305   KFGMSLDEVIEECKLFYFAGQETTSALLTWSMIVLSKHSDWQARAREEVLQVFGNNRPDY  364

Query  1227  DGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEM  1406
             D LN+LK+VTMI+ E LRLYPP+  + R V ++ KLGNLSLP GV+LL+P I LHHD E+
Sbjct  365   DMLNQLKVVTMIIQEVLRLYPPLLLMGREVHKETKLGNLSLPGGVQLLLPTIMLHHDQEI  424

Query  1407  WGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSF  1586
             WGED  EFNPERF EGV+KAT GK  Y PFS GPRICIG +FAM++AK AL+ IL+ ++F
Sbjct  425   WGEDVKEFNPERFSEGVNKATKGKFAYFPFSWGPRICIGQHFAMLQAKMALAMILQHYAF  484

Query  1587  KLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              +SPSYAH PY+ LT  P +GA LIL KL
Sbjct  485   DVSPSYAHVPYSVLTLQPQHGAQLILHKL  513



>ref|XP_006348902.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Solanum 
tuberosum]
Length=435

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/435 (60%), Positives = 335/435 (77%), Gaps = 0/435 (0%)
 Frame = +3

Query  369   IPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGLL  548
             +P+F ++I K+GK SF+WLG  P+V I DPD +KEV +K   +Q+   +P+   L+QGL+
Sbjct  1     MPFFLDTINKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTNPLTKLLAQGLV  60

Query  549   KYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPELK  728
             + EGDKW+KHRKI NPAF LEKLKHM+PA    C+EM+ +WE+IVS   + E+DVWP L+
Sbjct  61    REEGDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEMLSKWEDIVSVERAYEIDVWPHLQ  120

Query  729   TIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNGID  908
              +  +VIS TAFG SYE GRR+FELQ E A++  E   SVYIPG  FLPTK+NRRM  I+
Sbjct  121   QLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPGWSFLPTKRNRRMKEIE  180

Query  909   KEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISECK  1088
             + +   ++ II+KR+ AMK GE  + +LL +LLESNFKE++ HG++ FG+SIE++I ECK
Sbjct  181   RHVQATIRGIIDKRVKAMKGGEANNEDLLGILLESNFKEIEQHGDKNFGLSIEEVIEECK  240

Query  1089  LFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMILN  1268
             LFY AGQETTS LLVWT+ILL R+ +WQ  AREEV+ VFG+ KPDFDGLN LK+VTMIL 
Sbjct  241   LFYFAGQETTSALLVWTLILLCRHHDWQTRAREEVLQVFGNRKPDFDGLNHLKVVTMILY  300

Query  1269  ESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPERFR  1448
             ESLRLYPPV T+ R + ED  LG++SLPAGV L +P + LHHD E+WGEDA +FNPERFR
Sbjct  301   ESLRLYPPVMTVTRRLNEDTVLGDMSLPAGVLLSLPAVLLHHDEEIWGEDAKKFNPERFR  360

Query  1449  EGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYTGL  1628
             EGVS AT G+  + PF+ GPRICIG NFAM+EAK  L+ IL+RFSF LS SYAHAP++ +
Sbjct  361   EGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKMVLAMILQRFSFDLSSSYAHAPHSVI  420

Query  1629  TTNPLYGAPLILQKL  1673
             TT P YGAPLIL +L
Sbjct  421   TTQPQYGAPLILHRL  435



>emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera]
Length=518

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/513 (54%), Positives = 368/513 (72%), Gaps = 3/513 (1%)
 Frame = +3

Query  141   NLFLFSFS-IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNE  317
             NL   SF+ I  L+ AWRV+NW W+RPK LE+ L+ Q L GN YRL YGD KE++ M+ E
Sbjct  7     NLVALSFAFITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIKE  66

Query  318   TKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTF  497
               S+P++  SD+++ RV P+ + SI+K+GK+SF+W+G  P V I +P+ +++VLS H  F
Sbjct  67    ATSRPIS-FSDDILQRVAPFHYHSIKKYGKSSFIWMGLKPRVNIMEPELIRDVLSMHTVF  125

Query  498   QQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEE  677
             ++     +  + + GL   EG+KW+KHRKI NPAF+LEKLK+M+PA +  CS+M+ +WE 
Sbjct  126   RKPRVHALGKQPASGLFFLEGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWEX  185

Query  678   IVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIP  857
              +S   S E DVWP L+ +  + IS TAFG +YE GR +FELQ E A+   +   S  IP
Sbjct  186   KLSTXGSCEXDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSQSACIP  245

Query  858   GGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHH  1037
             G RFLPTK N+RM    KE+N +L  II+KR  AMK GE  +++LL +LLESNFKE++ H
Sbjct  246   GWRFLPTKSNKRMKQNRKEVNELLWGIIDKREKAMKAGETLNDDLLGILLESNFKEIQEH  305

Query  1038  GN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDD  1214
             GN +  GMSI+D+I ECK+FY AGQETTS LL+WTM+LLS++  WQ  AREEV+HVFG++
Sbjct  306   GNDKNVGMSIKDVIDECKIFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVFGNN  365

Query  1215  KPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHH  1394
             KP+ DGLN LKIV MIL+E LRLYPPVP L R V ED ++G++ LPAGV + +P I +HH
Sbjct  366   KPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHH  425

Query  1395  DPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILR  1574
             D E+WGEDA EFNPERF +G  KAT     + PF  G R+CIG NFA++EAK  L+ IL+
Sbjct  426   DHEIWGEDAREFNPERFSQGALKATKSLVSFFPFGWGSRLCIGQNFAILEAKMVLAMILQ  485

Query  1575  RFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             RFSF LSPSY+HAP + +T  P YGA LIL  +
Sbjct  486   RFSFSLSPSYSHAPCSLVTLKPQYGAHLILHGI  518



>ref|XP_006495014.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=518

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/519 (53%), Positives = 370/519 (71%), Gaps = 4/519 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVC-AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             ME       FS  I+ +V  A +++NWAW++PK LEK LR Q  +GN YR  +GD KE  
Sbjct  1     MEFSVKSIAFSIVIVTVVTWACKILNWAWLKPKKLEKQLRRQGFRGNSYRFLFGDVKEHG  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
              +  + KSKP++ L D++ PRV+P + +  + +GKN++ W+G IPM+ I DPD +KEV +
Sbjct  61    ILSRQAKSKPIS-LDDDIAPRVVPLYDQREKLYGKNTYWWIGPIPMINIMDPDQIKEVFT  119

Query  483   KHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMV  662
               N FQ+   +P+   L+ GL   EG+KW+KHRKI NPAF  EKLK M+PA Y+ C+E++
Sbjct  120   NINDFQKPKTNPLGKILTTGLAIREGEKWAKHRKIINPAFHQEKLKLMLPAFYQSCTEII  179

Query  663   GRWEEIVSRNE-SGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
              +WE+++  ++ S ELDVWP L  +  +VIS TAFG +YE G R+F+LQ ELA+ A +  
Sbjct  180   SKWEKLMIGDQGSCELDVWPYLVKLTSDVISRTAFGSNYEEGIRIFQLQTELADIALQAL  239

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              SVYIPG R++PTK+NRRM  +DKEI   L  II KR  AMK GE A ++LL +L+ESN 
Sbjct  240   QSVYIPGWRYVPTKRNRRMKELDKEIRVSLADIIRKREIAMKTGEAAKDDLLGLLMESNL  299

Query  1020  KEMKHHGNQEF-GMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
             KE+K HGN +  G+S +D+I ECKLFY AGQETTS LL+WTM+LLS++Q+WQ  AREEV+
Sbjct  300   KEIKEHGNNKLKGISRDDVIDECKLFYFAGQETTSVLLLWTMVLLSKHQDWQAHAREEVL  359

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              V GD KPDFDGLNRLKIV MI  E LRLYPP+P L R V+++ K+G+L LPA   + + 
Sbjct  360   QVLGDKKPDFDGLNRLKIVQMIFYEVLRLYPPLPVLSRYVEKETKIGDLILPAESVIALQ  419

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
              + +HHD ++WG+DA EF PERF EG+SKAT  +  Y PFS GPRICIG NFA+VEAK A
Sbjct  420   TLLVHHDKKLWGDDAKEFKPERFSEGISKATKNQVSYFPFSWGPRICIGQNFALVEAKMA  479

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             ++ IL+ FSF+LSPSY HAP+  +   P +G  LIL+KL
Sbjct  480   MAMILQNFSFELSPSYVHAPHAFIFLQPQHGVYLILRKL  518



>ref|XP_009628921.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/512 (54%), Positives = 372/512 (73%), Gaps = 5/512 (1%)
 Frame = +3

Query  144   LFLFSFSIMFLV-CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNET  320
             L +FSF+I+F++  AW+++N+ W++PK LEK +R Q  KGN Y+  +GD KEI KM  E 
Sbjct  10    LTIFSFAIIFVLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMKEIKKMGEEA  69

Query  321   KSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQ  500
              SKP+N   D + PRV+P+  ++I  +GKN FVW G  P V+ITDP+ VKEVL+K+  +Q
Sbjct  70    MSKPINFSHDMIWPRVMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKEVLTKNFVYQ  129

Query  501   QNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEI  680
             +    P+    + G+  YE DKW+ HR++ NPAF L+KLKHM+PA      EM+ + E++
Sbjct  130   KPPGTPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTACEMLSKLEKV  189

Query  681   VSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPG  860
             VS N + E+DVWP L+T+  + IS TAFG SYE GR++FELQ E      E+  ++YIPG
Sbjct  190   VSPNGT-EIDVWPYLQTLTSDAISRTAFGSSYEEGRKIFELQKEQLSLILEVSRTIYIPG  248

Query  861   GRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG  1040
              RFLPTK+N+RM  I  E+  ++  II+KR+  ++ GE A ++LL +LL SN KE++ HG
Sbjct  249   WRFLPTKRNKRMKQIFNEVRALVLGIIKKRLSMIENGE-APDDLLGILLASNLKEIQQHG  307

Query  1041  N-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDK  1217
             N ++FGMSI+++I ECKLFY AGQETTS LLVWTMILL ++  WQ+ AREEV+ VFG  +
Sbjct  308   NNKKFGMSIDEVIEECKLFYFAGQETTSSLLVWTMILLCKHPSWQDKAREEVLQVFGSRE  367

Query  1218  PDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHD  1397
              D+D LN+LKIVTMILNE LRLYP    + R+V ++ KLGNL LPAGV+LL+P I L HD
Sbjct  368   VDYDKLNQLKIVTMILNEVLRLYPAGYAINRMVTKETKLGNLCLPAGVQLLLPTILLQHD  427

Query  1398  PEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRR  1577
              E+WG+DA EFNPERF +G+SKAT GK  + PFS GPRICIG NFAM+EAK A++ IL+ 
Sbjct  428   TEIWGDDAMEFNPERFSDGISKATKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKN  487

Query  1578  FSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             ++F+LSPSYAHAP+  L   P YGA LIL KL
Sbjct  488   YAFELSPSYAHAPHP-LLLQPQYGAQLILYKL  518



>ref|XP_009602242.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=513

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/509 (53%), Positives = 362/509 (71%), Gaps = 3/509 (1%)
 Frame = +3

Query  150   LFSFSIMFLVC-AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKS  326
             LFS  ++ LV   WR+VNW W+RP+ LEK  R Q + G+PYR  YGDTKE+A+M  E K 
Sbjct  7     LFSAIVIALVIWVWRMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAEMTKEAKF  66

Query  327   KPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQN  506
             KP+  L+D+++PR+ P++  +  K+G + F W+G  P + +  P+ +KE+++ +  F++ 
Sbjct  67    KPIK-LTDDILPRIFPFYHHTFNKYGNHCFAWIGPEPRIFVMKPELIKEIVTNNTIFKKP  125

Query  507   LADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS  686
                P+V  L  G+  YE DKW+KHRKI N AF  EKLK M+PAM+  C +M+ +WE ++S
Sbjct  126   KPAPLVQLLVSGISSYEDDKWAKHRKILNTAFYAEKLKCMLPAMHTSCEDMINKWEILLS  185

Query  687   RNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGR  866
              N+S ELDV P  +    +VIS TAFG SY  G R+F LQ ELAE   +   SVYIPG R
Sbjct  186   ENKSCELDVHPYFEDFTSDVISRTAFGSSYAEGTRIFHLQKELAELTRQAFQSVYIPGWR  245

Query  867   FLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQ  1046
             +LPT+ NRRM  ID E+  +L++I+ KR  AM        +LL +LL+SN KE++  G++
Sbjct  246   YLPTRTNRRMKAIDNELRDILRKIVSKRERAMVGEASDQEDLLGILLKSNLKEIQERGSK  305

Query  1047  EFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDF  1226
              FGM+ +++I ECK+FY AGQE++S+LLVWTM+LLS +Q WQ  AREEV  VF ++KPDF
Sbjct  306   -FGMTTDEVIEECKVFYFAGQESSSNLLVWTMVLLSVHQTWQARAREEVQQVFQNNKPDF  364

Query  1227  DGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEM  1406
             +GL+RLKIVTMILNE LRLYPP P  +R V ++ KLGN+S+P  V L++P IF+HH+PE+
Sbjct  365   EGLSRLKIVTMILNEVLRLYPPAPYFVRKVYKETKLGNMSIPPEVILVIPTIFVHHNPEL  424

Query  1407  WGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSF  1586
             WGED  EF PERF EG++ AT  + C+LPFS GPRICIG NFAM+E K AL+ IL+RF+F
Sbjct  425   WGEDVKEFKPERFAEGIATATKNRLCFLPFSWGPRICIGNNFAMLETKIALAMILQRFAF  484

Query  1587  KLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +LSPSYAHAP   +T  P  GA LILQKL
Sbjct  485   ELSPSYAHAPTYVVTLRPQCGAHLILQKL  513



>ref|XP_003543172.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=519

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/498 (55%), Positives = 358/498 (72%), Gaps = 1/498 (0%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AW+++NW W+ PK LE+ LR Q L+GNPY L  GD+ E+ K+  E  SKP+ + S ++VP
Sbjct  20    AWKLLNWLWLTPKRLERLLREQGLQGNPYTLLVGDSMEVIKIRKEALSKPITLFSHDIVP  79

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RV  Y   ++ KHGKNSF+W G IP V +TDP+ +KEVL+K   F +   +P V  L  G
Sbjct  80    RVSSYAQHTLNKHGKNSFIWFGPIPRVTLTDPELIKEVLNKIYDFGKLKLNPHVKLLVPG  139

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L + E +KWSKHRKI NPAF L+KLK+M+P   K C +++ +WE ++S + S E++VWP 
Sbjct  140   LARLEREKWSKHRKIINPAFNLDKLKNMLPLFIKCCDDLISKWEGMLSSDGSSEINVWPF  199

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +A + IS TAFG SYE GRR+F+L  E  E   ++   VYIPG RF+PT  +RR+  
Sbjct  200   LQNLASDAISRTAFGSSYEEGRRIFQLLKEQTELTMKIILKVYIPGWRFVPTTTHRRIKE  259

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHH-GNQEFGMSIEDIIS  1079
             ID+ I  +L  +I KR  A+K  E   NNLLD+LLESN KE++ H  N+  G+++E++I 
Sbjct  260   IDRVIKALLMDMINKREKALKADEATKNNLLDILLESNHKEIQEHKNNKNVGLNLEEVIQ  319

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AGQETTS LLVWTMILLSR  +WQ  AREEV+ VFG+ KP+FDGL+ LKIVTM
Sbjct  320   ECKLFYFAGQETTSVLLVWTMILLSRYPDWQTRAREEVLKVFGNQKPNFDGLSHLKIVTM  379

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             IL E LRLYPP   L+R V +D KLGNLSLPAGV++ +PI+ +HHD E+WG+DA EF PE
Sbjct  380   ILYEVLRLYPPAIGLVRKVNKDVKLGNLSLPAGVQISLPIVLVHHDCELWGDDAKEFKPE  439

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EG+ KATNG+  +  F GGPRICIG NF+ +EAK ALS IL+RF F LSP+Y HAP 
Sbjct  440   RFSEGLLKATNGRFSFFAFGGGPRICIGQNFSFLEAKIALSMILQRFLFGLSPTYTHAPT  499

Query  1620  TGLTTNPLYGAPLILQKL  1673
             T +T  P YGA LIL+K+
Sbjct  500   TVITLQPQYGAHLILRKV  517



>ref|XP_009343589.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=515

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/497 (55%), Positives = 359/497 (72%), Gaps = 3/497 (1%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWRVVNW W+RPK LE++LR Q L GN YR   GD KEI+    +  SKPM+ LS  + P
Sbjct  20    AWRVVNWLWLRPKKLERYLRQQGLAGNLYRFKSGDMKEISMTTEQAYSKPMS-LSHYIAP  78

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RVIP+    +  + KNSFVW+GTIP VIIT+P+ +K +L+K   F Q   +P+V  L+ G
Sbjct  79    RVIPFHHRLVNTYRKNSFVWMGTIPRVIITNPEDLKYILTKMEEFPQPEPNPLVKLLATG  138

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             +  YEG+KW+KH++I NP F LEKLK M+PA Y+ CSEM+  WE +V +  S ELDV P 
Sbjct  139   IALYEGEKWAKHQRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLVLKEGSCELDVRPC  198

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +  ++IS +AFG SY+ GR++F+L  E A+  +++  +VYIPG RF+PTK N++M G
Sbjct  199   LENLTADMISRSAFGSSYKEGRKIFQLLREQAQLVTKVIQNVYIPGWRFVPTKMNKKMKG  258

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-FGMSIEDIIS  1079
             IDKEI  +L  II KR   ++ GE   ++LL  L+ESN KE+K HGN +  GMS++D+I 
Sbjct  259   IDKEIRGLLMGIINKREEGIRAGEATKDDLLGNLMESNLKEIKEHGNDKTVGMSMDDVIE  318

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AGQETTS LLVWTM+LL +NQ WQ+ AREEV+ VFG +KPDFDG+  LK+VTM
Sbjct  319   ECKLFYFAGQETTSLLLVWTMVLLGQNQIWQDRAREEVLQVFGSNKPDFDGIIHLKVVTM  378

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             IL+E LRLYP  P L+R   +  +L N SLPAGV + +P++ +HHD E+WG+DA EF PE
Sbjct  379   ILHEVLRLYPS-PLLVRTTSKTTELRNFSLPAGVEVALPLLLIHHDRELWGDDAQEFKPE  437

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RF EGV+K T  K  Y PFSGGPR+CIG NFAMVEAK A+S IL+ F+F+LSPSYAHAP 
Sbjct  438   RFSEGVAKTTKNKFTYFPFSGGPRVCIGQNFAMVEAKLAISLILQHFTFELSPSYAHAPS  497

Query  1620  TGLTTNPLYGAPLILQK  1670
               +  +P +GA +IL K
Sbjct  498   AKINLHPQFGAHIILHK  514



>ref|XP_004248200.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/503 (54%), Positives = 363/503 (72%), Gaps = 3/503 (1%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             I+ L+ AWR++NW W +PK LEK LR Q  KGN Y+  +GD KE+ KM  E  SKP++  
Sbjct  22    ILVLIWAWRILNWVWFKPKMLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKEALSKPIDFS  81

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
              D   PRV+P+F ++I  +GKN F W G  P V+I DP+ ++EVLSK+  +Q+   +P+ 
Sbjct  82    HDMTWPRVMPFFHKTINNYGKNCFGWYGPRPAVVIVDPELIREVLSKNYIYQKPPGNPLT  141

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
                + GL  YE DKW+KHR+I NP F L+KLKHM+PA     SEM+ +W+EI+S+ E  E
Sbjct  142   RLAANGLAGYEADKWAKHRRIINPGFHLDKLKHMLPAFQLTSSEMLNKWKEIISK-EGSE  200

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             +DVWP L+T+  + IS TAFG SYE G+++FELQ E  E   ++  S+YIPG RF+PTK 
Sbjct  201   IDVWPYLQTLTSDAISRTAFGSSYEEGKKIFELQKEQMELLLQVARSLYIPGWRFVPTKT  260

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSI  1064
             NRRM  I  E+  ++  II KRI  +++GE   ++LL +LL SN +E++ HG+++FGMSI
Sbjct  261   NRRMKQIFNEVGALILGIINKRIKMIEDGE-IHDDLLSILLASNLQEIQQHGHKKFGMSI  319

Query  1065  EDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRL  1244
             +++I ECKLFYLAGQETTS LLVWTMILLS+   WQ+ AR+EV+ VF  D+ D+D LN L
Sbjct  320   DEVIEECKLFYLAGQETTSALLVWTMILLSKYPIWQQRARQEVLQVFESDEFDYDKLNHL  379

Query  1245  KIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDAN  1424
             K+VTMILNE LRLYP    + R+V +D KLGNL LP+GV+LL+  I LHHD E+WG+DA 
Sbjct  380   KVVTMILNEVLRLYPSAYFINRVVTKDTKLGNLCLPSGVQLLLGTILLHHDTEIWGDDAM  439

Query  1425  EFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSY  1604
             EFNPERF +GV+KAT G+  + PFS GPRICIG NFAM+EAK A++ IL+ +SF+LS SY
Sbjct  440   EFNPERFSDGVAKATKGQLVFFPFSWGPRICIGQNFAMLEAKMAIAMILKHYSFELSSSY  499

Query  1605  AHAPYTGLTTNPLYGAPLILQKL  1673
             AHAP+  L   P YGA LIL KL
Sbjct  500   AHAPHP-LLLQPQYGAHLILYKL  521



>ref|XP_011082969.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/517 (53%), Positives = 371/517 (72%), Gaps = 2/517 (0%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME    +   S   + L+ AWRVV WA++RPK +EK LR Q   G+ YRL   + KE  K
Sbjct  1     MEGVWQIIAASLGFVVLIWAWRVVKWAYMRPKRVEKLLRKQGFNGSSYRLVNRELKERLK  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M+ E KS P+N L D++ PR++P++ ++IQ +G  SF+WLG  P VII+DP+ +KEV++K
Sbjct  61    MVKEAKSNPIN-LDDDIKPRILPFYTKTIQTYGTESFMWLGLSPTVIISDPELIKEVMTK  119

Query  486   HNTFQQ-NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMV  662
              + +++   A+P+   L+QGL  Y+ DKW+KH+KI NPAF +EKLK M+PA Y  C E++
Sbjct  120   THIYKKIKNANPLTRLLAQGLFSYDLDKWAKHKKIINPAFHMEKLKLMIPAFYLSCDEVL  179

Query  663   GRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRH  842
              +WE+ +S   S E+DVWP L+ ++ + IS TAFG SY+ GRR+FELQ E A H      
Sbjct  180   NKWEKSLSPEGSCEVDVWPFLQNLSSDAISRTAFGSSYQEGRRIFELQREQAGHFFIASR  239

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFK  1022
             S+YIPG RF+PTK+N+RM  I +E+ ++++ II +R+ AMK GE  + +LL +LLESN +
Sbjct  240   SMYIPGWRFVPTKRNKRMKEIAEEVQSLIRGIISRRVEAMKAGEANNEDLLGILLESNAR  299

Query  1023  EMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             E++ HGN+ FGM+I++++ ECKLFY AGQETTS LLVWT++LLSR  +WQ+ AREEV+ V
Sbjct  300   EIEQHGNKTFGMTIDEVVEECKLFYFAGQETTSSLLVWTLVLLSRYPDWQKRAREEVLQV  359

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG   P FDGLN LKIVTMIL E LR YPPV TL R V E+ KLGNL+LPAGV++ +P+I
Sbjct  360   FGRQTPAFDGLNYLKIVTMILYEVLRFYPPVVTLGRRVTEETKLGNLTLPAGVQISLPLI  419

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              LHH+ ++WG+DA EF PERF +GV+KA   +  + PF  G RICIG  FAM+EAK  L+
Sbjct  420   SLHHNRDIWGDDAMEFKPERFSQGVAKAQKRQGIFFPFGWGSRICIGQVFAMMEAKVVLA  479

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL+RFSF+LSPSY HAP   +   P +GA L+L KL
Sbjct  480   MILQRFSFELSPSYQHAPQRVVALQPQHGAHLLLHKL  516



>emb|CDP15985.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/513 (53%), Positives = 363/513 (71%), Gaps = 6/513 (1%)
 Frame = +3

Query  135   FCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMN  314
             F    + S  ++  V AWRV+NWAW +PK L+K L+ Q  KGNPY+L YGD K+I+ +  
Sbjct  7     FMIALVSSCCVVLSVLAWRVLNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDLKQISSLFQ  66

Query  315   ETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNT  494
             E  SKP++ LSD +VPR+ P+F E++ K+GKN+++W G  PM++I DP+ +++V  K + 
Sbjct  67    EANSKPIS-LSDGIVPRIAPHFLEAVNKYGKNTYLWSGPRPMMLIMDPELIRKVTQKMDI  125

Query  495   FQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWE  674
             FQ+    P    L  G+L YEG+KW K RK+ N AF +EKLK MVPA YK   EM+ +WE
Sbjct  126   FQKVKFHPQASLLVAGILGYEGEKWVKQRKLLNQAFHMEKLKLMVPAFYKSACEMLSKWE  185

Query  675   EIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYI  854
             E++S   S E+DVWP ++T+  + IS TAFG  YE GR++FELQ E A H      S+YI
Sbjct  186   EMISVKGSFEVDVWPTIQTMTSDAISRTAFGSRYEEGRKIFELQREQAGHLVLATRSIYI  245

Query  855   PGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKH  1034
             PG RFLPTK+NRRM  I KE+   ++ II  R+ A++ GE    ++L +LL ++      
Sbjct  246   PGSRFLPTKRNRRMKQIAKEVEGSIREIINARLKALRAGEAIDTDMLGLLLATS-----Q  300

Query  1035  HGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDD  1214
                 E GM+  +II ECKLFY+AGQETT+ LLVWTMILLS + +WQE AREEV+  FG +
Sbjct  301   ETGGESGMTTGEIIQECKLFYVAGQETTAVLLVWTMILLSMHPDWQERAREEVLQHFGTN  360

Query  1215  KPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHH  1394
              P+FDGLN+LKIVTMIL+E LRLYPP+  + R V E+ K+GNL++PAG RL +P+I LHH
Sbjct  361   MPNFDGLNQLKIVTMILHEVLRLYPPISNIGRTVAEETKIGNLTIPAGQRLALPVILLHH  420

Query  1395  DPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILR  1574
             DPE+WGED  EF PERF +GVS AT G+  Y PF  GPRICIG NFA++EAK AL+ IL+
Sbjct  421   DPEIWGEDVKEFKPERFADGVSSATKGQIVYFPFGWGPRICIGANFALLEAKLALAMILQ  480

Query  1575  RFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             RFSF+LSPSY+HAP+ G+   P +GAPL+L KL
Sbjct  481   RFSFELSPSYSHAPHQGIALQPQFGAPLVLHKL  513



>ref|XP_009394213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/505 (53%), Positives = 361/505 (71%), Gaps = 2/505 (0%)
 Frame = +3

Query  162   SIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV  341
              ++FL  A RV+NWAW RP+ LE+ LR Q L G PYR  YGD KEI ++  E ++KPM  
Sbjct  19    GLLFLAWALRVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRLRKEARAKPMP-  77

Query  342   LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS-KHNTFQQNLADP  518
             L+  ++PR++P+F  ++ ++GK SF W G +P V ITDP+ V+EVLS K   F +   +P
Sbjct  78    LAHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGKPTQNP  137

Query  519   VVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNES  698
             +    S+GL  YEG+KW KHR+I NPAF  EKLK M+PA    CS+++ RWE +      
Sbjct  138   LSRFFSKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEAC  197

Query  699   GELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPT  878
              ELDVWPEL++ + +VIS TAFG SYE GR++F+LQ E AE   ++  ++Y+PG RFLPT
Sbjct  198   YELDVWPELQSFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPT  257

Query  879   KKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGM  1058
              KN+R+  ID+EI ++L+ II+KR   +K G+ ++++LL +L+ESN K ++  GN+  GM
Sbjct  258   PKNKRIKAIDREIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKHLQEDGNKNAGM  317

Query  1059  SIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLN  1238
             + ED+I ECKLFY AGQETTS LL WTMI LS +  WQ  AREEV+ VFG++KPDFDGL+
Sbjct  318   TTEDVIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDFDGLS  377

Query  1239  RLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGED  1418
              LKIVTMIL E LRLYPP   + R   +  K+G++  P GV LL+  IF+HHDP +WG+D
Sbjct  378   HLKIVTMILYEVLRLYPPFILIRRQTYKTMKIGDVVYPPGVLLLLHAIFVHHDPNLWGKD  437

Query  1419  ANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSP  1598
             A+EFNPERF EGVSKA+  +  + PF GGPRICIG NFA++EAK  LS IL+ FSF LSP
Sbjct  438   ASEFNPERFAEGVSKASKEQVAFFPFGGGPRICIGQNFALLEAKMGLSMILQHFSFDLSP  497

Query  1599  SYAHAPYTGLTTNPLYGAPLILQKL  1673
             SYAHAP+T  T +P +GA + L+KL
Sbjct  498   SYAHAPHTVFTLHPQHGAQIRLRKL  522



>ref|XP_010060783.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/496 (56%), Positives = 360/496 (73%), Gaps = 8/496 (2%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWRVVNW W+RPK LE+ LR Q L G PY   +GD KE ++++ E  SKP++V SD++ P
Sbjct  21    AWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPISV-SDDIKP  79

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             R++P+  +S Q +GK+SF+W+G  P V IT+P+ +KE+ SK N + +  ++P+V  L+ G
Sbjct  80    RLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPRPGSNPLVKLLADG  139

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  +EG+KW++HRKI NPAF +EKLK M+PA Y  C+EMVGRWE++VS + S E+D W +
Sbjct  140   LASHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLVSVDRSCEIDAWVD  199

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +   VIS TAFG S+E G+R+FELQ E A+       SVYIPG RF+PTK NRRM  
Sbjct  200   LQNLTREVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQSVYIPGWRFVPTKMNRRMKS  259

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
             IDKE+  +L  II +R  A++EGE A ++LL +LLESN KE         GMS+ D+I E
Sbjct  260   IDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVIEE  312

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTM+LLS + +WQ  AREEV+ +FG  KPD DGL+ LKIVTMI
Sbjct  313   CKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMI  372

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             LNE LRLYPPV  L R V  + KLG L++P GV+L +P + +HHD E+WGEDA EF PER
Sbjct  373   LNEVLRLYPPVTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDQELWGEDAEEFKPER  432

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F EGVSKAT  +  + PF  GPRICIG NFA++EAK AL+ IL++F+F+LSPSYAHAP  
Sbjct  433   FAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPSYAHAPSN  492

Query  1623  GLTTNPLYGAPLILQK  1670
              +T  P YG  +IL+K
Sbjct  493   VITLQPRYGVQVILRK  508



>gb|KEH37983.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=520

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/524 (52%), Positives = 376/524 (72%), Gaps = 14/524 (3%)
 Frame = +3

Query  126   MEVF--CNLFLFSFSIMF-LVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKE  296
             ME+F   N  +   ++ F LV AWRV+NW W++PK +EK LR Q L+GNPYRL  GD K+
Sbjct  1     MELFWTTNSAIILITVTFGLVYAWRVLNWMWLKPKKMEKLLREQGLQGNPYRLLLGDAKD  60

Query  297   IAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEV  476
                M  + +SKPMN LSD++ PRV PY   ++Q HGK SF+W GT P VI+ +P+ ++EV
Sbjct  61    YFVMQKKVQSKPMN-LSDDIAPRVAPYIHHAVQTHGKKSFIWFGTKPWVILNEPEQIREV  119

Query  477   LSKHNTFQQNLADPVVYK----LSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYK  644
              +K + F +     V YK    +++GL+K EG+KW+KHR+I NPAF +EKLK M P   K
Sbjct  120   FNKISEFPK-----VQYKFMKLITRGLVKLEGEKWTKHRRIINPAFHMEKLKIMTPTFLK  174

Query  645   ICSEMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEH  824
              C++++  WEE +S N S E+D+WP L+++  +VI+ ++FG SYE GR++F+LQ E  E 
Sbjct  175   SCNDLISNWEETLSSNGSSEIDIWPSLQSLTSDVIARSSFGSSYEEGRKVFQLQIEQGEL  234

Query  825   ASELRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDML  1004
               +      IP  RFLPT  +R++N  DK+I T +K II KR  A+K GE   N+LL +L
Sbjct  235   IMKNLMKSLIPLWRFLPTADHRKINENDKQIETTIKNIINKREKAIKAGEATENDLLGLL  294

Query  1005  LESNFKEMKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELA  1181
             LESN KE+K HGN +  G+S+E+++ EC LF++AGQETTSDLLVWTM+LLSR+ +WQE A
Sbjct  295   LESNHKEIKEHGNFKNMGLSLEEVVGECMLFHIAGQETTSDLLVWTMVLLSRHPDWQERA  354

Query  1182  REEVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGV  1361
             R+EV+ +FG++KPDFDGLN+LKI+ MIL E LRLYPP+  + R V+ D KLG+L+L AG+
Sbjct  355   RKEVLEIFGNEKPDFDGLNKLKIMGMILYEVLRLYPPITGVSRKVENDIKLGDLTLYAGM  414

Query  1362  RLLVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMV  1541
              + +PI+ +HHD E+WG+DA  FNPERF  G+SKATNG+  Y PF  GPRICIG  F+++
Sbjct  415   DVYLPIVLIHHDCELWGDDAKIFNPERFSGGISKATNGRFSYFPFGAGPRICIGQTFSLL  474

Query  1542  EAKTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             EAK A++ IL+ FSF+LS +YAHAP   LT  P +GA +IL+K+
Sbjct  475   EAKMAMALILQNFSFELSQTYAHAPSVVLTVQPQHGAHVILRKI  518



>gb|AGX93058.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Amsonia hubrichtii]
Length=518

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/519 (53%), Positives = 359/519 (69%), Gaps = 4/519 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME F ++ +  F  + L   +R+++W W RPK LEK LR Q  KGNPYRL  GD  E  K
Sbjct  1     MENFKSVAVLGFVCVALYWVYRLLDWVWFRPKKLEKCLREQGFKGNPYRLLLGDQYESGK  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             ++ E  SKP+  L ++V  R+IP+  ++++ HGKNSF+W+G IP V +TDP+ +KEVL+K
Sbjct  61    LIREAMSKPIG-LEEDVKKRIIPHLLKTVETHGKNSFMWVGRIPRVQVTDPELIKEVLTK  119

Query  486   HNTFQQNL--ADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             +  FQ+N    DP+   L  G+   EG+ W+K RKI N AF  EKLK M+PA Y  C ++
Sbjct  120   YYKFQKNHHDLDPITKLLLTGIGSLEGEPWAKRRKIINSAFHFEKLKLMLPAFYLSCRDL  179

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             V +W++ V    S E+DVW +++T+  +VIS T FG +YE GRR+FEL  EL     ++ 
Sbjct  180   VSKWDKKVPEGGSAEVDVWHDIETLTGDVISRTLFGSNYEEGRRIFELMKELTALTIDVI  239

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              SVYIPG RFLPTK+N RM  IDKE+   +  II  ++  MK GE A ++ L +LLE N 
Sbjct  240   RSVYIPGQRFLPTKRNNRMRTIDKEVRVRITEIINNKMKIMKTGEAAGDDFLGILLECNQ  299

Query  1020  KEMKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
              E++  GN +  GM+IE II ECKLFY AGQ+TTS LLVWTM+LLSR  EWQ  AREEV+
Sbjct  300   NEIREQGNNKNAGMTIEQIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQTRAREEVL  359

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              VFGD  PD+DG++ LKIVTMIL E LRLY PV  L ++  ED +LG   +PAGV+L++P
Sbjct  360   QVFGDKTPDYDGISHLKIVTMILYEVLRLYTPVAELTKVAHEDTQLGKYFIPAGVQLMMP  419

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
              + LHHDP++WGED  EF PERF EGV KAT  +  Y PFS GPR+CIG NFA++EAK A
Sbjct  420   QMLLHHDPQIWGEDVMEFKPERFSEGVLKATKSQGSYFPFSLGPRMCIGQNFALLEAKMA  479

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             ++ ILRRFSF+LSPSY HAP+T +T  P YGA LIL KL
Sbjct  480   MALILRRFSFELSPSYVHAPFTLITMQPQYGAHLILHKL  518



>ref|XP_006377693.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
 gb|ERP55490.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
Length=518

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/506 (54%), Positives = 364/506 (72%), Gaps = 5/506 (1%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             +  L  AWR++NW W RPK +E+ LR Q   G PYRL +GD KE + M+ E ++KP+  L
Sbjct  15    VAVLRWAWRLLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKESSDMLKEARTKPIG-L  73

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             SD ++PRV+P+  + ++ +GKNSF+W+G  P V I +PD +K+V  K N +Q+  + P++
Sbjct  74    SDALLPRVMPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIKDVFMKINEYQKP-SHPLL  132

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNE-SG  701
               ++ GL  +EG+KWS HRKI NPAF  EK+K M+PA Y+ CS M+ +WE++VS +E S 
Sbjct  133   KAIACGLPSHEGEKWSNHRKIINPAFHQEKIKLMIPAFYESCSGMINKWEKLVSIDEGSC  192

Query  702   ELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASE-LRHSVYIPGGRFLPT  878
             ELDVWP+L+ +  + IS T+FG +YE G+R+F+L  EL +     +  ++ IPG RFLP 
Sbjct  193   ELDVWPDLQGLTCDAISRTSFGSNYEEGKRIFDLLKELTDLTVHVIIKAIVIPGYRFLPI  252

Query  879   KKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFG  1055
               NRR+  IDKEI   L  +I KR  AM  GE+A N+LL +LLESNF+E++ HGN +  G
Sbjct  253   PSNRRLKAIDKEIKASLNALINKREQAMSAGEDAKNDLLGLLLESNFREIQEHGNTKSVG  312

Query  1056  MSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGL  1235
             MSIED+I EC++FY AGQETT+ LL WTM+LL++   WQ  AREEV+ VFG+ KPDFDGL
Sbjct  313   MSIEDVIDECRIFYFAGQETTTVLLTWTMVLLAQYPNWQARAREEVVQVFGNKKPDFDGL  372

Query  1236  NRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGE  1415
             N LK+VTMI  E LRLYPPV  L R V E+ KLGNL LPAGV++ VP I LH D E+WG+
Sbjct  373   NHLKVVTMIFYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQVSVPTILLHQDHELWGD  432

Query  1416  DANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLS  1595
             DA+EF P RF EGVSKAT  +  +LPF  GPRIC+G NFA++EAK AL+ IL+R SF+LS
Sbjct  433   DASEFKPGRFAEGVSKATKSQVSFLPFGWGPRICVGQNFALIEAKMALAMILQRCSFELS  492

Query  1596  PSYAHAPYTGLTTNPLYGAPLILQKL  1673
             PSY HAP T +T  P +GAP+IL+KL
Sbjct  493   PSYIHAPRTVITLQPQHGAPMILRKL  518



>gb|AHK60841.1| CYP72A225 [Catharanthus roseus]
Length=538

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/521 (53%), Positives = 379/521 (73%), Gaps = 7/521 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             M+VF        +  FL+ AW+++NWAWI+PK LEK LR   LKGN YRL  GD  E ++
Sbjct  18    MDVFYRGISVLGTCFFLLLAWKMLNWAWIKPKKLEKRLRQLGLKGNSYRLLIGDLGETSQ  77

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M  E KSKP+N  ++ ++PR++P+  + IQ HGKN F+W G  P VIITDP+ +KEVL+K
Sbjct  78    MDKEAKSKPIN-FTNHIIPRIMPFLHKIIQSHGKNPFIWQGPNPAVIITDPELIKEVLTK  136

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
             + T+Q+  +D +   +SQG+  Y+ DKW+KHR++ NPAF +EKLKHM+PA +  CSEM+ 
Sbjct  137   NYTYQKPPSDDLGKLISQGVAAYDKDKWAKHRRLLNPAFHIEKLKHMLPAFHLSCSEMLK  196

Query  666   RWEEIVSRNESG--ELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             +WE++ S +  G  ELDVWP L+ +  +VIS TAFG + E G+ +F+LQ E+ EH  ++ 
Sbjct  197   KWEKLASASAEGSFELDVWPYLQDMTSDVISRTAFGSNLEEGKNIFKLQKEILEHILQIL  256

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              S Y PG  +LPTK+ RRM  I KE+++ +  II KR+ AMK GE ++++LL +LL+SNF
Sbjct  257   QSFYFPGMLYLPTKRIRRMKKISKEVHSSVLNIIMKRVEAMKAGEPSNDDLLGILLDSNF  316

Query  1020  KEMKHHGNQEF----GMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELARE  1187
             KE+++          GMS E++I ECKLFY AGQETT+ LLVWT++LLS++ EWQ  AR+
Sbjct  317   KEIENDNGNNSNKNCGMSFEEVIEECKLFYFAGQETTAVLLVWTLLLLSKHPEWQMRARD  376

Query  1188  EVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRL  1367
             EV+ +FG+ +PDFD LN LK++TM++NE LRLYPP   + R++ ED KLG+LSLP G+ +
Sbjct  377   EVLQIFGNSEPDFDALNHLKVITMVINEVLRLYPPGFMMSRVIHEDTKLGSLSLPGGISI  436

Query  1368  LVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEA  1547
              +P I LHHD E+WG+DA EF PERF EG+SKAT G+  Y PFSGGPRICIG NFAM+EA
Sbjct  437   FLPTIMLHHDEELWGDDAKEFKPERFSEGISKATKGQFIYFPFSGGPRICIGNNFAMLEA  496

Query  1548  KTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
             K AL+ IL+RF+F++SPSY HAP+T +T  P YGA LIL K
Sbjct  497   KMALALILQRFTFEISPSYTHAPHTLVTLQPQYGAQLILYK  537



>dbj|BAL45204.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=520

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/505 (53%), Positives = 367/505 (73%), Gaps = 11/505 (2%)
 Frame = +3

Query  174   LVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDE  353
             LV AWRV+NW W++PK +EK LR Q L+GNPYRL  GD K+   M  + +SKPMN LSD+
Sbjct  20    LVYAWRVLNWMWLKPKKMEKLLREQGLQGNPYRLLLGDAKDYFVMQKKVQSKPMN-LSDD  78

Query  354   VVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYK-  530
             + PRV PY   ++Q HGK SF+W GT P VI+ +P+ ++EV +K + F +     V YK 
Sbjct  79    IAPRVAPYIHHAVQTHGKKSFIWFGTKPWVILNEPEQIREVFNKISEFPK-----VQYKF  133

Query  531   ---LSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESG  701
                +++GL+K EG+KWSKHR+I NPAF +EKLK M P   K C++++  WEE +S N S 
Sbjct  134   MKLITRGLVKLEGEKWSKHRRIINPAFHMEKLKIMTPTFLKSCNDLISNWEETLSSNGSS  193

Query  702   ELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTK  881
             E+D+WP L+++  +VI+ ++FG SYE GR++F+LQ E  E   +      IP  RFLPT 
Sbjct  194   EIDIWPSLQSLTSDVIARSSFGSSYEEGRKVFQLQIEQGELIMKNLMKSLIPLWRFLPTA  253

Query  882   KNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGM  1058
              +R++N  DK+I T +K II KR  A+K GE   N+LL +LLESN +E+K HGN +  G+
Sbjct  254   DHRKINENDKQIETTIKNIINKREKAIKAGEATENDLLGLLLESNHREIKEHGNFKNMGL  313

Query  1059  SIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLN  1238
             S+E+++ EC LF++AGQETTSDLLVWTM+LLSR  +WQE AR+EV+ +FG++KPDFDGLN
Sbjct  314   SLEEVVGECMLFHIAGQETTSDLLVWTMVLLSRYPDWQERARKEVLEIFGNEKPDFDGLN  373

Query  1239  RLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGED  1418
             +LKI+ MIL E LRLYPP+  + R V+ D KLG+L+L AG+ + +PI+ +HHD E+WG+D
Sbjct  374   KLKIMGMILYEVLRLYPPITGVSRKVENDIKLGDLTLYAGMDVYLPIVLIHHDCELWGDD  433

Query  1419  ANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSP  1598
             A  FNPERF  G+SKATNG+  Y PF  GPRICIG  F+++EAK A++ IL++FSF+LS 
Sbjct  434   AKIFNPERFSGGISKATNGRFSYFPFGAGPRICIGQTFSLLEAKMAMALILQKFSFELSQ  493

Query  1599  SYAHAPYTGLTTNPLYGAPLILQKL  1673
             +YAHAP   LT  P +GA +IL+K+
Sbjct  494   TYAHAPSVVLTVQPQHGAHVILRKI  518



>ref|XP_004244382.2| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=511

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/511 (52%), Positives = 367/511 (72%), Gaps = 4/511 (1%)
 Frame = +3

Query  144   LFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETK  323
             L  FS  ++ ++  WR+VNW WIRP+ +EK  R Q L G+PYR  YGDTKE+AK+  + K
Sbjct  4     LICFSALLVTMIWMWRMVNWVWIRPRKIEKCFRKQGLNGHPYRTLYGDTKEMAKLTKQAK  63

Query  324   SKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQ  503
              KPM  L+D+++ RV+P++  ++ K+G N F+W+G  P + I +P+ +++++  +N F++
Sbjct  64    LKPMK-LTDDILTRVLPFYHYTLNKYGNNCFIWIGPEPRIFIMEPELIRDIVMNNNIFKK  122

Query  504   NLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWE-EI  680
                 P+V  L  G+  YE  KW+KHRKI N AF  EKLK+MVPAM+K C +M+ +WE  I
Sbjct  123   PKPTPLVQLLVSGISSYEDQKWAKHRKILNTAFYTEKLKYMVPAMHKSCEDMMNKWEILI  182

Query  681   VSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPG  860
              ++N+S ELDV P  + +  +VIS TAFG SY+ G ++F LQ ELAE   +   SVYIPG
Sbjct  183   CNKNKSCELDVHPYFEDLTSDVISRTAFGSSYQEGMKIFHLQKELAELTRQAFQSVYIPG  242

Query  861   GRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG  1040
              RFLPT++NRRM GID E+   L++I+ KR  +M  GE    +LL +LL+SN  E++ +G
Sbjct  243   WRFLPTRRNRRMKGIDNELKDTLRKIVNKRERSMNLGE-TQEDLLGILLKSNVNEIQQNG  301

Query  1041  NQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKP  1220
              + FGM+ +++I ECKLFY AGQET+S+LLVWTM+LLS +Q WQ  AREEV  VF ++KP
Sbjct  302   TK-FGMTTDEVIEECKLFYFAGQETSSNLLVWTMVLLSVHQNWQTRAREEVQQVFHNNKP  360

Query  1221  DFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDP  1400
             DF+GL RLKIVTMILNE LRLYPP P  +R   ++ KLGN+++P+ V L++P IF+HH+ 
Sbjct  361   DFEGLKRLKIVTMILNEVLRLYPPAPYFLRKANQETKLGNMNIPSEVILMIPTIFIHHNE  420

Query  1401  EMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRF  1580
             E+WG+D  EF P+RF +G++KAT  + C+LPFS GPRICIG NFAM+E K AL+ IL+RF
Sbjct  421   ELWGDDVKEFKPDRFSQGIAKATKDRLCFLPFSWGPRICIGHNFAMMETKIALAMILQRF  480

Query  1581  SFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +F+LSPSY HAP   +T  P  GA LIL KL
Sbjct  481   AFELSPSYTHAPTYVVTLQPQCGAHLILNKL  511



>ref|XP_009790251.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
 gb|ABC69391.1| CYP72A53v2 [Nicotiana tabacum]
Length=518

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/508 (54%), Positives = 371/508 (73%), Gaps = 5/508 (1%)
 Frame = +3

Query  156   SFSIMFLV-CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             SF+I+F++  AW+++N+ W++PK LEK+LR Q  KGN Y+  +GD KE+ KM  E  SKP
Sbjct  14    SFAIIFVLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMKEMKKMGEEAMSKP  73

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             +N   D + PRV+P+  ++I  +GKN  VW G  P V+ITDP+ VKEVL+K+  +Q+ L 
Sbjct  74    INFSHDMIWPRVMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKEVLTKNFVYQKPLG  133

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
             +P+    + G+  YE DKW+ HR++ NPAF L+KLKHM+PA     SEM+ + E++VS N
Sbjct  134   NPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTASEMLSKLEKVVSPN  193

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
              + E+DVWP L+T+  + IS TAFG SYE GR++F+LQ E      E+  ++YIPG RFL
Sbjct  194   GT-EIDVWPYLQTLTSDAISRTAFGSSYEEGRKIFDLQKEQLSLILEVSRTIYIPGWRFL  252

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QE  1049
             PTK+N+RM  I  E+  ++  II+KR+  ++ GE A ++LL +LL SN KE++ HGN ++
Sbjct  253   PTKRNKRMKQIFNEVRALVFGIIKKRMSMIENGE-APDDLLGILLASNLKEIQQHGNNKK  311

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
             FGMSI+++I ECKLFY AGQETTS LLVWTMILL +   WQ+ AREEV+ VFG  + D+D
Sbjct  312   FGMSIDEVIEECKLFYFAGQETTSSLLVWTMILLCKYPNWQDKAREEVLQVFGSREVDYD  371

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
              LN+LKIVTMILNE LRLYP    + R+V ++ KLGNL LPAGV+L++P + L HD E+W
Sbjct  372   KLNQLKIVTMILNEVLRLYPAGYVINRMVNKETKLGNLCLPAGVQLVLPTMLLQHDTEIW  431

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             G+DA EFNPERF +G+SKAT GK  + PFS GPRICIG NFAM+EAK A++ IL+ ++F+
Sbjct  432   GDDAMEFNPERFSDGISKATKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKTYAFE  491

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LSPSYAHAP+  L   P YGA LIL KL
Sbjct  492   LSPSYAHAPHP-LLLQPQYGAQLILYKL  518



>ref|XP_003525967.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=518

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/519 (53%), Positives = 372/519 (72%), Gaps = 4/519 (1%)
 Frame = +3

Query  126   MEVFCNLFLF-SFSIMFL-VCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEI  299
             MEV     +F  F I F+ +   + ++W W+ PK  E++LR Q LKGN Y LF+GD K I
Sbjct  1     MEVDATTMMFVGFCIAFVTILLTKALSWLWLEPKRAERYLRRQGLKGNSYTLFFGDIKAI  60

Query  300   AKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVL  479
             + ++ + KSKP+++ +D+V PR++P+  + I+ +GKNSF W G  P+V I DP+ ++EVL
Sbjct  61    STLIQKAKSKPIDI-NDDVTPRLVPFQHQLIRNYGKNSFFWYGPKPVVHIMDPEAIREVL  119

Query  480   SKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             +  N F +    P+   L  GL+  +GDKWSKHRKI NPAF L KLK ++PAMY  C++M
Sbjct  120   NLINDFPKPTLTPLSKFLITGLVDLDGDKWSKHRKIINPAFNLAKLKLVLPAMYHSCNQM  179

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             +  W+ +VS+ ES  +DVWP L ++  +VIS TAFG  YE G+ +F+LQ E AE  +++ 
Sbjct  180   MNEWKMLVSKKESCMVDVWPFLNSLTGDVISRTAFGSCYEEGKIVFQLQKEQAELTAKVF  239

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              SVYIPG RF+PTK N+RM  ID EI  VL  II+K+  AMK  +  ++NLL +LLESN 
Sbjct  240   QSVYIPGWRFVPTKLNKRMKEIDFEIRNVLSGIIQKQEAAMKTCKAPNDNLLGLLLESNQ  299

Query  1020  KEMKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
             KE++  G+ ++ GM+ +D+I+ECKLFY AGQETTS LL WTM+LLSR   WQ LAREEV+
Sbjct  300   KEIEDRGHRKDVGMNTDDVINECKLFYFAGQETTSVLLNWTMVLLSRFPNWQTLAREEVI  359

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              +FG  +PD+DGLNRLK+VTMIL E LRLYPPV  + R+V+++A++GNL+LPAG    +P
Sbjct  360   GIFGTKEPDYDGLNRLKVVTMILYEVLRLYPPVTAITRVVRKEARVGNLTLPAGALATIP  419

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
             I+ +HHD E+WG DA EF PERF EG+ KATNG+  +LPF+ GPRICIG NFA++EAK A
Sbjct  420   IVLVHHDSELWGSDAKEFKPERFSEGILKATNGQVSFLPFAWGPRICIGQNFALLEAKMA  479

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             L  IL+ FSF+LS SY HAP+T +T  P +G P+I  KL
Sbjct  480   LCLILQNFSFELSASYTHAPFTVITAQPQFGTPIIFHKL  518



>ref|XP_006349622.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=516

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/519 (53%), Positives = 373/519 (72%), Gaps = 6/519 (1%)
 Frame = +3

Query  126   MEVFCN--LFLFSFSIMFLV-CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKE  296
             ME+  N  L +FSF+I+F++  AWR++N+ W++PK LEK LR +  KGN Y+  +GD KE
Sbjct  1     MEIPYNFKLAIFSFAIIFVLRWAWRILNYVWLKPKYLEKQLRQEGFKGNSYKFLFGDMKE  60

Query  297   IAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEV  476
             ++KM  E  SKP+N   D + PRV P+  + I  +GKNSFVW G  P V+I DP+ +KEV
Sbjct  61    MSKMGEEALSKPVNFSHDMIWPRVNPFIHKIITNYGKNSFVWFGPKPAVVIMDPEVIKEV  120

Query  477   LSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSE  656
             + K+  FQ+   +P+   L+ G+  YE DKW+ HR++ NPAF L+KLKHM+PA     SE
Sbjct  121   MMKNYVFQKPGGNPLTKLLATGIADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLTASE  180

Query  657   MVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASEL  836
             M+G+WE+IVSR+ S E+DV   L+T+  + IS TAFG SYE G ++FELQ E  +   ++
Sbjct  181   MLGKWEKIVSRDGS-EIDVLSYLQTLTSDAISRTAFGSSYEEGIKIFELQKEQIQLILQV  239

Query  837   RHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESN  1016
               +VYIPG RFLPTK+N+RM  I  E+ T++  II KR+  M E  E+ ++LL +LL SN
Sbjct  240   SRTVYIPGWRFLPTKRNKRMKQIFNEVRTLIFEIINKRM-RMIEAGESHDDLLGILLSSN  298

Query  1017  FKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
              KE++ HGN++F MSI+++I ECKLFY AGQETTS LLVWTMILLS++  WQ+ AREEV+
Sbjct  299   LKEIQQHGNKKFSMSIDEVIEECKLFYFAGQETTSTLLVWTMILLSQHPNWQDRAREEVL  358

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              VFG ++ D+D LN+LK+VTMILNE LRLYP    + R+V+    LGNL LP GV+LL+P
Sbjct  359   QVFGSNEVDYDKLNQLKVVTMILNEVLRLYPAGYMMTRMVQTKTNLGNLCLPGGVQLLLP  418

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
              I L HD E+WG+DA EFNPERF +G+ KAT G+  + PF  GPRICIG NFAM+EAK A
Sbjct  419   TILLQHDTEIWGDDAMEFNPERFSDGILKATKGQLVFFPFGWGPRICIGQNFAMLEAKMA  478

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             ++ IL+ ++F+LS SY+HAP+  L   P YGAPLIL KL
Sbjct  479   MAMILKHYAFELSSSYSHAPHP-LMLQPQYGAPLILYKL  516



>gb|KCW67646.1| hypothetical protein EUGRSUZ_F01394 [Eucalyptus grandis]
Length=510

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/496 (55%), Positives = 361/496 (73%), Gaps = 8/496 (2%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWRVVNW W+RPK LE+ LR Q L G PY   +GD KE ++++ E  SKP++V SD++ P
Sbjct  21    AWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPISV-SDDIKP  79

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             R++P+  +S Q +GK+SF+W+G  P V IT+P+ +KE+ SK N + +  ++P+V  L+ G
Sbjct  80    RLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPRPGSNPLVKLLADG  139

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  +EG+KW++HRKI NPAF +EKLK M+PA Y  C+EMVGRWE++VS + S E+D W +
Sbjct  140   LASHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLVSVDRSCEIDAWVD  199

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +   VIS TAFG S+E G+R+FELQ E A+       SVYIPG RF+PTK NRRM  
Sbjct  200   LQNLTREVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQSVYIPGWRFVPTKMNRRMKS  259

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
             IDKE+  +L  II +R  A++EGE A ++LL +LLESN KE         GMS+ D++ E
Sbjct  260   IDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVMEE  312

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             C+LFY AGQETTS LLVWTM+LLS + +WQ  AREEV+ +FG  KPD DGL+ LKIVTMI
Sbjct  313   CRLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMI  372

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             LNE LRLYPPV  + R V ++ KLG L++P  V+LL+P + +HHD E+WGEDA EF PER
Sbjct  373   LNEVLRLYPPVTEMTRKVPKETKLGKLTIPPEVQLLMPTLLIHHDKELWGEDAEEFKPER  432

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F EGVSKAT  +  + PF  GPRICIG NFA++EAK AL+ IL++F+F+LSPSYAHAP  
Sbjct  433   FAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPSYAHAPSN  492

Query  1623  GLTTNPLYGAPLILQK  1670
              +T  P YG  +IL+K
Sbjct  493   VITLQPRYGVQVILRK  508



>ref|XP_009790250.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/508 (55%), Positives = 365/508 (72%), Gaps = 6/508 (1%)
 Frame = +3

Query  156   SFSIMFLV-CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             SF ++F++  AW+++NW W +PK LEK LR Q  KGN YR  +GD  E+ KM  E  SKP
Sbjct  14    SFVVIFILKWAWKILNWVWFKPKELEKCLRQQGFKGNSYRFLFGDVNEMMKMGKEALSKP  73

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             ++  S  + PRV+P+F ++I  +GKN   W G  P ++I DP+ ++EVL+K+  FQ+   
Sbjct  74    ID-FSHNIWPRVMPFFHKTITTYGKNCLAWYGPRPAIVIVDPELIREVLTKNYIFQKPPG  132

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
              P+    + GL  YE DKW+KHR++ NPAF L+KLKHM+PA     SEM+ +WE++VS  
Sbjct  133   TPLTKLAANGLAGYEADKWAKHRRLINPAFHLDKLKHMLPAFLLTASEMLSKWEKVVSTG  192

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
              S E+DVWP L+T+  + IS TAFG SYE GR++FELQ E  E   ++  S+YIPG RF+
Sbjct  193   GS-EIDVWPYLQTLTSDAISRTAFGSSYEEGRKIFELQKEQMELLLQIARSLYIPGWRFI  251

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QE  1049
             PTK NRRM  I  E+  ++  II+KR+  ++ GE A ++LL  LL SN KE++ HGN ++
Sbjct  252   PTKTNRRMKQIFNEVRVLILGIIKKRMSMIENGE-APDDLLGTLLASNLKEIQQHGNNKK  310

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
             FGMSI+++I ECKLFYLAGQETTS LLVWTMILL +   WQE AREEV+ VFG+D  D+D
Sbjct  311   FGMSIDEVIEECKLFYLAGQETTSALLVWTMILLCKYPIWQEQAREEVLQVFGNDDLDYD  370

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
              LN+LKIVTMILNE +RLYP    + R+V ++ KLGNL LPAGV+LL+  I LHHD E+W
Sbjct  371   KLNQLKIVTMILNEVMRLYPSGYFINRMVIKETKLGNLYLPAGVQLLLATILLHHDTEIW  430

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             G+DA EFNPERF EGV+KAT G+  + PFS GPRICIG NFAM+EAK  ++ IL+ ++F+
Sbjct  431   GDDAMEFNPERFSEGVAKATKGQLVFFPFSWGPRICIGQNFAMLEAKMTIAMILKHYAFE  490

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LSPSYAHAP+  L   P YGA LIL KL
Sbjct  491   LSPSYAHAPHP-LLLQPQYGAHLILHKL  517



>gb|ABC59077.1| cytochrome P450 monooxygenase CYP72A68 [Medicago truncatula]
 gb|KEH37987.1| cytochrome P450 family 709 protein [Medicago truncatula]
Length=520

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/505 (53%), Positives = 368/505 (73%), Gaps = 11/505 (2%)
 Frame = +3

Query  174   LVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDE  353
             LV AWRV+NW W++PK +EK LR Q L+GNPYRL  GD K+   M  + +SKPMN LSD+
Sbjct  20    LVYAWRVLNWMWLKPKKIEKLLREQGLQGNPYRLLLGDAKDYFVMQKKVQSKPMN-LSDD  78

Query  354   VVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYK-  530
             + PRV PY   ++Q HGK SF+W G  P VI+ +P+ ++EV +K + F +     V YK 
Sbjct  79    IAPRVAPYIHHAVQTHGKKSFIWFGMKPWVILNEPEQIREVFNKMSEFPK-----VQYKF  133

Query  531   ---LSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESG  701
                +++GL+K EG+KWSKHR+I NPAF +EKLK M P   K C++++  WE+++S N S 
Sbjct  134   MKLITRGLVKLEGEKWSKHRRIINPAFHMEKLKIMTPTFLKSCNDLISNWEKMLSSNGSC  193

Query  702   ELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTK  881
             E+DVWP L+++  +VI+ ++FG SYE GR++F+LQ E  E   +      IP  RFLPT 
Sbjct  194   EMDVWPSLQSLTSDVIARSSFGSSYEEGRKVFQLQIEQGELIMKNLMKSLIPLWRFLPTA  253

Query  882   KNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGM  1058
              +R++N  +K+I T LK II KR  A+K GE   N+LL +LLESN +E+K HGN +  G+
Sbjct  254   DHRKINENEKQIETTLKNIINKREKAIKAGEATENDLLGLLLESNHREIKEHGNVKNMGL  313

Query  1059  SIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLN  1238
             S+E+++ EC+LF++AGQETTSDLLVWTM+LLSR  +WQE AR+EV+ +FG++KPDFDGLN
Sbjct  314   SLEEVVGECRLFHVAGQETTSDLLVWTMVLLSRYPDWQERARKEVLEIFGNEKPDFDGLN  373

Query  1239  RLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGED  1418
             +LKI+ MIL E LRLYPPV  + R V+ D KLG+L+L AG+ + +PI+ +HHD E+WG+D
Sbjct  374   KLKIMAMILYEVLRLYPPVTGVARKVENDIKLGDLTLYAGMEVYMPIVLIHHDCELWGDD  433

Query  1419  ANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSP  1598
             A  FNPERF  G+SKATNG+  Y PF  GPRICIG NF+++EAK A++ IL+ FSF+LS 
Sbjct  434   AKIFNPERFSGGISKATNGRFSYFPFGAGPRICIGQNFSLLEAKMAMALILKNFSFELSQ  493

Query  1599  SYAHAPYTGLTTNPLYGAPLILQKL  1673
             +YAHAP   L+  P +GA +IL+K+
Sbjct  494   TYAHAPSVVLSVQPQHGAHVILRKI  518



>gb|ABC69390.1| CYP72A53v1 [Nicotiana tabacum]
Length=518

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/508 (54%), Positives = 370/508 (73%), Gaps = 5/508 (1%)
 Frame = +3

Query  156   SFSIMFLV-CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             SF+I+F++  AW+++N+ W++PK LEK+LR Q  KGN Y+  +GD KE  KM  E  SKP
Sbjct  14    SFAIIFVLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMKETKKMGEEAMSKP  73

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             +N   D + PRV+P+  ++I  +GKN  VW G  P V+ITDP+ VKEVL+K+  +Q+ L 
Sbjct  74    INFSHDMIWPRVMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKEVLTKNFVYQKPLG  133

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
             +P+    + G+  YE DKW+ HR++ NPAF L+KLKHM+PA     SEM+ + E++VS N
Sbjct  134   NPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTASEMLSKLEKVVSPN  193

Query  693   ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFL  872
              + E+DVWP L+T+  + IS TAFG SYE GR++F+LQ E      E+  ++YIPG RFL
Sbjct  194   GT-EIDVWPYLQTLTSDAISRTAFGSSYEEGRKIFDLQKEQLSLILEVSRTIYIPGWRFL  252

Query  873   PTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QE  1049
             PTK+N+RM  I  E+  ++  II+KR+  ++ GE A ++LL +LL SN KE++ HGN ++
Sbjct  253   PTKRNKRMKQIFNEVRALVFGIIKKRMSMIENGE-APDDLLGILLASNLKEIQQHGNNKK  311

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
             FGMSI+++I ECKLFY AGQETTS LLVWTMILL +   WQ+ AREEV+ VFG  + D+D
Sbjct  312   FGMSIDEVIEECKLFYFAGQETTSSLLVWTMILLCKYPNWQDKAREEVLQVFGSREVDYD  371

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
              LN+LKIVTMILNE LRLYP    + R+V ++ KLGNL LPAGV+L++P + L HD E+W
Sbjct  372   KLNQLKIVTMILNEVLRLYPAGYVINRMVNKETKLGNLCLPAGVQLVLPTMLLQHDTEIW  431

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             G+DA EFNPERF +G+SKAT GK  + PFS GPRICIG NFAM+EAK A++ IL+ ++F+
Sbjct  432   GDDAMEFNPERFSDGISKATKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKTYAFE  491

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LSPSYAHAP+  L   P YGA LIL KL
Sbjct  492   LSPSYAHAPHP-LLLQPQYGAQLILYKL  518



>ref|XP_011082820.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=519

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/519 (53%), Positives = 368/519 (71%), Gaps = 8/519 (2%)
 Frame = +3

Query  132   VFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMM  311
             +  +LF F F     + AWR+VNW WIRPK +EK LR Q   GNPYR+ YGDT ++AKM+
Sbjct  1     MISSLFTFLF-FAIAIWAWRIVNWVWIRPKNIEKRLRAQGFGGNPYRILYGDTNDMAKMI  59

Query  312   NETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHN  491
              E  SKP+  LSD+V+PRVIP     ++K+GK  FVW+G +  V+I +P+ +KEVL+ ++
Sbjct  60    KEANSKPIK-LSDDVLPRVIPLHHHIVRKYGKACFVWIGPVARVVIMEPELIKEVLNNNH  118

Query  492   TFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRW  671
              F++   +P+   L  G+  YE DKWSKHRKI NPAF +EKL+HMVPAM++ C EM+ +W
Sbjct  119   IFKKPTPNPLARFLVCGINGYEDDKWSKHRKIINPAFYVEKLRHMVPAMHRSCVEMIEKW  178

Query  672   EEIV----SRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             E++V     + +  E+DV P  + +   VIS TAFG SYE GRR+FELQ E AE   ++ 
Sbjct  179   EKLVEIEGGKRKGIEIDVGPYFEDLTGQVISRTAFGSSYEEGRRIFELQKEQAELTRQVL  238

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEA-SNNLLDMLLESN  1016
              SVY+PG R++PTK+NRR+  I+ ++ ++L+ II++R  AM+ G     ++LL +LL+SN
Sbjct  239   QSVYVPGWRYVPTKRNRRLKEINDDLCSLLRGIIKQRQTAMQTGNSTEDDDLLGILLKSN  298

Query  1017  FKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
              KEMK +G +  GMSIE++I ECK FY +GQE+TS+LL WTM LLS +Q+WQ+ AREE+ 
Sbjct  299   EKEMKENGKKS-GMSIEEVIEECKTFYFSGQESTSNLLSWTMFLLSIHQDWQKRAREELF  357

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              VFGD  PDFDGLNRLKIVTMIL E LRLYPP     RI+ ++ KLG ++LPAGV L +P
Sbjct  358   QVFGDSAPDFDGLNRLKIVTMILYEVLRLYPPAIIFNRIIHKETKLGEVTLPAGVHLQLP  417

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
             II LHHD  +WGEDA EF PERF +G++KAT  +  + PFS GPRICIG NFA++E K A
Sbjct  418   IILLHHDQNLWGEDAKEFKPERFSQGIAKATKNQLSFFPFSWGPRICIGNNFALMETKMA  477

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             L+ ILR FSF LSPSY HAP   LT  P  G  L++ ++
Sbjct  478   LAMILRAFSFDLSPSYTHAPSYVLTLQPQCGVHLMMTQI  516



>ref|XP_009343590.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/517 (53%), Positives = 362/517 (70%), Gaps = 4/517 (1%)
 Frame = +3

Query  126   MEV-FCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             MEV   N+ +    I+    AWRVVNW W+RPK LE++LR Q L GN YR   GD KE  
Sbjct  1     MEVSVSNIGVVLVGIIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERT  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
              M+ +  SKPMN LS ++ PRV+P+ + S+  +GKNSF+W G +P V I +P+ +K++L+
Sbjct  61    MMLKQAYSKPMN-LSHDIAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILT  119

Query  483   KHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMV  662
             K   F +  ++P V  L  G   Y+G+KW +HR+I NPAF L+KLK M+PA Y   +EM+
Sbjct  120   KIEDFPKLKSNPYVKLLVTGTAHYQGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSNEMI  179

Query  663   GRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRH  842
               WE +V +  S ELDV P L+ +  ++IS +AFG SY+ GR++F+L  E  +  S++  
Sbjct  180   KEWESLVLKAGSCELDVQPCLENLTADMISRSAFGSSYKEGRKIFQLLREQVQLVSKVIQ  239

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFK  1022
             +VYIPG RF+PTK N++M GIDKEI  +L  II KR   ++ GE   ++LL +L+ESN K
Sbjct  240   NVYIPGWRFVPTKMNKKMKGIDKEIGGLLMGIINKREEGIRAGEATKDDLLGILMESNLK  299

Query  1023  EMKHHG-NQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             E+K HG N+  GMS +D+I ECKLFY AGQETTS LLVWTM+LL +NQ WQ+ AREEV+ 
Sbjct  300   EIKEHGNNKRVGMSTDDVIEECKLFYFAGQETTSLLLVWTMVLLGQNQIWQDRAREEVLQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             VFG +KPDFDG+  LK+VTMIL+E LRLY P P L+R   +  +  N SLPAGV + +P+
Sbjct  360   VFGSNKPDFDGIIHLKVVTMILHEVLRLY-PAPLLVRTTDKKTEFRNFSLPAGVEVALPM  418

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             + +HHD E+WG+DA EF PERF EGV+K T  K  Y PFSGGPR+CIG NFAMVEAK A+
Sbjct  419   LLIHHDRELWGDDAQEFKPERFSEGVAKTTKNKFTYFPFSGGPRVCIGQNFAMVEAKLAI  478

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
             S IL+ F+F+LSPSYAHAP   L  +P +GA +IL K
Sbjct  479   SLILQHFTFELSPSYAHAPSAKLMLHPQFGAHIILHK  515



>ref|XP_009146335.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/497 (54%), Positives = 362/497 (73%), Gaps = 7/497 (1%)
 Frame = +3

Query  186   WRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPR  365
             WR +NW W +PK LE +LR Q L G+PY    GD K    M  E +SKP+  L+D+V  R
Sbjct  22    WRTLNWVWFKPKKLESYLRSQGLSGSPYTPLIGDLKRTFSMAMEARSKPIK-LTDDVSTR  80

Query  366   VIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGL  545
             V+P+ FE ++ HG+  F WLGTIP + I DP+ +KEV +K   FQ+    P+   +++GL
Sbjct  81    VVPFPFEMLKTHGRTYFTWLGTIPTITIMDPELIKEVFNKVYDFQKPHTFPLGNVIAKGL  140

Query  546   LKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS-RNESGELDVWPE  722
               Y+G+KW+KHRKI NPAF LEK+K+MVPA ++ CSE+VG+W++IVS +  S E+DVWP 
Sbjct  141   ANYDGEKWAKHRKIINPAFHLEKIKNMVPAFHQSCSEVVGKWDKIVSEKGSSCEVDVWPG  200

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L ++  +VIS TAFG SY+ G+R+FELQ ELA+         ++PG  +LPTK NRR+  
Sbjct  201   LVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIILAVLKAFVPGYLYLPTKGNRRIKA  260

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
               +EI  +L+ I+ KR+ A + GE  S++LL +LLESN  + K  GN+   MS ED++ E
Sbjct  261   AAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNLGQAK--GNE---MSTEDVMEE  315

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTM+LLS++Q+WQ  AR+EV  VFGD +PD +GLN+LK++TMI
Sbjct  316   CKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARDEVKQVFGDKEPDTEGLNQLKVMTMI  375

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             L E LRLYPPV  L R + ++ KLG+L+LP G ++ +PI+ +H D ++WGEDA EF PER
Sbjct  376   LYEVLRLYPPVAQLTRAIHKEMKLGDLTLPGGAQISLPILLVHRDTQLWGEDAAEFKPER  435

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F++GVSKATNGK  + PF+ GPRICIG +FA++E K AL+ IL+RFSF+LSPSY HAPYT
Sbjct  436   FKDGVSKATNGKVSFFPFAWGPRICIGQSFALLETKMALALILKRFSFELSPSYVHAPYT  495

Query  1623  GLTTNPLYGAPLILQKL  1673
              +T +P +GAPLIL+KL
Sbjct  496   VITLHPQFGAPLILRKL  512



>ref|XP_004248734.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=516

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/511 (53%), Positives = 369/511 (72%), Gaps = 4/511 (1%)
 Frame = +3

Query  144   LFLFSFSIMFLV-CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNET  320
             L +FSF+I+F++  AWR++N+ W++PK LEK LR Q  KG+ Y+  +GD KE++KM  E 
Sbjct  9     LAIFSFAIIFVLRWAWRILNYVWLKPKYLEKQLRKQGFKGHTYKFLFGDMKEMSKMGEEA  68

Query  321   KSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQ  500
              SKP+N   D + PRV P+  + I  +GKN FVW G  P V+I DP+ +KEV+ K+  FQ
Sbjct  69    WSKPVNFSHDTIWPRVNPFIHKIITNYGKNCFVWFGPRPAVVIMDPEVIKEVMMKNYVFQ  128

Query  501   QNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEI  680
             +   +P+   L+ G+  YE DKW+ HR++ NPAF L+KLKHM+PA     +EM+ +WE+I
Sbjct  129   KPGGNPLTKLLATGIADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLTGNEMLSKWEKI  188

Query  681   VSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPG  860
             VSR E  E+DV P L+T+  + IS TAFG SYE G ++FELQ E  +   E+  ++YIPG
Sbjct  189   VSR-EGSEIDVLPYLQTLTSDAISRTAFGSSYEEGIKIFELQKEQIQLILEVSRTIYIPG  247

Query  861   GRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG  1040
              RFLPTK+N+RM  I  E+ T++  II KR+  M E  E+ ++LL +LL SN KE++ HG
Sbjct  248   WRFLPTKRNKRMKQIFNEVRTLILEIINKRM-RMIEAGESHDDLLGILLSSNLKEIQQHG  306

Query  1041  NQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKP  1220
             N++FGMSI+++I ECKLFY AGQETTS LLVWTMILLS++  WQ+ AREEV+ VFG ++ 
Sbjct  307   NKKFGMSIDEVIEECKLFYFAGQETTSTLLVWTMILLSQHPNWQDRAREEVLQVFGSNEV  366

Query  1221  DFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDP  1400
             D+D LN+LK+VTMILNE LRLYP    + R+VK   KLGNL LP GV+LL+P I L HD 
Sbjct  367   DYDKLNQLKVVTMILNEVLRLYPAGYMMTRMVKTKTKLGNLCLPGGVQLLLPTILLQHDT  426

Query  1401  EMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRF  1580
             ++WG+DA EFNPERF +G+ KAT G+  + PF  GPRICIG NFAM+EAK A++ IL+ +
Sbjct  427   KIWGDDAMEFNPERFSDGILKATKGQLVFFPFGWGPRICIGQNFAMLEAKMAMAMILKHY  486

Query  1581  SFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +F+LS SY+HAP+  L   P +GAPLIL KL
Sbjct  487   AFELSSSYSHAPHP-LMLQPQFGAPLILYKL  516



>ref|XP_008226217.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=522

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/503 (55%), Positives = 361/503 (72%), Gaps = 2/503 (0%)
 Frame = +3

Query  168   MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV-L  344
             + +  AWRV+NW W+RP  LE+ LR Q L GN YRL +GDTKEI+ M+ + +SKP+ +  
Sbjct  19    IVIAWAWRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGDTKEISMMVEQAQSKPIKLST  78

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             + ++ PRVIP+  + +  +G+NSFVW+G  P V I +P+ +K+  +K + FQ+ +++P+V
Sbjct  79    THDIAPRVIPFSHQIVYTYGRNSFVWMGPTPRVTIMNPEDLKDAFNKSDEFQRAISNPIV  138

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               +SQGL   EG+KW+KHRKI NPAF LEKLK M+P  Y+ CSEM+ +WE +V +  S E
Sbjct  139   KSISQGLSSLEGEKWAKHRKIINPAFHLEKLKGMLPTFYQSCSEMINKWESLVFKEGSRE  198

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             +DVWP L+ +  +VIS  AFG SYE GR++F+L  E A+  +    SVYIPG RFLPTK+
Sbjct  199   MDVWPYLENLTSDVISRAAFGSSYEEGRKIFQLLREEAKFYTIAARSVYIPGWRFLPTKQ  258

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMS  1061
             N+RM  I KE+  +LK II KR  A+K GE A  NLL +L+ESNF+E++ HGN +  GMS
Sbjct  259   NKRMKEIHKEVRGLLKGIINKREDAIKAGEAAKGNLLGILMESNFREIQEHGNNKNAGMS  318

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             IED+I ECKLFY AGQETTS LLVWT++LLS+NQ+WQ  AREEV+ VFG + P +D L+ 
Sbjct  319   IEDVIGECKLFYFAGQETTSVLLVWTLVLLSQNQDWQARAREEVLQVFGTNIPTYDQLSH  378

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LK+VTMIL E LRLYP V  L R   +  +LG   LPAGV + + I+  HHD E+WGEDA
Sbjct  379   LKVVTMILLEVLRLYPAVVELPRTTYKKTQLGKFLLPAGVEVSLHIMLAHHDKELWGEDA  438

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
              EF PERF EGVSKAT  +  Y PF  GPRICIG NFAM+EAK ALS IL+ F+F+LSPS
Sbjct  439   KEFKPERFSEGVSKATKNQFTYFPFGAGPRICIGQNFAMLEAKLALSLILQHFTFELSPS  498

Query  1602  YAHAPYTGLTTNPLYGAPLILQK  1670
             YAHAP   +T +P +GA  IL K
Sbjct  499   YAHAPSVTITLHPQFGAHFILHK  521



>gb|KHG18227.1| Secologanin synthase [Gossypium arboreum]
Length=518

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/500 (53%), Positives = 358/500 (72%), Gaps = 4/500 (1%)
 Frame = +3

Query  174   LVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDE  353
             ++  WR +NW W+ PK LE+ L+ +   GNPYR   GD KE   M  +T++KPM V SD+
Sbjct  20    MIWGWRALNWVWLTPKRLERCLKQEGFAGNPYRFLSGDIKESFTMSRQTRAKPMPV-SDD  78

Query  354   VVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKL  533
             +   V+P+  ++I+ HG NSF+W+G  P V I DP+ ++E+ +K   FQ+  ++P+   L
Sbjct  79    IEAYVLPFLHQTIKNHGNNSFMWIGPRPRVTIMDPEKIREIFTKFTDFQKLHSNPLARFL  138

Query  534   SQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDV  713
               GL   EGD+WSKHRKI NPAF  +KLK+M+PA Y+ C+EM+ +WEE+VS+    ELDV
Sbjct  139   VGGLSNLEGDQWSKHRKIVNPAFHQDKLKNMLPAFYQSCNEMISKWEEMVSKEGYSELDV  198

Query  714   WPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRR  893
             WP +  +  +VIS  AFG SYE GRR+F+L  +L     ++  SVYIPG RFLPTK NR 
Sbjct  199   WPYIVNMTRDVISRAAFGSSYEEGRRIFQLLEDLTSLTIKVFQSVYIPGWRFLPTKTNRE  258

Query  894   MNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDI  1073
             +    K+I   L+ +I++R  A+K GEE++ +LLD+L+ESN +EM+    +  GMSIED+
Sbjct  259   LKMKHKDIKESLREMIKRREKAIKAGEESNEDLLDILVESNIREME---AKHMGMSIEDV  315

Query  1074  ISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIV  1253
             I ECKLFY AGQETTS LLVWTM+LL+R  +WQ  AR+EV+HV GD KPD DGLNRLK+V
Sbjct  316   IEECKLFYFAGQETTSVLLVWTMVLLARYPDWQTKARDEVLHVLGDRKPDADGLNRLKVV  375

Query  1254  TMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
             TMIL E LRLYPPV +L R + ++ K+G+L LPAG  +L+PI+ +HHD + WG+DA+EF 
Sbjct  376   TMILYEVLRLYPPVVSLARSIPKEIKVGHLLLPAGTEVLIPILQIHHDKDHWGDDAHEFR  435

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             PERF EGVSKAT  +  +LPF  GPRICIG NFAM+E K A++ IL+RF F+LSPSYAH+
Sbjct  436   PERFAEGVSKATKSQVTFLPFGWGPRICIGQNFAMMEVKMAMAMILQRFWFELSPSYAHS  495

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P T +T  P +GA +IL KL
Sbjct  496   PCTTMTLRPQHGAQIILHKL  515



>ref|XP_010060778.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW67643.1| hypothetical protein EUGRSUZ_F01390 [Eucalyptus grandis]
Length=510

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/496 (55%), Positives = 357/496 (72%), Gaps = 8/496 (2%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWRVVNW W+RP+ LE+ LR Q L G PY   +GD KE ++++ E  SKP+ V SD++ P
Sbjct  21    AWRVVNWVWLRPQRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAV-SDDIKP  79

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             R++P+  +S Q +GK+SF+W+G  P V IT+P+ +KE+ SK N + +  ++P+V  L+ G
Sbjct  80    RLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPRPGSNPLVKLLADG  139

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  +EG+KW++HRKI NPAF +EKLK M+PA Y  C+EMVGRWE++VS   S E+D W +
Sbjct  140   LTSHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLVSVERSCEIDAWVD  199

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +   VIS TAFG S+E G+R+FELQ E A+       SVYIPG RF+PTK NRRM  
Sbjct  200   LQNLTGEVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQSVYIPGWRFVPTKMNRRMKS  259

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
             IDKE+  +L  I+ +R  A++EGE A ++LL +LLESN KE         GMS+ D+I E
Sbjct  260   IDKEVRALLMDIVRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVIEE  312

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTM+LLS + +WQ  AREEV+ +FG  KPD DGL+ LKIVTMI
Sbjct  313   CKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMI  372

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             LNE LRLYPPV  L R V  + KLG L++P GV+L +P + +HHD E+WGEDA EF PER
Sbjct  373   LNEVLRLYPPVTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDKELWGEDAEEFKPER  432

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F EGVSKAT  +  + PF  GPRICIG NFA++EAK AL+ IL++F+F LSPSYAHAP  
Sbjct  433   FAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFDLSPSYAHAPSN  492

Query  1623  GLTTNPLYGAPLILQK  1670
              +T  P YG  +IL+K
Sbjct  493   VITLQPRYGVQVILRK  508



>ref|XP_008226216.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/503 (55%), Positives = 361/503 (72%), Gaps = 2/503 (0%)
 Frame = +3

Query  168   MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV-L  344
             + +  AWRV+NW W+RP  LE+ LR Q L GN YRL +GDTKEI+ M+ + +SKP+ +  
Sbjct  18    IVIAWAWRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGDTKEISMMVEQAQSKPIKLST  77

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             + ++ PRVIP+  + +  +G+NSFVW+G  P V I +P+ +K+  +K + FQ+ +++P+V
Sbjct  78    THDIAPRVIPFSHQIVYTYGRNSFVWMGPTPRVTIMNPEDLKDAFNKSDEFQRAISNPIV  137

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               +SQGL   EG+KW+KHRKI NPAF LEKLK M+P  Y+ CSEM+ +WE +V +  S E
Sbjct  138   KSISQGLSSLEGEKWAKHRKIINPAFHLEKLKGMLPTFYQSCSEMINKWESLVFKEGSRE  197

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             +DVWP L+ +  +VIS  AFG SYE GR++F+L  E A+  +    SVYIPG RFLPTK+
Sbjct  198   MDVWPYLENLTSDVISRAAFGSSYEEGRKIFQLLREEAKFYTIAARSVYIPGWRFLPTKQ  257

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMS  1061
             N+RM  I KE+  +LK II KR  A+K GE A  NLL +L+ESNF+E++ HGN +  GMS
Sbjct  258   NKRMKEIHKEVRGLLKGIINKREDAIKAGEAAKGNLLGILMESNFREIQEHGNNKNAGMS  317

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             IED+I ECKLFY AGQETTS LLVWT++LLS+NQ+WQ  AREEV+ VFG + P +D L+ 
Sbjct  318   IEDVIGECKLFYFAGQETTSVLLVWTLVLLSQNQDWQARAREEVLQVFGTNIPTYDQLSH  377

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LK+VTMIL E LRLYP V  L R   +  +LG   LPAGV + + I+  HHD E+WGEDA
Sbjct  378   LKVVTMILLEVLRLYPAVVELPRTTYKKTQLGKFLLPAGVEVSLHIMLAHHDKELWGEDA  437

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
              EF PERF EGVSKAT  +  Y PF  GPRICIG NFAM+EAK ALS IL+ F+F+LSPS
Sbjct  438   KEFKPERFSEGVSKATKNQFTYFPFGAGPRICIGQNFAMLEAKLALSLILQHFTFELSPS  497

Query  1602  YAHAPYTGLTTNPLYGAPLILQK  1670
             YAHAP   +T +P +GA  IL K
Sbjct  498   YAHAPSVTITLHPQFGAHFILHK  520



>ref|XP_004488665.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=524

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/499 (56%), Positives = 371/499 (74%), Gaps = 5/499 (1%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AW+V+N  W++PK LEK LR Q L+GNPYR   GD K++ KM NE KSK MN L+D++VP
Sbjct  27    AWKVLNLLWLKPKKLEKLLREQGLQGNPYRFLVGDLKDLFKMENEAKSKSMN-LTDDIVP  85

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKL-SQ  539
             RV PY  +S++ HGKNSF+W GT P + +T+P+ +K+VL+K + F +   +  ++KL + 
Sbjct  86    RVFPYTQQSVKIHGKNSFIWFGTKPRLTLTEPEQIKDVLNKISDFPK--TNYKIFKLLAS  143

Query  540   GLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWP  719
             GL  Y G+KWSKHRK+ N AF LEKLK M P+ +  C++++  WEEI+S N S E+D+WP
Sbjct  144   GLASYHGEKWSKHRKLINSAFHLEKLKIMTPSFFTSCNDLISEWEEILSSNGSCEIDIWP  203

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
              L+ +A + IS TAFG SYE G+R+F+LQ E AE  +++    +IP  RF+PT  +RRMN
Sbjct  204   SLQNMASDAISRTAFGSSYEEGKRIFQLQREQAELITKVVMKSFIPLWRFVPTIVHRRMN  263

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIEDII  1076
              +DK+I + LK +I KR   +K GE   N+LL +LLESN KE+K HGN +  GM+IED+I
Sbjct  264   EVDKDIKSSLKDMINKREKTLKAGEANKNDLLGILLESNHKEIKEHGNNKNAGMNIEDVI  323

Query  1077  SECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVT  1256
              ECKLFY AGQETTS LLVWTMILLSR  +WQ  AREEV HVFG+ KPDFDGL+ LKIVT
Sbjct  324   EECKLFYFAGQETTSVLLVWTMILLSRYPDWQARAREEVFHVFGNKKPDFDGLSNLKIVT  383

Query  1257  MILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNP  1436
             M+L E LRLYPPV  L R + +D KLGNL+LPAGV + +PII LHHD ++WG+DA  FNP
Sbjct  384   MVLYEVLRLYPPVIGLARKIDKDMKLGNLTLPAGVEVFLPIILLHHDTQLWGDDATMFNP  443

Query  1437  ERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAP  1616
             ERF  GVSKATNG+  + PF  GPRIC+G NF+++EAK A++ IL+ FSF+LSP+Y+HAP
Sbjct  444   ERFSGGVSKATNGRVSFFPFGWGPRICVGQNFSLLEAKMAMAMILQHFSFELSPTYSHAP  503

Query  1617  YTGLTTNPLYGAPLILQKL  1673
              T +T  P +GA +IL+K+
Sbjct  504   TTVITLRPQHGAHIILRKV  522



>gb|AGX93061.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Vinca minor]
Length=520

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/521 (52%), Positives = 362/521 (69%), Gaps = 4/521 (1%)
 Frame = +3

Query  120   MRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEI  299
             M +  F ++ +  F  + +   +RV++W W RPK LEK LR Q  KGNPYRLF GD  E 
Sbjct  1     MELMNFNSVAILGFISLSIFWIYRVLDWVWFRPKKLEKCLREQGFKGNPYRLFLGDQYES  60

Query  300   AKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVL  479
              K++ E  SKP+ +  ++V  R++P+  ++++ HGKNSF+W+G I  V ITDP+ +KEVL
Sbjct  61    GKLIREAMSKPIGI-DEDVKKRIVPHILKAVETHGKNSFMWVGRILRVQITDPELIKEVL  119

Query  480   SKHNTFQQNL--ADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICS  653
             +K+  FQ+N    DP+   L  G+   EG+ W+K RKI N AF  EKLK M+PA Y  C 
Sbjct  120   TKYYKFQKNHHDLDPITKLLLGGIGSLEGESWAKRRKIINSAFHFEKLKLMLPAFYLSCR  179

Query  654   EMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASE  833
             +MV +W++ V    S E++VW +++T+  +VIS T FG +YE GRR+FEL  EL     +
Sbjct  180   DMVEKWDKKVPEGGSSEVEVWHDIETLTGDVISRTLFGSNYEEGRRIFELMKELTALTID  239

Query  834   LRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLES  1013
             +  SVYIPG RFLPTK+N RM  IDKE+   +  II K++  MK GE A+++ L +LLE+
Sbjct  240   VIRSVYIPGQRFLPTKRNNRMRAIDKEVRVRITEIINKKMKIMKAGETAADDFLGILLEN  299

Query  1014  NFKEMKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREE  1190
             N  E++  GN +  GM+IE II ECKLFY AGQ+TTS L+VWTM+LLSR  EWQ  AREE
Sbjct  300   NLNEIREQGNNRNAGMTIEQIIGECKLFYFAGQDTTSTLIVWTMVLLSRFPEWQTRAREE  359

Query  1191  VMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLL  1370
             V+ VFG+  PD+DG++RLK++TMIL E LRLY PV  L ++  ED +LG   +PAGV+L+
Sbjct  360   VLQVFGNKPPDYDGISRLKVITMILYEVLRLYTPVAELTKVAHEDTQLGKYFIPAGVQLM  419

Query  1371  VPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAK  1550
             +P   LHHDPE+WGED  EF PERF EGV KAT  +  + PFS GPR+CIG NFA++EAK
Sbjct  420   MPQALLHHDPEIWGEDVMEFKPERFSEGVLKATKSQGSFFPFSLGPRMCIGQNFALLEAK  479

Query  1551  TALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              A+S ILRRF+F+LSPSY HAP+T +T  P YGA LIL KL
Sbjct  480   MAMSLILRRFAFELSPSYVHAPFTLITMQPQYGAHLILHKL  520



>gb|AIA82924.1| SLS1 [Gentiana rigescens]
Length=519

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/519 (53%), Positives = 352/519 (68%), Gaps = 1/519 (0%)
 Frame = +3

Query  120   MRME-VFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKE  296
             M ME  F    LF      L  A+ V+NW W +PK +EK L+ Q LKGNPYRL YGD KE
Sbjct  1     MEMENRFLIWLLFVTGAAALYVAYEVLNWVWFKPKKIEKQLQEQGLKGNPYRLLYGDLKE  60

Query  297   IAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEV  476
             + K + +  S+P+   S    PRVIP + + + K+GKN + W G    VI+ DP+ +KEV
Sbjct  61    MQKTLKKACSQPVKGFSHAFEPRVIPLYQDVVHKYGKNGYAWFGPEASVIVMDPESIKEV  120

Query  477   LSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSE  656
               K++ F +  ++P+   L +G++ YEGDKW KHRKI NPAF  +KLKHM+P+ +    E
Sbjct  121   TLKYDVFNKPHSNPLSKLLLRGVVSYEGDKWVKHRKIINPAFHQDKLKHMLPSFHTSAME  180

Query  657   MVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASEL  836
              V  W+ +V+   S E+DV P L+T+  + IS TAFG +YE G+R+FELQ E AE     
Sbjct  181   TVSIWDAMVAEKGSTEVDVLPYLQTLTSDAISRTAFGSNYEEGKRIFELQREQAELVVIA  240

Query  837   RHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESN  1016
               S+YIPG RFLPTK NRRM  I K +N  +  I+ +RI AM+ G    ++LL  LLESN
Sbjct  241   LRSLYIPGWRFLPTKMNRRMKSISKVVNNSIGIIVSERIKAMEAGVACEDDLLGTLLESN  300

Query  1017  FKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
             FKEM  HG +E G+SI+D+I ECKLFY AGQETTS LLVWTM+LLS+   WQ LAREEV+
Sbjct  301   FKEMDEHGKKEVGLSIQDVIEECKLFYFAGQETTSTLLVWTMVLLSKYSHWQTLAREEVL  360

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
               FG  KPD+DGL+ LK V+MIL E LRLYPPVP + R   ++ KLG ++LPAG  L +P
Sbjct  361   QHFGTKKPDYDGLHHLKTVSMILYEVLRLYPPVPVIARRSTQEIKLGKMTLPAGGLLSLP  420

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
             I+ LH D E+WGEDA EF PERF +GVS AT G+  + PF  GPRICI  NFA++EAK A
Sbjct  421   IMLLHRDTELWGEDALEFKPERFADGVSHATKGQVIFFPFGWGPRICIAQNFALLEAKMA  480

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             ++ IL+RFSF+LSPSY HAP + +T  P YGA LIL K+
Sbjct  481   MALILQRFSFELSPSYTHAPISIITLRPQYGAHLILHKI  519



>ref|XP_008366858.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=516

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/517 (53%), Positives = 361/517 (70%), Gaps = 4/517 (1%)
 Frame = +3

Query  126   MEV-FCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             MEV   N+ +    I+    AWRVVNW W+RPK LE++LR Q L GN YR   GD KE  
Sbjct  1     MEVSVSNIGVVLVGIIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERT  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
              M+ +  SKPMN LS ++ PRV+P+ + S+  +GKNSF+W G +P V I +P+ +K++L+
Sbjct  61    MMLKQAYSKPMN-LSHDIAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILT  119

Query  483   KHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMV  662
             K   F +  ++P V  L  G   YEG+KW +HR+I NPAF L+KLK M+PA Y   SEM+
Sbjct  120   KIEDFPKLKSNPYVKLLVTGTAHYEGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSSEMI  179

Query  663   GRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRH  842
               WE +V +  S ELDV P L+ +  ++IS +AFG SY+ GR++F+L  E  +  +++  
Sbjct  180   KEWESLVLKEGSCELDVRPCLENLTADMISRSAFGSSYKEGRKIFQLLREQLQLVTKVIQ  239

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFK  1022
             +VYIPG RF+PTK N++M GIDKEI  +L  II KR   ++ GE   ++LL +L+ESN K
Sbjct  240   NVYIPGWRFVPTKMNKKMKGIDKEIGGLLMGIINKREEGIRAGEATKDDLLGILMESNLK  299

Query  1023  EMKHHGNQE-FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             E+K HGN +  GM + D+I ECKLFY AGQETTS LLVWTM+LL +NQ WQ+ AREEV+ 
Sbjct  300   EIKEHGNNKGVGMXMYDVIEECKLFYFAGQETTSLLLVWTMVLLGQNQIWQDRAREEVLQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             VFG +KPDFDG+  LK+VTMIL+E LRLY P P L+R   +  +  N SLPAGV + +P+
Sbjct  360   VFGSNKPDFDGIIHLKVVTMILHEVLRLY-PAPLLVRTTSKKTEFRNFSLPAGVEVALPM  418

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             + +HHD E+WG+DA EF PERF EGV+K T  K  Y PFSGGPR+CIG NFAMVEAK A+
Sbjct  419   LLIHHDRELWGDDAQEFKPERFSEGVAKTTKNKFTYFPFSGGPRVCIGQNFAMVEAKLAI  478

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
             S IL+ F+F+LSPSYAHAP   L  +P +GA +IL K
Sbjct  479   SLILQHFTFELSPSYAHAPSAKLILHPQFGAHIILHK  515



>ref|XP_010323670.1| PREDICTED: cytochrome P450 CYP72A219 isoform X2 [Solanum lycopersicum]
Length=431

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/430 (60%), Positives = 334/430 (78%), Gaps = 1/430 (0%)
 Frame = +3

Query  387   SIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTF-QQNLADPVVYKLSQGLLKYEGD  563
             S+   GK+SF+WLG  P+V+IT P+HVKE+ +K+  + +Q   +P    L++GL+  E D
Sbjct  2     SVSIKGKSSFIWLGPYPIVLITKPEHVKEIFTKNYVYLKQTHPNPFTKLLAKGLVSLEED  61

Query  564   KWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPELKTIAVN  743
             KW+KHRKI NP F +EKLKHM+PA Y  CSEM+ +WEEIV +  S E+DVWP+L+ +   
Sbjct  62    KWAKHRKIINPTFHVEKLKHMLPAFYVCCSEMISKWEEIVPKGTSTEIDVWPDLEKMTSE  121

Query  744   VISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNGIDKEINT  923
             VIS TAFG SYE GR +FELQ E AEH  E+  S+YIPG RFLPTK+N+RM  I+KEI T
Sbjct  122   VISRTAFGSSYEEGRIVFELQKEQAEHVMEVARSIYIPGSRFLPTKRNKRMLEIEKEIQT  181

Query  924   VLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISECKLFYLA  1103
              ++RII+KR+ AM+ GE + ++LL +LLESN KE++ HG+++FGM+  ++I ECKLFY A
Sbjct  182   TIRRIIDKRLRAMEGGETSKDDLLGILLESNMKEIEQHGSKDFGMTTVEVIEECKLFYFA  241

Query  1104  GQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMILNESLRL  1283
             GQETTS LLVWTMILL  + EWQ  AREEV+ VFG+DKPD +GL RLKIVTMIL E+LRL
Sbjct  242   GQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDKPDLEGLGRLKIVTMILYETLRL  301

Query  1284  YPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPERFREGVSK  1463
             +PP+PT  R  KE+ KLG L+LPAGV L+VP I +H+D E+WGEDA EF PERF EGVSK
Sbjct  302   FPPLPTFGRTNKEEVKLGELNLPAGVILIVPAILVHYDKEIWGEDAKEFKPERFSEGVSK  361

Query  1464  ATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYTGLTTNPL  1643
             AT G+  ++PF GGPRICIG NFAM+EAK AL+ IL+RFSF+LSPSY HAP+  +T +P 
Sbjct  362   ATKGQFSFIPFGGGPRICIGQNFAMMEAKMALAMILQRFSFELSPSYTHAPFAVVTIHPQ  421

Query  1644  YGAPLILQKL  1673
             YGAPL+++KL
Sbjct  422   YGAPLLMRKL  431



>ref|XP_010060782.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/496 (55%), Positives = 358/496 (72%), Gaps = 8/496 (2%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWRVVNW W+RPK LE+ LR Q L G PY   +GD KE ++++ E  SKP+ V SD++ P
Sbjct  21    AWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAV-SDDIKP  79

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             R++P+  +S Q +GK+SF+W+G  P V IT+P+ +KE+ SK N + +  ++P+V  L+ G
Sbjct  80    RLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPRPGSNPLVKLLTNG  139

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  +EG+KW++HRKI NPAF +EKLK M+PA Y  C+EMVGRWE++VS   S E+D W +
Sbjct  140   LFDHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLVSVERSCEIDAWVD  199

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +   VIS TAFG S+E G+R+ ELQ E A+       SVYIPG RF+PTK NRRM  
Sbjct  200   LQNLTREVISRTAFGSSFEEGKRISELQGEQAQLTIIALQSVYIPGWRFVPTKMNRRMKS  259

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
             IDKE+  +L  II +R  A++EGE A ++LL +LLESN KE         GMS+ D++ E
Sbjct  260   IDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVMEE  312

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             C+LFY AGQETTS LLVWTM+LLS + +WQ  AREEV+ +FG  KPD DGL+ LKIVTMI
Sbjct  313   CRLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMI  372

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             LNE LRLYPPV  + R V ++ KLG L++P  V+LL+P + +HHD E+WGEDA EF PER
Sbjct  373   LNEVLRLYPPVTEMTRKVPKETKLGKLTIPPEVQLLMPTLLIHHDKELWGEDAEEFKPER  432

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F EGVSKAT  +  + PF  GPRICIG NFA++EAK AL+ IL++F+F+LSPSYAHAP  
Sbjct  433   FAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPSYAHAPSN  492

Query  1623  GLTTNPLYGAPLILQK  1670
              +T  P YG  +IL+K
Sbjct  493   VITLQPRYGVQVILRK  508



>ref|XP_009356829.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/517 (52%), Positives = 361/517 (70%), Gaps = 4/517 (1%)
 Frame = +3

Query  126   MEV-FCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             MEV   N+ +    I+    AWRVVNW W+RPK LE++LR Q L GN YR   GD  E  
Sbjct  1     MEVSVSNIGVVLVRIIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLTERT  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
              M+ +  SKPMN LS ++ PRV+P+ + S+  +GKNSF+W G +P V I +P+ +K++L+
Sbjct  61    MMLKQAYSKPMN-LSHDIAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILT  119

Query  483   KHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMV  662
             K   F +  ++P V  L  G   Y+G+KW +HR+I NPAF L+KLK M+PA Y   +EM+
Sbjct  120   KIEDFPKLKSNPYVKLLVTGTAHYQGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSNEMI  179

Query  663   GRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRH  842
               WE +V +  S ELDV P L+ +  ++IS +AFG SY+ GR++F+L  E  +  S++  
Sbjct  180   KEWESLVLKAGSCELDVQPCLENLTADMISRSAFGSSYKEGRKIFQLLREQVQLVSKVIQ  239

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFK  1022
             +VYIPG RF+PTK N++M GIDKEI  +L  II KR   ++ GE   ++LL +L+ESN K
Sbjct  240   NVYIPGWRFVPTKMNKKMKGIDKEIGGLLMGIINKREEGIRAGEATKDDLLGILMESNLK  299

Query  1023  EMKHHG-NQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             E+K HG N+  GMS +D+I ECKLFY AGQETTS LLVWTM+LL +NQ WQ+ AREEV+ 
Sbjct  300   EIKEHGNNKRVGMSTDDVIEECKLFYFAGQETTSLLLVWTMVLLGQNQIWQDRAREEVLQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             VFG +KPDFDG+  LK+VTMIL+E LRLY P P L+R   +  +  N SLPAGV + +P+
Sbjct  360   VFGSNKPDFDGIIHLKVVTMILHEVLRLY-PAPLLVRTTDKKTEFRNFSLPAGVEVALPM  418

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             + +HHD E+WG+DA EF PERF EGV+K T  K  Y PFSGGPR+CIG NFAMVEAK A+
Sbjct  419   LLIHHDRELWGDDAQEFKPERFSEGVAKTTKNKFTYFPFSGGPRVCIGQNFAMVEAKLAI  478

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
             S IL+ F+F+LSPSYAHAP   L  +P +GA +IL K
Sbjct  479   SLILQHFTFELSPSYAHAPSAKLMLHPQFGAHIILHK  515



>ref|XP_008219294.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=515

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/503 (53%), Positives = 358/503 (71%), Gaps = 5/503 (1%)
 Frame = +3

Query  168   MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV-L  344
             + +  AWR +NW W+RPK LE+ LR Q   GN YRL +GDTK+ + M+ + +SKPM +  
Sbjct  15    IVIAWAWRALNWVWLRPKKLERCLREQGFTGNSYRLLFGDTKDSSMMLRQAQSKPMKLST  74

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             S ++ PRV+P+  +S+  +G+NSFVW+G IP V I +P+ +KE+ +KH   Q+ +A+P++
Sbjct  75    SHDIAPRVMPFVHQSVNTYGRNSFVWMGPIPKVNIMNPEDLKEIFNKHENMQRTVANPII  134

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L QGL     +KW+KHRKI NPAF LEKLK M+P  Y+ C+EM+  WE +VS+  S E
Sbjct  135   DLLVQGLGSTVDEKWAKHRKIINPAFHLEKLKGMLPTFYQSCNEMINEWESLVSKEGSCE  194

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             LDVWP L  ++ +VIS  AFG SY+ GR++F+L  +  ++ +    SVYIP   FLP+K 
Sbjct  195   LDVWPCLLNMSADVISRAAFGSSYQEGRKIFQLLQQQTKNYAAAIQSVYIP---FLPSKH  251

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-FGMS  1061
             N+RM  I+KEI  +L+ II KR  A+K GE ++++LL +LLESN KE++ HGN+   GMS
Sbjct  252   NKRMKEINKEIRVLLRGIINKREEAIKMGEASNHDLLGILLESNLKEIREHGNKRNTGMS  311

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             +ED+I ECKLFY AGQETTS LLVW ++LLS+NQ+WQ  AREEV+  FG + P FD L++
Sbjct  312   VEDVIEECKLFYFAGQETTSTLLVWAIVLLSQNQKWQARAREEVLQAFGSNPPTFDALSQ  371

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LK+VTM+L E LRLYPP   L R ++   +LG  SLPAGV + + I+ +HH+ E+WGEDA
Sbjct  372   LKVVTMVLLEVLRLYPPGIELPRTLRRKTQLGKFSLPAGVDVSLHILLVHHNKELWGEDA  431

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
             +EF PERF EG+SKAT  +  Y PF  GPRICIG NFAM+EAK ALS IL+ F+F+LSPS
Sbjct  432   HEFKPERFSEGISKATKNQFAYFPFGAGPRICIGQNFAMLEAKLALSLILQHFTFELSPS  491

Query  1602  YAHAPYTGLTTNPLYGAPLILQK  1670
             YAHAP       P YGA +IL K
Sbjct  492   YAHAPALLTILQPQYGAHIILSK  514



>ref|NP_188079.1| cytochrome P450, family 72, subfamily A, polypeptide 7 [Arabidopsis 
thaliana]
 dbj|BAB02393.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAL61910.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAO30051.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AEE75547.1| cytochrome P450, family 72, subfamily A, polypeptide 7 [Arabidopsis 
thaliana]
Length=512

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/499 (53%), Positives = 358/499 (72%), Gaps = 8/499 (2%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
              WR+V W WI+PK LE  L+ Q L G PY    GD K    MM E +SKP+NV +D++ P
Sbjct  20    TWRIVKWVWIKPKMLESSLKRQGLTGTPYTPLVGDIKRNVDMMMEARSKPINV-TDDITP  78

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             R++P   + +  HGK  F+W+G +P ++IT+P+ +KEV +K N F++    P++  L+ G
Sbjct  79    RLLPLALKMLNSHGKTFFIWIGPLPTIVITNPEQIKEVFNKVNDFEKASTFPLIRLLAGG  138

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESG-ELDVWP  719
             L  Y+GDKW+ HR+I NPAF LEK+K+M+PA Y  CSE+V +WE++ +  ES  E+DVWP
Sbjct  139   LASYKGDKWASHRRIINPAFHLEKIKNMIPAFYHCCSEVVCQWEKLFTDKESPLEVDVWP  198

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
              L  +  +VIS TAFG SY+ G+R+F+LQ ELAE  ++     YIPG RF PTK NRRM 
Sbjct  199   WLVNMTADVISHTAFGSSYKEGQRIFQLQGELAELIAQAFKKSYIPGSRFYPTKSNRRMK  258

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIIS  1079
              ID+E++ +L+ I+ KR  A + GE A+++LL +LLESN +E    GN   GMS+ED++ 
Sbjct  259   AIDREVDVILRGIVSKREKAREAGEPANDDLLGILLESNSEE--SQGN---GMSVEDVMK  313

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDD-KPDFDGLNRLKIVT  1256
             ECKLFY AGQETTS LLVWTM+LLS +Q+WQ  AREEVM V G++ KPD + LN LK++T
Sbjct  314   ECKLFYFAGQETTSVLLVWTMVLLSHHQDWQARAREEVMQVLGENNKPDMESLNNLKVMT  373

Query  1257  MILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNP  1436
             MI NE LRLYPPV  L R+V ++ KLG L+LPAG+++ +P I +  D E+WG+DA +F P
Sbjct  374   MIFNEVLRLYPPVAQLKRVVNKEMKLGELTLPAGIQIYLPTILVQRDTELWGDDAADFKP  433

Query  1437  ERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAP  1616
             ERFR+G+SKAT  +  + PF  GPRICIG NFAM+EAK A++ IL++FSF+LSPSY HAP
Sbjct  434   ERFRDGLSKATKNQVSFFPFGWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYVHAP  493

Query  1617  YTGLTTNPLYGAPLILQKL  1673
              T +TT P +GA LIL KL
Sbjct  494   QTVMTTRPQFGAHLILHKL  512



>ref|XP_009394212.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/505 (53%), Positives = 357/505 (71%), Gaps = 2/505 (0%)
 Frame = +3

Query  162   SIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV  341
              ++FL  A RV+NWAW RP+ LE+ LR Q L G PYR  YGD KEI ++  E ++KPM  
Sbjct  19    GLLFLAWALRVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRLRKEARAKPMP-  77

Query  342   LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS-KHNTFQQNLADP  518
             L+  ++PR++P+F  ++ ++GK SF W G +P V ITDP+ V+EVLS K   F +   +P
Sbjct  78    LAHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGKPTQNP  137

Query  519   VVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNES  698
             +    S+GL  YEG+KW KHR+I NPAF  EKLK M+PA    CS+++ RWE +      
Sbjct  138   LSRFFSKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEAC  197

Query  699   GELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPT  878
              ELDVWPEL++ + +VIS TAFG SYE GR++F+LQ E AE   ++  ++Y+PG RFLPT
Sbjct  198   YELDVWPELQSFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPT  257

Query  879   KKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGM  1058
              KN+R+  ID+EI ++L+ II+KR   +K G+ ++++LL +L+ESN K ++  GN+  GM
Sbjct  258   PKNKRIKAIDREIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKHLQEDGNKNAGM  317

Query  1059  SIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLN  1238
             + ED+I ECKLFY AGQETTS LL WTMI LS +  WQ  AREEV+ VFG++KPDFDGL+
Sbjct  318   TTEDVIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDFDGLS  377

Query  1239  RLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGED  1418
              LKIVTMIL E LRLYPP   + R   +  K+G++  P GV LL+  IF+HHDP +WG+D
Sbjct  378   HLKIVTMILYEVLRLYPPFILIRRQTYKTMKIGDVVYPPGVLLLLHAIFVHHDPNLWGKD  437

Query  1419  ANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSP  1598
             A+EFNPERF EGVSKA+  +  + PF GGPRICIG NF+++EAK  LS IL+ F F LSP
Sbjct  438   ASEFNPERFAEGVSKASKEQVAFFPFGGGPRICIGQNFSLLEAKMGLSMILQHFYFDLSP  497

Query  1599  SYAHAPYTGLTTNPLYGAPLILQKL  1673
             SYAHAP T  T  P  GA + L+KL
Sbjct  498   SYAHAPRTIFTLFPQRGAQIRLRKL  522



>ref|XP_007022097.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
 gb|EOY13622.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
Length=518

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/504 (53%), Positives = 358/504 (71%), Gaps = 2/504 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             +  LV  WR+++W W+RPK LE+ LR Q L GN YR   GD KE   M  + +SKPM  L
Sbjct  16    VGILVWGWRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSRQARSKPMP-L  74

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             SD++   V P+  ++++  GK+SF W+G IP V I +P+ ++E+ +K N FQ+  ++P+V
Sbjct  75    SDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDFQKPHSNPLV  134

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L  GL+  +G++W+KHRKI NPAF  +KLK+M+PA Y+ C EM+ +WE++V    S E
Sbjct  135   SLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSCIEMISKWEKLVFLEGSSE  194

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             LDVWP L  +  +VIS  AFG SYE GRR+F+L  +      ++  S YIPG R+LPTK 
Sbjct  195   LDVWPYLVKLTRDVISRAAFGSSYEEGRRIFQLLEDQTSLTMQVVQSAYIPGWRYLPTKT  254

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-FGMS  1061
             NR+M  I K+I   LK +I+KR  A K  E ++++LL +L+ESN +E++  G+ +  GMS
Sbjct  255   NRKMKVIAKDIKDSLKGMIKKREEATKASEVSNDDLLGILVESNIREIQEQGDHKNMGMS  314

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             IED+I ECKLFY AGQETTS LLVWTMILL+R+  WQ  AREEV+ VFGD KPD DGLNR
Sbjct  315   IEDVIEECKLFYFAGQETTSVLLVWTMILLARHPHWQTKAREEVLEVFGDSKPDSDGLNR  374

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LK+VTMIL+E LRLYP V  L R V +D +LG L LPAG  + +P++ +HHD E+WG+DA
Sbjct  375   LKVVTMILHEVLRLYPAVVALGRSVPKDTRLGKLLLPAGAEITLPVLLIHHDQELWGDDA  434

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
             +EFNP+RF EGVSKAT  +  Y PF  GPRICIG NFA++EAK AL+ ILR+F F+LSPS
Sbjct  435   HEFNPDRFSEGVSKATKSQVIYFPFGWGPRICIGQNFALMEAKMALAMILRQFWFELSPS  494

Query  1602  YAHAPYTGLTTNPLYGAPLILQKL  1673
             YAH+P T +T  P +GA +IL KL
Sbjct  495   YAHSPCTNITLRPQHGAHIILHKL  518



>emb|CDP15980.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/518 (52%), Positives = 361/518 (70%), Gaps = 1/518 (0%)
 Frame = +3

Query  120   MRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEI  299
             M M  + ++ + S   + L  AW++ NW W++PK LEK L+ Q  KGNPYRL +GD K+I
Sbjct  1     MEMSAYSSIAVLSSCFVLLTLAWKLFNWIWLKPKKLEKLLKQQGFKGNPYRLLFGDLKDI  60

Query  300   AKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVL  479
             +    E +SKP++ LSD+++PR+IP F + +QK+G  +++W G  P + I DP+ ++E  
Sbjct  61    SNSAREARSKPIS-LSDDIIPRIIPEFHKLVQKYGTKTYIWYGPEPAIFIQDPELLREAA  119

Query  480   SKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
                  F +  A      L+ GL  Y GDKW+KHRK+ NP F  EKLK M+PA     SEM
Sbjct  120   QAITVFHKPDAGQFTRLLTPGLASYNGDKWAKHRKLINPVFNGEKLKTMLPAFQTSASEM  179

Query  660   VGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELR  839
             + +WEEIV    S ELD+WP L+ +  + IS TAFG +YE  R++FELQ E  EH  +  
Sbjct  180   MRKWEEIVLPKGSCELDIWPYLQRVTCDAISRTAFGSNYEEARKIFELQGEQLEHCVKAV  239

Query  840   HSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNF  1019
              S++IPG RFLPTK+NRRM  I+KE++  ++RI+  R+ AM+ GE   ++ L  LLESN 
Sbjct  240   WSMFIPGWRFLPTKRNRRMRQIEKEVDDSIRRIVNSRLKAMRAGESCDDDFLGRLLESNS  299

Query  1020  KEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             +E+  HG++  GMS ++++ ECKLFY AGQETTS LL+WTMILLSR Q WQ+ AREEV+ 
Sbjct  300   QEIHKHGSKGVGMSTQEVVEECKLFYFAGQETTSVLLLWTMILLSRYQNWQKRAREEVLQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             +FG +KPD+DGLNRLK+VTMIL E LRLYPP+P   R   E+A+LGNLS+PAG+ +L  I
Sbjct  360   LFGTNKPDYDGLNRLKVVTMILYEVLRLYPPLPVNSRRTAEEARLGNLSIPAGILILKHI  419

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
               +HHDPE+WG+D  EF PERF +GVS A  G+A + PF  GPRIC G NF+M+EAK  +
Sbjct  420   ALIHHDPELWGDDVKEFKPERFSDGVSNAAKGQAAFFPFGWGPRICTGQNFSMLEAKIVM  479

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
               IL+RFSF+ SPSY+HAPY+ +T  P +GA LILQKL
Sbjct  480   VMILQRFSFEFSPSYSHAPYSLITLKPQHGAHLILQKL  517



>gb|EYU38228.1| hypothetical protein MIMGU_mgv1a004669mg [Erythranthe guttata]
Length=516

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/518 (52%), Positives = 370/518 (71%), Gaps = 4/518 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             MEV  ++ L    +  +  + + VNW WI+PK LEK LR + L GNPY+L  GD K++  
Sbjct  1     MEV-GSILLSILVVGLITLSAKFVNWVWIKPKKLEKLLRKEGLNGNPYKLLLGDMKQLIS  59

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             +M E + K +   SD ++P ++P++  +  K G+NSF+W+G  P +II DP  +KE+L K
Sbjct  60    VMKEEQPKSIQ-FSDHLLPHILPHYHHNRTKFGENSFMWVGPSPKLIIADPQLMKEILEK  118

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
              N FQ+   DP+   ++ GL+  E +KW+KHR+I NPAF +EKLK MVPA+   CS M+ 
Sbjct  119   PNVFQKPHPDPIGETIAGGLVVLEDEKWTKHRRIINPAFHMEKLKKMVPAIRLSCSNMLD  178

Query  666   RWE-EIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRH  842
             +WE      +ES E+DVWP L+ ++ +VIS  AFG S+E G R+FELQ +  + A EL  
Sbjct  179   QWEASFAGSDESKEIDVWPYLQNLSGDVISRVAFGSSHEQGVRIFELQKDQVKLALELLK  238

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFK  1022
              +++PG RF+PTK NRRM  I KEI ++L+ II +R  A+++GE    +LL  L+ESN +
Sbjct  239   FMFVPGWRFVPTKANRRMKAISKEIQSLLRDIINQREKAIEDGEVIGEDLLGTLMESNLR  298

Query  1023  EMKHHGNQE-FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             E+  +G+++  GM+IE++I+ECKLFY AG E+TS LL+WTM++LS+NQEWQ  AREEV+ 
Sbjct  299   EIDENGSKKNMGMTIEEVINECKLFYFAGSESTSGLLMWTMVMLSKNQEWQARAREEVLQ  358

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             +FG+ +P FDGLNRLKIVTMILNE LRLY P P + R   +  KLGN++LP GV LL+ I
Sbjct  359   IFGNKEPTFDGLNRLKIVTMILNEVLRLYSPAPLISRAPAKAVKLGNINLPVGVDLLLLI  418

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
               +HHDP++WG+DANEFNPERF EG+S AT G+  +LPFS GPRICIGL FAM EAK A+
Sbjct  419   GLVHHDPKIWGDDANEFNPERFSEGISGATKGQFSFLPFSLGPRICIGLQFAMTEAKLAV  478

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             S +L+RF+F+LSPSY HAP+  LT  P YGAPLIL+KL
Sbjct  479   SMMLQRFAFELSPSYLHAPFPILTLQPQYGAPLILRKL  516



>ref|XP_006364094.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/509 (52%), Positives = 367/509 (72%), Gaps = 4/509 (1%)
 Frame = +3

Query  150   LFSFSIMFLVC-AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKS  326
             +FSF+I+ ++  AWR++N+ W +PK LEK LR Q  KGN Y+L YGD KE+ KM+ E  S
Sbjct  12    IFSFAIILVLGWAWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMKEMKKMIEEATS  71

Query  327   KPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQN  506
             KP++   D + PR+ P+  ++I  +GKN FVW G  P V+IT+P  +KEVL+K+  +Q+ 
Sbjct  72    KPIDFSHDLIWPRINPFIHKTITNYGKNCFVWFGPKPAVLITEPKLIKEVLTKNYVYQKA  131

Query  507   LADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS  686
                P++     GL  +E DKW+ HR+I NPAF ++KLKHM+PA     +EM+  W+E++S
Sbjct  132   RGSPLLKLAISGLAAHEKDKWATHRRILNPAFHIDKLKHMLPAFKLTVNEMLNIWKEVIS  191

Query  687   RNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGR  866
             ++ + E+DVWP L+T+  + IS TAFG +YE G++ FELQ E  E  S++ HS+YIPG R
Sbjct  192   KDGT-EIDVWPYLQTLTSDAISRTAFGSNYEEGKKNFELQKEQIELISKMTHSIYIPGWR  250

Query  867   FLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQ  1046
             F+PTKKN+RM  I  E+  ++  II KR+  M E  E+ ++LL +LL SN KE++ HGN+
Sbjct  251   FVPTKKNKRMMQIFYEVKALILGIINKRM-RMIEAGESHDDLLSILLTSNLKEIQQHGNK  309

Query  1047  EFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDF  1226
             +FGMSI+++I ECKLFY AGQETTS LLVWTMILL +   WQE AREEV+ VF  D+ D+
Sbjct  310   KFGMSIDEVIEECKLFYFAGQETTSTLLVWTMILLCKYPIWQERAREEVLQVFASDELDY  369

Query  1227  DGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEM  1406
             D LN+LK+VTMILNE LRLY  V  + R+V  + KLG+L LP+GV+L++  + +HHD E+
Sbjct  370   DKLNQLKVVTMILNEVLRLYTSVYAINRMVNTETKLGDLCLPSGVQLILATMLVHHDTEI  429

Query  1407  WGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSF  1586
             WG+DA EF PERF EG+SKAT G+  + PF+ GPRICIG NFAM+EAK A+  IL+ ++F
Sbjct  430   WGDDAMEFKPERFSEGISKATKGQVVFFPFNWGPRICIGQNFAMLEAKMAMVMILKHYAF  489

Query  1587  KLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +LSPSYAHAP+  L   P YGA LI+ KL
Sbjct  490   ELSPSYAHAPHP-LLLQPQYGAQLIMHKL  517



>ref|XP_008386157.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/509 (52%), Positives = 356/509 (70%), Gaps = 2/509 (0%)
 Frame = +3

Query  150   LFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSK  329
             L   +++ +  AWR++NW W+RPK LE++LR Q L GN YR + GD KEI+ M+ +  SK
Sbjct  12    LVGITVIIIAGAWRLLNWLWLRPKKLERYLRQQGLTGNSYRFYTGDMKEISTMIKQAYSK  71

Query  330   PMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNL  509
             P++ LS ++ PRVIP+ ++ +  +GKN FVW+G  P V ITDP+ +K +L+K + F +  
Sbjct  72    PVS-LSHDIAPRVIPFDYQLVNTYGKNYFVWMGPTPRVNITDPEDMKTILTKMDDFPKPX  130

Query  510   ADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSR  689
             A+P+   L  G+   EG+KW+KHR+I NP F +EKLK M+P  Y+ CSEM+  WE +V +
Sbjct  131   ANPLXKLLXTGIALCEGEKWAKHRRIINPVFHIEKLKRMLPEFYQSCSEMIVEWESLVLK  190

Query  690   NESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRF  869
               S ELDVWP  + +  +VIS TAFG SY+ GR++F+L  E A+ A ++  SVYIPG RF
Sbjct  191   EGSCELDVWPYFENMTADVISRTAFGSSYKEGRKIFQLLKEQAKLAIKVVQSVYIPGARF  250

Query  870   LPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-Q  1046
             LPTK N +M  ID+EI  +L  II  R  A++ GE   ++LL +L+ESN  E+K HGN +
Sbjct  251   LPTKINMKMKEIDREIRALLMGIINXREDAIRAGEATKDDLLGVLMESNLNEIKEHGNNK  310

Query  1047  EFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDF  1226
             + GMS+ D+I ECKLFY AGQETTS LLVWTM+LL + Q WQ+ AREEV+ VFG +KP+F
Sbjct  311   KVGMSMHDVIEECKLFYFAGQETTSVLLVWTMVLLGQYQNWQDRAREEVLQVFGSNKPEF  370

Query  1227  DGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEM  1406
              G+  LK+VTMIL+E LRLYP +  + R   +  +L   SLPAGV + +  + +HHD ++
Sbjct  371   XGIIHLKVVTMILHEVLRLYPALTVMTRTTNKKTQLSKYSLPAGVEVALSTLLVHHDKQL  430

Query  1407  WGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSF  1586
             WG+DA+EF PERF EG+ KAT  K  Y PF GGPR CIG NFAMVEAK ALS IL+ F+F
Sbjct  431   WGDDAHEFKPERFSEGIXKATKNKFMYFPFGGGPRNCIGQNFAMVEAKLALSLILQHFTF  490

Query  1587  KLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +LS SYAHAP + L   P +GA +IL KL
Sbjct  491   ELSASYAHAPSSNLIIQPQFGAHIILHKL  519



>ref|XP_011098148.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=519

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/510 (53%), Positives = 358/510 (70%), Gaps = 7/510 (1%)
 Frame = +3

Query  162   SIMFLVCAWRVV---NWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             SI+ LV    VV   NW W RPK LEK LR Q L GNPYRLF GD ++   +M   + K 
Sbjct  11    SIITLVSTTLVVKLLNWVWFRPKKLEKLLRKQGLSGNPYRLFLGDMQDFGNVMKTEQPKT  70

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             +  LSD++ P ++PY+   I K+GK SFVW G  P V + DP+ +KE+LSK   F + L 
Sbjct  71    LK-LSDDLPPHILPYYHNIIHKYGKLSFVWFGPSPRVNVADPELIKEILSKPGLFHKPLP  129

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWE-EIVSR  689
             DP+   +  GLL  EGDKW+KHRKI N AF +EKLK+M+PAM+  CS+M+ +WE  I S 
Sbjct  130   DPIGETIVGGLLFLEGDKWAKHRKIINQAFHMEKLKNMIPAMFLSCSKMIEKWEASISSC  189

Query  690   NESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRF  869
               S E+DVWP L+ ++ +VIS TAFG SYE GRR+FELQ E  +    L    +IPG R+
Sbjct  190   GSSQEIDVWPSLEDLSGDVISRTAFGSSYEEGRRIFELQKEQVKLVLHLLQFSFIPGWRY  249

Query  870   LPTKKNRRMNGIDKEINTVLKRIIEKRIGAMK--EGEEASNNLLDMLLESNFKEMKHHGN  1043
              PT  NRR+  I K+I ++L+ II +R  AM+  +GE   N+LL +L+ESNF+E++ HGN
Sbjct  250   FPTNANRRLREITKQIESLLRGIINQRGKAMERADGEIIRNDLLGILMESNFREIQQHGN  309

Query  1044  QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPD  1223
             +  G+SIED+I ECKLFY AG+ETTS+LLVWTM+LLS++Q+WQ  AREEV+ VFG  +P 
Sbjct  310   KNVGLSIEDVIEECKLFYFAGKETTSNLLVWTMVLLSKHQDWQARAREEVLQVFGKKQPT  369

Query  1224  FDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPE  1403
             FDGL++LKIVTMI  E LRLYPP P +IR   +  +LG+  +P GV+L + I  LHHDP+
Sbjct  370   FDGLHQLKIVTMIFQEVLRLYPPAPLIIRAPTKTVQLGSTIIPVGVQLTLLIGLLHHDPD  429

Query  1404  MWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFS  1583
             +WG D  EF PERF EG+S AT  +  ++PFS GPR+C+G NFAM+EAK AL+ IL+ FS
Sbjct  430   IWGNDVKEFKPERFSEGISSATKTQYSFIPFSSGPRVCVGQNFAMIEAKMALAMILQHFS  489

Query  1584  FKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             F+LS SY HAP+  +T  P YGAPLI++KL
Sbjct  490   FELSSSYLHAPFPIMTLQPQYGAPLIVRKL  519



>ref|XP_009394217.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=538

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/505 (54%), Positives = 358/505 (71%), Gaps = 2/505 (0%)
 Frame = +3

Query  162   SIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV  341
              ++FL  A RV+NWAW RP+ LE+ LR Q L G  YR  YGD KE A+   E ++KPM  
Sbjct  35    GLLFLAWALRVLNWAWWRPRWLERALRAQGLNGTAYRFPYGDLKENARFSKEARAKPMP-  93

Query  342   LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS-KHNTFQQNLADP  518
             LS  ++PR++P+   ++ ++GK SF WLG +P V ITDP+ V+EVLS K   F +   +P
Sbjct  94    LSHNIIPRLLPFLNRAMDEYGKISFTWLGPVPQVTITDPELVREVLSNKFGHFGKPNQNP  153

Query  519   VVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNES  698
             +V   ++GL  YEG+KW KHR+I NPAF  EKLK M+PA    CS+++ RWE +      
Sbjct  154   LVRFFARGLFVYEGEKWVKHRRILNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEAC  213

Query  699   GELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPT  878
              ELDVWPEL++   +VIS TAFG SYE GR +F LQ E AE   ++  ++Y+PG RFLPT
Sbjct  214   YELDVWPELQSFTGDVISRTAFGSSYEEGRPIFHLQAEQAELLIQVVQNLYVPGYRFLPT  273

Query  879   KKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGM  1058
              KN+R+  ID+EI ++L+ II+KR   +K G+ ++++LL +L+ESN K ++  GN+  GM
Sbjct  274   PKNKRIKAIDREIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKRLQEDGNKNAGM  333

Query  1059  SIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLN  1238
             + ED+I ECKLFY AGQETTS LL WTMI LS +  WQ  AREEV+ VFG++KPDFDGL+
Sbjct  334   TTEDVIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDFDGLS  393

Query  1239  RLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGED  1418
              LKIVTMIL E LRLYPPV  L R   +  KLG++  P GV LL+ +IF+HHDP +WG+D
Sbjct  394   HLKIVTMILYEVLRLYPPVIILRRQTYKTMKLGDVVYPPGVLLLLHVIFVHHDPNLWGKD  453

Query  1419  ANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSP  1598
             A+EFNPERF EGVSKA+  +  + PF GGPRICIG NFA++EAK  LS IL+ FSF LSP
Sbjct  454   ASEFNPERFAEGVSKASKEQVAFFPFGGGPRICIGQNFALLEAKMGLSMILQHFSFDLSP  513

Query  1599  SYAHAPYTGLTTNPLYGAPLILQKL  1673
             SYAHAP+T    +P +GA + L+KL
Sbjct  514   SYAHAPHTVFIHHPQHGAQIRLRKL  538



>gb|AGX93059.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Rauvolfia serpentina]
Length=520

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/521 (53%), Positives = 359/521 (69%), Gaps = 6/521 (1%)
 Frame = +3

Query  126   MEV-FCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIA  302
             MEV F ++ +  F  + L   +RV++W W RPK LEK LR Q  KGNPYRLF GD  E  
Sbjct  1     MEVSFKSVTVLGFVGLALYWVYRVLDWIWFRPKKLEKCLREQGFKGNPYRLFLGDQYESG  60

Query  303   KMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS  482
             K++ E  SKP+ V  D V  R++P+  ++++ HGKNSF+W+G IP V ITDP+ +KEVL+
Sbjct  61    KLIKEAMSKPIGVEED-VKKRIVPHILKTVETHGKNSFMWVGRIPRVQITDPELIKEVLT  119

Query  483   KHNTFQQNL--ADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSE  656
             K+  FQ+N    DP+   L  G+   EG+ W+K RKI N AF  EKLK M+PA Y  C +
Sbjct  120   KYYKFQKNHHDLDPITKFLLTGIGSLEGETWAKRRKIINAAFHFEKLKLMLPAFYLSCRD  179

Query  657   MVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASEL  836
             MV +W++ V    S E+DVW +++T+  +VIS T FG +Y  GRR+FEL  EL     ++
Sbjct  180   MVAKWDKKVPEGGSAEVDVWHDIETLTGDVISRTLFGSNYGEGRRIFELMKELTALTIDV  239

Query  837   RHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEAS-NNLLDMLLES  1013
               SVYIPG RFLPTK+N RM  IDKE+   +  II K+   MK GE A+ ++ L +LLE 
Sbjct  240   IRSVYIPGHRFLPTKRNNRMRAIDKEVRVRITEIINKKTKIMKAGEAAAADDFLGILLEC  299

Query  1014  NFKEMKHHG-NQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREE  1190
             N  E++  G N+  GM+IE+II ECKLFY AGQ+TTS LLVWTM+LLSR  EWQ  AREE
Sbjct  300   NLNEIREQGHNKTAGMTIEEIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQTRAREE  359

Query  1191  VMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLL  1370
             V  VFG+  PD+DG++ LK++TMIL E LRLY PV  L ++  ED +LG   +PAGV+L+
Sbjct  360   VFQVFGNKTPDYDGISHLKVITMILYEVLRLYTPVAELTKVAHEDTQLGKYLIPAGVQLM  419

Query  1371  VPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAK  1550
             +P + LHHDPE+WGED  EF PERF EGV KAT  +  + PFS GPR+CIG NFA++EAK
Sbjct  420   MPQVLLHHDPEIWGEDVMEFKPERFAEGVLKATKSQGSFFPFSLGPRMCIGQNFALLEAK  479

Query  1551  TALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              A++ ILRRFSF+LS SY HAP+T +T  P YGA LIL KL
Sbjct  480   MAMTLILRRFSFELSLSYVHAPFTLITMQPQYGAHLILHKL  520



>ref|XP_009797437.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=515

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/517 (50%), Positives = 366/517 (71%), Gaps = 3/517 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             M++   LF        ++  W++VNW W+RP+ LEK  R Q + G+PYR  YGDTKE+A+
Sbjct  1     MKIVAILFSAIVINALVIWGWKMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAE  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             +  E   KP+  L+D+++PR+ P++  ++ K+G + + W+G  P + + +P+ +KE+++ 
Sbjct  61    LTKEAMLKPIK-LTDDILPRIFPFYHHTLNKYGNHCYAWIGPEPRIFVMEPELIKEIVTN  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
             +  F++    P+V  L  G+  YE +KW+KHRKI N AF  EKLK M+PAM+  C +M+ 
Sbjct  120   NTIFKKPKPAPLVQLLVSGISSYEDEKWAKHRKIINTAFYAEKLKCMLPAMHTSCEDMIN  179

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE ++S N+S ELDV P  + +  +VIS TAFG SY  G R+F LQ ELAE   +   S
Sbjct  180   KWEILLSENKSYELDVHPYFEDLTSDVISRTAFGSSYAEGTRIFHLQKELAELTRQAFQS  239

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASN-NLLDMLLESNFK  1022
             VYIPG R+LPT+ NRRM  ID E+  +L++I+ KR  AMK GE +   +LL +LL+SN K
Sbjct  240   VYIPGWRYLPTRTNRRMKAIDNELRDILRKIVSKRERAMKVGEASDEEDLLGILLKSNLK  299

Query  1023  EMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             E++  G ++FGM+ +++I ECK+FY AGQE++S+LL+WTM+LLS +Q WQ  AREEV  V
Sbjct  300   EIQE-GGRKFGMTTDEVIEECKIFYFAGQESSSNLLIWTMVLLSMHQNWQARAREEVQQV  358

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             F ++KPDF+GL+RLKIVTMILNE LRLYPP P  +R   ++ KLGN+S+P  V L++P I
Sbjct  359   FQNNKPDFEGLSRLKIVTMILNEVLRLYPPAPYFVRKAYKETKLGNMSIPPEVILVIPTI  418

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
             F+HH+PE+WG+D  EF PERF EG++ AT  + C+LPFS GPRICIG NFA++E K AL+
Sbjct  419   FVHHNPELWGDDVKEFKPERFAEGIATATKNRLCFLPFSWGPRICIGNNFAIMETKIALA  478

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL+RF+F+LSPSY HAP   +T  P  GA LILQKL
Sbjct  479   MILQRFAFQLSPSYTHAPTYVVTLRPQCGAHLILQKL  515



>ref|XP_010060776.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67641.1| hypothetical protein EUGRSUZ_F01387 [Eucalyptus grandis]
Length=510

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/496 (55%), Positives = 353/496 (71%), Gaps = 8/496 (2%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWR VNW W+RPK LE+ LR Q L G PY   +GD KE  +M+ E KSKP+ V SD++ P
Sbjct  21    AWRAVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENLRMLKEAKSKPIAV-SDDIKP  79

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             R++P+   S Q +GK+ F W+G IP V IT+P+ +KE+ SK   + +  ++ +V  L+ G
Sbjct  80    RLLPFLHRSFQTYGKDWFTWMGPIPRVNITNPEQIKEIFSKIYDYPKPASNALVKLLADG  139

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  +EG+KW++HRKI NPAF +EKLKHM+PA Y  C+EMV RWE+ V    S E+D W +
Sbjct  140   LANHEGEKWARHRKIINPAFHMEKLKHMLPAFYSSCTEMVDRWEKSVLEERSCEVDAWVD  199

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +  +VIS TAFG S+E G+R+FELQ E A  A +   SVYIPG RF+PTK NRRM  
Sbjct  200   LQNLTRDVISRTAFGSSFEEGKRIFELQEEQALLAIKALQSVYIPGWRFVPTKMNRRMQN  259

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
             IDKE+  +L  I+ +R  A++ G  A ++LL +LLESN KE         GMS+ D+I E
Sbjct  260   IDKEVQALLMDIVRRREKAIRAGGAAGDDLLGLLLESNMKE-------NAGMSLHDVIEE  312

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY+AGQETTS LLVWTM+LLS + +WQ  AREEV+  FG  KPDFDGL+ LKIVTMI
Sbjct  313   CKLFYIAGQETTSVLLVWTMVLLSVHPDWQARAREEVLQTFGSKKPDFDGLSHLKIVTMI  372

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             LNE LRLYPPV  L R V ++ KLG L+LPAGV++ +P + +HHD E+WGEDA EF PER
Sbjct  373   LNEVLRLYPPVVVLARKVPKETKLGKLTLPAGVQVSMPTLLIHHDKELWGEDAEEFKPER  432

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F EGVSKAT  +  + PF  GPRIC+G NFAM+EAK AL+ IL++F+F+LS SYAH+P T
Sbjct  433   FTEGVSKATKNQVSFFPFGWGPRICVGQNFAMMEAKMALAMILQQFTFELSASYAHSPLT  492

Query  1623  GLTTNPLYGAPLILQK  1670
              +T  P YG  +IL K
Sbjct  493   KITLQPQYGVQVILHK  508



>ref|XP_009394812.1| PREDICTED: cytochrome P450 72A15-like [Musa acuminata subsp. 
malaccensis]
Length=518

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/504 (51%), Positives = 353/504 (70%), Gaps = 2/504 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             ++ L CA   +NWAW RP+  E+ LR Q L+G PYR   GD KE  +++ E  SKP+  L
Sbjct  16    VLLLACAVWTLNWAWWRPRRQERLLRAQGLRGTPYRFIRGDVKEDRRLLAEALSKPIP-L  74

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS-KHNTFQQNLADPV  521
             S  ++PRV P+   ++ + GK  F W G +P V+I DP+ V+E+LS K   F++    P+
Sbjct  75    SHHIIPRVAPFLRAAMNEFGKTFFTWFGPVPRVMIMDPELVREILSNKFGHFERASLSPL  134

Query  522   VYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESG  701
                ++ GL+ Y G KW+KHR+I NPAF +EKLK M+PA    C ++VGRWE +V +  S 
Sbjct  135   GRAVASGLISYHGGKWAKHRRILNPAFHVEKLKRMLPAFSASCGDLVGRWENLVGQEGSC  194

Query  702   ELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTK  881
             ELDVWPE ++   +VIS  AFG SYE GRR+F+LQ EL +         YIPG RFLPT 
Sbjct  195   ELDVWPEFQSFTGDVISRAAFGSSYEKGRRIFQLQVELTQVVFHAIQRAYIPGYRFLPTP  254

Query  882   KNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMS  1061
             +N R+N I++E+ ++L+ II++R  AM+ GE  +N+LL +L+ESN +  + HGN+  GM+
Sbjct  255   QNNRINAINREVRSLLRGIIKERQEAMRTGEATNNDLLGLLMESNLQHFQEHGNKNAGMT  314

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
              ++++ ECKLFY AGQET S LL WTM++LS + EWQ  AREEV+  FG +KPDFDGL+ 
Sbjct  315   SDEVVEECKLFYFAGQETVSTLLTWTMVVLSMHPEWQVRAREEVLQAFGKNKPDFDGLSH  374

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LKIVTMIL E LRLYPP   + RI  +  KLGN+  P GV L+VPI+F+HHDP++WG+DA
Sbjct  375   LKIVTMILYEVLRLYPPAILIQRIAYKTMKLGNIVYPPGVLLMVPIVFIHHDPDLWGKDA  434

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
             +EF PERF +G++KA+  +  + PFSGGPR+CIG NFA++EAKTAL  IL++FSF+LSP+
Sbjct  435   SEFKPERFAQGIAKASKDQVAFFPFSGGPRVCIGQNFALLEAKTALCMILQQFSFELSPA  494

Query  1602  YAHAPYTGLTTNPLYGAPLILQKL  1673
             Y HAP T +T  P +GA L L KL
Sbjct  495   YTHAPRTFVTLQPQHGAQLRLHKL  518



>dbj|BAL45203.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=520

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/517 (51%), Positives = 369/517 (71%), Gaps = 4/517 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             + ++  + L + + + LV  WRV+NW W++PK LEK LR Q  KGN YRL  GD K+  K
Sbjct  5     LAIYYGIILITVT-LGLVYTWRVLNWIWLKPKRLEKLLREQGCKGNSYRLVLGDLKDSYK  63

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M  + KSKPM  LSD+++PRVIPY  + +Q +GKN F+W GT P +I+T+P+ +K+VL++
Sbjct  64    MGKQAKSKPME-LSDDIIPRVIPYIQQLVQIYGKNPFIWSGTTPRLILTEPELIKDVLNR  122

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
              +  Q+   +   +  S GL+ +EG+KW KHR++ N AFQLEKLK M P+    C++M+ 
Sbjct  123   TSELQKPKYEIFKFLFS-GLIIHEGEKWRKHRRLMNAAFQLEKLKIMAPSFLTSCTDMIS  181

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE  +S + SGE+D+WP L+ +  +VIS  AFG SYE G+R+F+LQ E  E   +    
Sbjct  182   KWEATLSSDGSGEIDIWPSLQNLTSDVISRNAFGSSYEEGKRIFDLQREQGELVMKNLVK  241

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
               IP  RF+PT   RRM+ I+K+I++ L+ II KR  AMK GE   N+LL +LLESN +E
Sbjct  242   SLIPLWRFIPTATQRRMHEIEKDIDSSLRYIINKREKAMKAGEATENDLLGLLLESNHQE  301

Query  1026  MKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             ++ HGN +  GMS+ED++ ECKLFYLAGQE+TS +LVWTMILLSR  +WQE AREEV+ +
Sbjct  302   IRDHGNNKNMGMSLEDVVGECKLFYLAGQESTSTMLVWTMILLSRYPDWQERAREEVLQI  361

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG++KPD++GLN+LKI+ MIL E LRLYPP   + R V +D K GN+ +PAGV + +PII
Sbjct  362   FGNNKPDYEGLNKLKILPMILYEVLRLYPPAFGVTRYVGKDIKFGNMEVPAGVEVFLPII  421

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              L H+ E+WG+DA  FNPERF EG+SKATNG+  Y PF GGPR+C+G NF+++EAK A+S
Sbjct  422   LLQHNNELWGDDAKMFNPERFAEGISKATNGRFIYFPFGGGPRVCMGQNFSLLEAKMAVS  481

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL+ F F+LSP+YAH P   +T  P  GA +IL+K+
Sbjct  482   MILQNFYFELSPTYAHTPNLVMTIQPEKGAHVILRKV  518



>emb|CDX97592.1| BnaA05g24870D [Brassica napus]
Length=512

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/510 (52%), Positives = 364/510 (71%), Gaps = 10/510 (2%)
 Frame = +3

Query  156   SFSIMFLVCAW---RVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKS  326
             + SI   V +W   R +NW W +PK LE +LR Q L G+PY    GD K    ++ E +S
Sbjct  9     TLSIAIAVVSWWLWRTLNWVWFKPKKLESYLRRQGLSGSPYTPLVGDLKRNFSLLKEARS  68

Query  327   KPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQN  506
             KP+  L+D++ PR++PY  + ++ HG+  F WLG IP + I DP+ +KEV +K   F + 
Sbjct  69    KPIK-LTDDITPRLVPYPLKMLKTHGRTYFTWLGPIPTITIMDPEQIKEVFNKVYDFPKT  127

Query  507   LADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS  686
                P+   +  GL  Y+GDKW+KHR+I NPAF LEK+K+MVPA ++ CSE+VG W+++VS
Sbjct  128   HTFPLARLIGTGLASYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGEWDKLVS  187

Query  687   -RNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGG  863
              +  S E+DVWP L ++  +VIS TAFG SY+ G+R+FELQ ELA+   +      IPG 
Sbjct  188   DKGLSCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKHIIPGY  247

Query  864   RFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN  1043
             R+LPTK+NR M    +E+  +L+ I+ KR+ A + GE  S++LL +LLESN  ++K  GN
Sbjct  248   RYLPTKENRMMKAKAREVQDILRGIVNKRLRAREAGEAPSDDLLGILLESNLGQVK--GN  305

Query  1044  QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPD  1223
                GMS ED+I ECKLFY AGQETTS LLVWTM+LLS++Q+WQ  AREEV  VFGD  PD
Sbjct  306   ---GMSTEDVIEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQAKAREEVKQVFGDKVPD  362

Query  1224  FDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPE  1403
              DGLN+LK++TMIL E LRLYPPV  + R + ++ KLG+L+LP GV++ +PI+ + HD E
Sbjct  363   IDGLNQLKVMTMILYEVLRLYPPVTQVSRAIHKEMKLGDLTLPGGVQISLPILLVQHDTE  422

Query  1404  MWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFS  1583
             +WG+DA+EF PERF+EG+SKAT  +  + PF+ GPRICIG NFA++EAK A++ IL+RFS
Sbjct  423   LWGDDASEFKPERFKEGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFS  482

Query  1584  FKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             F+LSPSY HAPYT +T +P YGA LIL+K+
Sbjct  483   FELSPSYVHAPYTVITIHPQYGAHLILKKI  512



>ref|XP_010092744.1| Secologanin synthase [Morus notabilis]
 gb|EXB52089.1| Secologanin synthase [Morus notabilis]
Length=558

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/528 (52%), Positives = 356/528 (67%), Gaps = 42/528 (8%)
 Frame = +3

Query  210   IRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPRVIPYFFES  389
             +RPK LEK LR Q LKGN YR  +GD KE   M  E +SKP+N LSD++  RV P+  ++
Sbjct  31    LRPKRLEKCLRKQGLKGNSYRFLFGDLKESISMYKEARSKPIN-LSDDITTRVFPFVLQT  89

Query  390   IQKHG----------------------------------------KNSFVWLGTIPMVII  449
             +QK+G                                        K+SF+W+G  P V I
Sbjct  90    VQKYGMYLYSTQSGGQTVIFGTQGSQIDHKTLFNKRKAFSFPVSGKDSFMWIGPNPRVNI  149

Query  450   TDPDHVKEVLSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMV  629
             T+P+H+K++ +K   F +   +P+V  L+ GL  YEG+KW+KHRKI NPAF +EKLKHM+
Sbjct  150   TNPEHLKDIFNKIGDFPKPHNNPLVELLATGLASYEGEKWAKHRKIINPAFHVEKLKHML  209

Query  630   PAMYKICSEMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQH  809
             PA Y  C+EM+ +WE  ++   S E+DVWP L+ +  +VIS TAFG SYE GRR+F+LQ 
Sbjct  210   PAFYLSCNEMLKKWESFLNNEGSCEIDVWPYLQNMTGDVISRTAFGSSYEEGRRIFQLQR  269

Query  810   ELAEHASELRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNN  989
             E AE A +   +VY+PG RF PT  N+RM  +D E+  +LK II KR  AM+ GE  +++
Sbjct  270   EQAELAIKAIQTVYVPGWRFAPTTLNKRMKEVDHEVQGLLKDIIHKREKAMRAGEAPNDD  329

Query  990   LLDMLLESNFKEMKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQE  1166
             LL +L+ESNFKE++ HGN +  G+SI D+I ECKLFY AGQETTS LLVWTM+LLSR  +
Sbjct  330   LLGILMESNFKEIQEHGNNKNMGISIRDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPD  389

Query  1167  WQELAREEVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLS  1346
             WQ  AREEV+ VFG + PDFDGL  LKIVTMIL E LR YPPV  L R V++  +LGNLS
Sbjct  390   WQARAREEVLQVFGYNNPDFDGLGHLKIVTMILYEVLRFYPPVILLTRTVQKQTQLGNLS  449

Query  1347  LPAGVRLLVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGL  1526
             LP GV++ +P+I +H D  +WGEDA EF PERF EGVSKAT G+  + PF  GPRICIG 
Sbjct  450   LPPGVQISLPVILVHRDTNLWGEDAKEFKPERFAEGVSKATKGQVSFFPFGWGPRICIGQ  509

Query  1527  NFAMVEAKTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
             NFAM+EAK AL+ IL+RF+F+LSPSYAHAP T +T  P YGA + L K
Sbjct  510   NFAMIEAKMALALILQRFTFELSPSYAHAPCTVITLQPQYGAHITLHK  557



>ref|XP_008443405.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=525

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/500 (53%), Positives = 360/500 (72%), Gaps = 6/500 (1%)
 Frame = +3

Query  189   RVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPRV  368
             R+VNW W+RPK LEK LR Q L GN YR  +GDTKEI   + + +S+ M   S ++  R 
Sbjct  27    RIVNWVWLRPKRLEKLLRQQGLAGNSYRFLFGDTKEIGVAVRQARSQSM-TFSHDIASRA  85

Query  369   IPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGLL  548
              P  + +I K+GK+SF W+GT P V IT+P+ VK V S+ N  ++  + P+  ++  GL+
Sbjct  86    TPSSYPTIHKYGKDSFTWIGTTPRVYITEPEQVKIVFSQINDIRKTSSFPLRRRMGSGLV  145

Query  549   KYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPELK  728
               EG KW+KHRKI NPAF +EKLK M PA  K C EMV +WE+++S   SGE+DVWP+L+
Sbjct  146   TLEGSKWAKHRKIINPAFHMEKLKEMFPAFSKSCREMVNKWEKMISEKGSGEIDVWPDLQ  205

Query  729   TIAVNVISLTAFGISYETGRRLFELQHELAE--HASELRHSVYIPGGRFLPTKKNRRMNG  902
              +A +VIS TAFG SY+ G+++F+L  E A    +   + + YIPG R++PTK N+RM  
Sbjct  206   NLAADVISRTAFGSSYDEGKKIFQLLKEWAVLLMSYLTKRAYYIPGARYIPTKLNKRMQE  265

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASN-NLLDMLLESNFKEMKHHGNQ-EFGMSIEDII  1076
             ID +I  +++ II KR  AMK+GE + N +LL +LLESN  +++   N+ + GMSIE++I
Sbjct  266   IDMKIRDLVRGIINKRQNAMKKGEASKNEDLLGILLESNETQIEEQKNKKDVGMSIEEVI  325

Query  1077  SECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKP-DFDGLNRLKIV  1253
             SEC+LFY AGQETT+ LL WTM+LL R  EWQ+ AR EV+ VFG++K  DFDGL+RL++V
Sbjct  326   SECRLFYFAGQETTAVLLAWTMVLLGRYSEWQDRARAEVLEVFGNNKKLDFDGLSRLRVV  385

Query  1254  TMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
             +MILNE LRLYPPV  L R V  + KLGNL+LP+GV + +PI+ +H +P++WGED  EFN
Sbjct  386   SMILNEVLRLYPPVGMLAREVHNETKLGNLTLPSGVSIGIPILSMHQNPKIWGEDVLEFN  445

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             PERF EG+SKAT  + C++PF  GPRICIG NFAM+EAK ALS IL++FSF LSP+Y HA
Sbjct  446   PERFSEGISKATKNQVCFIPFGWGPRICIGQNFAMIEAKIALSMILQQFSFTLSPTYTHA  505

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P T +T  P +GA LIL+KL
Sbjct  506   PITNITIQPQHGAHLILRKL  525



>ref|XP_010275170.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/512 (53%), Positives = 357/512 (70%), Gaps = 3/512 (1%)
 Frame = +3

Query  144   LFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETK  323
             + + +F ++ L   W VV   W +P  LE+ LR Q LKG P+RL  G+ K+  +M  E  
Sbjct  7     VVILAFPVLILSWIWSVVYSIWWKPMKLERNLREQGLKGPPHRLLSGNLKDELRMRKEAW  66

Query  324   SKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS-KHNTFQ  500
             S+PMN LS  +VPRV+P+  ++I+ +GK S  W G  P V I  P+ +K++LS K   F+
Sbjct  67    SRPMN-LSHNIVPRVVPFTHQTIKTYGKMSVTWFGRTPRVNIMHPELIKDILSNKFGHFE  125

Query  501   QNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEI  680
             +   + ++  L+ GL  YEG+KW+KHR+I NPAF +EKLK M+PA Y  CSE + RWE++
Sbjct  126   KPKLNQLIKLLANGLANYEGEKWAKHRRIINPAFHIEKLKRMLPAFYTSCSETITRWEKL  185

Query  681   VSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPG  860
             V+     ELDVWPE + +  +VIS TAFG SY+ GRR+F+LQ+E A+   +   S+YIPG
Sbjct  186   VALKGCCELDVWPEFQNLTGDVISRTAFGSSYDEGRRIFQLQNEQAKLVVQAALSIYIPG  245

Query  861   GRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG  1040
                LPTK+N RM  ID+E+  +L+ II KR  A+K GE + N+LL +LLESNFKE++ H 
Sbjct  246   YSLLPTKRNNRMKEIDREVRGLLRGIINKREKAIKLGEASQNDLLGLLLESNFKEIQEHD  305

Query  1041  N-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDK  1217
             N +  GM+I+D+I ECKLFY AGQETT++LLVWTM++LS + EWQ  +REEV+  FG DK
Sbjct  306   NAKNLGMNIDDVIEECKLFYFAGQETTANLLVWTMVVLSMHPEWQIRSREEVLQAFGKDK  365

Query  1218  PDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHD  1397
             PDFDGLN LK+VTMIL E LRLYPP   L R   +  KLG + LP GV LL+P I +HH 
Sbjct  366   PDFDGLNHLKVVTMILYEVLRLYPPAVILTRHTYKKIKLGGIYLPPGVELLLPTILIHHS  425

Query  1398  PEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRR  1577
              E+WGEDA EF PERF  GVSKAT  +  + PF  GPRICIG NFAM EAK AL+ IL++
Sbjct  426   RELWGEDAQEFKPERFSSGVSKATKNQVSFFPFGWGPRICIGQNFAMTEAKMALALILQQ  485

Query  1578  FSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             FSF+LSPSYAHAPYT +T  P YGA +IL KL
Sbjct  486   FSFELSPSYAHAPYTIITLQPQYGAQIILHKL  517



>ref|XP_006407055.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
 dbj|BAJ33634.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48508.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
Length=512

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/497 (53%), Positives = 355/497 (71%), Gaps = 7/497 (1%)
 Frame = +3

Query  186   WRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPR  365
             WR +NW W +PKTLE +LR Q L G PY    GD+K    M  E +SKP+N L+D+++PR
Sbjct  22    WRTLNWVWFKPKTLESYLRRQGLVGTPYTPLAGDSKRTFNMSMEARSKPIN-LTDDIIPR  80

Query  366   VIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGL  545
             V+P+    ++ +G+  F W G IP++ I DP+ +KEV +K   FQ+    P+   ++ GL
Sbjct  81    VLPFSLHMLKTYGRTFFTWRGHIPVITIMDPEQIKEVFNKIYDFQKPHTFPLGRLIATGL  140

Query  546   LKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS-RNESGELDVWPE  722
               Y+GDKW+ HR+I NPAF LEK+K+MVPA ++ CSE++G W+++VS +  S E+DVWP 
Sbjct  141   FSYDGDKWANHRRIINPAFHLEKIKNMVPAFHQTCSEVIGEWDKLVSDKGSSCEVDVWPW  200

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L ++  +VIS TAFG SY+ G+R+FELQ ELA+  +    + +IPG RFLPTK+NRR+  
Sbjct  201   LMSMTADVISRTAFGSSYKEGQRIFELQAELAQLITLSVQTAFIPGYRFLPTKRNRRIKA  260

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
               +EI  +L  II KR+ A + GE  SN+LL +LLESN  + K  GN   GMS ED++ E
Sbjct  261   AAREIQIILSGIINKRLRAREAGEAPSNDLLGILLESNLGQAK--GN---GMSTEDVMEE  315

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTM+LLS++Q+WQ  AREEV  VFGD +PD +GLN+LK++TMI
Sbjct  316   CKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDTEGLNQLKVMTMI  375

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
               E LRLYPPV  L R + ++ KLG+L+LP GV++ +PI+ +  D E+WG+DA EF PER
Sbjct  376   FYEVLRLYPPVNQLTRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGKDAAEFKPER  435

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F+EG+SKAT  +  + PF  GPRICIG NFA++EAK A++ IL RFS +LSPSY HAPYT
Sbjct  436   FQEGISKATKSQVSFFPFGWGPRICIGQNFALLEAKMAMALILHRFSLELSPSYVHAPYT  495

Query  1623  GLTTNPLYGAPLILQKL  1673
               T +P +GA LIL KL
Sbjct  496   VFTIHPQFGAHLILHKL  512



>ref|NP_188087.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
 sp|Q9LUC5.1|C7A15_ARATH RecName: Full=Cytochrome P450 72A15 [Arabidopsis thaliana]
 dbj|BAB02401.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAK92762.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM20382.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE75556.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
Length=512

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/497 (52%), Positives = 358/497 (72%), Gaps = 7/497 (1%)
 Frame = +3

Query  186   WRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPR  365
             WR + W W +PK LE +LR Q L G PY    GD K+   M++E +SKP+  L+D++ PR
Sbjct  22    WRTLQWVWFKPKMLEHYLRRQGLAGTPYTPLVGDLKKNFTMLSEARSKPLK-LTDDISPR  80

Query  366   VIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGL  545
             V+PY  +  + +G+  F W G IP + I DP+ +KEV +K   FQ+    P+   +++GL
Sbjct  81    VVPYPLQMFKTYGRTYFTWFGPIPTITIMDPEQIKEVFNKVYDFQKPHTFPLATIIAKGL  140

Query  546   LKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS-RNESGELDVWPE  722
               Y+GDKW+KHR+I NPAF +EK+K+MVPA ++ C E+VG W+++VS +  S E+DVWP 
Sbjct  141   ANYDGDKWAKHRRIINPAFHIEKIKNMVPAFHQSCREVVGEWDQLVSDKGSSCEVDVWPG  200

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L ++  +VIS TAFG SY+ G+R+FELQ ELA+   +     +IPG  +LPTK NRRM  
Sbjct  201   LVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKAFIPGYSYLPTKSNRRMKA  260

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
               +EI  +L+ I+ KR+ A + GE  S++LL +LLESN ++ +  GN   GMS ED++ E
Sbjct  261   AAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNLRQTE--GN---GMSTEDLMEE  315

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTM+LLS++Q+WQ  AREEV  VFGD +PD +GLN+LK++TMI
Sbjct  316   CKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDAEGLNQLKVMTMI  375

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             L E LRLYPPV  L R + ++ KLG+L+LP GV++ +PI+ + HD E+WG DA EFNP+R
Sbjct  376   LYEVLRLYPPVTQLTRAIHKELKLGDLTLPGGVQISLPILLVQHDIELWGNDAAEFNPDR  435

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F++G+SKAT  +  + PF+ GPRICIG NFA++EAK A++ ILRRFSF++SPSY HAPYT
Sbjct  436   FKDGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILRRFSFEISPSYVHAPYT  495

Query  1623  GLTTNPLYGAPLILQKL  1673
              +T +P +GA LI+ KL
Sbjct  496   VITIHPQFGAQLIMHKL  512



>ref|XP_007022098.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
 gb|EOY13623.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
Length=518

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/504 (53%), Positives = 356/504 (71%), Gaps = 2/504 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             +  LV  WR+++W W+RPK LE+ LR Q L GN YR   GD KE   M  + +SKPM  L
Sbjct  16    VGILVWGWRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSRQARSKPMP-L  74

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             SD++   V P+  ++++  GK+SF W+G IP V I +P+ ++E+ +K N FQ+  ++P+V
Sbjct  75    SDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDFQKPHSNPLV  134

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L  GL+  +G++W+KHRKI NPAF  +KLK+M+PA Y+ C EM+ +WE++V    S E
Sbjct  135   SLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSCIEMISKWEKLVFLEGSSE  194

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             LDVWP L  +  +VIS  AFG SYE GRR+F+L  +      ++  S YIPG R+LPTK 
Sbjct  195   LDVWPYLVKLTRDVISRAAFGSSYEEGRRIFQLLEDQTSLTMQVVQSAYIPGWRYLPTKT  254

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-FGMS  1061
             NR+M  I K+I   LK +I+KR  A K  E ++++LL +L+ESN +E++  G+ +  GMS
Sbjct  255   NRKMKVIAKDIKDSLKGMIKKREEATKASEVSNDDLLGILVESNIREIQEQGDHKNMGMS  314

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             IED+I ECKLFY AGQETTS LLVWTMILL+R+  WQ  AREEV+ VFGD KPD DGLNR
Sbjct  315   IEDVIEECKLFYFAGQETTSVLLVWTMILLARHPHWQTKAREEVLEVFGDSKPDSDGLNR  374

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LK+VTMIL E LRLYP    L R V +D KLG L LPAG  + +P++ +HHD E+WG+DA
Sbjct  375   LKVVTMILYEVLRLYPAGVALGRSVPKDTKLGKLLLPAGAEITLPVLLIHHDQELWGDDA  434

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
             +EFNP+RF EGVSKAT  +  Y PF  GPRICIG NFA++EAK AL+ ILR+F F+LSPS
Sbjct  435   HEFNPDRFSEGVSKATKSQVIYFPFGWGPRICIGQNFALMEAKMALAMILRQFWFELSPS  494

Query  1602  YAHAPYTGLTTNPLYGAPLILQKL  1673
             YAH+P T +T  P +GA +IL KL
Sbjct  495   YAHSPCTFITLRPQHGAHIILHKL  518



>ref|XP_010060779.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Eucalyptus 
grandis]
Length=510

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/496 (55%), Positives = 355/496 (72%), Gaps = 8/496 (2%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWRVVN  W+RPK LE+ LR Q L G PY   +GD KE ++++ E  SKP+ +  D++ P
Sbjct  21    AWRVVNSVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLKEAYSKPITIF-DDIKP  79

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             R++P+  +S Q +GK+SF+W+G  P V IT+P+ +KE+ SK N + +  ++P+V  L+ G
Sbjct  80    RLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPRPGSNPLVKLLADG  139

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  +EG+KW++HRKI NPAF +EKLK M+PA Y  C+EMVGRWE++VS   S E+D W +
Sbjct  140   LTSHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLVSVERSCEIDAWVD  199

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +   VIS TAFG S+E G+R+FELQ E A+       SVYIPG RF+PTK NRRM  
Sbjct  200   LQNLTGEVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQSVYIPGWRFVPTKMNRRMKS  259

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
             IDKE+  +L  I+ +R  A++EGE A ++LL +LLESN KE         GMS+ D+I E
Sbjct  260   IDKEVRALLMDIVRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVIEE  312

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTM+LLS + +WQ  AREEV+ +FG  KPD DGL+ LKIVTMI
Sbjct  313   CKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMI  372

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             LNE LRLYPPV  L R V  + KLG L++P GV+L +P + +HHD E+WGEDA EF PER
Sbjct  373   LNEVLRLYPPVTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDKELWGEDAEEFKPER  432

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F EGVSKAT  +  + PF  GPRICIG NFA++EAK AL+ IL++F+F LSPSYAHAP  
Sbjct  433   FAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFDLSPSYAHAPSN  492

Query  1623  GLTTNPLYGAPLILQK  1670
              +T  P YG  +IL+K
Sbjct  493   VITLQPRYGVQVILRK  508



>ref|XP_010060780.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 ref|XP_010060781.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67645.1| hypothetical protein EUGRSUZ_F01392 [Eucalyptus grandis]
Length=510

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/496 (54%), Positives = 354/496 (71%), Gaps = 8/496 (2%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWRVVNW W+RPK LE+ LR Q L G PY   +GD KE ++++ E  SKP+  +SD++ P
Sbjct  21    AWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPI-AISDDIKP  79

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             R+ P+  +S Q +GK+SF+W+G  P V IT+P+ +KE+ S  N + +  ++P+V  L  G
Sbjct  80    RLFPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSNINDYPKPASNPLVKLLVDG  139

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  +EG+KW +HRKI NPAF +EKLK M+PA Y  C+EMVGRWE++VS   S E+D W +
Sbjct  140   LANHEGEKWVRHRKIINPAFHMEKLKLMLPAFYSSCAEMVGRWEKLVSVERSCEIDAWVD  199

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +   V+S TAFG S+E G+R+ ELQ E A+       SVYIPG RF+PTK NRRM  
Sbjct  200   LQNLTREVLSRTAFGSSFEEGKRICELQGEQAQLTIIAFQSVYIPGWRFVPTKMNRRMKN  259

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
             IDKE+  +L  I+ +R  A++EGE A ++LL +LLESN KE         GMS+ D+I E
Sbjct  260   IDKEVRALLMDIVRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVIEE  312

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTM+LLS + +WQ  AREEV+ +FG  KPD DGL+ LKIVTMI
Sbjct  313   CKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLRIFGSGKPDPDGLSHLKIVTMI  372

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             LNE LRLYPP   L+R V ++ KLG L++P GV+L +P + +HHD E+WGEDA EF PER
Sbjct  373   LNEVLRLYPPATDLVREVLKETKLGKLTIPPGVQLSMPTLLIHHDKELWGEDAEEFKPER  432

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F EGVSKAT  +  + PF  GPRICIG NFA++EAK AL+ IL++F+F+LSPSYAHAP  
Sbjct  433   FAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPSYAHAPSN  492

Query  1623  GLTTNPLYGAPLILQK  1670
              +T  P YG  +IL+K
Sbjct  493   VITLQPRYGVQVILRK  508



>ref|XP_010060775.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67640.1| hypothetical protein EUGRSUZ_F01386 [Eucalyptus grandis]
Length=510

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/496 (55%), Positives = 351/496 (71%), Gaps = 8/496 (2%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWR VNW W+RPK LE+ LR Q L G  Y    GD KE  +M+ E KSKP+ V SD++ P
Sbjct  21    AWRAVNWVWLRPKRLERLLRQQGLSGKSYTFLVGDLKENLRMLKEAKSKPIAV-SDDIKP  79

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             R++P+  +S Q +GK+SF W+G  P V IT+P+ +KEV SK   + +  ++P+V  L+ G
Sbjct  80    RLLPFLHQSFQTYGKDSFTWMGPTPRVNITNPEQIKEVFSKIYDYPKPASNPLVKLLADG  139

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L  +EG+KW++HRKI NPAF +EKLK M+PA Y  C+EMV RWE+ V    S E+D W +
Sbjct  140   LANHEGEKWARHRKIINPAFHMEKLKLMLPAFYLSCTEMVDRWEKSVLEERSCEVDAWVD  199

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +  +VIS TAFG S+E G+R+FELQ E A  A +   SVYIPG RF+PTK NRRM  
Sbjct  200   LQNLTRDVISRTAFGSSFEEGKRIFELQEEQALLAIKALQSVYIPGWRFVPTKMNRRMKN  259

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
             I+KE+  VL  II +R+ A++ G+ A ++LL +LLESN KE       + GMS+ D+I E
Sbjct  260   INKEVQAVLMDIIRRRVKAIRAGDAAGDDLLGLLLESNMKE-------DVGMSLHDVIEE  312

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTM+LLS + +WQ  AREEV+  FG  KPDFDGL+ LKIVTMI
Sbjct  313   CKLFYFAGQETTSVLLVWTMVLLSVHPDWQARAREEVLQTFGSRKPDFDGLSHLKIVTMI  372

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             LNE LRLYPP   + R V ++ KLG L+LPAGV+L +  + +HHD E+WGEDA EF PER
Sbjct  373   LNEVLRLYPPAIVMARKVPKETKLGKLTLPAGVQLSMSTLLIHHDKELWGEDAEEFKPER  432

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F EGVS AT  + C+ PF  GPR C+G NFAM+EAK AL+ IL++F+F+LSPSYAHAP T
Sbjct  433   FAEGVSNATKNQVCFFPFGWGPRTCVGQNFAMIEAKMALAMILQQFTFELSPSYAHAPLT  492

Query  1623  GLTTNPLYGAPLILQK  1670
               T  P YG  +IL K
Sbjct  493   IFTLQPQYGVQVILHK  508



>ref|XP_007227257.1| hypothetical protein PRUPE_ppa017915mg [Prunus persica]
 gb|EMJ28456.1| hypothetical protein PRUPE_ppa017915mg [Prunus persica]
Length=515

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/503 (52%), Positives = 357/503 (71%), Gaps = 5/503 (1%)
 Frame = +3

Query  168   MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV-L  344
             + +  AWRV+NW W+RPK LE+ L+ Q   GN YRL +GDTK+ + M+ + +SKPM +  
Sbjct  15    IVIAWAWRVLNWVWLRPKKLERCLKEQGFTGNSYRLLFGDTKDSSMMLRQAQSKPMKLST  74

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             S ++ PRV+P+  +++  +G+NSFVW+G IP V I +P+ +KE+ +KH   Q+ +A+P++
Sbjct  75    SHDIAPRVMPFVHQTVNTYGRNSFVWVGPIPKVNILNPEDLKEIFNKHENIQRTVANPII  134

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L QGL     +KW+KHRKI NPAF LEKLK M+P  Y  CSEM+  WE +VS+  S E
Sbjct  135   DLLVQGLGSTVDEKWAKHRKIINPAFHLEKLKGMLPTFYHSCSEMINEWERLVSKEGSCE  194

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
             LDVWP L  ++ +VIS  AFG SY+ GR++F+L  +  ++ +    SV+IP   FLPTK 
Sbjct  195   LDVWPCLLNMSADVISRAAFGSSYQEGRKIFQLLQQQTKNYAAAIQSVHIP---FLPTKH  251

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-FGMS  1061
             ++RM  I+KEI  +L+ II KR  A+K GE ++++LL +LLESN KE++ HGN+   GMS
Sbjct  252   HKRMKEINKEIRVLLRGIINKREEAIKMGEASNHDLLGILLESNLKEIREHGNKRNTGMS  311

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             +ED+I ECKLFY AGQETTS LLVW ++LLS+NQ WQ  AREEV+  FG + P FD L++
Sbjct  312   VEDVIEECKLFYFAGQETTSTLLVWAIVLLSQNQNWQTRAREEVLQAFGSNPPTFDALSQ  371

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LK+VTM+L E LRLYPP   L R ++   +LG  SLPAGV + + I+ +HH+ E+WGEDA
Sbjct  372   LKVVTMVLLEVLRLYPPGIELPRTLRRKTQLGRFSLPAGVDVSLHILLVHHNEELWGEDA  431

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
             +EF PERF +GVSKAT  +  Y PF  GPRICIG NFAM+EAK ALS IL+ F+F+LSPS
Sbjct  432   HEFKPERFSDGVSKATKNQFAYFPFGAGPRICIGQNFAMLEAKLALSLILQHFTFELSPS  491

Query  1602  YAHAPYTGLTTNPLYGAPLILQK  1670
             YAHAP       P YGA +IL K
Sbjct  492   YAHAPALLTILQPQYGAHIILSK  514



>gb|AGX93060.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Tabernaemontana 
elegans]
Length=519

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/511 (52%), Positives = 355/511 (69%), Gaps = 4/511 (1%)
 Frame = +3

Query  150   LFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSK  329
             +  F  + L   +RV++W W +PK LEK LR Q  KGNPYRLF GD  E  K++ E  SK
Sbjct  10    VLGFIGLALYWVYRVLDWVWFKPKKLEKCLREQGFKGNPYRLFLGDQYESGKLIREAMSK  69

Query  330   PMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNL  509
             P+ V  ++V  R+IP+  ++++ HGKNSF+W+G IP V +TDP+ +KEVL+K+  FQ+N 
Sbjct  70    PIGV-EEDVKKRIIPHILKTVETHGKNSFMWVGRIPRVHVTDPELIKEVLTKYYKFQKNH  128

Query  510   AD--PVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIV  683
              D  P+   L  G+   EG+ W+K RKI N AF  EKLK M+PA Y  C ++V +W++ V
Sbjct  129   HDLDPITKFLLTGIGSLEGEPWAKRRKIINAAFHFEKLKLMLPAFYLSCRDLVSKWDKKV  188

Query  684   SRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGG  863
                 S E+DVW +++T+  +VIS T FG +YE GRR+FEL  EL     ++  SVYIPG 
Sbjct  189   PEGGSAEVDVWHDIETLTGDVISRTLFGSNYEEGRRIFELMKELTALTIDVIRSVYIPGQ  248

Query  864   RFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN  1043
             RFLPTK+N +M  IDKE+   +K II+ ++  +K G+ A ++ L +LLE N  E++  GN
Sbjct  249   RFLPTKRNNKMRAIDKEVRVRIKEIIDNKMKILKAGKTAGDDFLGILLECNLNEIREQGN  308

Query  1044  -QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKP  1220
              +  GM+IE II ECKLFY AGQ+TTS LLVWTM+LLSR  EWQ  AREEV+ VFG+  P
Sbjct  309   NKNAGMTIEQIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQNRAREEVLQVFGNKTP  368

Query  1221  DFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDP  1400
             D+DG++ LK VTMIL E LR+Y PV  L ++  ED +LG   +PAGV+L++P + LHHDP
Sbjct  369   DYDGISHLKTVTMILYEVLRIYTPVAELTKVAHEDTQLGKYFIPAGVQLMMPQMLLHHDP  428

Query  1401  EMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRF  1580
             ++WGED  EF PERF EGV KAT  +  Y PFS GPR+CIG NFA++EAK A++ IL RF
Sbjct  429   QIWGEDVMEFKPERFSEGVLKATKSQGSYFPFSLGPRMCIGQNFALLEAKMAMALILCRF  488

Query  1581  SFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             SF+LSPSY HAP+T +T  P YGA LIL KL
Sbjct  489   SFELSPSYVHAPFTLITMQPQYGAHLILHKL  519



>emb|CDX97591.1| BnaA05g24880D [Brassica napus]
Length=495

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/495 (54%), Positives = 358/495 (72%), Gaps = 7/495 (1%)
 Frame = +3

Query  192   VVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPRVI  371
             +V W W++PK LE +LR Q L G+PY    GD K    M  E +SKP+  L+D++  RV+
Sbjct  7     LVTWVWLKPKKLESYLRSQGLSGSPYTPLIGDLKRTFSMAMEARSKPIK-LTDDISTRVV  65

Query  372   PYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGLLK  551
             P+  E ++ HG   F WLGTIP V I DP+ VKEV +K   FQ+    P+   +++GL  
Sbjct  66    PFPLEMLKTHGMTYFTWLGTIPTVTIMDPELVKEVFNKVYDFQKPHTFPLGNVIAKGLAN  125

Query  552   YEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS-RNESGELDVWPELK  728
             Y+G+KW+KHRKI NPAF LEK+K+MVPA ++ CSE+VG+W++IVS +  S E+DVWP L 
Sbjct  126   YDGEKWAKHRKIINPAFHLEKIKNMVPAFHQSCSEVVGKWDKIVSEKGSSCEVDVWPGLV  185

Query  729   TIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNGID  908
             ++  +VIS TAFG SY+ G+R+FELQ ELA+         ++PG  +LPTK NRR+    
Sbjct  186   SMTADVISRTAFGSSYKEGQRIFELQAELAQLIILAVLKAFVPGYLYLPTKGNRRIKAAA  245

Query  909   KEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISECK  1088
             +EI  +L+ I+ KR+ A + GE  S++LL +LLESN  + K  GN+   MS ED++ ECK
Sbjct  246   REIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNLGQAK--GNE---MSTEDVMEECK  300

Query  1089  LFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMILN  1268
             LFY AGQETTS LLVWTM+LLS++Q+WQ  AR+EV  VFGD +PD +GLN+LK++TMIL 
Sbjct  301   LFYFAGQETTSVLLVWTMVLLSQHQDWQARARDEVKQVFGDKEPDTEGLNQLKVMTMILY  360

Query  1269  ESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPERFR  1448
             E LRLYPPV  L R + ++ KLG+L+LP G ++ +PI+ +H D ++WGEDA EF PERF+
Sbjct  361   EVLRLYPPVAQLTRAIHKEMKLGDLTLPGGAQISLPILLVHRDTQLWGEDAAEFKPERFK  420

Query  1449  EGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYTGL  1628
             +GVSKATNGK  + PF+ GPRICIG +FA++E K AL+ IL+RFSF LSPSY HAPYT +
Sbjct  421   DGVSKATNGKVSFFPFAWGPRICIGQSFALLETKMALALILKRFSFGLSPSYVHAPYTVI  480

Query  1629  TTNPLYGAPLILQKL  1673
             T +P +GAPLIL+KL
Sbjct  481   TLHPQFGAPLILRKL  495



>ref|XP_002882888.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59147.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/497 (52%), Positives = 359/497 (72%), Gaps = 7/497 (1%)
 Frame = +3

Query  186   WRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPR  365
             WR + W W +PK LE +LR Q L G PY    GD K    M+ E +SKP+N L+D++ PR
Sbjct  22    WRTLQWVWFKPKMLESYLRRQGLVGTPYTPLVGDLKRNFSMLAEARSKPIN-LTDDITPR  80

Query  366   VIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGL  545
             ++PY  +  + +G+  + WLG IP + I DP+ +KEV +K   FQ++   P+   ++ GL
Sbjct  81    IVPYPLQMFKTYGRTFYTWLGPIPTITIMDPEQIKEVFNKVYDFQKSHTFPLARLIAAGL  140

Query  546   LKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS-RNESGELDVWPE  722
             + Y+GDKW+KHR+I NPAF LEK+K+MVPA ++ CSE+VG+W+++VS +  S E+D+WP 
Sbjct  141   VSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHRSCSEVVGQWDKLVSDKGLSCEVDIWPG  200

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L ++  +VIS TAFG SY+ G+R+FELQ ELA+   +     +IPG  +LPTK NRRM  
Sbjct  201   LVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKAFIPGFSYLPTKGNRRMKA  260

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
               +EI  +L+ I+ KR+ A + GE  S++LL +LLESN ++ +  GN   GMS ED++ E
Sbjct  261   KAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNLRQTE--GN---GMSTEDLMEE  315

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTMILLS++Q+WQ  AREEV  VFGD +PD +GLN+LK+++MI
Sbjct  316   CKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDKEPDAEGLNQLKVMSMI  375

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             L E LRLYPPV  L R + ++ KLG+L+LP GV++ +PI+ +  D E+WG DA EF PER
Sbjct  376   LYEVLRLYPPVTQLTRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGNDAAEFKPER  435

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F++G+SKAT  +  + PF+ GPRICIG NFA++EAK A++ IL+RFSF+LSPSY HAPYT
Sbjct  436   FKDGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILKRFSFELSPSYVHAPYT  495

Query  1623  GLTTNPLYGAPLILQKL  1673
              +T +P +GA LI+ KL
Sbjct  496   VITIHPQFGAQLIMHKL  512



>ref|XP_010502032.1| PREDICTED: cytochrome P450 72A13-like isoform X2 [Camelina sativa]
Length=512

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/497 (53%), Positives = 358/497 (72%), Gaps = 7/497 (1%)
 Frame = +3

Query  186   WRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPR  365
             WR + W W +PK LE  LR Q L G PY L  GD K    M+ E KSKP+  L+D++ PR
Sbjct  22    WRTLQWVWFKPKILESNLRRQGLSGTPYTLLVGDLKRHFSMLTEAKSKPIK-LTDDITPR  80

Query  366   VIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGL  545
             ++PY  + ++ HG+  F WLG IP + I DP+ +KEV +K   FQ+    P+   ++ GL
Sbjct  81    IVPYPLQMLKTHGRTFFTWLGPIPTITIMDPEQIKEVFNKVYDFQKAHTFPLGRLIAAGL  140

Query  546   LKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS-RNESGELDVWPE  722
             + Y+GDKW+KHR+I NPAF LEK+K+MVPA ++ CSE VG W+++VS +  S E+DVWP 
Sbjct  141   VSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSETVGEWDKLVSNKGSSCEMDVWPW  200

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L ++  +VIS TAFG SY+ G+R+FELQ ELA+   +     +IPG R+LPTK NRRMN 
Sbjct  201   LVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFGKAFIPGYRYLPTKGNRRMNA  260

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
               +EI  +L+ I++KR+   + GE  S++LL +LLESN  + K  GN   GMS E+++ E
Sbjct  261   TAREIKVILRGIVDKRLRGREGGEVPSDDLLGILLESNLGQTK--GN---GMSTEELMEE  315

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTM+LLS++Q+WQ  AREEV  VFG+ +P+ +GLN+LK++T I
Sbjct  316   CKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGNKEPNTEGLNQLKVMTTI  375

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             L E LRLYPPV  L R + ++ KLG+L+LP GV++ +PI+ +  D ++WG DA EF PER
Sbjct  376   LYEVLRLYPPVSQLTRAINKEMKLGDLTLPGGVQITLPILLVQRDTDLWGNDAGEFKPER  435

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F++G+SKAT G+  +L F+ GPRICIG NFAM+EAK A++ IL++FSF+LSPSY HAP T
Sbjct  436   FKDGLSKATKGQVSFLAFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYVHAPDT  495

Query  1623  GLTTNPLYGAPLILQKL  1673
              LTT+P +GAPLIL KL
Sbjct  496   VLTTHPQFGAPLILHKL  512



>ref|XP_011098149.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=515

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/508 (52%), Positives = 354/508 (70%), Gaps = 5/508 (1%)
 Frame = +3

Query  162   SIMFLVCAW---RVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             SI+ LV      +V+NW W RPK LEK LR Q L GNPYRLF GD +++  ++   + K 
Sbjct  9     SILILVSTALVVKVLNWVWFRPKKLEKLLRKQGLNGNPYRLFLGDMQDLTNVLKTQQPKT  68

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             +N LSD++ P ++PY+   I   GK+SFVW G  P + + DP+ +KE+LSK   F + L 
Sbjct  69    LN-LSDDLRPHILPYYQNIIDNFGKHSFVWFGPSPRLNVADPELIKEILSKPRLFHKALP  127

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRN  692
             DP+   +  GL   E +KW+KHRKI N AF +EKLK+M+PAM+  CS+M+ +WE ++SR+
Sbjct  128   DPIGETIVGGLSYLEDEKWAKHRKIVNEAFHMEKLKNMIPAMFLSCSKMIEKWEALISRS  187

Query  693   -ESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRF  869
               S E+DVWP L+ +  +VIS TAFG SYE GRR+F+LQ E  +    L    +IPG R+
Sbjct  188   GSSQEIDVWPFLEDLTGDVISRTAFGSSYEEGRRIFQLQKEQVKLLLHLLQFSFIPGWRY  247

Query  870   LPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE  1049
              PTK NRR+  I K+I ++L+ +I +R  AM+ GE   ++LL +L+ESNFKE++ HGN+ 
Sbjct  248   FPTKANRRLRAITKQIQSLLRGMINQREKAMERGEIIHSDLLSILMESNFKEIQEHGNKN  307

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
              G+SIED+I ECKLFY AG ETTS LLVWTM+LLS++Q+WQ  AREEV+ VFG  KP FD
Sbjct  308   VGLSIEDVIEECKLFYFAGSETTSTLLVWTMVLLSKHQDWQARAREEVLQVFGKKKPTFD  367

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
             GL +LK VTMIL E LRLYP VP + R   +   LG+  +P GV+L + I+ LHHDPE+W
Sbjct  368   GLQQLKTVTMILQEVLRLYPSVPFIARAPTKTVTLGSKIIPVGVQLTLLIVLLHHDPEIW  427

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             G+D  EF PERF +G+S A   +  + PFS GPR+CIG NFAM+EAK AL+ IL+ FSF+
Sbjct  428   GDDVKEFKPERFSQGISSAAKAQYSFTPFSTGPRVCIGHNFAMIEAKMALAMILQHFSFE  487

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LS SY HAP+   T  P YGAPLIL++L
Sbjct  488   LSSSYLHAPFPLTTLQPQYGAPLILRRL  515



>gb|AJD25171.1| cytochrome P450 CYP72A330 [Salvia miltiorrhiza]
Length=517

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/518 (54%), Positives = 365/518 (70%), Gaps = 3/518 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             ME  C +F  + ++  L+  W+++NWA+I PK L + LR Q  KGN Y+L YGD KE+ +
Sbjct  1     MEALCQVFASALALAALIYTWKLLNWAYITPKRLGEALRKQGFKGNAYKLVYGDLKELTQ  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             +  E +SKP+N L D++  RV P+   +I KHG  SFVWLG  P +I+TDP+ VKEVLSK
Sbjct  61    LSMEARSKPIN-LDDDIKNRVAPFIVNAIHKHGNESFVWLGPRPSIILTDPELVKEVLSK  119

Query  486   HNTF-QQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMV  662
                + +    +P+   L QGL  YE D+W+KHRKI NPAF LEKLK M+PA Y  C E++
Sbjct  120   SYLYLRPENRNPMTKLLLQGLASYEKDEWAKHRKIINPAFHLEKLKLMIPAFYMSCDEVL  179

Query  663   GRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRH  842
               WE+ VS   S E+DVWP L+ +  + IS TAFG SY+ GRR+FELQ E  EH  +   
Sbjct  180   KTWEKNVSSEGSYEVDVWPYLQNLTSDAISRTAFGSSYQEGRRIFELQREQVEHIIQALR  239

Query  843   SVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASN-NLLDMLLESNF  1019
             S+Y+PG RF+PTK+NRRM  I++E+ + ++ +I KRI AMK GE   + +LL +LL SNF
Sbjct  240   SIYVPGWRFVPTKRNRRMKQIEREVQSTIRGLISKRIEAMKTGEARHDEDLLSILLASNF  299

Query  1020  KEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             +E++  GN+ FGM+I+ ++ ECKLFY AGQETTS LLVWT++LLSR  +WQ  AREEVM 
Sbjct  300   QEIEKGGNKSFGMTIDAVVEECKLFYFAGQETTSVLLVWTLVLLSRYPDWQTRAREEVMQ  359

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             V G+  PDFD LN+LKIVTMIL E LRLYPPV  L R   E+ KLG  +LPAGV+L + I
Sbjct  360   VIGNRTPDFDSLNQLKIVTMILYEVLRLYPPVVALGRRASEETKLGKYTLPAGVQLSLSI  419

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             I LHHD ++WG+DA EFNP+RF EGV+KA  G   + PF  GPRICIG  FAM+EAK A+
Sbjct  420   IVLHHDTKIWGDDAMEFNPQRFSEGVAKAQKGPGIFFPFGWGPRICIGQVFAMLEAKMAM  479

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             + +LR FSF+LSP+Y HAP   +TT P +GA L+L KL
Sbjct  480   AVLLRSFSFELSPAYTHAPLNLITTQPQHGAHLLLHKL  517



>ref|XP_010060784.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67652.1| hypothetical protein EUGRSUZ_F01400 [Eucalyptus grandis]
Length=510

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/496 (55%), Positives = 354/496 (71%), Gaps = 8/496 (2%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWRVVNW W+RPK LE+ LR Q L   PY   +GD KE ++++ E  SKP+  +SD++ P
Sbjct  21    AWRVVNWVWVRPKRLERLLRQQGLSRKPYTFLFGDLKENSRLLTEANSKPI-AISDDIKP  79

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             R++P+  +S Q +GK+SF+W+G  P V IT+P+ +KE+ S  N + +   +P+V  L  G
Sbjct  80    RLLPFLHQSSQTYGKDSFMWIGPTPGVRITNPEQLKEIFSNINDYPKPGPNPLVKLLGDG  139

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPE  722
             L+ +EG+KW+++RKI NPAF +EKLK M+PA Y  C+EMVGRWE++VS   S E+D W +
Sbjct  140   LVNHEGEKWTRYRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLVSVERSCEIDAWVD  199

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L+ +   VIS TAFG S+E G+R+FELQ E A  A     SVYIPG RF+PTK NRRM  
Sbjct  200   LQNLTREVISRTAFGSSFEEGKRIFELQGEQAHLAIIALQSVYIPGWRFVPTKMNRRMKN  259

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
             IDKE+  +L  II +R  A++EGE A ++LL +LLESN KE         GMS+ D+I E
Sbjct  260   IDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVIEE  312

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTM+LLS + +WQ  AREEV+ +FG  KPD DGL+ LKIVTMI
Sbjct  313   CKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMI  372

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             LNE LRLYPPV  L R V ++ KLG L++P GV+L +P + +HHD E+WGEDA EF PER
Sbjct  373   LNEVLRLYPPVTELARKVPKETKLGKLTIPPGVQLSMPTLLIHHDKELWGEDAEEFKPER  432

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F EGVS AT  +  + PF  GPRICIG NFA++EAK AL+ IL++F+F+LSPSYAHAP  
Sbjct  433   FAEGVSMATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPSYAHAPSN  492

Query  1623  GLTTNPLYGAPLILQK  1670
              L   P YG  +IL+K
Sbjct  493   VLILQPRYGVQVILRK  508



>gb|AGX93062.1| CYP72A224 7-deoxyloganic acid 7-hydroxylase [Catharanthus roseus]
 gb|AHK60834.1| 7-deoxyloganic acid hydroxylase [Catharanthus roseus]
Length=521

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/518 (52%), Positives = 354/518 (68%), Gaps = 6/518 (1%)
 Frame = +3

Query  135   FCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMN  314
             F ++    F  + L   +R+++W W +PK LEK LR Q  KGNPYRLF GD  +  K++ 
Sbjct  5     FKSIIFLVFVSLTLYWVYRILDWVWFKPKKLEKCLREQGFKGNPYRLFLGDQYDSGKLIR  64

Query  315   ETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNT  494
             +  +KP+ V  ++V  R++P+  +++  HGK SF+W+G IP V ITDP+ +KEVL+K+  
Sbjct  65    QALTKPIGV-EEDVKKRIVPHILKTVGTHGKKSFMWVGRIPRVNITDPELIKEVLTKYYK  123

Query  495   FQQNL--ADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGR  668
             FQ+N    DP+   L  G+   EGD W+K RKI N AF  EKLK M+PA Y  C +MV +
Sbjct  124   FQKNHHDLDPITKLLLTGIGSLEGDPWAKRRKIINAAFHFEKLKLMLPAFYLSCRDMVTK  183

Query  669   WEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSV  848
             W+  V    S E+DVW +++T+  +VIS T FG ++E GRR+FEL  EL     ++  SV
Sbjct  184   WDNKVPEGGSAEVDVWHDIETLTGDVISRTLFGSNFEEGRRIFELMKELTALTIDVIRSV  243

Query  849   YIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEAS--NNLLDMLLESNFK  1022
             YIPG RFLPTK+N RM  IDKE+   +  II K++  MK GE AS  ++ L +LLE N  
Sbjct  244   YIPGQRFLPTKRNNRMRAIDKEVRVRITEIINKKMKVMKSGEAASAADDFLGILLECNLN  303

Query  1023  EMKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMH  1199
             E+K  GN +  GM+I +II ECKLFY AGQ+TTS LLVWTM+LLSR  EWQ  AREEV  
Sbjct  304   EIKEQGNNKSAGMTIGEIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQTRAREEVFQ  363

Query  1200  VFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPI  1379
             VFG+  PD+DG++ LK++TMIL E LRLY PV  L ++  E  +LG   +PAGV+L++P 
Sbjct  364   VFGNKTPDYDGISHLKVITMILYEVLRLYTPVAELTKVAHEATQLGKYFIPAGVQLMMPQ  423

Query  1380  IFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTAL  1559
             I LHHDPE+WGED  EF PERF EGV KAT  +  + PFS GPR+CIG NFA++EAK A+
Sbjct  424   ILLHHDPEIWGEDVMEFKPERFAEGVLKATKSQGSFFPFSLGPRMCIGQNFALLEAKMAM  483

Query  1560  SCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             S ILRRFSF+LSPSY HAP+T +T  P YGA LIL KL
Sbjct  484   SLILRRFSFELSPSYVHAPFTLITMQPQYGAHLILHKL  521



>ref|XP_008798317.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP72A219-like 
[Phoenix dactylifera]
Length=527

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/506 (53%), Positives = 360/506 (71%), Gaps = 3/506 (1%)
 Frame = +3

Query  162   SIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV  341
              ++F++ AWR + W W RPK LE+ LRGQ L+G+ YR  +GD KE A++  E +SKPM  
Sbjct  23    GLLFVLRAWRGLEWVWWRPKRLERALRGQGLRGSRYRFLHGDLKETARLNKEARSKPMP-  81

Query  342   LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS-KHNTFQQNLADP  518
              S +++PRV P F  +I+++GK S  WLG +P V I +P+ V+EVLS K   F +   +P
Sbjct  82    FSHDIIPRVSPIFHRAIKENGKISITWLGPVPRVTIMNPELVREVLSNKFGHFTKPKLNP  141

Query  519   VVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNES  698
             +   L++GL  YEG++W+KHR+I NPAF LEKLK M+PA    C E+V RWE+ +     
Sbjct  142   LGQLLARGLADYEGEQWAKHRRILNPAFHLEKLKRMLPAFSACCGELVSRWEKSIGSLGY  201

Query  699   GELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPT  878
              ELDVWPEL+T   +VIS TAFG SY  GRR+F+LQ E AE   +   +VYIPG RFLPT
Sbjct  202   YELDVWPELQTFTGDVISRTAFGSSYAEGRRIFQLQAEQAELVIKAVQTVYIPGYRFLPT  261

Query  879   KKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFG  1055
               N R   I +E+  +L+ IIEKR  A+K GE ++++LL +++E N K  + HGN +  G
Sbjct  262   PINNRRKEIYREVRALLRGIIEKREKAIKLGEASNDDLLGVMIEYNLKHFQEHGNSKNTG  321

Query  1056  MSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGL  1235
             M+ E++I ECKLFY AGQETTS LL WTMI+LS +  WQ  AREEV+ +FG ++PD+DGL
Sbjct  322   MTTEEVIEECKLFYFAGQETTSVLLTWTMIVLSMHPSWQVRAREEVLELFGKNRPDYDGL  381

Query  1236  NRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGE  1415
             NRLKIVTMIL E LRLYPPV  L RI  +  KLG+++ PAGV L +P+IF+HHDPE+WG+
Sbjct  382   NRLKIVTMILYEVLRLYPPVILLNRITYKTMKLGDITYPAGVLLTLPVIFIHHDPEIWGK  441

Query  1416  DANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLS  1595
             DA+EFNPERF EG+SKA+ G+  + PF  GPR CIG +FA++EAK  LS IL+ +SF+LS
Sbjct  442   DASEFNPERFAEGISKASKGQLAFFPFGWGPRTCIGQSFALLEAKMGLSMILQHYSFELS  501

Query  1596  PSYAHAPYTGLTTNPLYGAPLILQKL  1673
             PSY HAPY  +T  P +GA + L+++
Sbjct  502   PSYVHAPYAAITLQPQHGAQIRLRRV  527



>ref|XP_011083293.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=510

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/499 (52%), Positives = 358/499 (72%), Gaps = 4/499 (1%)
 Frame = +3

Query  186   WRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPR  365
             WR+VN+ W+RP+ +EKWLR Q  KGNPYR++YGD K++ +M     S P++ L  +++P 
Sbjct  13    WRIVNYVWVRPRRVEKWLREQGWKGNPYRVWYGDLKDVGRMSVAAHSNPIS-LHQDILPY  71

Query  366   VIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGL  545
             V+P+    I K+GK   +W G  P +I+T+PD +KEVL+KH  F +  A P+   L  GL
Sbjct  72    VLPFHHHIITKYGKRCLIWQGPSPRIIVTEPDLIKEVLNKHEVFVKVYAHPLNKLLISGL  131

Query  546   LKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS-RNESGELDVWPE  722
               +EG KW+KHR+I NPAF + KLK M+P M+  C+E+V +W+ +   +  S E+DVWP 
Sbjct  132   TVHEGQKWAKHRRILNPAFTITKLKDMIPMMHVSCTELVKKWQSMFGDKGSSHEIDVWPF  191

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
              + +  +VIS TAFG ++E G+++F LQ E A+   +L  +VYIPG RFLP  K +RM  
Sbjct  192   FENLTADVISRTAFGSNFEQGKKVFLLQREQAQLIVQLSRTVYIPGLRFLPMGKIKRMKE  251

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN-QEFGMSIEDIIS  1079
             ID+E+  VL+ II++R  AM+ GE+ SN++L +LLESN +E++  GN +E G+SIED+I 
Sbjct  252   IDREVRDVLRGIIQRREEAMRVGEKTSNDMLGILLESNSREVEGDGNRKELGISIEDVID  311

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AGQETTS+LLVWTM++LS +Q WQ  AREEV+ VFG   PDFDGLN+LK V +
Sbjct  312   ECKLFYFAGQETTSNLLVWTMVMLSIHQNWQTQAREEVLQVFGKSIPDFDGLNQLKKVNL  371

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             IL+E LRLYPP  T+ R+ +E  KLG+ +LPAG  L++PI+F+HHD E+WG+DA EF PE
Sbjct  372   ILHEVLRLYPPATTIARVTREKIKLGDTTLPAGTGLVLPILFVHHDKEIWGDDAKEFKPE  431

Query  1440  RFREGVSKATNGK-ACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAP  1616
             RF +GV+ AT G+ A + PFS GPRICIG NF+MVEAK  L+ IL+ FSF+LSPSY HAP
Sbjct  432   RFAQGVANATKGRIAAFFPFSLGPRICIGQNFSMVEAKLVLAMILQHFSFELSPSYEHAP  491

Query  1617  YTGLTTNPLYGAPLILQKL  1673
                LT  P YGA ++  K+
Sbjct  492   VPVLTLQPKYGAKIMFSKI  510



>gb|ABC59075.1| cytochrome P450 monooxygenase CYP72A67 [Medicago truncatula]
 gb|KEH36885.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=520

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/517 (51%), Positives = 366/517 (71%), Gaps = 4/517 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             + ++  + L + + + LV  WRV+NW W++PK LEK LR Q   GN YRL  GD K+  K
Sbjct  5     LAIYYGIILITVT-LGLVYTWRVLNWIWLKPKRLEKLLREQGCNGNSYRLVLGDLKDSYK  63

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             M  + KSKPM  LSD+++PRVIPY  + +Q +GKN F+W GT P +I+T+P+ +K+VL++
Sbjct  64    MGKKAKSKPME-LSDDIIPRVIPYIQQLVQIYGKNPFIWSGTTPRLILTEPELIKDVLNR  122

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
              +  Q+   +   +  S GL+ +EG+KW KHR++ N AFQLEKLK M P+    C +M+ 
Sbjct  123   TSELQKPKYEIFKFLFS-GLIIHEGEKWRKHRRLMNAAFQLEKLKIMAPSFLTSCIDMIS  181

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +WE  +S + SGE+D+WP L+ +  +VIS  AFG SYE G+R+F+LQ E  E   +    
Sbjct  182   KWESTLSSDGSGEIDIWPSLQNLTSDVISRNAFGSSYEEGKRIFDLQREQGELVMKNLVK  241

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
               IP  RF+PT   RRM+ I+K+I++ L+ II KR  AMK GE   N+LL +LLESN +E
Sbjct  242   SLIPLWRFIPTATQRRMHEIEKDIDSSLRYIINKREKAMKAGEATENDLLGLLLESNHQE  301

Query  1026  MKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHV  1202
             ++ HGN +  GMS+ED++ ECKLFYLAGQE+TS +LVWTMILLSR  +WQE AREEV+ +
Sbjct  302   IRDHGNNKNMGMSLEDVVGECKLFYLAGQESTSTMLVWTMILLSRYPDWQERAREEVLQI  361

Query  1203  FGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPII  1382
             FG+ KPD++GLN+LKI+ MIL E LRLYPP   + R V +D K GN+ +PAGV + +PII
Sbjct  362   FGNKKPDYEGLNKLKILPMILYEVLRLYPPAFGVTRYVGKDIKFGNMEVPAGVEVFLPII  421

Query  1383  FLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALS  1562
              L H+ E+WG+DA  FNPERF EG+SKATNG+  Y PF GGPR+C+G NF+++EAK A+S
Sbjct  422   LLQHNNELWGDDAKMFNPERFAEGISKATNGRFIYFPFGGGPRVCMGQNFSLLEAKMAVS  481

Query  1563  CILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              IL+ F F+LSP+YAH P   +T  P  GA +IL+K+
Sbjct  482   MILQNFYFELSPTYAHTPNLVMTIQPEKGAHVILRKV  518



>gb|ADU19849.1| putative secologanin synthase [Camptotheca acuminata]
Length=524

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/521 (52%), Positives = 364/521 (70%), Gaps = 4/521 (1%)
 Frame = +3

Query  120   MRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEI  299
             ++M+V       S +++FLV AW+++NWA++ PK +EK LR Q  KGN YRL  GD KE 
Sbjct  3     IQMDVLYKSIAASVAVVFLVYAWKMLNWAYLTPKRIEKCLRKQGFKGNSYRLLVGDLKES  62

Query  300   AKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVL  479
             + M+ ET SKP+NV S+++V RV+P+  ++I  +GKNSF W+G +P V I +PD +K++L
Sbjct  63    SMMLKETMSKPINV-SEDIVERVMPHVIKTIDTYGKNSFTWIGRMPRVHIMEPDLIKDIL  121

Query  480   SKHNTFQQN--LADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICS  653
             + HN F +N    +P+   L  G+   EGDKW+KHR+I +P+F LEKLK M+PA Y    
Sbjct  122   ANHNDFMKNHHAYNPLTKFLLTGIGSLEGDKWAKHRRIISPSFHLEKLKTMLPAFYVSYD  181

Query  654   EMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASE  833
             +++ +WE+  S   S E+D++P   T+  +VIS  AFG SY  G R+F L  EL +   +
Sbjct  182   DLLTKWEQQCSSKGSVEIDLFPTFDTLTSDVISRVAFGSSYGEGGRIFILLKELMDLTVD  241

Query  834   LRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLES  1013
             +  SVY+PG  FLPTK+N RM  +D EI   L  II  R+ AMK GE +  +LL  LLES
Sbjct  242   VMRSVYVPGSSFLPTKRNNRMREVDGEIKDRLSGIINSRVKAMKAGEPSGEDLLGTLLES  301

Query  1014  NFKEMKHHGNQE-FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREE  1190
             NFKE++  GN++  GMSIED+ISECKLFY AGQETT  LL WT +LLSR+ EWQE AREE
Sbjct  302   NFKEIERLGNKKNAGMSIEDVISECKLFYFAGQETTGILLTWTCVLLSRHPEWQERAREE  361

Query  1191  VMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLL  1370
             +  VFG+ K DFD +  LKIV MIL E LRLYPPV  L ++  E+ KLGNL++PAGV+L+
Sbjct  362   IFQVFGNGKVDFDRVQNLKIVPMILYEVLRLYPPVIELTKVTYEEQKLGNLTIPAGVQLM  421

Query  1371  VPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAK  1550
             +P I LH D EMWG D+ EFNP RF +G+SKA      Y+PFS GPRIC+G NFA+++AK
Sbjct  422   MPSILLHRDQEMWGADSKEFNPGRFADGISKAVKSPFFYIPFSWGPRICVGQNFALLQAK  481

Query  1551  TALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
              AL+ IL+RF+F LSP+YAHAP+T LT  P +GA ++ +K+
Sbjct  482   MALTMILQRFTFDLSPTYAHAPFTVLTLQPQHGAQVVFRKI  522



>ref|XP_004151308.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=524

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/500 (53%), Positives = 355/500 (71%), Gaps = 6/500 (1%)
 Frame = +3

Query  189   RVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPRV  368
             R+VNW W+RPK LEK LR Q L GN YR  +GDTKEI   + + + + M   S ++  R 
Sbjct  26    RIVNWVWLRPKRLEKLLRQQGLAGNSYRFLFGDTKEIGVAVRQARLQSM-TFSHDIASRA  84

Query  369   IPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGLL  548
              P  + +I K+GKNSF W+GT P V IT+P+ VK   S+ N  ++  + P+  ++  GL+
Sbjct  85    TPSSYPTIHKYGKNSFTWIGTTPRVYITEPEQVKIAFSQINDIRKTSSFPLRRRMGSGLV  144

Query  549   KYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWPELK  728
               EG KW+KHRKI NPAF +EKLK M PA  K C EMV +WE++++  ES E+DVWP+L+
Sbjct  145   TLEGSKWAKHRKIINPAFHMEKLKEMFPAFSKSCREMVNKWEKMINEEESCEIDVWPDLQ  204

Query  729   TIAVNVISLTAFGISYETGRRLFELQHELAE--HASELRHSVYIPGGRFLPTKKNRRMNG  902
              +  +VIS TAFG SY+ G+++F+L  E A    +   +   YIPG R++PTK N RM  
Sbjct  205   NMTADVISRTAFGSSYDEGKKIFQLLKEWAMLLMSYLTKRGYYIPGARYVPTKLNNRMQE  264

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASN-NLLDMLLESNFKEMKHHGNQ-EFGMSIEDII  1076
             ID +I  +++ II KR   MK+GE ++N +LL +LLESN  +++ H N+ + GMSIE++I
Sbjct  265   IDTKIRDMVRGIINKRQNGMKKGEASNNEDLLGILLESNASQIEEHKNKKDVGMSIEEVI  324

Query  1077  SECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKP-DFDGLNRLKIV  1253
             SEC+LFY AGQETT+ LL WTM+LL R  EWQ+ AR EV+ VFGD+K  DFDGL+RL++V
Sbjct  325   SECRLFYFAGQETTAVLLAWTMVLLGRYPEWQDRARAEVLEVFGDNKKLDFDGLSRLRVV  384

Query  1254  TMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFN  1433
              MILNE LRLYPPV  L R +  + KLGNL+LP GV + VPI+ +H +P++WGEDA EFN
Sbjct  385   NMILNEVLRLYPPVGMLAREIHNETKLGNLTLPCGVSIGVPILSMHQNPKIWGEDALEFN  444

Query  1434  PERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHA  1613
             PERF EG+SKAT  + CY+PF  GPRICIG NFAM+EAK ALS IL++FSF LSP+Y HA
Sbjct  445   PERFAEGISKATKNQVCYVPFGWGPRICIGQNFAMIEAKIALSMILQQFSFTLSPTYTHA  504

Query  1614  PYTGLTTNPLYGAPLILQKL  1673
             P T +T  P +GA LIL+KL
Sbjct  505   PITHITIQPQHGAHLILRKL  524



>ref|XP_009146334.1| PREDICTED: cytochrome P450 72A15 [Brassica rapa]
Length=512

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/510 (52%), Positives = 360/510 (71%), Gaps = 10/510 (2%)
 Frame = +3

Query  156   SFSIMFLVCAW---RVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKS  326
             + SI   V +W   R +NW W +PK LE +LR Q L G+PY    GD K    ++   +S
Sbjct  9     TLSIAIAVVSWWVWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDLKRNFSLLKNARS  68

Query  327   KPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQN  506
             KP+  L+D++ PR++PY  + ++ HG+  F WLG IP + I DP+ +KEV +K   F + 
Sbjct  69    KPIK-LTDDITPRLVPYPLKMLKTHGRTYFTWLGPIPTITIVDPEQIKEVFNKVYDFPKT  127

Query  507   LADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS  686
                P+   +  GL  Y+GDKW+KHR+I NPAF LEK+K+MVPA ++ CSE+VG W+++VS
Sbjct  128   HTFPLARLIGTGLASYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGEWDKLVS  187

Query  687   -RNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGG  863
              +  S E+DVWP L ++  +VIS TAFG SY+ G+R+FELQ ELA+   +      IPG 
Sbjct  188   DKGLSCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKHIIPGY  247

Query  864   RFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN  1043
             R+LPTK+NR M    +E+  +L+ I+ KR+ A + GE  S++LL +LLESN  ++K  GN
Sbjct  248   RYLPTKENRMMKAKAREVQAILRGIVNKRLRAREAGEAPSDDLLGILLESNLGQVK--GN  305

Query  1044  QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPD  1223
                GMS ED+I ECKLFY AGQETTS LLVWTM+LLS++Q+WQ  AREEV  VFGD  PD
Sbjct  306   ---GMSNEDVIEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQAKAREEVKQVFGDKVPD  362

Query  1224  FDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPE  1403
              DGLN+LK++TMIL E LRLYPPV  + R + ++ KLG+L+LP GV++ +PI+ + HD E
Sbjct  363   IDGLNQLKVMTMILYEVLRLYPPVTQVSRAIHKEMKLGDLTLPGGVQISLPILLVQHDTE  422

Query  1404  MWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFS  1583
             +WG DA EF PERF+EG+SKAT  +  + PF+ GPRICIG NFA++EAK A++ IL+RFS
Sbjct  423   LWGNDAAEFKPERFKEGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFS  482

Query  1584  FKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             F+LSPSY HAPYT +T +P +GA LIL KL
Sbjct  483   FELSPSYVHAPYTVITIHPQFGAHLILHKL  512



>ref|XP_010927457.1| PREDICTED: cytochrome P450 72A15-like [Elaeis guineensis]
Length=522

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/505 (52%), Positives = 362/505 (72%), Gaps = 3/505 (1%)
 Frame = +3

Query  162   SIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV  341
              ++FLV A   ++W W RP+ LE+ LR Q L+G  YR  +GD K+  ++  E +SKPM+ 
Sbjct  18    GVLFLVRALSALHWVWWRPRRLERALRAQGLEGTRYRFPHGDVKDYDRLDQEARSKPMS-  76

Query  342   LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS-KHNTFQQNLADP  518
              S +++PRV+PY  ++I+K+GK SF W G  P VI+ DP   +E+LS K   F++   +P
Sbjct  77    FSHQIIPRVLPYLHQTIKKNGKTSFTWFGPEPRVIMMDPGLTREILSNKFGHFEKPNLNP  136

Query  519   VVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNES  698
             +   L  GL  YEG+KW+KHR+I NPAF LEKLK M+PA    C E++ +W+ +V+ N S
Sbjct  137   LGRLLVTGLAIYEGEKWAKHRRIINPAFHLEKLKCMMPAFSACCDELINKWDGLVASNGS  196

Query  699   GELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPT  878
              ELDVWPE ++   +VIS TAFG ++  G+R+F LQ E A  A     ++YIPG RFLPT
Sbjct  197   CELDVWPEFQSFTADVISRTAFGSNFREGQRIFHLQQEQAGLAIRALQNIYIPGFRFLPT  256

Query  879   KKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHG-NQEFG  1055
             KKN+RM  ID EI T+L R+IE+R  A+++   ++++LL +L+ESNF+  K +G ++  G
Sbjct  257   KKNKRMKEIDIEIRTLLMRMIERREMAIRKEGTSNDDLLSLLMESNFRHSKENGGSKNSG  316

Query  1056  MSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGL  1235
             MSIE++I ECKLFY AG ETTS LL WT++ LS +  WQ  AREEV  VFG +KPD+DGL
Sbjct  317   MSIEEVIQECKLFYFAGHETTSVLLTWTLVALSMHPSWQARAREEVNGVFGKNKPDYDGL  376

Query  1236  NRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGE  1415
             +RLKIVTM+L E LRLYPP   L+R   ++ KLG ++ P GV+LL+PIIF+HHDPE WGE
Sbjct  377   SRLKIVTMVLYEVLRLYPPAVLLMRKTYKEMKLGQITFPEGVQLLLPIIFIHHDPEFWGE  436

Query  1416  DANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLS  1595
             DA+EFNPERF +GVSKA+  +  + PF GGPRICIG +FA++EAK AL+ IL+ F+F++S
Sbjct  437   DASEFNPERFADGVSKASKIQGAFFPFGGGPRICIGQSFAVIEAKMALARILQHFTFEIS  496

Query  1596  PSYAHAPYTGLTTNPLYGAPLILQK  1670
             PSYAHAPYT  T +P +GA +IL K
Sbjct  497   PSYAHAPYTVATLHPQHGAQIILHK  521



>ref|XP_010487267.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=547

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/519 (51%), Positives = 365/519 (70%), Gaps = 8/519 (2%)
 Frame = +3

Query  123   RMEVFCNLFLFSFSIMFLV-CAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEI  299
             +ME+       S +++      WR + W W +PK LE +LR Q L G  Y    GD K  
Sbjct  35    KMEISVASVTISVAVVVTSWLVWRALQWVWFKPKMLESYLRRQGLPGTSYTPLVGDVKRN  94

Query  300   AKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVL  479
               M+ E +SKP+N L+D++ PRV+P+  + ++ HG+  F W G +P++ I DP+ +KEV 
Sbjct  95    FSMLTEARSKPIN-LTDDITPRVMPHPLQMLKTHGRTYFSWFGPVPIITIMDPEQIKEVF  153

Query  480   SKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEM  659
             +K   FQ+    P+   +++GL  Y+GDKW+KHR+I NPAF LEK+K+MVPA ++ CSE+
Sbjct  154   NKVYDFQKPHTFPLATLIAKGLANYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEV  213

Query  660   VGRWEEIVS-RNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASEL  836
             +G WE++VS +  S E+DVWP L ++  +VIS TAFG SY+ G+R+FELQ ELA+   + 
Sbjct  214   LGEWEKLVSDKGSSCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQA  273

Query  837   RHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESN  1016
                  IPG  +LPTK NRRM    +EI  +L+ I+ KR+ A + GE  S++LL +LLESN
Sbjct  274   FRKAIIPGFSYLPTKGNRRMKAKAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESN  333

Query  1017  FKEMKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVM  1196
               + K  GN   GMS ED++ ECKLFY AGQETTS LLVWTM+LLS++Q+WQ  AREEV 
Sbjct  334   LGQTK--GN---GMSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVK  388

Query  1197  HVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVP  1376
              VFGD +PD +GLN+LK++TMIL E LRLYPPV  L R + ++ KLG+L+LP GV++ +P
Sbjct  389   QVFGDKEPDAEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPGGVQISLP  448

Query  1377  IIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTA  1556
             I+ +  D E+WG+DA EF PERF++G+SKAT  +  + PF+ GPRICIG NFAM+EAK A
Sbjct  449   ILLVQRDTELWGKDAGEFKPERFKDGLSKATKSQVSFFPFAWGPRICIGQNFAMLEAKMA  508

Query  1557  LSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             ++ IL++FSF+LSPSY HAPYT +T +P +GA LILQKL
Sbjct  509   MALILQKFSFELSPSYLHAPYTIITIHPQFGAQLILQKL  547



>ref|XP_010465353.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/497 (53%), Positives = 360/497 (72%), Gaps = 7/497 (1%)
 Frame = +3

Query  186   WRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVPR  365
             WR + W W +PK LE +LR Q L G  Y    GD K    M+ E KSKP+  L+D++ PR
Sbjct  22    WRTLQWVWFKPKMLESYLRRQGLAGTSYTPLVGDLKRHFSMLTEAKSKPIK-LTDDITPR  80

Query  366   VIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQGL  545
             ++PY  + ++ HG+  F WLG IP + I DP+ +KEV +K   FQ+    P+   ++ GL
Sbjct  81    IVPYPLQMLKTHGRTHFTWLGPIPTITIMDPELIKEVFNKVYDFQKAHTFPLGRLIAAGL  140

Query  546   LKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS-RNESGELDVWPE  722
             L Y+GDKW+KHR+I NPAF LEK+K+MVPA ++ CSE VG W+++VS +  S ELDVWP 
Sbjct  141   LSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSETVGEWDKLVSNKGSSCELDVWPW  200

Query  723   LKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMNG  902
             L ++  +VIS TAFG SY+ G+R+FELQ ELA+   +     +IPG R+LPTK NRRMN 
Sbjct  201   LVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFQKTFIPGYRYLPTKGNRRMNA  260

Query  903   IDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIISE  1082
               ++I  +L+ I++KR+ A + GE  S++LL +LLESN  + +  GN   GMS E+++ E
Sbjct  261   TARKIKVILRGIVDKRLRAREGGEVPSDDLLGILLESNSGQTE--GN---GMSTEELMEE  315

Query  1083  CKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTMI  1262
             CKLFY AGQETTS LLVWTM+LLS++++WQ  AREEV  VFGD++P  +GLN+LKI+T I
Sbjct  316   CKLFYFAGQETTSVLLVWTMVLLSQHKDWQARAREEVKQVFGDEEPTTEGLNQLKIMTTI  375

Query  1263  LNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPER  1442
             L E LRLYPPV  L R + ++ KLG+++LP+GV++ +PI+ +  D E+WG+DA EF PER
Sbjct  376   LYEVLRLYPPVSQLTRAINKEMKLGDMTLPSGVQITLPIMLVQRDTELWGKDAGEFKPER  435

Query  1443  FREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPYT  1622
             F++G+SKAT G+  +L F+ GPRICIG NFAM+EAK A++ IL++FSF+LSPSY HAP T
Sbjct  436   FKDGLSKATKGQVSFLAFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYVHAPDT  495

Query  1623  GLTTNPLYGAPLILQKL  1673
              LTT+P +GAPLIL KL
Sbjct  496   VLTTHPQFGAPLILHKL  512



>ref|XP_010535012.1| PREDICTED: cytochrome P450 72A13-like [Tarenaya hassleriana]
Length=510

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/510 (52%), Positives = 360/510 (71%), Gaps = 12/510 (2%)
 Frame = +3

Query  150   LFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSK  329
             L + +++ +   WR V W W++PK LE  L+ Q L G PY  F GD +  + M++E +SK
Sbjct  11    LVALAMVLMAWIWRFVKWVWLKPKFLENRLKRQGLSGTPYTPFVGDMRRNSSMLSEARSK  70

Query  330   PMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNL  509
             P+N L+D++ PRV+P     ++ HGK+ F WLG IP++ +T+P+ +KEV +K   +++  
Sbjct  71    PIN-LTDDITPRVLPLPLTMLKTHGKSFFTWLGPIPVITLTNPEQIKEVFNKIYDYEKPH  129

Query  510   ADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS-  686
               P+V  ++ GL+ Y+GDKW+KHR+I NPAF LEK+K+MVPA Y+ CSE+V  WE + + 
Sbjct  130   TFPLVRLIASGLVNYDGDKWAKHRRIINPAFHLEKIKNMVPAFYQSCSEIVQEWERLAAD  189

Query  687   RNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGR  866
             +  S E+D+WP L  +  +VIS TAFG +Y  G+ +F+LQ ELA+  ++     YIPG R
Sbjct  190   KGSSCEVDIWPWLVNLTADVISRTAFGSNYREGQMIFKLQAELAQLLTQAFRKAYIPGYR  249

Query  867   FLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNN-LLDMLLESNFKEMKHHGN  1043
             + PTK NRRM  ID+EI   L  II KR+    E  EA N+ LL +LLESN  + K  GN
Sbjct  250   YFPTKSNRRMKEIDREIRATLSGIIGKRV----EAREAPNDDLLGILLESNSGQSK--GN  303

Query  1044  QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPD  1223
                GMSIE+++ ECKLFY AGQETTS LLVWTMILLS++Q+WQ  AREEVM V GD KPD
Sbjct  304   ---GMSIEEVMQECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVMQVLGDRKPD  360

Query  1224  FDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPE  1403
              D LN+LK+VTMIL E LRLYPP   L R V ++ KLG+L+LP GV + +PI+ +  D E
Sbjct  361   IDSLNQLKVVTMILYEVLRLYPPATQLSRAVHKETKLGDLTLPGGVHVALPILLIQRDVE  420

Query  1404  MWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFS  1583
             +WG DA EF PERF++G+SKAT  +  +LPF  GPRICIG NFA++E+KTAL+ ILRRFS
Sbjct  421   LWGSDAGEFKPERFKDGISKATKNQVSFLPFGWGPRICIGQNFALLESKTALALILRRFS  480

Query  1584  FKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             F+LSPSY HAPYT  T +P +GA L+L+KL
Sbjct  481   FELSPSYVHAPYTVFTLHPQFGAHLVLRKL  510



>ref|XP_009394210.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=526

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/505 (53%), Positives = 356/505 (70%), Gaps = 2/505 (0%)
 Frame = +3

Query  162   SIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV  341
              ++FL  A RV+NWAW RP+ LE+ LR Q LKG  YR  YGD KE A+   E ++K M  
Sbjct  19    GLLFLAWASRVLNWAWWRPRRLERALRAQGLKGTAYRFPYGDLKENARFSKEARAKSMP-  77

Query  342   LSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS-KHNTFQQNLADP  518
             L+  ++PR++P++  ++ ++GK SF W G +P V ITDP+ V+EVLS K   F +   +P
Sbjct  78    LAHNIIPRLLPFYHRAMDEYGKISFTWSGPVPQVAITDPELVREVLSNKFGHFGKPNQNP  137

Query  519   VVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNES  698
             +    ++GL  YEG+KW KHR+I NPAF  EKLK M+PA    CS+++ RWE +      
Sbjct  138   LARFFARGLAVYEGEKWVKHRRILNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEAC  197

Query  699   GELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPT  878
              ELDVWPEL++   +VIS TAFG S++ GR +F+LQ E AE   ++  ++Y+PG RFLPT
Sbjct  198   YELDVWPELQSFTGDVISRTAFGSSHKEGRPIFQLQAEQAELLIQVVQNLYVPGYRFLPT  257

Query  879   KKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGM  1058
              KN+R+  ID+EI ++L+ II+KR   +K G+ ++++LL +L+ESN K ++  GN+  GM
Sbjct  258   PKNKRIRAIDREIRSILRGIIKKREQDIKTGKASNDDLLGLLMESNMKHLQEDGNKNAGM  317

Query  1059  SIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLN  1238
             + ED+I ECKLFY AGQETTS LL WTMI LS +  WQ  AREEV+ VFGDDKPDFDGLN
Sbjct  318   TTEDVIEECKLFYFAGQETTSVLLTWTMICLSMHPTWQIRAREEVLRVFGDDKPDFDGLN  377

Query  1239  RLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGED  1418
              LKIVTMIL E LRLYPP   L R   +  KLG++  P GV LL+ +IF+HHDP +WG+D
Sbjct  378   HLKIVTMILYEVLRLYPPFILLRRQTYKPMKLGDVVYPPGVLLLLHVIFVHHDPNLWGKD  437

Query  1419  ANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSP  1598
              +EFNPERF EGVSKA+  +  + PF GGPRICIG NFA++EAK  LS IL+ FSF LSP
Sbjct  438   VSEFNPERFAEGVSKASKEQVAFFPFGGGPRICIGQNFALLEAKMGLSMILQHFSFDLSP  497

Query  1599  SYAHAPYTGLTTNPLYGAPLILQKL  1673
             SYAHAP+   T +P +GA + L+KL
Sbjct  498   SYAHAPHAVFTLHPQHGAQIRLRKL  522



>gb|KFK38823.1| hypothetical protein AALP_AA3G165300 [Arabis alpina]
Length=512

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/510 (52%), Positives = 355/510 (70%), Gaps = 10/510 (2%)
 Frame = +3

Query  156   SFSIMFLVCAW---RVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKS  326
             + S+  +V +W   R++ W W +PK LE +LRGQ L G  Y L  GD K  + M+ E +S
Sbjct  9     TISVAIVVVSWWIWRILKWVWFKPKMLESYLRGQGLPGTSYTLLVGDVKRNSNMLLEARS  68

Query  327   KPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQN  506
             KP+  L+D++  RV+PY  +  + HG+N F WLG IP + + DP+ +KEV +K   FQ+ 
Sbjct  69    KPIK-LTDDIASRVVPYPLQMAKTHGRNFFTWLGPIPSITLMDPELIKEVFNKIYNFQKP  127

Query  507   LADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS  686
                P+   ++ GL  Y+ DKW+KHR+I NPAF +EK+K MVPA ++ CSE+VG+W+++ S
Sbjct  128   NVFPLGRLVATGLFSYDDDKWAKHRRIINPAFHIEKIKSMVPAFHQSCSEVVGKWDKLAS  187

Query  687   -RNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGG  863
              +  S E+DVWP L ++  +VIS TAFG SY+ G R+FELQ EL E   +     +IPG 
Sbjct  188   DKGLSCEVDVWPWLGSLTGDVISRTAFGSSYKEGHRIFELQSELTELLIQAVQRFFIPGY  247

Query  864   RFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGN  1043
             R+LPTK NRRM    +E+  +L+ II KR+ A + GE  SN+LL  LLESN  E K  GN
Sbjct  248   RYLPTKDNRRMKVAAREVQDILRGIINKRLAAREAGEAPSNDLLGTLLESNLGEGK--GN  305

Query  1044  QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPD  1223
                GMSIED++ ECKLFY AGQETTS LLVWTMILLS++Q+WQ  AREEV   FGD +PD
Sbjct  306   ---GMSIEDVMEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQAFGDKEPD  362

Query  1224  FDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPE  1403
              +GLN LK++TMI NE LRLYPPV  L R + ++ KLG+++LP+GV + +PI+ + HD E
Sbjct  363   TEGLNHLKVMTMIFNEVLRLYPPVIQLTRAIHKETKLGDMTLPSGVHITLPILLVQHDTE  422

Query  1404  MWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFS  1583
             +WG DA EF PERF++G+SKAT  +  + PF  GPRICIG N AM+EAK A++ IL+RFS
Sbjct  423   LWGNDAAEFKPERFKDGISKATKSQVSFFPFGWGPRICIGQNLAMLEAKMAMALILQRFS  482

Query  1584  FKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             F+LSPSY HAP    T +P +GAPLIL KL
Sbjct  483   FELSPSYVHAPLPVFTVHPQFGAPLILHKL  512



>ref|XP_011082818.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=521

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/522 (52%), Positives = 370/522 (71%), Gaps = 5/522 (1%)
 Frame = +3

Query  120   MRMEV-FCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKE  296
             M+ME+   ++F+    +  +  A R++NW W RPK LEK LR Q L+GNPYR   GD K 
Sbjct  1     MKMELKLSSIFISVLIVGLITWAVRILNWVWFRPKKLEKLLRKQGLQGNPYRFLLGDMKT  60

Query  297   IAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEV  476
             +  +  E ++K +  LSD + P ++PY+ + I ++G+NSF+W G  P + ITDP  +KE+
Sbjct  61    LISVTKEEQTKSIQ-LSDHLAPHILPYYHQIINEYGQNSFIWFGPSPRLNITDPQLMKEI  119

Query  477   LSKHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSE  656
             L+K   F + L DP+   ++ GLL  E +KW++HRKI NPAF +EKLK+MV A+   CS 
Sbjct  120   LTKPEVFHKPLPDPIGETIAGGLLFLEDEKWAQHRKIINPAFHMEKLKNMVSAIRLSCSN  179

Query  657   MVGRWEEIVSRNE-SGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASE  833
             MV +WE + SR+E S E+DVWP L++++ +VIS TAFG S+E GRR+FEL  E  +   E
Sbjct  180   MVEKWESMFSRSERSLEIDVWPHLESLSGDVISRTAFGSSHEEGRRIFELHREQVKLVLE  239

Query  834   LRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLES  1013
             L    +IPG RF+PTK NRRM  I KEI ++L+ II +R  AM+ GE   ++LL  L+ES
Sbjct  240   LLKFFFIPGWRFVPTKANRRMRAISKEIQSLLRGIINQREKAMERGETVGDDLLSTLMES  299

Query  1014  NFKEMKHHGNQ--EFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELARE  1187
             N KE++ HG +  + GM IED+I+ECKLFY AG ETTS LLVWTM++LS++QEWQ  ARE
Sbjct  300   NLKEIEEHGGKKKDVGMDIEDVINECKLFYFAGSETTSLLLVWTMVMLSKHQEWQVRARE  359

Query  1188  EVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRL  1367
             EV  VFG ++P F+GLNRLK+VT IL+E LRLYPPVP + R   +  KLGN++LP GV L
Sbjct  360   EVSQVFGKNEPTFEGLNRLKVVTTILHEVLRLYPPVPLITRAPTKTLKLGNITLPVGVDL  419

Query  1368  LVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEA  1547
             ++ I  LHHDP++WG+D N+F PERF EG+S AT G+  ++PFS GPR+C+G  FAM+EA
Sbjct  420   ILLIGLLHHDPKIWGDDVNQFKPERFSEGISSATKGQFSFIPFSAGPRVCVGQQFAMIEA  479

Query  1548  KTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             K AL  IL++FSF+LS SY HAP++ LT  P YGA LIL +L
Sbjct  480   KLALVMILQKFSFELSSSYLHAPFSILTLRPQYGAALILHRL  521



>ref|XP_009394811.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=526

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/504 (53%), Positives = 353/504 (70%), Gaps = 2/504 (0%)
 Frame = +3

Query  165   IMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVL  344
             ++ LVCA   +N AW RP+  ++ LR Q L+G PYR   GD KE  +++ E  SKPM  L
Sbjct  20    LLLLVCAVWALNHAWWRPRRQDRLLRAQGLQGTPYRFLRGDLKEDKRLLEEALSKPMP-L  78

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS-KHNTFQQNLADPV  521
             S  +VPRV P+   ++   G   F W G +P V+I DP+ V+E+LS K   F++    P+
Sbjct  79    SHHIVPRVEPFLHAAMNDLGSRFFSWFGPVPRVMIMDPELVREILSNKFGHFERITLSPL  138

Query  522   VYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESG  701
                ++ GLL Y G KW+KHR+I NPAF +EKLK M+ A    C ++VGRWE +V +  S 
Sbjct  139   GRAVATGLLSYNGGKWAKHRRILNPAFHVEKLKRMLLAFSASCGDLVGRWENLVGQEGSC  198

Query  702   ELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTK  881
             ELDVWPE +    +VIS  AFG +YE GRR+F+LQ ELA+   +  HS YIPG RFLPT 
Sbjct  199   ELDVWPEFQYFTGDVISRAAFGSNYEEGRRIFQLQLELAQLVVQAIHSGYIPGYRFLPTP  258

Query  882   KNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMS  1061
             KN R+  I+KEI ++L+ II+KR  AMK GE +  +LL +L+ESN K+ + HGN++ GM+
Sbjct  259   KNNRIKAINKEIRSLLRGIIKKREEAMKTGEASGQDLLGLLMESNIKQFQEHGNKKAGMT  318

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             I++++ ECKLFY AGQETT+ LL WTMI+LS + EWQE AREEV+ V G DKP+FDGLNR
Sbjct  319   IDEVVEECKLFYFAGQETTAVLLTWTMIVLSMHPEWQERAREEVLQVLGKDKPEFDGLNR  378

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LKIVTMIL E LRLYPP+  + R   +  ++GN+S P G  L +PI+FLHHD  +WGEDA
Sbjct  379   LKIVTMILYEVLRLYPPLLLIQRRTYKTVEIGNVSYPPGTLLALPIVFLHHDQILWGEDA  438

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
             +EF PERF EG++KA+  +  + PF GGPR+CIG NFA++EAK  LS IL+RF F+LSPS
Sbjct  439   SEFKPERFAEGIAKASRDQVAFFPFGGGPRVCIGQNFALLEAKMGLSTILQRFWFELSPS  498

Query  1602  YAHAPYTGLTTNPLYGAPLILQKL  1673
             YAHAP++ +T  P +GA L L KL
Sbjct  499   YAHAPHSVVTLRPQHGAQLRLHKL  522



>dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=518

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/525 (52%), Positives = 363/525 (69%), Gaps = 10/525 (2%)
 Frame = +3

Query  105   AGQVMMRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYG  284
              G ++  + V C +   S        AW+   W W+ P+ LEK LR Q +KG  Y+   G
Sbjct  2     VGGILFTLLVTCAVIYIS------SWAWKAFVWVWLNPRKLEKCLREQGIKGPSYKFLSG  55

Query  285   DTKEIAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDH  464
             + K+I     E ++KPM  LS ++VPRV+P+  ++++K+GK SF+W G    V I DPD 
Sbjct  56    NLKDIVSATQEARAKPME-LSHKIVPRVMPFVHQTVEKYGKLSFIWYGPYCRVNIMDPDM  114

Query  465   VKEVLS-KHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMY  641
             ++++LS K   F++   +P+   L  G++ YEG+KW KHR+I NPAF LEKLK M+PA+Y
Sbjct  115   IRDILSNKFGHFEKIRTNPLGKLLISGVVSYEGEKWVKHRRILNPAFHLEKLKMMLPAIY  174

Query  642   KICSEMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAE  821
               CSEMV +WE +VS++ S ELDVWP L+ +  +VIS TAFG SYE GRR+F+LQ E A 
Sbjct  175   TSCSEMVNKWEMMVSQD-SCELDVWPHLQNLTADVISRTAFGSSYEEGRRIFQLQSEQAG  233

Query  822   HASELRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDM  1001
                +   S+YIPG RFLPTK+N RM  I  E   +L+ I+ KR  AMK GE  +++LL +
Sbjct  234   LVIKALQSIYIPGLRFLPTKRNNRMKEIYGEARVLLRDIVNKREKAMKIGEAHNDDLLGL  293

Query  1002  LLESNFKEMKHHGN-QEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQEL  1178
             L+ESNFKE+  + N + FGM+I+++I ECKLFY AGQETTS LLVWTM++LS + +WQE 
Sbjct  294   LMESNFKEITDNVNSKNFGMTIDEVIDECKLFYFAGQETTSTLLVWTMVVLSMHPDWQEK  353

Query  1179  AREEVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAG  1358
             AREEV+ VFG   PDFDGLN LKIVTMIL E LRLYPP   + R   +  KLG ++LPAG
Sbjct  354   AREEVLQVFGGKDPDFDGLNHLKIVTMILYEVLRLYPPAVLMARGTYKTMKLGEITLPAG  413

Query  1359  VRLLVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAM  1538
             V L +P + +HHD E+WGEDA +FNPERF  GVSKAT  +  + PFS GPRICIG NFA+
Sbjct  414   VHLAMPTLLVHHDRELWGEDAEDFNPERFSGGVSKATKNQVSFFPFSWGPRICIGQNFAL  473

Query  1539  VEAKTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             +E+K A++ IL+RFSF+LS +Y HAPYT +T  P +GA LIL KL
Sbjct  474   LESKMAIAMILQRFSFELSSTYVHAPYTVITLQPQHGAQLILHKL  518



>ref|XP_010275181.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/499 (53%), Positives = 357/499 (72%), Gaps = 3/499 (1%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AW V+   W RP  LEK  R Q ++G P    +G+ K+  +M NE  SKPMN LS ++ P
Sbjct  20    AWSVLYSIWWRPMKLEKCFREQGIEGPPRIWLHGNLKDEVRMRNEALSKPMN-LSHDIAP  78

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLS-KHNTFQQNLADPVVYKLSQ  539
             RV+P+  ++I+K+G  S  W G  P + + DPD +K++LS K   F++  ++P++     
Sbjct  79    RVVPFVHQTIEKYGNMSVTWFGRTPRINVMDPDLIKDILSNKFGQFEKPKSNPLIRLFVD  138

Query  540   GLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWP  719
             GL+ +EG+KW+KHR+I NPAF +EKLK M+PA Y  C EM+ +WE++V+   S ELD+WP
Sbjct  139   GLVSHEGEKWAKHRRIINPAFHIEKLKRMLPAFYTSCFEMITKWEKLVALEGSCELDIWP  198

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
             EL+ +  +VIS TAFG SY+ GRR+F+LQ+E A+   ++  S+YIPG R LPTK+N RM 
Sbjct  199   ELQNLTGDVISRTAFGSSYDEGRRIFQLQNEQAKIVMDVALSIYIPGYRLLPTKRNNRMK  258

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE-FGMSIEDII  1076
              ID+E+  +L+RI+ KR  A+K GE + ++LL +LLESNFKE++ HGN++  GM+++++I
Sbjct  259   EIDREVRGLLRRIVNKREKAIKLGEASKDDLLGLLLESNFKEIREHGNEKNIGMNVDEVI  318

Query  1077  SECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVT  1256
              ECKLFY AGQETTS+LLVWTM++LS + EWQ  AREEV+  FG DKPDFDG+N LK+V+
Sbjct  319   EECKLFYFAGQETTSNLLVWTMVVLSMHPEWQMRAREEVLQSFGKDKPDFDGINHLKVVS  378

Query  1257  MILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNP  1436
             MIL E LRLYPP   L R   +  KLG++ LP  V L +P I +HH  E+WGEDA EF P
Sbjct  379   MILYEVLRLYPPAVALTRQTYKKVKLGDVYLPPRVELSLPTILIHHSRELWGEDAQEFKP  438

Query  1437  ERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAP  1616
             ERF  GVSKA N +  ++PF  GPRICIG NFAM+EAK AL+ IL+ FSF+LSPSYAHAP
Sbjct  439   ERFLGGVSKAANNQVSFIPFGWGPRICIGQNFAMIEAKMALALILQHFSFELSPSYAHAP  498

Query  1617  YTGLTTNPLYGAPLILQKL  1673
              T +T  P YGA +IL KL
Sbjct  499   CTIITLQPQYGAQIILHKL  517



>ref|XP_007224159.1| hypothetical protein PRUPE_ppa016446mg [Prunus persica]
 gb|EMJ25358.1| hypothetical protein PRUPE_ppa016446mg [Prunus persica]
Length=519

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/499 (53%), Positives = 356/499 (71%), Gaps = 3/499 (1%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV-LSDEVV  359
             AWRV+NW  +RPK LE+ LR Q   GN YRL +GDTK+ + M+ + +SKPM +  S ++ 
Sbjct  20    AWRVLNWMCLRPKKLERCLREQGFTGNSYRLLFGDTKDSSMMLRQAQSKPMKLSTSHDIA  79

Query  360   PRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQ  539
             PRV+P+  + ++ +G+NSFVW+G +P + I +P+ +KE+ +K   FQ+  A+P++  L Q
Sbjct  80    PRVMPFVHQIVKTYGRNSFVWMGPMPKLNIMNPEDLKEIFNKRQNFQRPSANPLIKLLVQ  139

Query  540   GLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGELDVWP  719
             GLL  E +KW+KHRKI  PAF LEKLK M+P  Y+ CS+M+  W+ +VS++ S E DVWP
Sbjct  140   GLLHIEDEKWAKHRKIIKPAFHLEKLKGMLPTFYQSCSDMINEWKGLVSKDGSCEFDVWP  199

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
              LK ++ +VI+  AFG SY+ GR++F+L  +  ++ S +  SVYIPG RFLPTK NRRM 
Sbjct  200   CLKNLSADVIARAAFGSSYQEGRKIFQLLQQQDKNFSLVVRSVYIPGSRFLPTKHNRRMK  259

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQ-EFGMSIEDII  1076
              I+KEIN +LK II KR   +K GE+  ++LL +L+ESN KE++ HGN+ + GMSI+D+I
Sbjct  260   EINKEINVLLKGIINKREEEIKLGEDNKDDLLGILMESNLKEIREHGNKTDTGMSIQDVI  319

Query  1077  SECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVT  1256
              EC+LFYLAG E+TS LLVW MILL +NQ WQ  AREEV+  F  + P F+ L++LK+VT
Sbjct  320   EECRLFYLAGSESTSTLLVWAMILLGQNQNWQARAREEVLQAFESNPPSFNALSQLKVVT  379

Query  1257  MILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNP  1436
             M+L E LRLYP    L R   +  +LG   LPAGV + + I+F+HHD E+WGEDA+EF P
Sbjct  380   MVLLEVLRLYPAGVELPRTTCKKTQLGKFLLPAGVLVSLHIMFVHHDKELWGEDADEFKP  439

Query  1437  ERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAP  1616
             ERF EG+SKAT  +  Y PF  GPRICIG NFAM EAK AL+ IL+ F+F LSPSYAHAP
Sbjct  440   ERFSEGISKATKNQFAYFPFGAGPRICIGQNFAMQEAKLALALILQHFTFDLSPSYAHAP  499

Query  1617  YT-GLTTNPLYGAPLILQK  1670
              T G    P YGA +IL+K
Sbjct  500   TTQGNLLQPQYGAHIILRK  518



>ref|XP_008219216.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/504 (52%), Positives = 359/504 (71%), Gaps = 3/504 (1%)
 Frame = +3

Query  168   MFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNV-L  344
             + +  AWRV+NW W+RPK LE+ LR Q   GN YRL +GDTK+ + M+ + +SKPM +  
Sbjct  15    IVIAWAWRVLNWMWLRPKKLERCLREQGFTGNSYRLLFGDTKDSSMMLRQAQSKPMKLST  74

Query  345   SDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVV  524
             S ++ PRV+P+  + ++ +G+NSFVW+G +P + I +P+ +KE+ +K   FQ+  A+P++
Sbjct  75    SHDIAPRVMPFVHQIVKTYGRNSFVWMGPMPKLNIMNPEDLKEIFNKRQNFQRPSANPLI  134

Query  525   YKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVSRNESGE  704
               L QGLL  E  KW+KHRKI  PAF LEKLK M+P  Y+ CS+M+  W+ +VS++ S E
Sbjct  135   KLLVQGLLHIEDVKWAKHRKIIKPAFHLEKLKGMLPTFYQSCSDMINEWKGLVSKDGSCE  194

Query  705   LDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKK  884
              DVWP LK ++ +VI+  AFG SY+ GR++F+L  +  ++ S +  SVYIPG RFLPTK 
Sbjct  195   FDVWPCLKNLSADVIARAAFGSSYQEGRKIFQLLQQQDKNFSLVVRSVYIPGWRFLPTKH  254

Query  885   NRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQ-EFGMS  1061
             NRRM  I+KEIN +L+ II KR   +K GE+  ++LL +L+ESN KE++ HGN+ + GMS
Sbjct  255   NRRMKEINKEINVLLRGIINKREEEIKLGEDNKDDLLGILMESNLKEIREHGNKTDTGMS  314

Query  1062  IEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNR  1241
             I+D+I EC+LFYLAG E+TS LLVW MILL +NQ WQ  AREEV+  F  + P F+ L++
Sbjct  315   IQDVIEECRLFYLAGSESTSTLLVWAMILLGQNQNWQARAREEVLQAFESNPPSFNALSQ  374

Query  1242  LKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDA  1421
             LK+VTM+L E LRLYP    L R   +  +LG   LPAGV + + I+F+HHD E+WGEDA
Sbjct  375   LKVVTMVLLEVLRLYPAGVELPRTTCKKTQLGKFLLPAGVLVSLHIMFVHHDKELWGEDA  434

Query  1422  NEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPS  1601
             +EF PERF EG+SKAT  +  Y PF  GPRICIG NFAM EAK AL+ IL+ F+F+LSPS
Sbjct  435   DEFKPERFSEGISKATKNQFAYFPFGAGPRICIGQNFAMQEAKLALALILQHFTFELSPS  494

Query  1602  YAHAPYT-GLTTNPLYGAPLILQK  1670
             YAHAP T G    P YGA +IL+K
Sbjct  495   YAHAPTTQGNLLQPQYGAHIILRK  518



>ref|XP_008804072.1| PREDICTED: cytochrome P450 72A15-like [Phoenix dactylifera]
Length=523

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/522 (50%), Positives = 366/522 (70%), Gaps = 4/522 (1%)
 Frame = +3

Query  114   VMMRMEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTK  293
              ++ +++  NL      ++ LV     + WAW RP+ LE+ LR Q LKG  YR  YGD +
Sbjct  2     ALVSVDMLWNLGWGLVGVLLLVRGVSALEWAWWRPRRLERALRAQGLKGTRYRFLYGDLR  61

Query  294   EIAKMMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKE  473
             +  ++  E +S PM   S +++PRV+P+  ++I+K+GK SF W G  P V I DP   +E
Sbjct  62    DYDRLNKEARSMPM-AFSHQIIPRVLPHLHQAIKKNGKTSFTWFGPDPRVAIMDPGLTRE  120

Query  474   VLS-KHNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKIC  650
             +LS K   F++  ++P+   L+ GL  YE +KW+KHR+I NPAF LEKLK M+PA    C
Sbjct  121   ILSNKFGHFEKPNSNPLGRLLAGGLASYEREKWAKHRRIINPAFHLEKLKCMLPAFSTCC  180

Query  651   SEMVGRWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHAS  830
              E++ +W+ +V+   S ELDVWPE ++   +VIS TAFG ++  G+R+F LQ E AE   
Sbjct  181   DELIDKWDRLVASKGSCELDVWPEFQSFTADVISRTAFGSNFREGQRIFHLQEEQAELVI  240

Query  831   ELRHSVYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLE  1010
                 ++YIPG RFLPTKKN+RM  I+ EI ++L+ +I++R  A+++G  ++ +LL +L+E
Sbjct  241   PALQNIYIPGFRFLPTKKNKRMKEINIEIQSLLRSMIDRREVAIRKGGTSNEDLLGLLME  300

Query  1011  SNFKEMKHH--GNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAR  1184
             SNF+  K +  G++  GMSIED+I ECKLFY AG ETTS LL WT++ LS +  WQ  AR
Sbjct  301   SNFRHSKENEGGSKNSGMSIEDVIEECKLFYFAGHETTSVLLTWTLVALSLHPSWQARAR  360

Query  1185  EEVMHVFGDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVR  1364
             EEV+ VFG +KPD+DGL+RLKIVTM+L E LRLYPP   L+R+  ++ KLG  + P GV+
Sbjct  361   EEVLQVFGGNKPDYDGLSRLKIVTMVLYEVLRLYPPAVFLLRMTYKEMKLGQFTFPEGVQ  420

Query  1365  LLVPIIFLHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVE  1544
             LL+PIIF+HHDPE WGEDA+EFNPERF EGVSKA+  +  ++PF GGPRICIG +FAM+E
Sbjct  421   LLLPIIFIHHDPEFWGEDASEFNPERFAEGVSKASKIQGAFIPFGGGPRICIGQSFAMME  480

Query  1545  AKTALSCILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQK  1670
             AK AL+ IL+ F+F+LSPSYAHAPYT  T +P +GA +IL +
Sbjct  481   AKMALARILQHFTFQLSPSYAHAPYTVATLHPQHGAQIILHR  522



>gb|AJD25169.1| cytochrome P450 CYP72A328 [Salvia miltiorrhiza]
Length=517

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/516 (51%), Positives = 359/516 (70%), Gaps = 6/516 (1%)
 Frame = +3

Query  132   VFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMM  311
             + C   L +      VC  +++NW W RP+ LEK LR Q   GN YR+ YGD K++  M 
Sbjct  4     IICLQTLSAIVAFTYVC--KILNWVWFRPRNLEKRLRRQGFTGNSYRVLYGDLKDMRLMS  61

Query  312   NETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHN  491
              E  SKP++  S + V R++P F  +++K+G+N FVW G  P +++ +P+ V+EV+SK N
Sbjct  62    KEASSKPLD-FSHDFVHRIMPIFHFALKKYGENCFVWFGPSPAILVMNPESVREVVSKSN  120

Query  492   TFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRW  671
              FQ+    P +  +S+GL+  E DKW+KHR++ NPAF + KL+HMVP+ Y  C EM+ +W
Sbjct  121   VFQKPPGRPFIRLMSKGLVTLETDKWAKHRRLINPAFHVHKLEHMVPSFYLSCDEMLSKW  180

Query  672   EEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVY  851
             ++IV      E+DVWP L+T+  +VIS TAFG SY  GR++FELQ ELA+H  E   SVY
Sbjct  181   DKIVGNEGCCEVDVWPYLQTLTSDVISRTAFGSSYLEGRKIFELQRELAQHVMEGNRSVY  240

Query  852   IPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMK  1031
             IPG RFLPTK NRR+  I KE+ + +  II  R  AM+ GE +  +LL +LLESN KE++
Sbjct  241   IPGYRFLPTKVNRRVKEITKEVRSSMLGIINTRSKAMEAGEASKEDLLGILLESNSKEIE  300

Query  1032  HHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGD  1211
              HG++  GMS++++I ECKLFY AG ETT+ LLVWTMILLS++++WQ  AR+EV+ VF  
Sbjct  301   QHGSKH-GMSMDEVIEECKLFYFAGXETTASLLVWTMILLSKHEDWQSRARDEVLQVFKR  359

Query  1212  DKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLH  1391
              + D+  LN LKI+ MIL+E LRLYPP   L+R    + +LGN++LPAGV+L++P+I LH
Sbjct  360   GESDYQELNNLKILGMILHEVLRLYPPGLVLLRFTPNECRLGNVNLPAGVQLMLPLILLH  419

Query  1392  HDPEMWGEDANEFNPERFREGVSKATNGKA--CYLPFSGGPRICIGLNFAMVEAKTALSC  1565
             HDP++WG+DA EF PERFR+GV KA  G     Y PF  GPR CI  NFAM+EAK A++ 
Sbjct  420   HDPKIWGDDAEEFRPERFRDGVPKAAQGAGQLAYFPFGWGPRXCIAQNFAMLEAKMAMAM  479

Query  1566  ILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             IL+R+SF+LSPSY HAPY  +T  P +GA LIL KL
Sbjct  480   ILQRYSFQLSPSYTHAPYKVITLQPQHGAHLILTKL  515



>emb|CDX98485.1| BnaC05g38900D [Brassica napus]
Length=512

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/498 (53%), Positives = 356/498 (71%), Gaps = 7/498 (1%)
 Frame = +3

Query  183   AWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKPMNVLSDEVVP  362
             AWR +NW W +PK LE +LR Q L G+PY    GD K    ++ E +SKP+  L+D++ P
Sbjct  21    AWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDLKRNFSLLKEARSKPIK-LTDDITP  79

Query  363   RVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLADPVVYKLSQG  542
             RV+PY  + ++ HG+  F WLG IP + I DP+ +KEV +K   FQ+    P+   +  G
Sbjct  80    RVVPYPLKMLKTHGRTYFTWLGPIPTITIMDPEQIKEVFNKVYDFQKTHTFPLARLIGTG  139

Query  543   LLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS-RNESGELDVWP  719
             L  Y+ DKW+KHR+I NPAF LEK+K+MVPA ++ CSE+VG W+++VS +  S E+DVWP
Sbjct  140   LASYDCDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGEWDKLVSEKGLSCEVDVWP  199

Query  720   ELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRFLPTKKNRRMN  899
              L ++  +VIS TAFG SY+ G+R+FELQ ELA+   +      IPG  +LPTK+NR M 
Sbjct  200   GLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKHIIPGYSYLPTKENRMMK  259

Query  900   GIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQEFGMSIEDIIS  1079
                +E++ +L+ I+ KR+ A + GE  S++LL +LLESN  ++K  GN   GMS ED+I 
Sbjct  260   AKAREVHAILRGIVNKRLRAREAGEAPSDDLLGILLESNLGQVK--GN---GMSNEDVIE  314

Query  1080  ECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFDGLNRLKIVTM  1259
             ECKLFY AGQETTS LLVWTM+LLS++Q+WQ  AREEV  VFG   PD DGLN+LK++TM
Sbjct  315   ECKLFYFAGQETTSVLLVWTMVLLSQHQDWQAKAREEVKQVFGHKIPDTDGLNQLKVMTM  374

Query  1260  ILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMWGEDANEFNPE  1439
             IL E LRLYPPV  + R + ++ KLG+L+LP GV++ +PI+ +  D E+WG+DA EF PE
Sbjct  375   ILYEVLRLYPPVTQVSRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGDDAGEFKPE  434

Query  1440  RFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFKLSPSYAHAPY  1619
             RFREG+SKAT  +  + PF+ GPRICIG NFA++EAK A++ IL+RFSF+LSPSY HAPY
Sbjct  435   RFREGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPSYVHAPY  494

Query  1620  TGLTTNPLYGAPLILQKL  1673
             T +T +P +GA LIL KL
Sbjct  495   TVITIHPQFGAHLILHKL  512



>ref|XP_011098146.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=517

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/508 (51%), Positives = 354/508 (70%), Gaps = 5/508 (1%)
 Frame = +3

Query  162   SIMFLVCAWRVV---NWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAKMMNETKSKP  332
             SI+ LV    +V   NW W RPK LEK LR Q L GNPYRLF GD ++++ +M   + K 
Sbjct  11    SILILVSTALIVKLLNWVWFRPKKLEKLLRKQGLNGNPYRLFRGDMQDLSNVMKTKQPKT  70

Query  333   MNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSKHNTFQQNLA  512
             +  LSD++ P ++PY+   I K+GK+SF+W+G  P + + DP+H+KE+LSK   F + L 
Sbjct  71    LK-LSDDLPPHILPYYHNIIDKYGKHSFIWVGPSPRLNVADPEHIKEILSKPGLFHKPLP  129

Query  513   DPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVGRWEEIVS-R  689
             DP+   +  GL   E D+W+KHR+I NPAF +EKLK+M+PAM+  CS+++ +WE  +S  
Sbjct  130   DPIGETIVGGLAYLEDDRWAKHRRIMNPAFHMEKLKNMIPAMFLSCSKLIEKWEASISGS  189

Query  690   NESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHSVYIPGGRF  869
               S E+DVWP L+ +  +VIS TAFG SYE GRR+FELQ E  +    L    ++PG R+
Sbjct  190   GSSQEIDVWPYLQDLTGDVISRTAFGRSYEEGRRIFELQREQVKLVLHLFPFSFLPGWRY  249

Query  870   LPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKEMKHHGNQE  1049
              PTK NR++  I KEI ++++ II +R  AM  GE    +LL +L+ESN +E++ HGN+ 
Sbjct  250   FPTKANRKLRAITKEIQSLVRGIINQREQAMARGEIIHMDLLGILMESNSREIQQHGNKN  309

Query  1050  FGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVFGDDKPDFD  1229
              G+SIED+I ECKLFY AG ++TS LLVWTM+LLS +Q+WQ  AREEV+ VFG  +P FD
Sbjct  310   AGLSIEDVIEECKLFYFAGSDSTSTLLVWTMVLLSNHQDWQARAREEVLKVFGKKQPTFD  369

Query  1230  GLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIFLHHDPEMW  1409
             GL++LKIVTMI  E LRLYPP P +IR   +  +LG+ ++P GV+L + I  LHHDP +W
Sbjct  370   GLHQLKIVTMIFQEVLRLYPPAPLIIRAPTKTVQLGSTTIPVGVQLTLLIGLLHHDPNIW  429

Query  1410  GEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSCILRRFSFK  1589
             G D  EF PERF EG+S AT  +  ++PFS GPR+C+G NFAM+EAK AL+ IL+ FSF+
Sbjct  430   GNDVKEFKPERFSEGISSATKTQYSFIPFSAGPRVCVGQNFAMIEAKMALAMILQHFSFE  489

Query  1590  LSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             LS SY HAP+   T  P YGAPLI++KL
Sbjct  490   LSSSYLHAPFPIFTLQPQYGAPLIVRKL  517



>gb|AJD25170.1| cytochrome P450 CYP72A329 [Salvia miltiorrhiza]
Length=512

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/516 (51%), Positives = 361/516 (70%), Gaps = 4/516 (1%)
 Frame = +3

Query  126   MEVFCNLFLFSFSIMFLVCAWRVVNWAWIRPKTLEKWLRGQDLKGNPYRLFYGDTKEIAK  305
             M+VF +    S + + L+  W+++NW W  PK LEK LR Q   GN Y+LFYGD KEI  
Sbjct  1     MDVFISTVEISCAAVALIYLWKLLNWVWFTPKKLEKILRQQGFNGNSYKLFYGDFKEIRS  60

Query  306   MMNETKSKPMNVLSDEVVPRVIPYFFESIQKHGKNSFVWLGTIPMVIITDPDHVKEVLSK  485
             +  E  SKPMN  S+++ PR IP + ++ +++G+ SF W G  P + IT+P+ ++E+ SK
Sbjct  61    IAKEAVSKPMN-FSNDIAPRAIPIYHQTCKRYGEKSFTWFGPKPAINITEPEMIREITSK  119

Query  486   HNTFQQNLADPVVYKLSQGLLKYEGDKWSKHRKIANPAFQLEKLKHMVPAMYKICSEMVG  665
             +  F +   +P    L++G+  YE DKW+KHRK+ NPAF ++KLKHMVPA +   ++M+ 
Sbjct  120   NYVFLKPTGNPFGKMLAKGVALYETDKWAKHRKLINPAFHVQKLKHMVPAFHVSTADMLK  179

Query  666   RWEEIVSRNESGELDVWPELKTIAVNVISLTAFGISYETGRRLFELQHELAEHASELRHS  845
             +W+E+V    S E+DVWP L+T+  +VIS TAFG SYE G ++F+LQ E  E   E    
Sbjct  180   KWDELVPDGGSCEVDVWPGLQTMTSDVISRTAFGSSYEEGTKIFQLQREQVERIIEAGRH  239

Query  846   VYIPGGRFLPTKKNRRMNGIDKEINTVLKRIIEKRIGAMKEGEEASNNLLDMLLESNFKE  1025
             + +PG  +LPTK NRR+  I  E+ + +  II KR+ AM+ GE + ++LL +LLESN KE
Sbjct  240   MPVPG--WLPTKNNRRLKEIVAEVESRVLGIINKRMKAMEAGEPSMDDLLGILLESNAKE  297

Query  1026  MKHHGNQEFGMSIEDIISECKLFYLAGQETTSDLLVWTMILLSRNQEWQELAREEVMHVF  1205
             M+ HGN   GM+IE+++ ECK+FY AGQET++ LLVWTMILLS++Q+WQ+ AR+EV+ VF
Sbjct  298   MREHGNAS-GMTIEEVMEECKVFYFAGQETSASLLVWTMILLSKHQDWQDRARDEVLQVF  356

Query  1206  GDDKPDFDGLNRLKIVTMILNESLRLYPPVPTLIRIVKEDAKLGNLSLPAGVRLLVPIIF  1385
             G  KPD+  LN+LKI+ MILNESLR+Y P  TL R    +A  G   +PAGV+L++P++ 
Sbjct  357   GKGKPDYQELNQLKIMNMILNESLRVYTPGATLGRFTHSEANFGKYKIPAGVQLVLPVLA  416

Query  1386  LHHDPEMWGEDANEFNPERFREGVSKATNGKACYLPFSGGPRICIGLNFAMVEAKTALSC  1565
             +HHD  +WG+DA  F PERF EGVSKAT G+  ++PF  GPRICIG NFAM+EAK A+  
Sbjct  417   VHHDTRLWGDDATSFKPERFAEGVSKATQGQPKFIPFGSGPRICIGQNFAMLEAKLAMVM  476

Query  1566  ILRRFSFKLSPSYAHAPYTGLTTNPLYGAPLILQKL  1673
             IL+ +SFKLSPSYAHAP+  +T  P YGA LIL KL
Sbjct  477   ILQNYSFKLSPSYAHAPHALITLQPQYGAHLILTKL  512



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5380304293438