BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16884_g2_i1 len=1091 path=[1069:0-1090]

Length=1091
                                                                      Score     E

ref|XP_006338361.1|  PREDICTED: ninja-family protein AFP3-like          196   1e-55   
ref|XP_009797625.1|  PREDICTED: ninja-family protein AFP3-like          191   2e-53   
ref|XP_009605136.1|  PREDICTED: ninja-family protein AFP3-like          186   1e-51   
ref|XP_004232160.1|  PREDICTED: ninja-family protein AFP3               184   5e-51   
emb|CDP02322.1|  unnamed protein product                                183   2e-50   
ref|XP_009764520.1|  PREDICTED: ninja-family protein AFP3-like          169   2e-45   
ref|XP_007032759.1|  ABI five binding protein 3, putative               167   3e-44   
ref|XP_009588665.1|  PREDICTED: ninja-family protein AFP3-like          166   3e-44   
gb|KHG26156.1|  Ninja-family protein AFP2                               163   5e-43   
ref|XP_011098752.1|  PREDICTED: ninja-family protein AFP3-like is...    159   8e-42   
ref|XP_011000075.1|  PREDICTED: ninja-family protein AFP3-like          159   4e-41   
ref|XP_011098751.1|  PREDICTED: ninja-family protein AFP3-like is...    157   5e-41   
ref|XP_010258036.1|  PREDICTED: ninja-family protein AFP3               156   1e-39   
ref|XP_002324118.2|  hypothetical protein POPTR_0017s13000g             154   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_002527618.1|  hypothetical protein RCOM_1025320                  147   3e-39   Ricinus communis
ref|XP_010089637.1|  hypothetical protein L484_021030                   151   3e-38   
ref|XP_002277117.2|  PREDICTED: ninja-family protein AFP3-like          151   3e-38   Vitis vinifera
emb|CBI21211.3|  unnamed protein product                                151   4e-37   
emb|CDX85274.1|  BnaC07g25850D                                          145   5e-37   
ref|XP_004304226.1|  PREDICTED: ninja-family protein Os03g0214200...    147   6e-37   
gb|KDO72773.1|  hypothetical protein CISIN_1g022431mg                   144   8e-37   
ref|XP_009111795.1|  PREDICTED: ninja-family protein AFP3               143   2e-36   
emb|CAN77669.1|  hypothetical protein VITISV_038107                     150   3e-36   Vitis vinifera
gb|KDP27248.1|  hypothetical protein JCGZ_19947                         146   4e-36   
gb|KDO72774.1|  hypothetical protein CISIN_1g022431mg                   144   4e-36   
ref|XP_007215559.1|  hypothetical protein PRUPE_ppa007375mg             145   5e-36   
ref|XP_008230885.1|  PREDICTED: ninja-family protein AFP3-like          145   5e-36   
emb|CDY00093.1|  BnaC09g02080D                                          142   7e-36   
ref|XP_009365923.1|  PREDICTED: ninja-family protein AFP3-like          144   8e-36   
ref|XP_008365427.1|  PREDICTED: ninja-family protein AFP3-like          144   1e-35   
ref|XP_010260112.1|  PREDICTED: ninja-family protein AFP3-like          145   1e-35   
ref|XP_008357782.1|  PREDICTED: ninja-family protein AFP3-like          144   1e-35   
ref|XP_006431300.1|  hypothetical protein CICLE_v10011883mg             144   1e-35   
ref|XP_006482758.1|  PREDICTED: ninja-family protein AFP3-like is...    144   1e-35   
ref|XP_009365884.1|  PREDICTED: ninja-family protein AFP3-like          143   2e-35   
ref|XP_006395274.1|  hypothetical protein EUTSA_v10004771mg             140   3e-35   
ref|XP_006482754.1|  PREDICTED: ninja-family protein AFP3-like is...    143   4e-35   
ref|XP_006431301.1|  hypothetical protein CICLE_v10011883mg             143   4e-35   
ref|XP_009360511.1|  PREDICTED: ninja-family protein AFP3-like          141   9e-35   
ref|XP_010528407.1|  PREDICTED: ninja-family protein AFP3               140   1e-34   
ref|XP_010502975.1|  PREDICTED: ninja-family protein AFP3               138   1e-34   
ref|XP_003531858.1|  PREDICTED: ninja-family protein AFP2-like          141   2e-34   
ref|XP_010939184.1|  PREDICTED: ninja-family protein Os07g0602900       139   5e-34   
ref|XP_004490204.1|  PREDICTED: ninja-family protein AFP1-like          139   6e-34   
gb|KHN13550.1|  Ninja-family protein AFP2                               139   6e-34   
ref|XP_003552572.2|  PREDICTED: ninja-family protein AFP2-like          139   6e-34   
ref|XP_010514662.1|  PREDICTED: ninja-family protein AFP3-like          136   7e-34   
ref|XP_007139479.1|  hypothetical protein PHAVU_008G032900g             139   8e-34   
gb|KHN14039.1|  Ninja-family protein AFP2                               139   1e-33   
ref|XP_010425750.1|  PREDICTED: ninja-family protein AFP3               135   1e-33   
ref|XP_008805142.1|  PREDICTED: ninja-family protein AFP3-like          138   1e-33   
ref|XP_009151770.1|  PREDICTED: ninja-family protein AFP3-like          135   3e-33   
ref|XP_009399138.1|  PREDICTED: ninja-family protein AFP3-like          136   3e-33   
ref|NP_189598.1|  Ninja-family protein AFP3                             134   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392469.1|  PREDICTED: ninja-family protein 2-like             137   4e-33   
ref|XP_011085686.1|  PREDICTED: ninja-family protein AFP3-like          135   5e-33   
ref|XP_010936468.1|  PREDICTED: ninja-family protein 6                  136   8e-33   
ref|XP_009416563.1|  PREDICTED: ninja-family protein AFP3-like          135   9e-33   
ref|XP_008791349.1|  PREDICTED: ninja-family protein AFP3               127   2e-32   
ref|XP_006437917.1|  hypothetical protein CICLE_v10031813mg             134   3e-32   
ref|XP_008810752.1|  PREDICTED: ninja-family protein 6-like             134   5e-32   
ref|XP_008339804.1|  PREDICTED: ninja-family protein AFP3-like          129   5e-32   
ref|XP_009406311.1|  PREDICTED: ninja-family protein AFP3-like          133   6e-32   
ref|XP_008389402.1|  PREDICTED: ninja-family protein AFP3-like          134   6e-32   
ref|XP_010091583.1|  hypothetical protein L484_026430                   133   7e-32   
ref|XP_008243841.1|  PREDICTED: ninja-family protein AFP3               134   7e-32   
ref|XP_007223056.1|  hypothetical protein PRUPE_ppa006974mg             134   8e-32   
ref|XP_009356414.1|  PREDICTED: ninja-family protein AFP3               134   8e-32   
ref|XP_008350890.1|  PREDICTED: ninja-family protein AFP3-like          133   1e-31   
ref|XP_006291750.1|  hypothetical protein CARUB_v10017919mg             130   1e-31   
emb|CDY44386.1|  BnaA02g29910D                                          130   1e-31   
gb|KDO70354.1|  hypothetical protein CISIN_1g0167841mg                  126   2e-31   
ref|XP_010923621.1|  PREDICTED: ninja-family protein AFP3               130   2e-31   
ref|XP_008785998.1|  PREDICTED: ninja-family protein AFP3-like          131   3e-31   
ref|XP_003520115.1|  PREDICTED: ninja-family protein AFP2-like          132   4e-31   
emb|CDY04085.1|  BnaC02g38000D                                          129   4e-31   
gb|KHN29983.1|  Ninja-family protein AFP2                               131   5e-31   
ref|XP_004297228.1|  PREDICTED: ninja-family protein AFP2-like          130   6e-31   
ref|XP_007153513.1|  hypothetical protein PHAVU_003G042000g             131   6e-31   
emb|CBI27295.3|  unnamed protein product                                130   9e-31   
ref|XP_009416832.1|  PREDICTED: ninja-family protein AFP3-like          130   9e-31   
dbj|BAB01982.1|  unnamed protein product                                128   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002274025.1|  PREDICTED: ninja-family protein AFP2 isoform X1    130   1e-30   Vitis vinifera
ref|XP_007045850.1|  RNA binding protein, putative isoform 2            130   1e-30   
ref|XP_011009405.1|  PREDICTED: ninja-family protein AFP3-like          130   1e-30   
ref|XP_007045849.1|  ABI five binding protein 2, putative isoform 1     130   2e-30   
gb|KHN31942.1|  Ninja-family protein AFP2                               129   3e-30   
ref|XP_010906161.1|  PREDICTED: ninja-family protein AFP3-like is...    129   4e-30   
ref|XP_003516385.1|  PREDICTED: ninja-family protein AFP2-like          129   4e-30   
ref|XP_002306022.2|  hypothetical protein POPTR_0004s11980g             129   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_010906162.1|  PREDICTED: ninja-family protein AFP3-like is...    128   4e-30   
gb|KEH27866.1|  ninja-family protein AFP1                               130   4e-30   
gb|KCW64879.1|  hypothetical protein EUGRSUZ_G02444                     129   5e-30   
emb|CDP00441.1|  unnamed protein product                                128   7e-30   
ref|XP_011011869.1|  PREDICTED: ninja-family protein AFP2-like          127   8e-30   
ref|XP_008361875.1|  PREDICTED: ninja-family protein AFP1-like          129   8e-30   
ref|XP_009397240.1|  PREDICTED: ninja-family protein AFP3-like          125   1e-29   
ref|XP_002512070.1|  RNA binding protein, putative                      126   2e-29   Ricinus communis
ref|XP_009623485.1|  PREDICTED: ninja-family protein AFP2-like is...    126   2e-29   
ref|XP_006348683.1|  PREDICTED: ninja-family protein AFP3-like          127   2e-29   
ref|XP_009623484.1|  PREDICTED: ninja-family protein AFP1-like is...    126   3e-29   
ref|XP_010320856.1|  PREDICTED: ninja-family protein AFP3               127   3e-29   
dbj|BAJ90997.1|  predicted protein                                      125   3e-29   
ref|XP_009760153.1|  PREDICTED: ninja-family protein AFP1-like is...    126   4e-29   
ref|XP_003562743.1|  PREDICTED: ninja-family protein 1-like             125   4e-29   
ref|XP_009760154.1|  PREDICTED: ninja-family protein AFP1-like is...    125   4e-29   
sp|B1B5D3.1|NNJA1_WHEAT  RecName: Full=Ninja-family protein 1; Al...    125   4e-29   Triticum aestivum [Canadian hard winter wheat]
gb|EYU34604.1|  hypothetical protein MIMGU_mgv1a010027mg                125   4e-29   
ref|XP_004237223.1|  PREDICTED: ninja-family protein AFP3 isoform X1    125   5e-29   
sp|B1B5D4.1|NNJA2_WHEAT  RecName: Full=Ninja-family protein 2; Al...    124   6e-29   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006379694.1|  hypothetical protein POPTR_0008s09620g             124   8e-29   
ref|XP_009592703.1|  PREDICTED: ninja-family protein AFP3-like is...    125   1e-28   
gb|AHA43418.1|  ninja-family protein AFP1-like protein                  125   1e-28   
ref|XP_009411123.1|  PREDICTED: ninja-family protein AFP3-like          124   2e-28   
sp|B1B5D5.1|NNJA3_WHEAT  RecName: Full=Ninja-family protein 3; Al...    123   2e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009407390.1|  PREDICTED: ninja-family protein AFP3-like          123   2e-28   
ref|XP_006658776.1|  PREDICTED: ninja-family protein Os07g0602900...    122   2e-28   
gb|EYU28869.1|  hypothetical protein MIMGU_mgv1a008006mg                124   2e-28   
gb|KEH21656.1|  ABI five-binding protein                                123   2e-28   
ref|XP_011018739.1|  PREDICTED: ninja-family protein AFP2-like          123   3e-28   
ref|XP_010527971.1|  PREDICTED: ninja-family protein AFP2               123   3e-28   
ref|XP_010066842.1|  PREDICTED: ninja-family protein AFP3-like          115   3e-28   
gb|KDP41313.1|  hypothetical protein JCGZ_15720                         122   3e-28   
ref|XP_006845867.1|  hypothetical protein AMTR_s00154p00057990          117   4e-28   
sp|Q6YVY6.1|NNJA2_ORYSJ  RecName: Full=Ninja-family protein Os07g...    122   4e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008446443.1|  PREDICTED: ninja-family protein AFP3-like          123   5e-28   
ref|XP_009396433.1|  PREDICTED: ninja-family protein 6-like             122   6e-28   
ref|XP_004135434.1|  PREDICTED: ninja-family protein AFP1-like          122   8e-28   
ref|XP_011101763.1|  PREDICTED: ninja-family protein AFP1-like          122   1e-27   
gb|KHG14342.1|  Ninja-family protein AFP3                               120   1e-27   
ref|XP_009779157.1|  PREDICTED: ninja-family protein AFP3-like          122   1e-27   
ref|XP_004165617.1|  PREDICTED: ninja-family protein AFP1-like          121   2e-27   
ref|XP_006417093.1|  hypothetical protein EUTSA_v10008099mg             120   2e-27   
ref|XP_009394318.1|  PREDICTED: ninja-family protein 6-like             119   2e-27   
ref|XP_010495560.1|  PREDICTED: ninja-family protein AFP2               120   3e-27   
ref|XP_010458838.1|  PREDICTED: ninja-family protein AFP2-like          120   3e-27   
emb|CDY33807.1|  BnaA09g46130D                                          119   3e-27   
ref|XP_006305186.1|  hypothetical protein CARUB_v10009552mg             120   3e-27   
ref|XP_009117975.1|  PREDICTED: ninja-family protein AFP2-like          119   3e-27   
ref|XP_010476399.1|  PREDICTED: ninja-family protein AFP2-like          120   3e-27   
ref|XP_004489525.1|  PREDICTED: ninja-family protein AFP3-like          120   4e-27   
ref|XP_011102058.1|  PREDICTED: ninja-family protein AFP3-like          120   4e-27   
ref|XP_010550299.1|  PREDICTED: ninja-family protein AFP1-like          114   6e-27   
ref|XP_010680683.1|  PREDICTED: ninja-family protein AFP1               120   7e-27   
ref|XP_010228506.1|  PREDICTED: ninja-family protein Os03g0419100...    118   8e-27   
gb|EAZ26053.1|  hypothetical protein OsJ_09907                          119   9e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004958230.1|  PREDICTED: ninja-family protein 3-like isofo...    118   1e-26   
ref|XP_002890019.1|  hypothetical protein ARALYDRAFT_471533             118   1e-26   
gb|EAY89035.1|  hypothetical protein OsI_10519                          119   1e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_010044396.1|  PREDICTED: ninja-family protein AFP3-like          117   1e-26   
ref|NP_001173313.1|  Os03g0214200                                       119   1e-26   
gb|AAL07175.1|  unknown protein                                         117   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563933.1|  ABI five binding protein 2                            117   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008656995.1|  PREDICTED: ninja-family protein 6-like             116   2e-26   
ref|XP_010228505.1|  PREDICTED: ninja-family protein Os03g0419100...    117   2e-26   
ref|XP_006649630.1|  PREDICTED: ninja-family protein Os03g0214200...    118   2e-26   
ref|XP_004231669.2|  PREDICTED: ninja-family protein AFP3-like          115   3e-26   
ref|XP_002467685.1|  hypothetical protein SORBIDRAFT_01g032370          113   3e-26   Sorghum bicolor [broomcorn]
emb|CDY36406.1|  BnaC05g10070D                                          116   4e-26   
ref|XP_009148664.1|  PREDICTED: ninja-family protein AFP2               116   4e-26   
emb|CDY16104.1|  BnaC08g40190D                                          116   4e-26   
ref|XP_004984009.1|  PREDICTED: ninja-family protein 6-like             116   5e-26   
ref|XP_010315690.1|  PREDICTED: ninja-family protein AFP3-like          114   6e-26   
emb|CDX98125.1|  BnaA06g08760D                                          115   6e-26   
ref|XP_004231691.1|  PREDICTED: ninja-family protein AFP3-like          114   8e-26   
ref|XP_011070935.1|  PREDICTED: ninja-family protein AFP2-like          115   9e-26   
ref|NP_001150339.1|  ninja-family protein 6                             114   1e-25   Zea mays [maize]
gb|EAY90484.1|  hypothetical protein OsI_12072                          114   1e-25   Oryza sativa Indica Group [Indian rice]
ref|NP_001050378.1|  Os03g0419100                                       114   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006302500.1|  hypothetical protein CARUB_v10020599mg             114   2e-25   
gb|EAZ27349.1|  hypothetical protein OsJ_11293                          114   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009105006.1|  PREDICTED: ninja-family protein AFP1-like          114   3e-25   
emb|CDY07354.1|  BnaA07g24330D                                          114   3e-25   
ref|XP_010511949.1|  PREDICTED: ninja-family protein AFP1-like          114   3e-25   
ref|NP_564956.1|  ABI five binding protein                              114   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67141.1|  unknown                                                 114   3e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDY04272.1|  BnaC06g25430D                                          114   4e-25   
gb|AAG52486.1|AC018364_4  unknown protein; 57564-56338                  114   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415560.1|  PREDICTED: ninja-family protein AFP1-like          114   4e-25   
ref|XP_010317361.1|  PREDICTED: ninja-family protein AFP3-like          114   4e-25   
ref|XP_010470901.1|  PREDICTED: ninja-family protein AFP1-like          113   6e-25   
gb|AGT16625.1|  hypothetical protein SHCRBa_261_H05_F_190               112   9e-25   
gb|KFK41350.1|  hypothetical protein AALP_AA2G118900                    112   1e-24   
gb|EPS72568.1|  hypothetical protein M569_02189                         105   2e-24   
ref|NP_001147185.1|  ninja-family protein 5                             111   2e-24   Zea mays [maize]
ref|XP_006391038.1|  hypothetical protein EUTSA_v10018761mg             112   2e-24   
ref|XP_002887227.1|  hypothetical protein ARALYDRAFT_894706             111   3e-24   
emb|CDY40905.1|  BnaC06g30430D                                          111   3e-24   
ref|XP_010315753.1|  PREDICTED: ninja-family protein AFP3-like          109   6e-24   
gb|KHN17830.1|  Ninja-family protein AFP3                               107   2e-23   
ref|XP_003527115.1|  PREDICTED: ninja-family protein AFP3-like is...    107   2e-23   
gb|ACU23969.1|  unknown                                                 107   2e-23   Glycine max [soybeans]
ref|XP_003522990.1|  PREDICTED: ninja-family protein AFP3-like is...    107   2e-23   
ref|XP_006582022.1|  PREDICTED: ninja-family protein AFP3-like is...    107   3e-23   
ref|XP_004231689.1|  PREDICTED: ninja-family protein AFP3-like          107   3e-23   
ref|XP_006578537.1|  PREDICTED: ninja-family protein AFP3-like is...    106   4e-23   
ref|XP_006848485.1|  hypothetical protein AMTR_s00013p00255370          109   4e-23   
emb|CBW38448.1|  ABA responsive protein                                 101   5e-23   
ref|XP_007037582.1|  RNA binding-like protein                           109   7e-23   
gb|AES69254.2|  ninja-family protein AFP1                               105   7e-23   
ref|XP_002463155.1|  hypothetical protein SORBIDRAFT_02g038620          106   1e-22   Sorghum bicolor [broomcorn]
emb|CDX95951.1|  BnaA07g27800D                                          106   1e-22   
ref|XP_009105470.1|  PREDICTED: ninja-family protein AFP1               106   1e-22   
gb|EMS53692.1|  hypothetical protein TRIUR3_09869                       104   2e-22   
ref|XP_010464339.1|  PREDICTED: ninja-family protein AFP1-like          105   2e-22   
gb|KDP26350.1|  hypothetical protein JCGZ_17508                         107   2e-22   
ref|XP_007049691.1|  UPF0737 protein AFP3, putative                     106   2e-22   
ref|XP_004499859.1|  PREDICTED: ninja-family protein AFP3-like          103   3e-22   
ref|XP_004231670.1|  PREDICTED: ninja-family protein AFP3-like          103   4e-22   
ref|XP_003599003.1|  hypothetical protein MTR_3g025970                  100   4e-22   
ref|XP_007138357.1|  hypothetical protein PHAVU_009G202000g             102   5e-22   
gb|AAR06258.1|  ABRC5                                                   100   5e-22   Helianthus annuus
ref|XP_010105505.1|  hypothetical protein L484_007123                   104   6e-22   
gb|AGT16981.1|  Protein of unknown function DUF1675                     103   8e-22   
gb|KHG16149.1|  Ninja-family protein AFP3                               104   1e-21   
ref|XP_002531097.1|  hypothetical protein RCOM_1417730                  106   1e-21   Ricinus communis
ref|XP_004985196.1|  PREDICTED: ninja-family protein 1-like             103   1e-21   
ref|XP_010104165.1|  hypothetical protein L484_007004                   104   1e-21   
emb|CBI25670.3|  unnamed protein product                                101   2e-21   
gb|EMT13868.1|  hypothetical protein F775_31150                         103   2e-21   
ref|XP_002884637.1|  hypothetical protein ARALYDRAFT_340917             102   2e-21   
ref|XP_002514649.1|  RNA binding protein, putative                    99.0    2e-21   Ricinus communis
ref|XP_002465644.1|  hypothetical protein SORBIDRAFT_01g042880          103   3e-21   Sorghum bicolor [broomcorn]
gb|AGT15870.1|  hypothetical protein SHCRBa_252_E12_R_390               103   3e-21   
gb|AGT16721.1|  hypothetical protein SHCRBa_127_L16_F_40                103   3e-21   
gb|KEH18131.1|  ninja-family protein AFP1                               101   4e-21   
ref|XP_008450871.1|  PREDICTED: ninja-family protein 6-like isofo...    101   4e-21   
ref|XP_008450949.1|  PREDICTED: ninja-family protein 6-like isofo...    101   4e-21   
gb|KHG19654.1|  Ninja-family protein AFP3                               101   4e-21   
gb|AGT16149.1|  ABI five biding protein 3                               102   4e-21   
gb|KDO65985.1|  hypothetical protein CISIN_1g011821mg                   103   6e-21   
ref|XP_002271712.2|  PREDICTED: ninja-family protein AFP1-like          101   7e-21   Vitis vinifera
ref|XP_010486270.1|  PREDICTED: ninja-family protein AFP3-like          100   7e-21   
ref|XP_009614852.1|  PREDICTED: ninja-family protein 3-like             101   8e-21   
ref|XP_004137434.1|  PREDICTED: ninja-family protein AFP2-like          100   9e-21   
ref|XP_006443552.1|  hypothetical protein CICLE_v10019961mg             102   1e-20   
gb|KFK38175.1|  hypothetical protein AALP_AA3G079100                    100   1e-20   
ref|XP_004510250.1|  PREDICTED: uncharacterized protein LOC101492383    100   1e-20   
gb|KDP31355.1|  hypothetical protein JCGZ_11731                       98.2    2e-20   
ref|XP_002862294.1|  predicted protein                                99.4    2e-20   
ref|XP_010547110.1|  PREDICTED: ninja-family protein Os03g0419100       100   2e-20   
emb|CDP03912.1|  unnamed protein product                                102   2e-20   
ref|XP_002884305.1|  two or more abres-containing gene 2              98.6    4e-20   
ref|XP_010906183.1|  PREDICTED: ninja-family protein AFP3-like        95.1    4e-20   
emb|CAN68929.1|  hypothetical protein VITISV_044375                     100   9e-20   Vitis vinifera
ref|XP_006299766.1|  hypothetical protein CARUB_v10015962mg             100   1e-19   
ref|XP_007134133.1|  hypothetical protein PHAVU_010G022000g           97.8    1e-19   
emb|CDY34910.1|  BnaA01g32410D                                        96.7    1e-19   
ref|XP_010418109.1|  PREDICTED: uncharacterized protein LOC104703731    100   2e-19   
ref|XP_010317133.1|  PREDICTED: ninja-family protein AFP3-like        92.8    2e-19   
gb|EYU44202.1|  hypothetical protein MIMGU_mgv1a011530mg              95.5    3e-19   
ref|XP_008235433.1|  PREDICTED: AFP homolog 2                         97.4    3e-19   
ref|XP_010463607.1|  PREDICTED: ninja-family protein AFP4-like        95.9    4e-19   
ref|NP_566163.1|  Ninja-family protein AFP4                           95.9    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010274057.1|  PREDICTED: uncharacterized protein LOC104609435  97.8    4e-19   
ref|XP_009372621.1|  PREDICTED: ninja-family protein 1-like           93.6    5e-19   
ref|XP_004290175.1|  PREDICTED: uncharacterized protein LOC101309497  96.3    5e-19   
emb|CDX74054.1|  BnaA03g29930D                                        94.7    6e-19   
ref|XP_010485451.1|  PREDICTED: ninja-family protein AFP4-like        95.1    7e-19   
gb|AAF20221.1|AC012395_8  putative RNA-binding protein                98.2    7e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448534.1|  PREDICTED: ninja-family protein AFP4-like        94.7    8e-19   
ref|XP_009787345.1|  PREDICTED: ninja-family protein Os03g0419100...  95.5    8e-19   
ref|XP_008792918.1|  PREDICTED: uncharacterized protein LOC103709393  96.3    8e-19   
ref|NP_187381.2|  nuclear transport factor 2 and RNA recognition ...  97.8    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124452.1|  PREDICTED: ninja-family protein AFP3-like        94.0    1e-18   
gb|KFK37674.1|  hypothetical protein AALP_AA3G013800                  94.0    1e-18   
gb|KDO65719.1|  hypothetical protein CISIN_1g038750mg                 92.4    1e-18   
ref|XP_009134956.1|  PREDICTED: ninja-family protein 6                94.0    1e-18   
emb|CDY08008.1|  BnaC03g35150D                                        93.6    2e-18   
ref|XP_008346212.1|  PREDICTED: ninja-family protein Os03g0419100...  95.1    2e-18   
ref|XP_009372227.1|  PREDICTED: ninja-family protein 2-like           95.1    2e-18   
ref|XP_010696260.1|  PREDICTED: ninja-family protein 3-like           94.4    3e-18   
ref|XP_007199261.1|  hypothetical protein PRUPE_ppa022619mg           94.7    3e-18   
sp|B6SLJ0.1|NNJA3_MAIZE  RecName: Full=Ninja-family protein 3         92.8    3e-18   Zea mays [maize]
gb|ACN33721.1|  unknown                                               92.4    3e-18   Zea mays [maize]
ref|NP_001161741.1|  hypothetical protein LOC100192929 isoform 3      92.4    4e-18   Zea mays [maize]
ref|NP_001161740.1|  hypothetical protein LOC100192929 isoform 2      92.0    4e-18   Zea mays [maize]
ref|XP_006440767.1|  hypothetical protein CICLE_v10021061mg           92.8    5e-18   
ref|XP_004231671.1|  PREDICTED: ninja-family protein AFP3-like is...  89.4    5e-18   
gb|KGN58375.1|  hypothetical protein Csa_3G633290                     92.0    7e-18   
ref|XP_008240010.1|  PREDICTED: ninja-family protein 1-like           90.9    1e-17   
ref|XP_006299473.1|  hypothetical protein CARUB_v10015638mg           90.9    2e-17   
emb|CBI15312.3|  unnamed protein product                              94.0    2e-17   
ref|XP_007208775.1|  hypothetical protein PRUPE_ppa023628mg           90.9    2e-17   
gb|KHN27321.1|  Ninja-family protein AFP3                             90.5    2e-17   
ref|XP_008658076.1|  PREDICTED: hypothetical protein LOC100192929...  92.0    2e-17   
ref|XP_010045600.1|  PREDICTED: ninja-family protein 1-like           93.2    2e-17   
ref|NP_001131584.1|  hypothetical protein LOC100192929 isoform 1      92.0    2e-17   
emb|CDY68672.1|  BnaA05g37500D                                        90.1    2e-17   
ref|XP_010663438.1|  PREDICTED: extensin-like                         92.0    2e-17   
ref|XP_004162648.1|  PREDICTED: ninja-family protein AFP3-like        90.5    2e-17   
ref|XP_009147379.1|  PREDICTED: ninja-family protein AFP4             90.1    2e-17   
ref|XP_006408444.1|  hypothetical protein EUTSA_v10021165mg           90.1    3e-17   
ref|XP_003520982.1|  PREDICTED: ninja-family protein AFP2-like        90.9    3e-17   
ref|XP_010045601.1|  PREDICTED: wiskott-Aldrich syndrome protein ...  91.7    4e-17   
dbj|BAJ98416.1|  predicted protein                                    91.3    4e-17   
gb|EMT27031.1|  hypothetical protein F775_13020                       86.7    5e-17   
ref|XP_008794639.1|  PREDICTED: uncharacterized protein LOC103710605  91.3    5e-17   
ref|XP_010905136.1|  PREDICTED: uncharacterized protein LOC105032389  90.9    6e-17   
gb|EYU40630.1|  hypothetical protein MIMGU_mgv1a021447mg              85.1    6e-17   
emb|CDY43256.1|  BnaC05g48490D                                        89.0    6e-17   
gb|EEC82402.1|  hypothetical protein OsI_26773                        89.0    7e-17   
ref|XP_008382772.1|  PREDICTED: uncharacterized protein LOC103445531  90.5    8e-17   
ref|XP_006352677.1|  PREDICTED: ninja-family protein AFP3-like        88.2    8e-17   
ref|XP_011089656.1|  PREDICTED: uncharacterized protein LOC105170552  90.1    1e-16   
ref|XP_010315661.1|  PREDICTED: ninja-family protein AFP3-like is...  85.1    1e-16   
ref|XP_006579502.1|  PREDICTED: ninja-family protein Os03g0419100...  88.2    1e-16   
ref|XP_006579503.1|  PREDICTED: ninja-family protein Os03g0419100...  88.2    1e-16   
ref|XP_010317131.1|  PREDICTED: ninja-family protein AFP2-like        85.1    1e-16   
ref|XP_010317132.1|  PREDICTED: ninja-family protein AFP3-like        84.7    2e-16   
ref|XP_009134646.1|  PREDICTED: ninja-family protein AFP4-like        87.4    2e-16   
gb|KHN24813.1|  Ninja-family protein AFP3                             87.8    4e-16   
ref|XP_010069628.1|  PREDICTED: ninja-family protein Os07g0602900     88.6    4e-16   
ref|XP_003547791.1|  PREDICTED: ninja-family protein AFP2-like        87.8    4e-16   
emb|CDX74273.1|  BnaA03g27740D                                        86.3    5e-16   
gb|EPS61358.1|  hypothetical protein M569_13439                       81.6    5e-16   
ref|XP_009412728.1|  PREDICTED: ninja-family protein Os07g0602900...  87.0    8e-16   
ref|XP_010315660.1|  PREDICTED: ninja-family protein AFP3-like        82.4    1e-15   
ref|XP_010549993.1|  PREDICTED: ninja-family protein AFP4             85.1    1e-15   
ref|XP_004231690.1|  PREDICTED: ninja-family protein AFP3-like        82.4    1e-15   
ref|XP_011089064.1|  PREDICTED: AFP homolog 2-like                    86.7    2e-15   
ref|XP_002438161.1|  hypothetical protein SORBIDRAFT_10g008970        85.5    3e-15   
emb|CDX91976.1|  BnaC03g32780D                                        83.6    6e-15   
ref|XP_002989654.1|  hypothetical protein SELMODRAFT_447751           85.9    6e-15   
ref|XP_002986103.1|  hypothetical protein SELMODRAFT_446487           85.9    6e-15   
dbj|BAK08070.1|  predicted protein                                    84.7    7e-15   
gb|KHN48747.1|  Ninja-family protein AFP3                             78.6    1e-14   
ref|XP_010315657.1|  PREDICTED: ninja-family protein AFP3-like is...  80.1    1e-14   
ref|XP_010315659.1|  PREDICTED: ninja-family protein Os07g0602900...  78.6    2e-14   
gb|ABK26057.1|  unknown                                               79.0    3e-14   
ref|XP_010315658.1|  PREDICTED: ninja-family protein Os07g0602900...  77.4    7e-14   
ref|XP_008374952.1|  PREDICTED: ninja-family protein Os03g0419100...  80.1    1e-13   
ref|XP_010315754.1|  PREDICTED: ninja-family protein AFP3-like        76.6    1e-13   
ref|XP_009347958.1|  PREDICTED: ninja-family protein AFP3-like        77.8    7e-13   
ref|XP_009347966.1|  PREDICTED: ninja-family protein 6-like           77.0    1e-12   
ref|XP_004301111.1|  PREDICTED: ninja-family protein AFP3-like        75.5    2e-12   
ref|XP_008777907.1|  PREDICTED: ninja-family protein AFP3-like        74.7    5e-12   
ref|XP_009339605.1|  PREDICTED: ninja-family protein Os03g0419100...  75.5    6e-12   
ref|XP_004231602.1|  PREDICTED: ninja-family protein AFP1-like        72.0    2e-11   
ref|XP_008393370.1|  PREDICTED: ninja-family protein AFP3-like        70.1    2e-11   
ref|XP_009797015.1|  PREDICTED: uncharacterized protein LOC104243513  73.2    4e-11   
ref|XP_008351896.1|  PREDICTED: ninja-family protein Os03g0419100...  72.0    4e-11   
ref|XP_010315691.1|  PREDICTED: ninja-family protein Os03g0214200...  68.9    6e-11   
ref|XP_009629107.1|  PREDICTED: ninja-family protein 2-like           70.9    2e-10   
ref|XP_001779397.1|  predicted protein                                70.5    9e-10   
gb|EYU30732.1|  hypothetical protein MIMGU_mgv1a006501mg              68.6    2e-09   
ref|XP_008390569.1|  PREDICTED: ninja-family protein mc410            67.8    3e-09   
ref|XP_010540972.1|  PREDICTED: AFP homolog 2-like isoform X1         67.4    5e-09   
ref|XP_010540975.1|  PREDICTED: AFP homolog 2-like isoform X2         67.4    5e-09   
ref|XP_011078285.1|  PREDICTED: ninja-family protein mc410            67.4    6e-09   
ref|XP_002514251.1|  conserved hypothetical protein                   67.4    6e-09   
ref|XP_006451247.1|  hypothetical protein CICLE_v10008049mg           67.4    6e-09   
emb|CDX92901.1|  BnaC07g41590D                                        66.6    7e-09   
ref|XP_009129161.1|  PREDICTED: AFP homolog 2 isoform X2              66.6    8e-09   
ref|XP_009129148.1|  PREDICTED: AFP homolog 2 isoform X1              66.6    8e-09   
ref|XP_006283796.1|  hypothetical protein CARUB_v10004886mg           66.6    9e-09   
emb|CDY50931.1|  BnaA03g59090D                                        66.6    9e-09   
ref|XP_009352522.1|  PREDICTED: ninja-family protein mc410            66.6    1e-08   
ref|XP_006412898.1|  hypothetical protein EUTSA_v10025262mg           66.6    1e-08   
ref|XP_002867433.1|  hypothetical protein ARALYDRAFT_491865           66.6    1e-08   
ref|XP_008374876.1|  PREDICTED: ninja-family protein mc410-like       66.6    1e-08   
ref|XP_010438370.1|  PREDICTED: AFP homolog 2-like                    66.6    1e-08   
ref|XP_009137815.1|  PREDICTED: AFP homolog 2-like                    66.2    1e-08   
emb|CDY35233.1|  BnaA01g07980D                                        66.6    1e-08   
ref|XP_010249603.1|  PREDICTED: ninja-family protein mc410            66.6    1e-08   
ref|XP_010548698.1|  PREDICTED: AFP homolog 2-like isoform X2         66.2    1e-08   
ref|XP_007152895.1|  hypothetical protein PHAVU_004G169100g           66.6    1e-08   
ref|NP_194620.1|  novel interactor of JAZ                             66.2    1e-08   
gb|AAK96863.1|  putative protein                                      66.2    1e-08   
ref|XP_010548697.1|  PREDICTED: AFP homolog 2-like isoform X1         66.2    1e-08   
ref|XP_004287452.1|  PREDICTED: ninja-family protein mc410-like       66.2    1e-08   
ref|XP_008462697.1|  PREDICTED: ninja-family protein mc410-like       65.9    2e-08   
dbj|BAJ91403.1|  predicted protein                                    62.8    2e-08   
ref|XP_001782651.1|  predicted protein                                66.2    2e-08   
ref|XP_004239269.1|  PREDICTED: ninja-family protein mc410            65.5    2e-08   
ref|XP_003517065.1|  PREDICTED: ninja-family protein mc410-like i...  65.5    3e-08   
ref|XP_006338155.1|  PREDICTED: ninja-family protein mc410-like i...  65.5    3e-08   
ref|XP_010451140.1|  PREDICTED: AFP homolog 2-like                    64.7    3e-08   
gb|KDP33720.1|  hypothetical protein JCGZ_07291                       65.1    3e-08   
ref|XP_009392413.1|  PREDICTED: ninja-family protein Os05g0558800...  65.1    3e-08   
emb|CDY06858.1|  BnaC01g09570D                                        65.1    3e-08   
ref|XP_004151157.1|  PREDICTED: ninja-family protein mc410-like       65.1    3e-08   
ref|XP_009586636.1|  PREDICTED: ninja-family protein mc410            65.1    3e-08   
ref|XP_008352847.1|  PREDICTED: ninja-family protein AFP3-like        63.9    4e-08   
gb|ACN30588.1|  unknown                                               64.3    4e-08   
gb|KHN18361.1|  Ninja-family protein AFP3                             62.0    4e-08   
ref|XP_010433155.1|  PREDICTED: AFP homolog 2                         64.7    4e-08   
ref|XP_009779745.1|  PREDICTED: ninja-family protein mc410            64.7    4e-08   
sp|Q53HY2.1|NINJA_TOBAC  RecName: Full=Ninja-family protein mc410     64.7    5e-08   
gb|KHG17837.1|  Ninja-family protein                                  64.3    5e-08   
ref|XP_006600584.1|  PREDICTED: ninja-family protein AFP3-like is...  62.8    5e-08   
ref|XP_006600585.1|  PREDICTED: ninja-family protein AFP3-like is...  62.8    5e-08   
gb|KDP32541.1|  hypothetical protein JCGZ_14753                       62.0    7e-08   
ref|XP_006600583.1|  PREDICTED: ninja-family protein AFP3-like is...  62.4    7e-08   
gb|KDP46171.1|  hypothetical protein JCGZ_06682                       62.4    7e-08   
ref|XP_004151365.1|  PREDICTED: ninja-family protein mc410-like       63.9    7e-08   
ref|XP_006600582.1|  PREDICTED: ninja-family protein AFP3-like is...  62.4    7e-08   
ref|XP_003534217.1|  PREDICTED: ninja-family protein mc410-like i...  63.9    9e-08   
gb|ACR36997.1|  unknown                                               59.7    1e-07   
ref|XP_007203684.1|  hypothetical protein PRUPE_ppa004604mg           63.2    1e-07   
ref|XP_008242553.1|  PREDICTED: ninja-family protein mc410            63.2    2e-07   
ref|XP_004167697.1|  PREDICTED: ninja-family protein mc410-like       61.6    2e-07   
ref|XP_009395040.1|  PREDICTED: ninja-family protein Os05g0558800...  62.8    2e-07   
ref|XP_011048351.1|  PREDICTED: ninja-family protein mc410            62.8    2e-07   
ref|XP_010102745.1|  hypothetical protein L484_000007                 60.1    2e-07   
ref|XP_002440231.1|  hypothetical protein SORBIDRAFT_09g028150        62.4    2e-07   
ref|XP_006389458.1|  hypothetical protein POPTR_0024s00450g           62.0    3e-07   
ref|XP_004961251.1|  PREDICTED: ninja-family protein 8-like isofo...  62.4    3e-07   
gb|KHG01318.1|  Ninja-family protein                                  62.4    3e-07   
ref|XP_008458598.1|  PREDICTED: ninja-family protein mc410            62.4    3e-07   
ref|XP_010049641.1|  PREDICTED: ninja-family protein mc410 isofor...  62.0    3e-07   
gb|EAY98989.1|  hypothetical protein OsI_20947                        62.0    3e-07   
ref|NP_001056296.1|  Os05g0558800                                     62.0    3e-07   
ref|XP_004139437.1|  PREDICTED: ninja-family protein mc410-like       62.0    3e-07   
emb|CBI28024.3|  unnamed protein product                              59.7    3e-07   
ref|XP_009415225.1|  PREDICTED: ninja-family protein 7-like           62.0    4e-07   
ref|XP_002325016.1|  hypothetical protein POPTR_0018s09210g           61.6    4e-07   
ref|NP_001143733.1|  hypothetical protein LOC100276485                61.6    5e-07   
sp|B4FXN6.1|NNJA7_MAIZE  RecName: Full=Ninja-family protein 7         61.6    5e-07   
gb|AFW81066.1|  ninja-family protein 8                                61.6    5e-07   
ref|XP_008801473.1|  PREDICTED: ninja-family protein Os05g0558800...  61.2    5e-07   
ref|XP_011045442.1|  PREDICTED: ninja-family protein mc410-like i...  61.2    5e-07   
ref|XP_011045445.1|  PREDICTED: ninja-family protein mc410-like i...  61.2    6e-07   
ref|XP_011045446.1|  PREDICTED: ninja-family protein mc410-like i...  61.2    6e-07   
ref|XP_007013079.1|  Interactor of JAZ, putative isoform 1            61.2    6e-07   
ref|XP_008793086.1|  PREDICTED: ninja-family protein Os05g0558800...  60.8    7e-07   
ref|XP_008793082.1|  PREDICTED: ninja-family protein Os05g0558800...  60.8    8e-07   
emb|CDP03286.1|  unnamed protein product                              60.5    9e-07   
ref|XP_010924563.1|  PREDICTED: ninja-family protein Os05g0558800...  60.5    1e-06   
gb|EMT23868.1|  hypothetical protein F775_26642                       60.5    1e-06   
dbj|BAK03610.1|  predicted protein                                    60.5    1e-06   
ref|XP_010688282.1|  PREDICTED: ninja-family protein mc410            60.1    1e-06   
gb|AHJ60593.1|  novel interactor of JAZ long variant                  60.1    1e-06   
gb|AHJ60595.1|  novel interactor of JAZ long variant                  60.1    1e-06   
ref|XP_002283979.1|  PREDICTED: ninja-family protein mc410 isofor...  59.7    2e-06   
ref|XP_010656282.1|  PREDICTED: ninja-family protein mc410 isofor...  59.7    2e-06   
ref|XP_008653866.1|  PREDICTED: ninja-family protein 6-like           55.5    5e-06   
ref|XP_006655581.1|  PREDICTED: ninja-family protein Os05g0558800...  58.2    6e-06   
ref|XP_010230832.1|  PREDICTED: ninja-family protein Os05g0558800     57.8    7e-06   
gb|AFG59973.1|  hypothetical protein 0_6449_01                        55.1    7e-06   
gb|AFG59977.1|  hypothetical protein 0_6449_01                        53.9    2e-05   
dbj|BAD26583.1|  RNA-binding protein                                  52.0    3e-05   
ref|XP_010917729.1|  PREDICTED: ninja-family protein Os05g0558800...  55.8    3e-05   
ref|XP_004513022.1|  PREDICTED: ninja-family protein mc410-like i...  55.5    4e-05   
ref|XP_004513024.1|  PREDICTED: ninja-family protein mc410-like i...  55.5    4e-05   
ref|XP_006646609.1|  PREDICTED: ninja-family protein Os07g0602900...  51.6    2e-04   
ref|XP_003620575.1|  hypothetical protein MTR_6g087140                53.5    2e-04   
ref|XP_003620576.1|  hypothetical protein MTR_6g087140                53.1    2e-04   
gb|AFK37137.1|  unknown                                               53.1    2e-04   
gb|EMS57599.1|  hypothetical protein TRIUR3_28445                     51.2    2e-04   
ref|XP_002967515.1|  hypothetical protein SELMODRAFT_439999           51.2    8e-04   
ref|XP_002960191.1|  hypothetical protein SELMODRAFT_402278           51.2    9e-04   



>ref|XP_006338361.1| PREDICTED: ninja-family protein AFP3-like [Solanum tuberosum]
Length=314

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 191/267 (72%), Gaps = 20/267 (7%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFALNGGARA---FSPYAPPLSRTCSLPaeaaeteewrrrk  242
            +FGVDP RA++LKR SSIS+F  +GG  +    S    P++RTCSLP E  E    R+  
Sbjct  58   RFGVDPERAKRLKRSSSISNFVFSGGDESNGRCSFSVGPITRTCSLPVEGEEECRKRKEL  117

Query  243  eaQSQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEENGNGLIPVLSNGNALPssqgss  422
              QS +R+EAKRKRMEKL+NVRVV++K+D ++ P  EENG         GN+LP SQGS 
Sbjct  118  --QSLRRLEAKRKRMEKLQNVRVVKDKVDLDERP--EENGG------PGGNSLPVSQGSM  167

Query  423  vsqgsgssgisDFDSQPLQVCGKN-VEARSPSSVHSRELEQR-----PAATLVEPAVNNS  584
             SQGSGSSGISDF SQP+Q  G N   A +P+S+   E E++     P  T  +PA   +
Sbjct  168  ASQGSGSSGISDFGSQPIQGPGDNSTGANTPASIKPSEHERKQVAKPPKITSEKPASTCN  227

Query  585  GNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSP  764
            GN+ K++KE+  +N + NMPCV+T G+GP GKKIEGFLYRY+KGEEV+I+CVCHGNFLSP
Sbjct  228  GNASKEAKEMF-KNYMLNMPCVSTMGNGPNGKKIEGFLYRYQKGEEVKIMCVCHGNFLSP  286

Query  765  AEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            AEFVKHAGGGDVA+PLK I+V+PS L 
Sbjct  287  AEFVKHAGGGDVANPLKQIVVNPSPLL  313



>ref|XP_009797625.1| PREDICTED: ninja-family protein AFP3-like [Nicotiana sylvestris]
Length=337

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 152/282 (54%), Positives = 194/282 (69%), Gaps = 33/282 (12%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFALNGGARA-------FSPYAPPLSRTCSLPaeaaeteew  230
            +FGVDP RA++LKR SSI++     G  +       F  YA  L+RTCSLP E  E    
Sbjct  64   RFGVDPERAKRLKRSSSINNVVFINGEDSNNSRGFPFGSYAT-LARTCSLPVETEEECRK  122

Query  231  rrrkeaQSQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEENGNGL---------IPVL  383
            R+    QS +R+EAKRKR EKL+NVRVV++ +D E+  + EENGNG          I  +
Sbjct  123  RKEI--QSLRRLEAKRKRWEKLQNVRVVKDSVDLEE--NREENGNGYSNGQGSVGNIIYV  178

Query  384  SNGNALPssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHS--RELEQRPAAT  557
            +N N+LP SQGS  SQGSGSSGISD  SQP+Q  G +    +P+S+ S  +E EQ P A 
Sbjct  179  NNENSLPLSQGSMGSQGSGSSGISDLGSQPIQ--GPSDCTGTPASIKSAEQEHEQEPVAA  236

Query  558  LVE------PAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGE  719
              E      P++ N GN+ K++KE++ +N + NMPCV+T+GDGP GKKIEGFLYRY+KGE
Sbjct  237  QPETTSEKAPSICN-GNASKETKEMI-KNFMLNMPCVSTKGDGPNGKKIEGFLYRYKKGE  294

Query  720  EVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            EVRIVCVCHGNFLSPAEFVKHAGG DVA+PL+HI+V+P+ L 
Sbjct  295  EVRIVCVCHGNFLSPAEFVKHAGGSDVANPLRHIVVNPAPLM  336



>ref|XP_009605136.1| PREDICTED: ninja-family protein AFP3-like [Nicotiana tomentosiformis]
Length=338

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 192/286 (67%), Gaps = 39/286 (14%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFALNGG-----ARAF--SPYAPPLSRTCSLPaeaaeteew  230
            +FGVDP RA++LKR SSI++     G     +RAF    YA  L+RTCSLP EA E    
Sbjct  63   RFGVDPERAKRLKRSSSINNVVFTNGEDSNNSRAFPFGSYAT-LARTCSLPVEAEEECRK  121

Query  231  rrrkeaQSQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEENGNGLIPVLSNGN-----  395
            R+    QS +R+EAKRKR EKL+NVRVV++K+D E+  + EENGNG     SNG      
Sbjct  122  RKEM--QSLRRLEAKRKRWEKLQNVRVVKDKVDLEE--NREENGNGY----SNGKGSVGN  173

Query  396  --------ALPssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVH--SRELEQR  545
                    +LP SQGS  SQGSGSSGISDF SQP+Q         +P+S+    +E EQ+
Sbjct  174  IINGNNGNSLPLSQGSMGSQGSGSSGISDFGSQPIQGRSDCTGTNTPTSIKPSEQEHEQK  233

Query  546  PAATLVE------PAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRY  707
            P A   E      P++ N GN+ K++KE+  +N + NMPCV+T+GDGP GKKIEGFLYRY
Sbjct  234  PVAAQPETTSEKAPSICN-GNASKEAKEMF-KNFMLNMPCVSTKGDGPNGKKIEGFLYRY  291

Query  708  RKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
             KGEEVRIVCVCHGNF SPAEFVKHAGG DVA+PL+HI+V+PS L 
Sbjct  292  NKGEEVRIVCVCHGNFHSPAEFVKHAGGSDVANPLRHIVVNPSPLL  337



>ref|XP_004232160.1| PREDICTED: ninja-family protein AFP3 [Solanum lycopersicum]
Length=317

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 136/272 (50%), Positives = 180/272 (66%), Gaps = 27/272 (10%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFALNGGARA---FSPYAPPLSRTCSLPaeaaeteewrrrk  242
            +FGVDP RA++LKR SSIS+F  +GG  +    S    P++RTCSLP E  E    R   
Sbjct  58   RFGVDPERAKRLKRSSSISNFVFSGGDESNGRCSFSVGPIARTCSLPVEGEEECRKR---  114

Query  243  eaQSQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEENG---NGLIPVLSNGNALPssq  413
              +  + +     + ++++ +RVV++K+D ++ P  EENG   NG +     GN+LP SQ
Sbjct  115  --KELQSLRRLEAKRKRMEKLRVVKDKVDLDERP--EENGGSNNGPV-----GNSLPLSQ  165

Query  414  gssvsqgsgssgisDFDSQPLQVCGKN-VEARSPSSVHSRELEQR-------PAATLVEP  569
            GS  SQGSGSSGISDF SQP+Q  G N   A +P+S+   E E         P  T  +P
Sbjct  166  GSMASQGSGSSGISDFGSQPIQGPGDNSTGANTPTSIKPSEQEHEQKQVAKPPKITSEKP  225

Query  570  AVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHG  749
                +G++ K++KE+  +N + NMPCV+T G GP GKKIEGFLYRY+KGEEV+I+CVCHG
Sbjct  226  PTTCNGSASKEAKEMF-KNYMLNMPCVSTMGKGPNGKKIEGFLYRYQKGEEVKIMCVCHG  284

Query  750  NFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            NFLSPAEFVKHAGGGDVA+PLK I+V+PS L 
Sbjct  285  NFLSPAEFVKHAGGGDVANPLKQIVVNPSPLL  316



>emb|CDP02322.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 142/283 (50%), Positives = 185/283 (65%), Gaps = 31/283 (11%)
 Frame = +3

Query  72   KFGVDPNRAQ-KLKRCSSISSF---ALNGGARAFSPYAP-----PLSRTCSLPaeaaete  224
            +FGVDP +A+ KL R SS+ +F    + GG  + +   P     PLSRTCSLP E  +  
Sbjct  59   RFGVDPKQAKMKLMRSSSVLTFMYAGVAGGEESHASLVPIASYSPLSRTCSLPTETEQEW  118

Query  225  ewrrrkeaQSQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEENGNGL-----------  371
              R+    QS +RMEAKR+RM+K+K +RV REK++ ED    E   NG            
Sbjct  119  RKRKEL--QSLRRMEAKRRRMDKIKIMRVGREKVEPEDYSGEENESNGTNTNNSCQGLDS  176

Query  372  IPVLSNGNALPssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHSREL--EQR  545
            I    NGN +PSSQ S  SQGS  S IS+F SQP+QV  KN   +SPSSV S ++  EQ+
Sbjct  177  INGNGNGNMMPSSQASIGSQGSAFSEISEFHSQPIQVNEKN-GTKSPSSVQSLKVHHEQK  235

Query  546  PA---ATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKG  716
            P     ++V  A  + G   K++KE++ +N + +MPCV+T G+GP GKKIEGFLYRY+KG
Sbjct  236  PQVPPGSVVGKAAVDKG--AKEAKEML-KNVMLDMPCVSTTGNGPNGKKIEGFLYRYQKG  292

Query  717  EEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            EEV+IVCVCHG+FLSPAEFVKHAGG +V HPL+HI+V+PS L 
Sbjct  293  EEVKIVCVCHGSFLSPAEFVKHAGGTEVEHPLRHIVVNPSPLI  335



>ref|XP_009764520.1| PREDICTED: ninja-family protein AFP3-like [Nicotiana sylvestris]
Length=315

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 166/280 (59%), Gaps = 37/280 (13%)
 Frame = +3

Query  72   KFGVDPNRAQKLKR-CSSISSFALNGGAR-------AFS-PYAPPLSRTCSLPaeaaete  224
            +FGVDP   ++LKR CSSI++F  + G          FS     PL+RTCSLP E  E  
Sbjct  51   RFGVDPKIEKRLKRSCSSITNFVSSSGDNNNSGNEIQFSDAIYVPLNRTCSLPMETEEEW  110

Query  225  ewrrrkeaQSQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEENGNGLIPVLSNGNAL-  401
              +R++    ++    +++  +    VRVV+E         +EENGN      SNG    
Sbjct  111  WRKRKELQSLRRLEAKRKRLEKMKNVVRVVKE---------NEENGN----CYSNGTETC  157

Query  402  ------PssqgssvsqgsgssgisDFDS-QPLQVCGKNVEARSPSSVHSRELEQRPAATL  560
                        S   GSGSSGIS+F+S QP+Q    + EARSP+S    E E++  A  
Sbjct  158  GNFLQSSVGSLGSQGSGSGSSGISEFESHQPIQGRSDSTEARSPASGQFPEHERKSIA--  215

Query  561  VEPAVNNSG---NSGKDSKEV--VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEV  725
            + P  +N     +SGK  KE   + +N + NMPCV+ RGDGP GKKI+GFLY Y+KGEEV
Sbjct  216  IAPETSNEKTPVSSGKTCKEAKQMFKNFMLNMPCVSARGDGPNGKKIDGFLYGYKKGEEV  275

Query  726  RIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            RIVCVCHG+FLSPAEFVKHAGGGDV HPLKHI+V+PS L 
Sbjct  276  RIVCVCHGDFLSPAEFVKHAGGGDVQHPLKHIVVNPSPLL  315



>ref|XP_007032759.1| ABI five binding protein 3, putative [Theobroma cacao]
 gb|EOY03685.1| ABI five binding protein 3, putative [Theobroma cacao]
Length=352

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 151/293 (52%), Positives = 177/293 (60%), Gaps = 41/293 (14%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFA-------LNGGARAFSPYA-PPLSRTCSLPaeaaetee  227
            +FGVDP+ A+KL R SSI  F         N  + +  P A   L+RTCSLP E  E   
Sbjct  66   RFGVDPS-AKKLTRSSSIPDFINNSTRKDTNESSSSMFPMACGSLARTCSLPTETQEEWR  124

Query  228  wrrrkeaQSQkrmeakrkrmeklkNVRVVREK----LDKED--PPHSEENGNGLIPVLSN  389
             R+    QS +RMEAKRKR EK KN++  R++      +E+      EE GNG   V  N
Sbjct  125  KRKEL--QSLRRMEAKRKRSEKQKNLKAARDRNRGGFGEENCAEDKREEAGNGASWV--N  180

Query  390  GNALP-----ssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHSR-ELEQRP-  548
            G   P     +SQGS  SQGSGSSGIS+ DSQ  Q   K  EARSP+S  S  E EQ+P 
Sbjct  181  GGRGPCEGVAASQGSIGSQGSGSSGISELDSQSAQGTNKCAEARSPASEQSAVETEQKPM  240

Query  549  --------------AATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKI  686
                          A    E   +    + K  KEVV RN L +MPCV+T GDGP GK+I
Sbjct  241  IIPGRILSEKSEKLAGVATENKPSQPAVAEKRFKEVV-RNILEDMPCVSTTGDGPNGKRI  299

Query  687  EGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            EGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVA PLKHI+V+PS LF
Sbjct  300  EGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAQPLKHIVVNPSFLF  352



>ref|XP_009588665.1| PREDICTED: ninja-family protein AFP3-like [Nicotiana tomentosiformis]
Length=321

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 142/285 (50%), Positives = 177/285 (62%), Gaps = 41/285 (14%)
 Frame = +3

Query  72   KFGVDPNRAQKLKR-CSSISSFALNGGARAFSP----------------YAPPLSRTCSL  200
            +FGVDP R ++LKR CSSI++F         +                 YAP L+RTCSL
Sbjct  51   RFGVDPKREKRLKRSCSSITNFVFYNNNNNNNNNNNNSNGNEIQFRDDIYAP-LNRTCSL  109

Query  201  PaeaaeteewrrrkeaQSQkrmeakrkrmeklkN-VRVVREKLDKEDPPHSEENGNGLIP  377
            P E  E    R+    QS +R+EAKRKR+EK+KN VRVV ++        +EENGN    
Sbjct  110  PTETEEEWRKRKEL--QSFRRLEAKRKRLEKMKNAVRVVVKE--------NEENGNCYSN  159

Query  378  VLSNGNALPssqgssvsqgsgssgis--DFDS-QPLQVCGKNVEARSPSSVHSRELEQRP  548
              + G  L SS GS  SQGSGS      +F+S QP+Q    + EAR P+S  S E EQ+ 
Sbjct  160  GETGGTFLQSSVGSLGSQGSGSGSSGISEFESHQPIQGRSDSTEARPPASGQSPEHEQKS  219

Query  549  AATLVEPAVNN------SGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYR  710
             A  + P  +N      S  + K++KE+  +N +  MPCV+TRGDGP GKKIEGFLY Y+
Sbjct  220  VA--IAPETSNEKTPVSSRKTCKEAKEMF-KNFMLKMPCVSTRGDGPNGKKIEGFLYGYK  276

Query  711  KGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            KGEEVRIVCVCHG+FLSPAEFVKHAGGGDV HPLKHI+V+PS L 
Sbjct  277  KGEEVRIVCVCHGDFLSPAEFVKHAGGGDVQHPLKHIVVNPSPLL  321



>gb|KHG26156.1| Ninja-family protein AFP2 [Gossypium arboreum]
Length=342

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 140/285 (49%), Positives = 173/285 (61%), Gaps = 33/285 (12%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFALNGGARA------FSPYAPPLSRTCSLPaeaaeteewr  233
            +FGVDP +A+KL R SSI  F  N    +      F      L RTCSLP E  E    R
Sbjct  64   RFGVDP-KAKKLTRSSSIPDFINNTNESSSSPSSLFPMACGSLVRTCSLPVETEEEWRKR  122

Query  234  rrkeaQSQkrmeakrkrmeklkNVRVVREKLDK---EDPPHSEENGNGLIPVLSNGNALP  404
            +    QS +R+ AKRKR EK KN++ +++K  +   E+    ++   G +     G  + 
Sbjct  123  KEI--QSLRRLAAKRKRSEKQKNLKALKDKNREGLGEENCEEDKKEEGWVNG-GRGPLMA  179

Query  405  ssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHSR-ELEQRPAATLVEP----  569
            +SQGS  SQGSGSSGIS+ DSQP Q   K   +RSP+SV S  + EQ+P   ++ P    
Sbjct  180  ASQGSIGSQGSGSSGISELDSQPPQGTYKCQGSRSPTSVQSTTQTEQKP--NIINPGKIS  237

Query  570  -----------AVNNSGNSGKDSKEV--VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYR  710
                       A N     G D K V   VRN + +MPCV+T GDGP GK+IEGFLYRYR
Sbjct  238  IQKSEKLAGITAKNQHNQPGVDEKRVKASVRNIMEDMPCVSTTGDGPNGKRIEGFLYRYR  297

Query  711  KGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            KGEEVRIVCVCHG+FLSPAEFVKHAGGGDV HPLKHI+VSPS +F
Sbjct  298  KGEEVRIVCVCHGSFLSPAEFVKHAGGGDVEHPLKHIVVSPSFIF  342



>ref|XP_011098752.1| PREDICTED: ninja-family protein AFP3-like isoform X2 [Sesamum 
indicum]
Length=323

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 138/278 (50%), Positives = 170/278 (61%), Gaps = 34/278 (12%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFALNGGA-----------RAFSPYAPPLSRTCSLPaeaae  218
            +FGVDP+R +KLKR SSIS      GA            AF  YAP L RT SLP EA E
Sbjct  60   RFGVDPSR-KKLKRSSSISDLVFTIGAVDNGSSHRARGAAFEGYAP-LVRTHSLPTEAEE  117

Query  219  teewrrrkeaQSQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEE-----NG----NGL  371
                R+    QS +RMEA++KRMEKL+NVRVV++K +     + E      NG    +G+
Sbjct  118  EWRRRKEF--QSMRRMEARKKRMEKLRNVRVVKDKENSSGDVNCENVNGSVNGQRLDSGI  175

Query  372  IPVLSNGNALPssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHSRELEQRPA  551
                 +GN + S QGS  S+GSGSSG SD  +   +   +N EA SPSSV   + EQ  A
Sbjct  176  ANRFEDGNGMSSPQGSIGSRGSGSSGTSDLLANQTEGSKRNAEA-SPSSVQE-QGEQESA  233

Query  552  ATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRI  731
                +  V  + +        +++NA+ +MP VTT+ DGP G KIEGFLYRYRKGEEVRI
Sbjct  234  VRAPDRDVKRANS--------LIKNAMLDMPYVTTKEDGPNGHKIEGFLYRYRKGEEVRI  285

Query  732  VCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            VCVCHG FLSPAEFVKH GGGDV HPLKHI+V+P  L 
Sbjct  286  VCVCHGMFLSPAEFVKHGGGGDVEHPLKHIVVNPFPLL  323



>ref|XP_011000075.1| PREDICTED: ninja-family protein AFP3-like [Populus euphratica]
Length=357

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 173/297 (58%), Gaps = 42/297 (14%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFALNGGARAFSPYAPP------LSRTCSLPaeaaeteewr  233
            +FGVDP +A+K+ R SS++S  +N      S +         L RTCSLP E  E    R
Sbjct  64   RFGVDP-KAKKITRSSSVASDFINPTGENGSAFVVSNLESNYLPRTCSLPTETKEEWRKR  122

Query  234  rrkeaQSQkrmeakrkrmeklkNVRVVREK-LDKEDPPHSEENG-----------NGLIP  377
            +    Q+ +RMEAKRKR EK K ++ V +K + +ED   +  NG           NG   
Sbjct  123  KEM--QTLRRMEAKRKRTEKQKILKTVTDKTMGEEDKRENGTNGDHHQKEFLKSFNGFFG  180

Query  378  V----LSNGNALPssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHS-RELEQ  542
            V    LS    + +   +  SQG+GSSGI++F+SQPLQ   KN E+RSP SV S  + EQ
Sbjct  181  VGVEGLSTQAEVAAPPLTHESQGTGSSGITEFESQPLQGMNKNTESRSPVSVQSLSDYEQ  240

Query  543  R---------------PAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEG  677
            R               PA   +E   +N     ++  + VVR+ L +MP V+  GDGP G
Sbjct  241  RSIIAPGLVLGEKSSFPAGIAMEKNGSNKLTVAENGTKEVVRDVLEDMPYVSATGDGPNG  300

Query  678  KKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG-DVAHPLKHIIVSPSCLF  845
            K+IEGFLY+YRKGEEVRIVCVCHG+FLSPAEFVKHAGGG DV  PLKHI+V PS  F
Sbjct  301  KRIEGFLYQYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDDVEQPLKHIVVHPSPFF  357



>ref|XP_011098751.1| PREDICTED: ninja-family protein AFP3-like isoform X1 [Sesamum 
indicum]
Length=324

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 136/278 (49%), Positives = 167/278 (60%), Gaps = 33/278 (12%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFALNGGA-----------RAFSPYAPPLSRTCSLPaeaae  218
            +FGVDP+R +KLKR SSIS      GA            AF  YAP L RT SLP EA E
Sbjct  60   RFGVDPSR-KKLKRSSSISDLVFTIGAVDNGSSHRARGAAFEGYAP-LVRTHSLPTEAEE  117

Query  219  teewrrrkeaQSQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEE-----NG----NGL  371
                R+    QS +RMEA++KRMEKL+NVRVV++K +     + E      NG    +G+
Sbjct  118  EWRRRKEF--QSMRRMEARKKRMEKLRNVRVVKDKENSSGDVNCENVNGSVNGQRLDSGI  175

Query  372  IPVLSNGNALPssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHSRELEQRPA  551
                 +GN + S QGS  S+GSGSSG SD  +   +   K     SPSSV   + EQ  A
Sbjct  176  ANRFEDGNGMSSPQGSIGSRGSGSSGTSDLLANQTEAGSKRNAEASPSSVQE-QGEQESA  234

Query  552  ATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRI  731
                +  V  + +        +++NA+ +MP VTT+ DGP G KIEGFLYRYRKGEEVRI
Sbjct  235  VRAPDRDVKRANS--------LIKNAMLDMPYVTTKEDGPNGHKIEGFLYRYRKGEEVRI  286

Query  732  VCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            VCVCHG FLSPAEFVKH GGGDV HPLKHI+V+P  L 
Sbjct  287  VCVCHGMFLSPAEFVKHGGGGDVEHPLKHIVVNPFPLL  324



>ref|XP_010258036.1| PREDICTED: ninja-family protein AFP3 [Nelumbo nucifera]
Length=419

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 100/142 (70%), Gaps = 15/142 (11%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHS--RELEQRPAA----TLVEPAVNNSGNSGKDSKEVV  617
            +F+S+P+Q      EARSP+SV S     EQ+P A    TL E     +G   + SK+  
Sbjct  273  EFESRPVQGLSSCSEARSPTSVQSLPENCEQKPTASPAKTLAEMPSKFAGVEMETSKKPN  332

Query  618  V---------RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAE  770
            V         RN +  MPCV+TRGDGP GK+IEGFLY+YRKGEEVRIVCVCHG+FLSPAE
Sbjct  333  VVDNGLRELGRNMMDEMPCVSTRGDGPNGKRIEGFLYKYRKGEEVRIVCVCHGSFLSPAE  392

Query  771  FVKHAGGGDVAHPLKHIIVSPS  836
            FVKHAGGGDVAHPL+HI+V+PS
Sbjct  393  FVKHAGGGDVAHPLRHIVVNPS  414



>ref|XP_002324118.2| hypothetical protein POPTR_0017s13000g [Populus trichocarpa]
 gb|EEF04251.2| hypothetical protein POPTR_0017s13000g [Populus trichocarpa]
Length=356

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 133/296 (45%), Positives = 170/296 (57%), Gaps = 41/296 (14%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFALNGGARAFSPYAPP------LSRTCSLPaeaaeteewr  233
            +FGVDP +A+K+ R SSI+S  +N      S +         L RTCSLP E  E    R
Sbjct  64   RFGVDP-KAKKITRSSSIASDFINPTGENGSAFVVSNLESNYLPRTCSLPTETKEELRKR  122

Query  234  rrkeaQSQkrmeakrkrmeklkNVRVVREK-LDKEDPPHSEENG-----------NGLIP  377
            +    Q+ +RMEAKRKR EK K ++ V +K + +ED   +  NG           NG   
Sbjct  123  KEM--QTLRRMEAKRKRTEKQKILKTVTDKTMGEEDKRENGTNGDHHQKEFLKSFNGFFG  180

Query  378  VLSNG---NALPssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHS-RELEQR  545
            V   G    A  +   +  SQG+GSSG ++F+SQPLQ   K  E+RSP SV S  + EQR
Sbjct  181  VGVEGLSAQAEAAPPLTHESQGTGSSGTTEFESQPLQGMNKYTESRSPVSVQSLSDYEQR  240

Query  546  ---------------PAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGK  680
                           PA   +E   +N     ++  + VVR+ L +MP V+ +GDGP GK
Sbjct  241  SIIAPGLVLGEKSSFPAGVAMEKNGSNKLTVTENGTKEVVRDVLEDMPYVSAKGDGPNGK  300

Query  681  KIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG-DVAHPLKHIIVSPSCLF  845
            +IEGFLY+YRKGEEV IVCVCHG+FLSPAEFVKHAGGG DV  PLKHI+V PS  F
Sbjct  301  RIEGFLYQYRKGEEVTIVCVCHGSFLSPAEFVKHAGGGDDVEQPLKHIVVHPSPFF  356



>ref|XP_002527618.1| hypothetical protein RCOM_1025320 [Ricinus communis]
 gb|EEF34757.1| hypothetical protein RCOM_1025320 [Ricinus communis]
Length=133

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 90/127 (71%), Gaps = 12/127 (9%)
 Frame = +3

Query  489  KNVEARSPSSVHS-RELEQRPAATLVEPAVNNSGNSGKDSK-----------EVVVRNAL  632
            K  EARSP SV S  E EQ+   T        SG + +DS            E + RN L
Sbjct  3    KCSEARSPVSVQSLSECEQKLRVTSKSTINGKSGVAMEDSSRCDEARVRNGAEEMGRNVL  62

Query  633  FNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPL  812
             +MPCV+T+GDGP GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPL
Sbjct  63   EDMPCVSTKGDGPNGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPL  122

Query  813  KHIIVSP  833
            KHI+V+P
Sbjct  123  KHIVVNP  129



>ref|XP_010089637.1| hypothetical protein L484_021030 [Morus notabilis]
 gb|EXB38108.1| hypothetical protein L484_021030 [Morus notabilis]
Length=355

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 154/292 (53%), Gaps = 34/292 (12%)
 Frame = +3

Query  72   KFGVDPNRAQ-----KLKRCSSISSFALNGGARAFSPYAPP-----LSRTCSLPaeaaet  221
            +FGVDP RA+      LKR SSI  FA + G               L+RTCSLP E  E 
Sbjct  64   RFGVDPARAKNGNKLSLKRSSSIPDFATSQGESGCHVTTAARCHVGLARTCSLPTETEEE  123

Query  222  eewrrrkeaQSQkrmeakrkrmeklkNVRVVRE--KLDKEDPPHSEENGNGLIPVLSNGN  395
               R+  ++  +   + KR   ++    + VR   + + E   +  +  NGL P  ++  
Sbjct  124  WRKRKELQSLRRMEAKRKRSEKQRNSISKAVRTSCRAELESNNNGGDKDNGLPPQAASFQ  183

Query  396  ALPssqgssvsqgsgssgisDFDSQPLQV------CGKNVEARSPSSVHS-RELEQRPAA  554
                S GS  S  S S   +  DS  + +        K  E RSP+ V S ++ EQ+   
Sbjct  184  GSIGSHGSGSSGVSESDCRASQDSYAVTLKPGYARVPKCPEIRSPTGVQSLQQSEQKLTV  243

Query  555  T---------------LVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIE  689
            T               L   + +N     K+  + V RN L +MPCV+T G GP GK+IE
Sbjct  244  THRSTITRLTSGDFNALATESQSNKPTFTKNGTKEVARNMLEDMPCVSTTGIGPNGKRIE  303

Query  690  GFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            GFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+P+  F
Sbjct  304  GFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPASFF  355



>ref|XP_002277117.2| PREDICTED: ninja-family protein AFP3-like [Vitis vinifera]
Length=387

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 98/149 (66%), Gaps = 22/149 (15%)
 Frame = +3

Query  456  DFDSQPLQVCGKN--VEARSPSSVHSR--ELEQRPAATLVEPAV-NNSGNSGKDSKE---  611
            +F+SQP+QV G N   EARSP+S+ S   + EQ+P   L+ P     SG  G    E   
Sbjct  242  EFESQPMQVKGVNKCSEARSPASIQSLPGQSEQKP---LISPGTPEKSGKVGGVVAENQP  298

Query  612  -----------VVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFL  758
                        + R  + +MPCV+T GDGP GKK++GFLYRY+KGEEVRIVCVCHG FL
Sbjct  299  KKPTISSRGVSEMARKVMEDMPCVSTTGDGPNGKKVDGFLYRYKKGEEVRIVCVCHGTFL  358

Query  759  SPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            SPAEFVKHAGG DVAHPL+HI+V PS L 
Sbjct  359  SPAEFVKHAGGSDVAHPLRHIVVYPSSLL  387



>emb|CBI21211.3| unnamed protein product [Vitis vinifera]
Length=697

 Score =   151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 98/149 (66%), Gaps = 22/149 (15%)
 Frame = +3

Query  456  DFDSQPLQVCGKN--VEARSPSSVHSR--ELEQRPAATLVEPAV-NNSGNSGKDSKE---  611
            +F+SQP+QV G N   EARSP+S+ S   + EQ+P   L+ P     SG  G    E   
Sbjct  552  EFESQPMQVKGVNKCSEARSPASIQSLPGQSEQKP---LISPGTPEKSGKVGGVVAENQP  608

Query  612  -----------VVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFL  758
                        + R  + +MPCV+T GDGP GKK++GFLYRY+KGEEVRIVCVCHG FL
Sbjct  609  KKPTISSRGVSEMARKVMEDMPCVSTTGDGPNGKKVDGFLYRYKKGEEVRIVCVCHGTFL  668

Query  759  SPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            SPAEFVKHAGG DVAHPL+HI+V PS L 
Sbjct  669  SPAEFVKHAGGSDVAHPLRHIVVYPSSLL  697



>emb|CDX85274.1| BnaC07g25850D [Brassica napus]
Length=265

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 109/256 (43%), Positives = 136/256 (53%), Gaps = 50/256 (20%)
 Frame = +3

Query  72   KFGVDP-NRAQKLKRCSSISSFALNGGARAFSPYAPPLSRTCSLPaeaaeteewrrrkea  248
            +FGVDP  + + L R SSI  F +N G          LSRT SLP E  E  + +     
Sbjct  56   RFGVDPLAKTRLLTRSSSIPDFVVNDGRSEL------LSRTFSLPVETEEWRKRKEL---  106

Query  249  QSQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEENGNGLIPVLSNGNALPssqgssvs  428
            QS +R+EAKRKR EK +NVRV+REK       H    G G   ++  G+           
Sbjct  107  QSLRRLEAKRKRSEKQRNVRVLREK-------HKTGAGEGEEKIVEEGSI----------  149

Query  429  qgsgssgisDFDSQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEPAVNNSGNSGKDSK  608
                                    +    S    EL+  P    V+   N +  +   S 
Sbjct  150  -----------------------GSSGSGSSGLSELDNTPPLPCVQAKTNKTIETSPSSA  186

Query  609  EVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAG  788
              V RN + +MPCV+T GDGP GKKI+GFLYRYRKG+EVRIVCVCHG+FLSPAEF+KHAG
Sbjct  187  APVARNIIEDMPCVSTTGDGPNGKKIDGFLYRYRKGQEVRIVCVCHGSFLSPAEFIKHAG  246

Query  789  GGDVAHPLKHIIVSPS  836
            G DV HPLKHI+V+PS
Sbjct  247  GSDVTHPLKHIVVNPS  262



>ref|XP_004304226.1| PREDICTED: ninja-family protein Os03g0214200-like [Fragaria vesca 
subsp. vesca]
Length=366

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 122/301 (41%), Positives = 163/301 (54%), Gaps = 45/301 (15%)
 Frame = +3

Query  72   KFGVDPNRAQK---LKRCSSISSFA--------------LNGGARAFSPYAPPLSRTCSL  200
            +FGVDP RA+    LKR SS+S F+                   R   P   PL RTCSL
Sbjct  68   RFGVDP-RAKAGLHLKRSSSVSDFSPAAATAGTAGVREEEATTCRVPRPCVVPLMRTCSL  126

Query  201  PaeaaeteewrrrkeaQSQkrmeakrkrmeklkNVRV----VREKLDKEDPPHSEENGNG  368
            P+E  E    R+  ++  +   + KR   ++    ++     RE  D +        G G
Sbjct  127  PSETEEEWRKRKELQSLRRMEAKRKRSEKQQRSYSKLHRDRSRENFDVDRLAEPINAGGG  186

Query  369  LIPVLSNGNALPssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHS---RELE  539
              P+        S    + SQGSGSSG++D +SQ  QV  K  E RS S++ S    E E
Sbjct  187  CPPLPPVPPPPESQGTITGSQGSGSSGVTDSESQAAQVVHKCTEVRSGSNIESLPKSEKE  246

Query  540  QRPAATLVEPAVNNSGNSG-------------------KDSKEVVVRNALFNMPCVTTRG  662
                + + + A  ++ NSG                   K++KE+V RN L NMP V+T+G
Sbjct  247  PLVPSQMTKSAEISADNSGQLNGAVQMENHCANSTTPHKETKEIV-RNVLDNMPSVSTKG  305

Query  663  DGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  842
            DGP GK++EGFLYRY+KGEEVRIVCVCHG+FL+PAEFVKHAGGGDV HPLKHI+V+P+ +
Sbjct  306  DGPNGKRVEGFLYRYKKGEEVRIVCVCHGSFLTPAEFVKHAGGGDVPHPLKHIVVNPTPI  365

Query  843  F  845
             
Sbjct  366  L  366



>gb|KDO72773.1| hypothetical protein CISIN_1g022431mg [Citrus sinensis]
Length=268

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 90/134 (67%), Gaps = 8/134 (6%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSRE--------LEQRPAATLVEPAVNNSGNSGKDSKE  611
            + DS   Q   K  EA SPS + S +          ++   ++   +  N     K   +
Sbjct  131  ELDSITPQGSHKCTEAVSPSIIQSMQPPRNTEVATSEKSGKSMAVKSQWNKPTVAKKGVK  190

Query  612  VVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGG  791
              VR+ L +MPCV+T GDGP+GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGG
Sbjct  191  EAVRDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGG  250

Query  792  GDVAHPLKHIIVSP  833
            GDVAHPLKHI+V+P
Sbjct  251  GDVAHPLKHIVVNP  264



>ref|XP_009111795.1| PREDICTED: ninja-family protein AFP3 [Brassica rapa]
 emb|CDY19988.1| BnaA09g02630D [Brassica napus]
Length=255

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 113/256 (44%), Positives = 139/256 (54%), Gaps = 52/256 (20%)
 Frame = +3

Query  72   KFGVDP-NRAQKLKRCSSISSFALNGGARAFSPYAPPLSRTCSLPaeaaeteewrrrkea  248
            +FGVDP  + + L R SSI    +NGG          LSRTCSLP E  E  + +     
Sbjct  48   RFGVDPLAKTRLLTRSSSIPDLVVNGGRTE-------LSRTCSLPVETEEWRKRKEL---  97

Query  249  QSQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEENGNGLIPVLSNGNALPssqgssvs  428
            QS +R+EAKRKR+EK +NVRV+REK         E +        S  + L +S      
Sbjct  98   QSLRRLEAKRKRLEKQRNVRVLREKHKAGGGGGEEGSIGSSGSGSSGLSELDTSP-----  152

Query  429  qgsgssgisDFDSQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEPAVNNSGNSGKDSK  608
                        S P+Q   K    RSPSS               +P   N         
Sbjct  153  ------------SPPVQATTKASIERSPSST--------------QPLPENQA-------  179

Query  609  EVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAG  788
                RN + +MPCV+T GDGP G+KI+GFLYRYRKG+EVRIVCVCHG+FL+PAEFVKHAG
Sbjct  180  ---ARNMIDDMPCVSTTGDGPNGRKIDGFLYRYRKGDEVRIVCVCHGSFLTPAEFVKHAG  236

Query  789  GGDVAHPLKHIIVSPS  836
            G DVAHPLKHI+V+PS
Sbjct  237  GRDVAHPLKHIVVNPS  252



>emb|CAN77669.1| hypothetical protein VITISV_038107 [Vitis vinifera]
Length=1100

 Score =   150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 98/149 (66%), Gaps = 22/149 (15%)
 Frame = +3

Query  456   DFDSQPLQVCGKN--VEARSPSSVHSR--ELEQRPAATLVEPAV-NNSGNSGKDSKE---  611
             +F+SQP+QV G N   EARSP+S+ S   + EQ+P   L+ P     SG  G    E   
Sbjct  955   EFESQPMQVKGVNKCSEARSPASIQSLPGQSEQKP---LISPGTPEKSGKVGGVVAENQP  1011

Query  612   -----------VVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFL  758
                         + R  + +MPCV+T GDGP GKK++GFLYRY+KGEEVRIVCVCHG FL
Sbjct  1012  KKPTISSRGVSEMARKVMEDMPCVSTTGDGPNGKKVDGFLYRYKKGEEVRIVCVCHGTFL  1071

Query  759   SPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
             SPAEFVKHAGG DVAHPL+HI+V PS L 
Sbjct  1072  SPAEFVKHAGGSDVAHPLRHIVVYPSSLL  1100



>gb|KDP27248.1| hypothetical protein JCGZ_19947 [Jatropha curcas]
Length=393

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 93/136 (68%), Gaps = 23/136 (17%)
 Frame = +3

Query  495  VEARSPSSVHS-----RELEQRPAATL---------VEPAVNNSG-----NSGKDSKEVV  617
            +EARS  SV S     R+L   P +T+         V   ++ S      N  KD+    
Sbjct  262  IEARSRVSVQSLSERARKLTVTPKSTINGKPSSPADVAMVISRSNEPTVINGAKDT----  317

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            VRN L +MPCV+T+G+GP GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGD
Sbjct  318  VRNILEDMPCVSTKGEGPNGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGD  377

Query  798  VAHPLKHIIVSPSCLF  845
            VAHPLKHI+VSP  L 
Sbjct  378  VAHPLKHIVVSPYPLL  393



>gb|KDO72774.1| hypothetical protein CISIN_1g022431mg [Citrus sinensis]
Length=297

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 90/133 (68%), Gaps = 10/133 (8%)
 Frame = +3

Query  465  SQPLQVCG--KNVEARSPSSVHSRE--------LEQRPAATLVEPAVNNSGNSGKDSKEV  614
            S PL   G  K  EA SPS + S +          ++   ++   +  N     K   + 
Sbjct  161  SNPLLFHGSHKCTEAVSPSIIQSMQPPRNTEVATSEKSGKSMAVKSQWNKPTVAKKGVKE  220

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
             VR+ L +MPCV+T GDGP+GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGG
Sbjct  221  AVRDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGG  280

Query  795  DVAHPLKHIIVSP  833
            DVAHPLKHI+V+P
Sbjct  281  DVAHPLKHIVVNP  293



>ref|XP_007215559.1| hypothetical protein PRUPE_ppa007375mg [Prunus persica]
 gb|EMJ16758.1| hypothetical protein PRUPE_ppa007375mg [Prunus persica]
Length=370

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +VRN L NMPCV+T+GDGP GK+IEGFLYRY+KGEEVRIVCVCHG+FLSPAEFVKHAGGG
Sbjct  294  IVRNVLENMPCVSTKGDGPNGKRIEGFLYRYKKGEEVRIVCVCHGSFLSPAEFVKHAGGG  353

Query  795  DVAHPLKHIIVSPS  836
            DVAHPLKHI+V+PS
Sbjct  354  DVAHPLKHIVVNPS  367



>ref|XP_008230885.1| PREDICTED: ninja-family protein AFP3-like [Prunus mume]
Length=365

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +VRN L NMPCV+T+GDGP GK+IEGFLYRY+KGEEVRIVCVCHG+FLSPAEFVKHAGGG
Sbjct  289  IVRNVLENMPCVSTKGDGPNGKRIEGFLYRYKKGEEVRIVCVCHGSFLSPAEFVKHAGGG  348

Query  795  DVAHPLKHIIVSPS  836
            DVAHPLKHI+V+PS
Sbjct  349  DVAHPLKHIVVNPS  362



>emb|CDY00093.1| BnaC09g02080D [Brassica napus]
Length=254

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 143/256 (56%), Gaps = 53/256 (21%)
 Frame = +3

Query  72   KFGVDP-NRAQKLKRCSSISSFALNGGARAFSPYAPPLSRTCSLPaeaaeteewrrrkea  248
            +FGVDP  + + L R SSI    +NGG          LSRTCSLP E  E  + +     
Sbjct  48   RFGVDPLAKTRLLARSSSIPDLVVNGGGTE-------LSRTCSLPVETEEWRKRKEL---  97

Query  249  QSQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEENGNGLIPVLSNGNALPssqgssvs  428
            QS +R+EAKRKR+EK +NVRV+REK       H            + G     S GSS S
Sbjct  98   QSLRRLEAKRKRLEKQRNVRVLREK-------HK-----------AGGGGEERSIGSSGS  139

Query  429  qgsgssgisDFDSQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEPAVNNSGNSGKDSK  608
              SG S +    S P+Q   K    RSPSS               +P   N         
Sbjct  140  GSSGLSELDTSPSPPVQATTKASIERSPSST--------------QPLPENQA-------  178

Query  609  EVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAG  788
                RN + +MPCV+T GDGP G+KI+GFLYRYRKG+EVRIVCVCHG+FL+PAEFVKHAG
Sbjct  179  ---ARNMIDDMPCVSTTGDGPNGRKIDGFLYRYRKGDEVRIVCVCHGSFLTPAEFVKHAG  235

Query  789  GGDVAHPLKHIIVSPS  836
            G DVA PLKHI+V+PS
Sbjct  236  GRDVARPLKHIVVNPS  251



>ref|XP_009365923.1| PREDICTED: ninja-family protein AFP3-like [Pyrus x bretschneideri]
Length=359

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +VRN L NMPCV+T GDGP+GK+IEGFLYRY+KGEEVRIVCVCHG+FLSPAEFVKHAGGG
Sbjct  283  IVRNVLENMPCVSTTGDGPDGKRIEGFLYRYKKGEEVRIVCVCHGSFLSPAEFVKHAGGG  342

Query  795  DVAHPLKHIIVSPSCLF  845
            DV HPLKHI+V+PS L 
Sbjct  343  DVEHPLKHIVVNPSPLL  359



>ref|XP_008365427.1| PREDICTED: ninja-family protein AFP3-like [Malus domestica]
Length=358

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +VRN L +MPCV+T GDGP+GK+IEGFLYRY+KGEEVRIVCVCHG+FLSPAEFVKHAGGG
Sbjct  282  IVRNVLESMPCVSTTGDGPDGKRIEGFLYRYKKGEEVRIVCVCHGSFLSPAEFVKHAGGG  341

Query  795  DVAHPLKHIIVSPSCLF  845
            DV HPLKHI+VSPS L 
Sbjct  342  DVEHPLKHIVVSPSPLL  358



>ref|XP_010260112.1| PREDICTED: ninja-family protein AFP3-like [Nelumbo nucifera]
Length=417

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 95/142 (67%), Gaps = 15/142 (11%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHS------RELEQRPAATLVEPAVNNSGNSGKDSKEV-  614
            DF+   +Q      EARSP+S+ S      ++    P  T+ E +  +SG   + SK   
Sbjct  271  DFEGGQVQGLSSCSEARSPTSIQSLPEHGEQKTTASPGKTMTETSGMSSGIGTEASKNSN  330

Query  615  --------VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAE  770
                    V RN + +MPCV+TRGDG  G++IEGFLY+YRKGEEVRIVCVCHG+FLSPAE
Sbjct  331  VVENGVREVGRNMMEDMPCVSTRGDGHNGRRIEGFLYKYRKGEEVRIVCVCHGSFLSPAE  390

Query  771  FVKHAGGGDVAHPLKHIIVSPS  836
            FVKHAGGGDV HPL+HI+V+PS
Sbjct  391  FVKHAGGGDVTHPLRHIVVNPS  412



>ref|XP_008357782.1| PREDICTED: ninja-family protein AFP3-like [Malus domestica]
 ref|XP_008357783.1| PREDICTED: ninja-family protein AFP3-like [Malus domestica]
Length=357

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            ++RN L NMPCV+T GDGP+GK+IEGFLYRY+KGEEVRI+CVCHG+FLSPAEFVKHAGGG
Sbjct  281  IMRNVLENMPCVSTTGDGPDGKRIEGFLYRYKKGEEVRILCVCHGSFLSPAEFVKHAGGG  340

Query  795  DVAHPLKHIIVSPS  836
            DVAHPLKHI+V+PS
Sbjct  341  DVAHPLKHIVVNPS  354



>ref|XP_006431300.1| hypothetical protein CICLE_v10011883mg [Citrus clementina]
 gb|ESR44540.1| hypothetical protein CICLE_v10011883mg [Citrus clementina]
Length=374

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 90/134 (67%), Gaps = 8/134 (6%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSRE--------LEQRPAATLVEPAVNNSGNSGKDSKE  611
            + DS   Q   K  EA SPS + S +          ++   ++   +  N     K   +
Sbjct  237  ELDSITPQGSHKCTEAVSPSIIQSMQPPRNTEVATSEKSGKSMAVKSHWNKPTVAKKGVK  296

Query  612  VVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGG  791
              VR+ L +MPCV+T GDGP+GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGG
Sbjct  297  EAVRDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGG  356

Query  792  GDVAHPLKHIIVSP  833
            GDVAHPLKHI+V+P
Sbjct  357  GDVAHPLKHIVVNP  370



>ref|XP_006482758.1| PREDICTED: ninja-family protein AFP3-like isoform X5 [Citrus 
sinensis]
Length=374

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 92/135 (68%), Gaps = 10/135 (7%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSRE---------LEQRPAATLVEPAVNNSGNSGKDSK  608
            + DS   Q   K  EA SPS + S +          E+   +  V+   N    + K  K
Sbjct  237  ELDSITPQGSHKCTEAVSPSIIQSMQPPRNTEVATSEKSGKSMAVKSHCNKPTVAKKGVK  296

Query  609  EVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAG  788
            E V R+ L +MPCV+T GDGP+GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAG
Sbjct  297  EAV-RDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAG  355

Query  789  GGDVAHPLKHIIVSP  833
            GGDVAHPLKHI+V+P
Sbjct  356  GGDVAHPLKHIVVNP  370



>ref|XP_009365884.1| PREDICTED: ninja-family protein AFP3-like [Pyrus x bretschneideri]
Length=359

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            ++RN L NMPCV+T GDGP+GK+IEGFLYRY+KGEEVRIVCVCHG+FLSPAEFVKHAGGG
Sbjct  283  IMRNVLENMPCVSTTGDGPDGKRIEGFLYRYKKGEEVRIVCVCHGSFLSPAEFVKHAGGG  342

Query  795  DVAHPLKHIIVSPSCLF  845
            DV HPLKHI+V+PS L 
Sbjct  343  DVEHPLKHIVVNPSPLL  359



>ref|XP_006395274.1| hypothetical protein EUTSA_v10004771mg [Eutrema salsugineum]
 gb|ESQ32560.1| hypothetical protein EUTSA_v10004771mg [Eutrema salsugineum]
Length=268

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            RN + +MPCV+T GDGP GKKI+GFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGGDV
Sbjct  194  RNIIEDMPCVSTTGDGPNGKKIDGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDV  253

Query  801  AHPLKHIIVSPS  836
            AHPLKHI+V+PS
Sbjct  254  AHPLKHIVVNPS  265



>ref|XP_006482754.1| PREDICTED: ninja-family protein AFP3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006482755.1| PREDICTED: ninja-family protein AFP3-like isoform X2 [Citrus 
sinensis]
 ref|XP_006482756.1| PREDICTED: ninja-family protein AFP3-like isoform X3 [Citrus 
sinensis]
 ref|XP_006482757.1| PREDICTED: ninja-family protein AFP3-like isoform X4 [Citrus 
sinensis]
Length=403

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 92/134 (69%), Gaps = 12/134 (9%)
 Frame = +3

Query  465  SQPLQVCG--KNVEARSPSSVHSRE---------LEQRPAATLVEPAVNNSGNSGKDSKE  611
            S PL   G  K  EA SPS + S +          E+   +  V+   N    + K  KE
Sbjct  267  SNPLLFHGSHKCTEAVSPSIIQSMQPPRNTEVATSEKSGKSMAVKSHCNKPTVAKKGVKE  326

Query  612  VVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGG  791
             V R+ L +MPCV+T GDGP+GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGG
Sbjct  327  AV-RDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGG  385

Query  792  GDVAHPLKHIIVSP  833
            GDVAHPLKHI+V+P
Sbjct  386  GDVAHPLKHIVVNP  399



>ref|XP_006431301.1| hypothetical protein CICLE_v10011883mg [Citrus clementina]
 ref|XP_006431302.1| hypothetical protein CICLE_v10011883mg [Citrus clementina]
 gb|ESR44541.1| hypothetical protein CICLE_v10011883mg [Citrus clementina]
 gb|ESR44542.1| hypothetical protein CICLE_v10011883mg [Citrus clementina]
Length=403

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 90/133 (68%), Gaps = 10/133 (8%)
 Frame = +3

Query  465  SQPLQVCG--KNVEARSPSSVHSRE--------LEQRPAATLVEPAVNNSGNSGKDSKEV  614
            S PL   G  K  EA SPS + S +          ++   ++   +  N     K   + 
Sbjct  267  SNPLLFHGSHKCTEAVSPSIIQSMQPPRNTEVATSEKSGKSMAVKSHWNKPTVAKKGVKE  326

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
             VR+ L +MPCV+T GDGP+GK+IEGFLYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGGG
Sbjct  327  AVRDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGG  386

Query  795  DVAHPLKHIIVSP  833
            DVAHPLKHI+V+P
Sbjct  387  DVAHPLKHIVVNP  399



>ref|XP_009360511.1| PREDICTED: ninja-family protein AFP3-like [Pyrus x bretschneideri]
Length=355

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +VRN L NMPCV+T GDGP+ K+IEGFLYRY+KGEEVRI+CVCHG+FLSPAEFVKHAGGG
Sbjct  279  IVRNVLENMPCVSTTGDGPDRKRIEGFLYRYKKGEEVRILCVCHGSFLSPAEFVKHAGGG  338

Query  795  DVAHPLKHIIVSPS  836
            DVAHPLKHI+V+PS
Sbjct  339  DVAHPLKHIVVNPS  352



>ref|XP_010528407.1| PREDICTED: ninja-family protein AFP3 [Tarenaya hassleriana]
 ref|XP_010528409.1| PREDICTED: ninja-family protein AFP3 [Tarenaya hassleriana]
 ref|XP_010528410.1| PREDICTED: ninja-family protein AFP3 [Tarenaya hassleriana]
Length=313

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +3

Query  549  AATLVEPAVNNSGNSGKD-SKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEV  725
            AA    P      NSG++ +KE V    L +MP V+T+GDGP GK+IEGFLYRYRKGEEV
Sbjct  218  AAAATPPLPEKPDNSGENRAKETV----LEDMPFVSTKGDGPNGKRIEGFLYRYRKGEEV  273

Query  726  RIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
            RIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+V+PS L 
Sbjct  274  RIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPSPLM  313



>ref|XP_010502975.1| PREDICTED: ninja-family protein AFP3 [Camelina sativa]
 ref|XP_010502976.1| PREDICTED: ninja-family protein AFP3 [Camelina sativa]
Length=237

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 79/103 (77%), Gaps = 9/103 (9%)
 Frame = +3

Query  528  RELEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRY  707
            + +E  P+    +P      N GK++     RN + +MPCV+T GDGP GKKI+GFLYRY
Sbjct  141  KSMETSPSTAQSQPE-----NPGKEAS----RNIMEDMPCVSTIGDGPNGKKIDGFLYRY  191

Query  708  RKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            RKGEEVRIVCVCHG+FLSPAEFVKHAGG DVAHPLKHI+V+PS
Sbjct  192  RKGEEVRIVCVCHGSFLSPAEFVKHAGGSDVAHPLKHIVVNPS  234



>ref|XP_003531858.1| PREDICTED: ninja-family protein AFP2-like [Glycine max]
Length=383

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +3

Query  498  EARSPSSVHSRELEQRPAATLVEPAVNNSGNSGKDSK-EVVVRNALFNMPCVTTRGDGPE  674
            E +SP+ V      +  AA +V     ++ +S   S+ + +VRN L +MPCV+T+G+GP 
Sbjct  268  ELKSPAGVAENNTGKNAAAAVVTMRSQSNKHSPPQSRTKDIVRNLLEDMPCVSTKGEGPN  327

Query  675  GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  842
            GK+IEGFLYRY KGEEVRIVCVCHG+FL+P+EFVKHAGGGDVA+PLKHI+VSPS L
Sbjct  328  GKRIEGFLYRYGKGEEVRIVCVCHGSFLTPSEFVKHAGGGDVANPLKHIVVSPSLL  383



>ref|XP_010939184.1| PREDICTED: ninja-family protein Os07g0602900 [Elaeis guineensis]
Length=371

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 99/148 (67%), Gaps = 21/148 (14%)
 Frame = +3

Query  456  DFDSQPLQ---VCGKN--VEARSPSSVHS------RELEQRPAATLVEPAVNNSGNSGKD  602
            ++DS+P+Q   + G +   EARS  ++ S       ++   P   +V  AV + G   +D
Sbjct  219  EYDSRPMQGFDISGFSSCTEARSSLTIRSLPENSNHKMAATPPTAIVGKAVGSVGGGEED  278

Query  603  ----------SKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGN  752
                        + V RN +  MPCV+TRG+GP G++IEGFLY+Y+KGEEVRIVCVCHG+
Sbjct  279  PPKKIARRASGMKEVERNMMEEMPCVSTRGEGPNGRRIEGFLYKYKKGEEVRIVCVCHGS  338

Query  753  FLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            FL+PAEFV+HAGGGDVAHPL+HI+V+PS
Sbjct  339  FLTPAEFVRHAGGGDVAHPLRHIVVNPS  366



>ref|XP_004490204.1| PREDICTED: ninja-family protein AFP1-like [Cicer arietinum]
Length=367

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 97/153 (63%), Gaps = 31/153 (20%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEPAVNNSGNSGKDSK--------E  611
            + DS+P    G   EARSP+S  S  L++R +    + AV +SG +  + K        E
Sbjct  217  EMDSKPFLGSGSCGEARSPASTQS--LQERSS----QDAVGSSGGTKTNEKLTRTSSRAE  270

Query  612  V-----------------VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCV  740
            V                 +  N++ +MPCV T+GDGP G++IEG LY+Y KGEEVRI+CV
Sbjct  271  VMENSSKKPNPTQNMGKEIGTNSMEDMPCVFTKGDGPNGRRIEGILYKYGKGEEVRIMCV  330

Query  741  CHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  839
            CHGNFLSPAEFVKHAGGGDVAHPL+HI+V+PS 
Sbjct  331  CHGNFLSPAEFVKHAGGGDVAHPLRHIVVNPSA  363



>gb|KHN13550.1| Ninja-family protein AFP2 [Glycine soja]
Length=381

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +VRN L +MPCV+T+GDGP GK+IEGFLYRY KGEEVRIVCVCHG+FL+P+EFVKHAGGG
Sbjct  306  IVRNLLEDMPCVSTKGDGPNGKRIEGFLYRYGKGEEVRIVCVCHGSFLTPSEFVKHAGGG  365

Query  795  DVAHPLKHIIVSPSCL  842
            DVA+PLKHI+VSPS L
Sbjct  366  DVANPLKHIVVSPSFL  381



>ref|XP_003552572.2| PREDICTED: ninja-family protein AFP2-like [Glycine max]
Length=377

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +VRN L +MPCV+T+GDGP GK+IEGFLYRY KGEEVRIVCVCHG+FL+P+EFVKHAGGG
Sbjct  302  IVRNLLEDMPCVSTKGDGPNGKRIEGFLYRYGKGEEVRIVCVCHGSFLTPSEFVKHAGGG  361

Query  795  DVAHPLKHIIVSPSCL  842
            DVA+PLKHI+VSPS L
Sbjct  362  DVANPLKHIVVSPSFL  377



>ref|XP_010514662.1| PREDICTED: ninja-family protein AFP3-like [Camelina sativa]
 ref|XP_010514663.1| PREDICTED: ninja-family protein AFP3-like [Camelina sativa]
Length=232

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 9/107 (8%)
 Frame = +3

Query  516  SVHSRELEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGF  695
            +  ++ +E  P+    +P      N GK++     RN + +MPCV+T GDGP GKKI+GF
Sbjct  132  ATTNKSMETSPSTAQSQPE-----NPGKEAS----RNIMEDMPCVSTIGDGPNGKKIDGF  182

Query  696  LYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            LYRYRKGEEVRIVCVCHG+FLSPAEFVKHAGG DVA+PLKHI+V+PS
Sbjct  183  LYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGSDVAYPLKHIVVNPS  229



>ref|XP_007139479.1| hypothetical protein PHAVU_008G032900g [Phaseolus vulgaris]
 gb|ESW11473.1| hypothetical protein PHAVU_008G032900g [Phaseolus vulgaris]
Length=379

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +VRN L +MPCV+T+GDGP G+++EGFLYRY KGEEVRIVCVCHG+FL+P+EFVKHAGGG
Sbjct  304  IVRNLLEDMPCVSTKGDGPNGRRVEGFLYRYGKGEEVRIVCVCHGSFLTPSEFVKHAGGG  363

Query  795  DVAHPLKHIIVSPSCL  842
            DVA+PLKHI+VSPS L
Sbjct  364  DVANPLKHIVVSPSIL  379



>gb|KHN14039.1| Ninja-family protein AFP2 [Glycine soja]
Length=383

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = +3

Query  498  EARSPSSVHSRELEQRPAATLVEPAVNNSGNSGKDSK-EVVVRNALFNMPCVTTRGDGPE  674
            E +SP+ V      +  AA +V     ++ +S   S+ + +VRN L +MPCV+T+G+GP 
Sbjct  268  ELKSPAGVAENNTGKNAAAAVVTMRSQSNKHSPPQSRTKDIVRNLLEDMPCVSTKGEGPN  327

Query  675  GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  842
            GK+IEGFLYRY KGEEVRIVCVCHG+FL+P+EFVKHAGG DVA+PLKHI+VSPS L
Sbjct  328  GKRIEGFLYRYGKGEEVRIVCVCHGSFLTPSEFVKHAGGSDVANPLKHIVVSPSLL  383



>ref|XP_010425750.1| PREDICTED: ninja-family protein AFP3 [Camelina sativa]
 ref|XP_010425751.1| PREDICTED: ninja-family protein AFP3 [Camelina sativa]
Length=238

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 78/101 (77%), Gaps = 9/101 (9%)
 Frame = +3

Query  534  LEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRK  713
            +E  P+ +  +P      N G+++     RN + +MPCV+T GDGP GKKI+GFLYRYRK
Sbjct  144  METSPSTSQSQPE-----NQGREAS----RNIMEDMPCVSTIGDGPNGKKIDGFLYRYRK  194

Query  714  GEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            GEEVRIVCVCHG+FLSPAEFVKHAGG DVAHPLKHI+V+ S
Sbjct  195  GEEVRIVCVCHGSFLSPAEFVKHAGGSDVAHPLKHIVVNLS  235



>ref|XP_008805142.1| PREDICTED: ninja-family protein AFP3-like [Phoenix dactylifera]
Length=361

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 111/298 (37%), Positives = 162/298 (54%), Gaps = 46/298 (15%)
 Frame = +3

Query  75   FGVDPNRAQKLKRCSSISSFALNGGARAFSPYAPPLSRTCSLPaeaaeteewrrrkeaQS  254
            FGV+ ++ +KL R SS+++ ++        P  PPL+RTCSLP E  E    R+  ++  
Sbjct  61   FGVE-SKERKLVRSSSVATLSMFPLEHDL-PMVPPLARTCSLPTETEEEHRKRKELQSLK  118

Query  255  QkrmeakrkrmeklkNVRVVREKLDKE--------------DPPHSEENG----------  362
            +   + KR   + L  +  VR++ D+                  H+E +G          
Sbjct  119  RLEAKRKRSEKKNLSKLAAVRDQRDENLNEGVNGGHGRVLPMAVHTELSGFPAVPGSNKV  178

Query  363  ----NGLIPVLSNGNALPssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHS-  527
                +G  P+ ++G    +SQG +  QGS SSG+ DF +  +Q        RSPS+  S 
Sbjct  179  RGLMHGARPIDASGCFSLASQGPAGFQGSSSSGVPDFKTLSVQGSNGCATVRSPSTTMSF  238

Query  528  -----RELEQRPAATLV-EPAVNNSGNSGKDSKEV---------VVRNALFNMPCVTTRG  662
                  +    PA  +V +PA++        +K           + RN +  MPCV+T G
Sbjct  239  PENTNHKAATSPATMMVGKPALSAREEEESSTKTSARPNGVPREMERNMMQEMPCVSTTG  298

Query  663  DGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            DGP G++IEGFLYRY+KGEE+RIVCVCHG+FL+PAEFV+HAGGGDVAHPL+HI+V+PS
Sbjct  299  DGPNGRRIEGFLYRYKKGEELRIVCVCHGSFLTPAEFVRHAGGGDVAHPLRHIVVNPS  356



>ref|XP_009151770.1| PREDICTED: ninja-family protein AFP3-like [Brassica rapa]
 emb|CDX86364.1| BnaA06g30810D [Brassica napus]
Length=267

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  531  ELEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYR  710
            EL+  P    V    N S  +         RN + +MPCV+T GDGP GKKI+GFLYRYR
Sbjct  163  ELDNTPPPPPVHATTNKSVETSPPITAPAARNIIEDMPCVSTTGDGPNGKKIDGFLYRYR  222

Query  711  KGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            KG+EVRIVCVCHG+FLSPAEF+KHAGG DV HPLKHI+V+PS
Sbjct  223  KGQEVRIVCVCHGSFLSPAEFIKHAGGSDVTHPLKHIVVNPS  264



>ref|XP_009399138.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399139.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=324

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 6/133 (5%)
 Frame = +3

Query  456  DFDSQP---LQVCGKN--VEARSPSSVHSRELEQRPAATLVEPAVNNSGNS-GKDSKEVV  617
            DFD  P     V GKN   + RS S+++      R   T  E   +    S G  + + V
Sbjct  186  DFDCPPKHGFGVAGKNHHRDVRSQSAMNPTTSLIRKRVTFGEEEDDRPRKSAGHGTAKGV  245

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
             R+ +  MPCV+TRGDGP G++IEGFLY+YR+GEEVRIVC+CHG FL+PAEFVKH GGGD
Sbjct  246  TRDMMREMPCVSTRGDGPSGRRIEGFLYKYREGEEVRIVCLCHGRFLTPAEFVKHGGGGD  305

Query  798  VAHPLKHIIVSPS  836
            VAHPL+HI+V+PS
Sbjct  306  VAHPLRHIVVNPS  318



>ref|NP_189598.1| Ninja-family protein AFP3 [Arabidopsis thaliana]
 ref|NP_001030794.1| Ninja-family protein AFP3 [Arabidopsis thaliana]
 ref|NP_001078222.1| Ninja-family protein AFP3 [Arabidopsis thaliana]
 sp|Q94F39.1|AFP3_ARATH RecName: Full=Ninja-family protein AFP3; AltName: Full=ABI five-binding 
protein 3; Short=ABI5-binding protein 3 [Arabidopsis 
thaliana]
 gb|AAK60331.1|AF385741_1 AT3g29575/MWE13_2 [Arabidopsis thaliana]
 gb|AAM91506.1| AT3g29575/MWE13_2 [Arabidopsis thaliana]
 dbj|BAH20080.1| AT3G29575 [Arabidopsis thaliana]
 gb|AEE77588.1| Ninja-family protein AFP3 [Arabidopsis thaliana]
 gb|AEE77589.1| Ninja-family protein AFP3 [Arabidopsis thaliana]
 gb|AEE77590.1| Ninja-family protein AFP3 [Arabidopsis thaliana]
Length=231

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 4/83 (5%)
 Frame = +3

Query  588  NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPA  767
            N GK++ +    N + +MP V+T GDGP GKKI GFLYRYRKGEEVRIVCVCHG+FLSPA
Sbjct  150  NLGKEASQ----NIIEDMPFVSTTGDGPNGKKINGFLYRYRKGEEVRIVCVCHGSFLSPA  205

Query  768  EFVKHAGGGDVAHPLKHIIVSPS  836
            EFVKHAGGGDVAHPLKHI+V+PS
Sbjct  206  EFVKHAGGGDVAHPLKHIVVNPS  228



>ref|XP_009392469.1| PREDICTED: ninja-family protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=368

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 79/103 (77%), Gaps = 6/103 (6%)
 Frame = +3

Query  534  LEQRPAATLV--EPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRY  707
            LE R   T+V  E ++ N    G +      RN +  MPCV+TRGDGP G+KIEGFLY+Y
Sbjct  264  LEVRKPITVVGEEDSLKNFATDGVNRG----RNMVGEMPCVSTRGDGPNGRKIEGFLYKY  319

Query  708  RKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            RKGEEVRIVCVCHG FL+PAEFVKHAGGGDV+HPL+HI+V+PS
Sbjct  320  RKGEEVRIVCVCHGTFLTPAEFVKHAGGGDVSHPLRHIVVNPS  362



>ref|XP_011085686.1| PREDICTED: ninja-family protein AFP3-like [Sesamum indicum]
Length=317

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 132/272 (49%), Positives = 168/272 (62%), Gaps = 25/272 (9%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFAL------NGGAR------AFSPYAPPLSRTCSLPaeaa  215
            +FGVDP + +KL+R SS+S+  L      NG +       A   YAP L+R CSLP    
Sbjct  57   RFGVDPAK-KKLRRSSSVSNLVLPVGSFDNGSSSHQARGVAGESYAP-LTRACSLP---I  111

Query  216  eteewrrrkeaQSQkrmeakrkrmeklkNVRVV-REKLDKEDPPHSEENGN-GLIPVLSN  389
            ETEEWRRRKE QS + MEA++KRMEKLKNVRV  +E    ED  H+    + G++    N
Sbjct  112  ETEEWRRRKELQSIRCMEARKKRMEKLKNVRVKDKENNSSEDHAHNGSGSHEGVLNGFQN  171

Query  390  GNALPssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEP  569
             N + SSQGS  S  SGS+ +S   +Q +   G  +   S S+     L   P  T+  P
Sbjct  172  WNLMQSSQGSIGSTSSGSARVSHLQNQLID-GGNRISTISSSA----SLPILPEQTIQIP  226

Query  570  AVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHG  749
            AV  +  S     + V R AL +MP V+TRG GP  +K EGFLYRY++G++V+IVCVCHG
Sbjct  227  AVKGA-ESDPIGVDEVQRTALLDMPYVSTRGSGPNFRKTEGFLYRYKRGDDVKIVCVCHG  285

Query  750  NFLSPAEFVKHAGGGDVAHPLKHIIVSPSCLF  845
             FLSPAEFVKH GGGDVA PLKHI+V+P  LF
Sbjct  286  LFLSPAEFVKHGGGGDVAQPLKHIVVNPFPLF  317



>ref|XP_010936468.1| PREDICTED: ninja-family protein 6 [Elaeis guineensis]
Length=360

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 93/145 (64%), Gaps = 20/145 (14%)
 Frame = +3

Query  459  FDSQPLQVCGKNVEARSPSSVHS------RELEQRPAATLVEPAVNNSGNSGKD------  602
            FD+     C    + RSPS+  S       ++      ++V  A+   G   +D      
Sbjct  220  FDASGFTSC---ADVRSPSTFQSLPEHAIHQMAANAPTSVVGKAIGTVGGGEEDPAKKNA  276

Query  603  --SKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFV  776
              +KE+  RN +  MPCV+T+GDGP G++IEGFLY+YRKGEEVRIVCVCHG+FL+PAEFV
Sbjct  277  GRAKEME-RNMIEEMPCVSTKGDGPNGRRIEGFLYKYRKGEEVRIVCVCHGSFLTPAEFV  335

Query  777  KHAGGGDVAHPLKHIIV--SPSCLF  845
            +HAGGGDVAHPL+HI+V  SP   F
Sbjct  336  RHAGGGDVAHPLRHIVVNTSPFAFF  360



>ref|XP_009416563.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=310

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            RN + +MPCV+TRGDGP G++IEG LYRY+KGE+VRIVCVCHG+FL+PAEFVKHAGGGDV
Sbjct  234  RNMMEDMPCVSTRGDGPNGRRIEGLLYRYKKGEDVRIVCVCHGSFLTPAEFVKHAGGGDV  293

Query  801  AHPLKHIIVSPS  836
            AHPL+HI+V+PS
Sbjct  294  AHPLRHIVVNPS  305



>ref|XP_008791349.1| PREDICTED: ninja-family protein AFP3 [Phoenix dactylifera]
Length=102

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 76/101 (75%), Gaps = 4/101 (4%)
 Frame = +3

Query  534  LEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRK  713
            +   P   +V  AV + G   +D  + + R A     CV+TRGDGP G++IEGFLY+Y+ 
Sbjct  1    MAATPPTAIVGKAVGSVGGGEEDPTKKIARRAT----CVSTRGDGPNGRRIEGFLYKYKN  56

Query  714  GEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            GEEVRIVCVCHG+FL+PAEFV+HAGGGDVAHPL+HI+V+PS
Sbjct  57   GEEVRIVCVCHGSFLTPAEFVRHAGGGDVAHPLRHIVVNPS  97



>ref|XP_006437917.1| hypothetical protein CICLE_v10031813mg [Citrus clementina]
 ref|XP_006484218.1| PREDICTED: ninja-family protein AFP2-like [Citrus sinensis]
 gb|ESR51157.1| hypothetical protein CICLE_v10031813mg [Citrus clementina]
Length=382

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 92/144 (64%), Gaps = 18/144 (13%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEPAVNNSGNSG-------------  596
            + +S+PLQ      EAR+P +V +  L+ R +   V  +V N   +              
Sbjct  237  ELESKPLQGMSSGGEARTPLTVQA--LQDRSSQEAVGSSVTNINENACHTSRPENLSNKL  294

Query  597  --KDSK-EVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPA  767
              ++S+   +  N   +MPCV T+GDGP G+KIEG LYRY KGEEVRI+CVCHG+FLSPA
Sbjct  295  DRRNSRGREMAMNTYEDMPCVFTKGDGPNGRKIEGILYRYGKGEEVRIMCVCHGSFLSPA  354

Query  768  EFVKHAGGGDVAHPLKHIIVSPSC  839
            EFVKHAGGGDV HPL+HI+V+P+ 
Sbjct  355  EFVKHAGGGDVDHPLRHIVVNPAA  378



>ref|XP_008810752.1| PREDICTED: ninja-family protein 6-like [Phoenix dactylifera]
Length=362

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 92/142 (65%), Gaps = 19/142 (13%)
 Frame = +3

Query  459  FDSQPLQVCGKNVEARSPSSVHS------RELEQRPAATLVEPAVNNSG---------NS  593
            FD      C    E RSPS+  S       ++    A + V  A+ + G         N+
Sbjct  219  FDVSGFTSC---TEVRSPSTFQSLPEHANHKMAANAATSAVGKAIGSVGGGEEDPAKKNA  275

Query  594  GK-DSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAE  770
            G+ +  + + RN +  MPCV T+GDGP G++IEGFLY+Y+KG EVRIVCVCHG+FL+PAE
Sbjct  276  GRANVMKEMERNMIEEMPCVFTKGDGPNGRRIEGFLYKYKKGGEVRIVCVCHGSFLTPAE  335

Query  771  FVKHAGGGDVAHPLKHIIVSPS  836
            FV+HAGGGDVAHPLKHI+V+PS
Sbjct  336  FVRHAGGGDVAHPLKHIVVNPS  357



>ref|XP_008339804.1| PREDICTED: ninja-family protein AFP3-like [Malus domestica]
Length=161

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  588  NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPA  767
            +S ++S+    RNA+ +MPCV T GDGP G+K+EG LYRY KG+EVRI+CVCHG+FLSPA
Sbjct  76   SSQENSERETRRNAMEDMPCVFTIGDGPNGRKVEGILYRYGKGQEVRIMCVCHGSFLSPA  135

Query  768  EFVKHAGGGDVAHPLKHIIVSPS  836
            EFVKHAGG DVAHPL+HI+V+P+
Sbjct  136  EFVKHAGGSDVAHPLRHIVVNPA  158



>ref|XP_009406311.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=356

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            RN +  MPCV+TRGDGP G++IEGFLY+Y+KGEEVRIVCVCHG+FL+PAEFVKHAGGGDV
Sbjct  277  RNMIGEMPCVSTRGDGPNGRRIEGFLYKYKKGEEVRIVCVCHGSFLTPAEFVKHAGGGDV  336

Query  801  AHPLKHIIVSP  833
             HPL+HI+V+P
Sbjct  337  THPLRHIVVNP  347



>ref|XP_008389402.1| PREDICTED: ninja-family protein AFP3-like [Malus domestica]
Length=397

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 94/145 (65%), Gaps = 17/145 (12%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSRELEQRP--------------AATLVEPAVNNSG--  587
            + +S+PLQ      EAR+ +   ++ L++R               A+   +P + N    
Sbjct  249  ELESKPLQGTSSCGEARNXTPASNQSLQERSXNXVGSSGTGTTDDASRTPKPDIENPSRK  308

Query  588  -NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSP  764
             N+ ++SK    RN + +MPCV T+GDGP G+K+EG LYRY KGEEVRI+C+CHG+FLSP
Sbjct  309  PNTQENSKRETSRNGMEDMPCVFTKGDGPNGRKVEGILYRYGKGEEVRIMCICHGSFLSP  368

Query  765  AEFVKHAGGGDVAHPLKHIIVSPSC  839
            AEFVKHAGG DV +PL+HI+V+P+ 
Sbjct  369  AEFVKHAGGSDVTNPLRHIVVNPAA  393



>ref|XP_010091583.1| hypothetical protein L484_026430 [Morus notabilis]
 gb|EXB44849.1| hypothetical protein L484_026430 [Morus notabilis]
Length=345

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 93/143 (65%), Gaps = 16/143 (11%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPS---SVHSRELE-QRPAAT--LVEPAVNNSGN---------  590
            + +S+P+Q      EARSP+   S+  R  E   P+ T    E   + SGN         
Sbjct  197  ELESKPVQGSSTYGEARSPAGHQSMQERSQEIMGPSGTKSTAENKCSTSGNKMENPSKKP  256

Query  591  -SGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPA  767
             SG +    +  NA+ +MPCV T+G+GP G++++G LYRY KGEEVRI+CVCHG FLSPA
Sbjct  257  NSGGNKGSEIGMNAMEDMPCVFTKGNGPNGRRVDGILYRYGKGEEVRIMCVCHGKFLSPA  316

Query  768  EFVKHAGGGDVAHPLKHIIVSPS  836
            EFVKHAGGGDV HPL+HI+++PS
Sbjct  317  EFVKHAGGGDVDHPLRHIVINPS  339



>ref|XP_008243841.1| PREDICTED: ninja-family protein AFP3 [Prunus mume]
Length=398

 Score =   134 bits (337),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 88/144 (61%), Gaps = 18/144 (13%)
 Frame = +3

Query  459  FDSQPLQVCGKNVEARSPSS-----------------VHSRELEQRPAATLVEPAVNNSG  587
             +S+PLQ      EARSP+S                   + E   R +   VE       
Sbjct  252  LESKPLQGSSNCGEARSPASNQLLQERSNQDTVVSSGTGTAEDASRASRADVESKCKKPN  311

Query  588  NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPA  767
            +S K  +E    NA+ +MPCV T+GDGP G+K+EG LYRY KGEEVRI+CVCHG+FLSPA
Sbjct  312  SSEKSGRETRT-NAMEDMPCVFTKGDGPNGRKVEGILYRYGKGEEVRIMCVCHGSFLSPA  370

Query  768  EFVKHAGGGDVAHPLKHIIVSPSC  839
            EFVKHAGG DV HPL+HI+V+P+ 
Sbjct  371  EFVKHAGGSDVTHPLRHIVVNPAA  394



>ref|XP_007223056.1| hypothetical protein PRUPE_ppa006974mg [Prunus persica]
 gb|EMJ24255.1| hypothetical protein PRUPE_ppa006974mg [Prunus persica]
Length=387

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 88/144 (61%), Gaps = 18/144 (13%)
 Frame = +3

Query  459  FDSQPLQVCGKNVEARSPSS-----------------VHSRELEQRPAATLVEPAVNNSG  587
             +S+PLQ      EARSP+S                   + E   R +   VE       
Sbjct  241  LESKPLQGSSNCGEARSPASNQLLQERSNQDTVGSSGTGTAEDASRASRADVESKCKKPN  300

Query  588  NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPA  767
            +S K  +E    NA+ +MPCV T+GDGP G+K+EG LYRY KGEEVRI+CVCHG+FLSPA
Sbjct  301  SSEKSGRETRT-NAMEDMPCVFTKGDGPNGRKVEGILYRYGKGEEVRIMCVCHGSFLSPA  359

Query  768  EFVKHAGGGDVAHPLKHIIVSPSC  839
            EFVKHAGG DV HPL+HI+V+P+ 
Sbjct  360  EFVKHAGGSDVTHPLRHIVVNPAA  383



>ref|XP_009356414.1| PREDICTED: ninja-family protein AFP3 [Pyrus x bretschneideri]
Length=394

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 94/145 (65%), Gaps = 17/145 (12%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSRELEQRP--------------AATLVEPAVNNSG--  587
            + +S+PL       EAR+P+   ++ L++R               A+   +P + N    
Sbjct  246  ELESKPLPGTSSCGEARNPTPASNQSLQERSNNAVGSSGTGTTDDASRTPKPDIENPSRK  305

Query  588  -NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSP  764
             N+ ++SK    RN + +MPCV T+GDGP G+K+EG LYRY KGEEVRI+C+CHG+FLSP
Sbjct  306  PNTQENSKRETSRNGMEDMPCVFTKGDGPNGRKVEGILYRYGKGEEVRIMCICHGSFLSP  365

Query  765  AEFVKHAGGGDVAHPLKHIIVSPSC  839
            AEFVKHAGG DV +PL+HI+V+P+ 
Sbjct  366  AEFVKHAGGSDVTNPLRHIVVNPAA  390



>ref|XP_008350890.1| PREDICTED: ninja-family protein AFP3-like [Malus domestica]
Length=397

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 94/145 (65%), Gaps = 17/145 (12%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSRELEQRP--------------AATLVEPAVNNSG--  587
            + +S+PLQ      EAR+ +   ++ L++R               A+   +P + N    
Sbjct  249  ELESKPLQGTSSCGEARNLTPASNQSLQERSNNAVGSSGTGTTDDASRTPKPDIENPSRK  308

Query  588  -NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSP  764
             N+ ++SK    RN + +MPCV T+GDGP G+K+EG LYRY KGEEVRI+C+CHG+FLSP
Sbjct  309  PNTQENSKRETSRNGMEDMPCVFTKGDGPNGRKVEGILYRYGKGEEVRIMCICHGSFLSP  368

Query  765  AEFVKHAGGGDVAHPLKHIIVSPSC  839
            AEFVKHAGG DV +PL+HI+V+P+ 
Sbjct  369  AEFVKHAGGSDVTNPLRHIVVNPAA  393



>ref|XP_006291750.1| hypothetical protein CARUB_v10017919mg, partial [Capsella rubella]
 gb|EOA24648.1| hypothetical protein CARUB_v10017919mg, partial [Capsella rubella]
Length=246

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 4/83 (5%)
 Frame = +3

Query  588  NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPA  767
            N+GK +     RN + +MPCV+T G+GP GKKI+GFLYRY KGEEVRIVCVCHG+FLSPA
Sbjct  165  NAGKQA----TRNIMEDMPCVSTIGNGPNGKKIDGFLYRYGKGEEVRIVCVCHGSFLSPA  220

Query  768  EFVKHAGGGDVAHPLKHIIVSPS  836
            EF+KHAGG DVA+PLKHI+V+PS
Sbjct  221  EFIKHAGGSDVANPLKHIVVNPS  243



>emb|CDY44386.1| BnaA02g29910D [Brassica napus]
Length=251

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = +3

Query  561  VEPAVNNSGNSGKDSKEVV--VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIV  734
            V+   N S  +   S + +   RN + +MPCV+T G+GP GKKI+GFLYRY KG+EVRIV
Sbjct  155  VQATTNKSKETSPSSAQSLPAARNIIEDMPCVSTTGEGPNGKKIDGFLYRYMKGQEVRIV  214

Query  735  CVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            CVCHG+FL+PAEFVKHAGG DV HPLKHI+V+PS
Sbjct  215  CVCHGSFLTPAEFVKHAGGRDVTHPLKHIVVNPS  248



>gb|KDO70354.1| hypothetical protein CISIN_1g0167841mg, partial [Citrus sinensis]
Length=137

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +  NA  +MPCV T+GDGP G+KIEG LYRY KGEEVRI+CVCHG+FLSPAEFVKHAGGG
Sbjct  59   MAMNAYEDMPCVFTKGDGPNGRKIEGILYRYGKGEEVRIMCVCHGSFLSPAEFVKHAGGG  118

Query  795  DVAHPLKHIIVSPS  836
            DV HPL+HI+V+P+
Sbjct  119  DVDHPLRHIVVNPA  132



>ref|XP_010923621.1| PREDICTED: ninja-family protein AFP3 [Elaeis guineensis]
Length=307

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 149/265 (56%), Gaps = 34/265 (13%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFALNGGARAFSPYAPPLSRTCSLPaeaaeteewrrrkeaQ  251
            +FGV+P   ++L R SSI++ ++      F P A P +R CSLP EA E    R+  ++ 
Sbjct  62   RFGVEPKEQRRLVRSSSIATLSMFPSENDF-PVAAPPTRACSLPMEAEEEHRNRKEMQSL  120

Query  252  SQkrmeakrkrmeklkNV--RVVREKLDKEDP--------PHSEENGNGLIPVLSNGNAL  401
             +  ++ KR     L  +  R  RE+   E          P S   G G   V ++    
Sbjct  121  KRLEVKRKRSEKRNLSKLAARDQREENFNEGTNGGHGRVLPRSASTGTGARQVDASRCFR  180

Query  402  PssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEPAVNN  581
            P+SQ S  SQGS SSG+S+F+SQ LQ  G N  AR                  VE +   
Sbjct  181  PASQWSIGSQGSSSSGMSNFESQMLQ--GSNGGAREE----------------VEESWKK  222

Query  582  SGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLS  761
             G  G+ S    VR  +  MP V+TRGDGP G++IEG LYRY KG+EVRIVCVCHG+FL+
Sbjct  223  IG--GRAS---WVREEMEEMPRVSTRGDGPNGRRIEGLLYRYGKGKEVRIVCVCHGSFLT  277

Query  762  PAEFVKHAGGGDVAHPLKHIIVSPS  836
            PAEFV+HAGGG+VAHPL+HI+V P+
Sbjct  278  PAEFVRHAGGGNVAHPLRHIVVYPT  302



>ref|XP_008785998.1| PREDICTED: ninja-family protein AFP3-like [Phoenix dactylifera]
Length=328

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 109/267 (41%), Positives = 155/267 (58%), Gaps = 16/267 (6%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSISSFALNGGARAFSPYAPPLSRTCSLPaeaaeteewrrrkeaQ  251
            +FGV+P   ++L R SSI++ ++      F P A PL RTCSLP EA E    R+    Q
Sbjct  61   RFGVEPEEKKRLVRSSSIATLSMFPSENDF-PVAAPLPRTCSLPTEAEEEHRKRKEL--Q  117

Query  252  SQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEENGNGLI------------PVLSNGN  395
            S KR+E KRKR E+    ++V     +E+       G+G +             V ++G 
Sbjct  118  SLKRLEVKRKRSERRNLSKLVARDQREENSNEGMNAGHGRVLPGPASTAAGARQVDASGC  177

Query  396  ALPssqgssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEPAV  575
              P+S+ S  SQGS SSG+S+F+S  +Q   ++  +R+PS       E   +A  VE + 
Sbjct  178  FRPASRWSIGSQGSSSSGVSNFESHMVQEVRRSA-SRTPSLPEHSNHEAAGSAREVEESS  236

Query  576  NNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNF  755
                      +  +  NA+  MPCV+  GDGP G++IEGFLY Y +GEEVRIVC CHG+ 
Sbjct  237  KKIAGRPTWMRREMEWNAMEEMPCVSATGDGPNGRRIEGFLYGYGEGEEVRIVCACHGSL  296

Query  756  LSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            L+PAEFV+HAG G+VAHPL+HI+V+P+
Sbjct  297  LTPAEFVRHAGAGNVAHPLRHILVNPT  323



>ref|XP_003520115.1| PREDICTED: ninja-family protein AFP2-like [Glycine max]
Length=411

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N++ +MPCV T+GDGP G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVA
Sbjct  337  NSMEDMPCVFTKGDGPNGRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVA  396

Query  804  HPLKHIIVSPSC  839
            HPL+HI+V+PS 
Sbjct  397  HPLRHIVVNPSA  408



>emb|CDY04085.1| BnaC02g38000D [Brassica napus]
Length=249

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            RN + +MPCV+T GDGP  KKI+GFLYRY KG+EVRIVCVCHG+FL+PAEFVKHAGG DV
Sbjct  175  RNIIEDMPCVSTTGDGPNRKKIDGFLYRYMKGQEVRIVCVCHGSFLTPAEFVKHAGGRDV  234

Query  801  AHPLKHIIVSPS  836
             HPLKHI+V+PS
Sbjct  235  THPLKHIVVNPS  246



>gb|KHN29983.1| Ninja-family protein AFP2 [Glycine soja]
Length=369

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N++ +MPCV T+GDGP G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVA
Sbjct  295  NSMEDMPCVFTKGDGPNGRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVA  354

Query  804  HPLKHIIVSPSC  839
            HPL+HI+V+PS 
Sbjct  355  HPLRHIVVNPSA  366



>ref|XP_004297228.1| PREDICTED: ninja-family protein AFP2-like [Fragaria vesca subsp. 
vesca]
Length=356

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 91/148 (61%), Gaps = 24/148 (16%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSRELEQ----RPAATLVEPAVNN--------------  581
            + +S+PLQ      EARSP+S   ++  Q    R   +L     N               
Sbjct  209  EMESKPLQGSSSCGEARSPASNQDQQSNQGTTLRSLGSLTPEHANRISRAVMESMRKKPP  268

Query  582  --SGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNF  755
              S + G++S+     N + +MPCV T+GDGP G+KIEG LYRY KGEEVRI+CVCHG F
Sbjct  269  IPSEDKGRESR----MNHMEDMPCVFTKGDGPNGRKIEGILYRYAKGEEVRIMCVCHGTF  324

Query  756  LSPAEFVKHAGGGDVAHPLKHIIVSPSC  839
            LSPAEFVKHAGGGDV +PL+HI+V+P+ 
Sbjct  325  LSPAEFVKHAGGGDVTNPLRHIVVNPAA  352



>ref|XP_007153513.1| hypothetical protein PHAVU_003G042000g [Phaseolus vulgaris]
 gb|ESW25507.1| hypothetical protein PHAVU_003G042000g [Phaseolus vulgaris]
Length=406

 Score =   131 bits (330),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N++ +MPCV T+GDGP G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVA
Sbjct  332  NSIEDMPCVFTKGDGPNGRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVA  391

Query  804  HPLKHIIVSPSC  839
            HPL+HI+V+PS 
Sbjct  392  HPLRHIVVNPSA  403



>emb|CBI27295.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N + +MPCV TRGDGP G++IEG LY+Y KGEEVRI+CVCHG+FLSPAEFVKHAGGGDVA
Sbjct  278  NFMGDMPCVFTRGDGPNGRRIEGILYKYGKGEEVRIMCVCHGSFLSPAEFVKHAGGGDVA  337

Query  804  HPLKHIIVSPS  836
            HPL+HI+V+PS
Sbjct  338  HPLRHIVVNPS  348



>ref|XP_009416832.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=338

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 2/82 (2%)
 Frame = +3

Query  606  KEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHA  785
            +E   RN +  MPCV+TRGDGP G++IEGFLY+YRKGEEV+IVCVCHG+F +PAEFVKHA
Sbjct  257  REKAGRNMVERMPCVSTRGDGPNGRRIEGFLYKYRKGEEVKIVCVCHGSFFTPAEFVKHA  316

Query  786  GGGDVAHPLKHIIVS--PSCLF  845
            GGG+VAHPL+HI+V   PS   
Sbjct  317  GGGEVAHPLRHIVVDTLPSAFL  338



>dbj|BAB01982.1| unnamed protein product [Arabidopsis thaliana]
Length=261

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 9/99 (9%)
 Frame = +3

Query  528  RELEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRY  707
            + +E  P++   +P      N GK++ +    N + +MP V+T GDGP GKKI GFLYRY
Sbjct  135  KSVETSPSSAQSQPE-----NLGKEASQ----NIIEDMPFVSTTGDGPNGKKINGFLYRY  185

Query  708  RKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHII  824
            RKGEEVRIVCVCHG+FLSPAEFVKHAGGGDVAHPLKHI+
Sbjct  186  RKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIV  224



>ref|XP_002274025.1| PREDICTED: ninja-family protein AFP2 isoform X1 [Vitis vinifera]
Length=360

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N + +MPCV TRGDGP G++IEG LY+Y KGEEVRI+CVCHG+FLSPAEFVKHAGGGDVA
Sbjct  285  NFMGDMPCVFTRGDGPNGRRIEGILYKYGKGEEVRIMCVCHGSFLSPAEFVKHAGGGDVA  344

Query  804  HPLKHIIVSPS  836
            HPL+HI+V+PS
Sbjct  345  HPLRHIVVNPS  355



>ref|XP_007045850.1| RNA binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY01682.1| RNA binding protein, putative isoform 2 [Theobroma cacao]
Length=380

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 85/124 (69%), Gaps = 7/124 (6%)
 Frame = +3

Query  465  SQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMP  644
            +Q LQ  G N EA   S   + E   R +   VE     + N GK+       +A+ +MP
Sbjct  259  TQSLQDQG-NQEATGSSGTKTSET-CRTSRLEVETLCKAAENRGKERG-----DAMEDMP  311

Query  645  CVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHII  824
            CV T+G+GP GK++EG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDV HPL+HI+
Sbjct  312  CVFTKGEGPNGKRVEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVDHPLRHIV  371

Query  825  VSPS  836
            V+PS
Sbjct  372  VNPS  375



>ref|XP_011009405.1| PREDICTED: ninja-family protein AFP3-like [Populus euphratica]
Length=367

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 86/131 (66%), Gaps = 16/131 (12%)
 Frame = +3

Query  489  KNVEARSPSSVHS-RELEQR---------------PAATLVEPAVNNSGNSGKDSKEVVV  620
            K VE+RSP SV S  E EQ+               PA   +E   +N     ++  +  V
Sbjct  233  KCVESRSPVSVQSLSECEQKSIIALRLALAEKIGVPAGVAMEKNGSNKLIVAENGTKEAV  292

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            RN L +MP V+T+GDGP  K+IEGFLY+YRKGEEVRIVC+CHG+FLS AEFVKHAG GDV
Sbjct  293  RNVLEDMPYVSTKGDGPNRKRIEGFLYQYRKGEEVRIVCICHGSFLSAAEFVKHAGDGDV  352

Query  801  AHPLKHIIVSP  833
              PLKHI+V+P
Sbjct  353  EQPLKHIVVNP  363



>ref|XP_007045849.1| ABI five binding protein 2, putative isoform 1 [Theobroma cacao]
 gb|EOY01681.1| ABI five binding protein 2, putative isoform 1 [Theobroma cacao]
Length=420

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 85/124 (69%), Gaps = 7/124 (6%)
 Frame = +3

Query  465  SQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMP  644
            +Q LQ  G N EA   S   + E   R +   VE     + N GK+       +A+ +MP
Sbjct  299  TQSLQDQG-NQEATGSSGTKTSET-CRTSRLEVETLCKAAENRGKERG-----DAMEDMP  351

Query  645  CVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHII  824
            CV T+G+GP GK++EG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDV HPL+HI+
Sbjct  352  CVFTKGEGPNGKRVEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVDHPLRHIV  411

Query  825  VSPS  836
            V+PS
Sbjct  412  VNPS  415



>gb|KHN31942.1| Ninja-family protein AFP2 [Glycine soja]
Length=381

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N++ +MPCV T+GDGP G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVA
Sbjct  307  NSMEDMPCVFTKGDGPNGRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVA  366

Query  804  HPLKHIIVSPSC  839
            +PL+HI+V+PS 
Sbjct  367  YPLRHIVVNPSA  378



>ref|XP_010906161.1| PREDICTED: ninja-family protein AFP3-like isoform X1 [Elaeis 
guineensis]
Length=367

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  642  PCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHI  821
            PCV+T GDGP G++IEGFLYRYRKGEEVRIVCVCHG+FL+PAEFV+HAGGGDVAHPL+HI
Sbjct  298  PCVSTTGDGPNGRRIEGFLYRYRKGEEVRIVCVCHGSFLTPAEFVRHAGGGDVAHPLRHI  357

Query  822  IVSPS  836
            +V+P+
Sbjct  358  VVNPT  362



>ref|XP_003516385.1| PREDICTED: ninja-family protein AFP2-like [Glycine max]
Length=407

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N++ +MPCV T+GDGP G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVA
Sbjct  333  NSMEDMPCVFTKGDGPNGRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVA  392

Query  804  HPLKHIIVSPSC  839
            +PL+HI+V+PS 
Sbjct  393  YPLRHIVVNPSA  404



>ref|XP_002306022.2| hypothetical protein POPTR_0004s11980g, partial [Populus trichocarpa]
 gb|EEE86533.2| hypothetical protein POPTR_0004s11980g, partial [Populus trichocarpa]
Length=390

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 156/284 (55%), Gaps = 37/284 (13%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRC--SSISS-----FALNGGARAF---SPYAPPLSRTCSLPaeaaet  221
            +FGVDP +A+K+ R   SSI++        NG   +F   +  +  LSRTCSLP E  E 
Sbjct  110  RFGVDP-KAKKITRSRPSSIATDFVNPLRENGNGSSFVVPNMESNNLSRTCSLPTETEEE  168

Query  222  eewrrrkeaQSQkrmeakrkrmeklkNVRVVREKLDKEDPPHSEENG-------------  362
               R+  +   +   + KR   +   N + V++K ++ +     ENG             
Sbjct  169  WRKRKEMQTLRRMEAKRKRSEKQ---NFKAVKDK-NRGEEDDQRENGTTGNHHQKEFLKS  224

Query  363  -NGLIPVLSNGNALPssqg----ssvsqgsgssgisDFDSQPLQVCGKNVEARSPSSVHS  527
             NGL  V   G    +          SQG+ SSGI++F+SQP++ C +     +P    +
Sbjct  225  FNGLFGVAIEGLLKQAEVAPPPLLLTSQGTASSGITEFESQPVKECERK-SIIAPRLALA  283

Query  528  RELEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRY  707
             +L   PA   +E   +N     ++  +  VRN L + PCV+T+GDGP GK+IEGFLY+Y
Sbjct  284  EKL-GFPAGVAMEKNRSNKLIVAENGTKEAVRNVLEDTPCVSTKGDGPNGKRIEGFLYQY  342

Query  708  RKGEEVRIVCVCHGNFLSPAEFVKHA--GGGDVAHPLKHIIVSP  833
            RKGEE+RIVCVCHG+FLS AEFVKHA  G GDV  PLKHI+V+P
Sbjct  343  RKGEELRIVCVCHGSFLSAAEFVKHAGDGDGDVEQPLKHIVVNP  386



>ref|XP_010906162.1| PREDICTED: ninja-family protein AFP3-like isoform X2 [Elaeis 
guineensis]
Length=366

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  642  PCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHI  821
            PCV+T GDGP G++IEGFLYRYRKGEEVRIVCVCHG+FL+PAEFV+HAGGGDVAHPL+HI
Sbjct  297  PCVSTTGDGPNGRRIEGFLYRYRKGEEVRIVCVCHGSFLTPAEFVRHAGGGDVAHPLRHI  356

Query  822  IVSPS  836
            +V+P+
Sbjct  357  VVNPT  361



>gb|KEH27866.1| ninja-family protein AFP1 [Medicago truncatula]
Length=570

 Score =   130 bits (327),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N++ +MPCV T+GDGP G++IEG LY+Y KGEEVRI+CVCHGNFLSPAEFVKHAGGGDVA
Sbjct  322  NSVEDMPCVFTKGDGPNGRRIEGILYKYGKGEEVRIMCVCHGNFLSPAEFVKHAGGGDVA  381

Query  804  HPLKHIIVSPSCLF  845
            HPL+HI+V+PS   
Sbjct  382  HPLRHIVVNPSATL  395



>gb|KCW64879.1| hypothetical protein EUGRSUZ_G02444 [Eucalyptus grandis]
Length=392

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 68/85 (80%), Gaps = 4/85 (5%)
 Frame = +3

Query  576  NNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNF  755
            N+  N GKD     V NA  +MP V TRGDGP+GK+IEG LY+Y KGEEVRIVCVCHGNF
Sbjct  306  NSVDNGGKD----FVTNATVDMPWVFTRGDGPDGKRIEGILYKYGKGEEVRIVCVCHGNF  361

Query  756  LSPAEFVKHAGGGDVAHPLKHIIVS  830
            LSPAEFVKHAGGGDVA+P KHI +S
Sbjct  362  LSPAEFVKHAGGGDVANPRKHIFIS  386



>emb|CDP00441.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 4/84 (5%)
 Frame = +3

Query  588  NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPA  767
            N GK+    +  NAL +MPCV T+GDGP G++++G LY+Y KGEEVRI+CVCHGNFLSPA
Sbjct  294  NQGKE----IGMNALEDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCVCHGNFLSPA  349

Query  768  EFVKHAGGGDVAHPLKHIIVSPSC  839
            EFVKHAGG DV HPLKHI+V+P+ 
Sbjct  350  EFVKHAGGSDVTHPLKHIVVNPNA  373



>ref|XP_011011869.1| PREDICTED: ninja-family protein AFP2-like [Populus euphratica]
Length=354

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 93/148 (63%), Gaps = 28/148 (19%)
 Frame = +3

Query  459  FDSQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEPAVNNSG-----------------  587
             +S+P+Q      EARSP+S  S  L++R +    + AV +SG                 
Sbjct  208  MESKPVQGSSSGGEARSPASNQS--LQERSS----QEAVGSSGTKKIENTCRASRTETEN  261

Query  588  -----NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGN  752
                 +S ++    +  NA+ +MPCV T+GDGP G++++G LY+Y KGEEVRI+CVCHG+
Sbjct  262  LSKRLDSAENRGREIGNNAMEDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCVCHGS  321

Query  753  FLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            F SPAEFVKHAGG DV HPL+HI+V+PS
Sbjct  322  FHSPAEFVKHAGGSDVDHPLRHIVVNPS  349



>ref|XP_008361875.1| PREDICTED: ninja-family protein AFP1-like [Malus domestica]
Length=534

 Score =   129 bits (324),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  588  NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPA  767
            +S ++S+    RNA+ +MPCV T GDGP G+K+EG LYRY KG+EVRI+CVCHG+FLSPA
Sbjct  449  SSQENSERETRRNAMEDMPCVFTIGDGPNGRKVEGILYRYGKGQEVRIMCVCHGSFLSPA  508

Query  768  EFVKHAGGGDVAHPLKHIIVSPS  836
            EFVKHAGG DVAHPL+HI+V+P+
Sbjct  509  EFVKHAGGSDVAHPLRHIVVNPA  531



>ref|XP_009397240.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=281

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 73/100 (73%), Gaps = 4/100 (4%)
 Frame = +3

Query  534  LEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRK  713
            +E+      V     N+G    D+KEV  R+    MPCV+  GDGP G +IEGFLY+YRK
Sbjct  180  IEESKPTKAVNATAMNAGRVMGDTKEVE-RDM---MPCVSATGDGPNGTRIEGFLYKYRK  235

Query  714  GEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  833
            GE+VRIVCVCHG F +PAEFVKHAGGGDVAHPL+HI+V+P
Sbjct  236  GEDVRIVCVCHGRFFTPAEFVKHAGGGDVAHPLRHIVVNP  275



>ref|XP_002512070.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF50739.1| RNA binding protein, putative [Ricinus communis]
Length=355

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 152/289 (53%), Gaps = 39/289 (13%)
 Frame = +3

Query  72   KFGVDPNRAQKLKRCSSIS-SFALNGGARAFSPY----APPLSRTCSLPaeaaeteewrr  236
            +FGVD   ++KL R SSI+ S  L     AF+       P L RT SLP E  E    R+
Sbjct  68   RFGVDKT-SKKLTRSSSIAGSIPLVRDHDAFNTQPAVSYPLLIRTSSLPTETEEEWRKRK  126

Query  237  rkeaQSQkrmeakrkrmeklkNVRVVREKLDKEDPPH--SEENGNGLIPVLSN----GNA  398
                Q+ +RMEAKR+R EK KN+ + R +L  ED     +   GN + P  S     GN 
Sbjct  127  EM--QTLRRMEAKRRRSEKQKNLNLNRGELSLEDERKGLNANRGNWVAPTWSRNVNRGNT  184

Query  399  LPssqgssvsqgsgssgis-------DFDSQPLQVCGKNVEARSPSSVHSRELEQR----  545
            L    G                    + +S+P+Q      EARSP+S  S  L+ R    
Sbjct  185  LQGLIGQQQGSQGSVESQGGSSSGISEMESKPVQGTSSGGEARSPASNQS--LQDRINQE  242

Query  546  ---PAATLVEPAVNNSGNSGKDSKEV---------VVRNALFNMPCVTTRGDGPEGKKIE  689
                + +     +N + +    S+++         +  N + +MPCV T GDGP G+K+E
Sbjct  243  AVGSSRSKTNENINRTSSMENPSRKLESAEIRGREIGMNPMEDMPCVFTIGDGPNGRKVE  302

Query  690  GFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            G LY+Y KGEEVRI+CVCHG+FLSPAEFVKHAGG DV HPL+HI+V+ S
Sbjct  303  GILYKYGKGEEVRIMCVCHGSFLSPAEFVKHAGGRDVDHPLRHIVVNTS  351



>ref|XP_009623485.1| PREDICTED: ninja-family protein AFP2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=348

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N L +MPCV T+GDGP G++I+G LY+Y KGEE+RI+CVCHG+FLSPAEFVKHAGG DVA
Sbjct  273  NTLGDMPCVFTKGDGPNGRRIDGILYKYGKGEEIRIMCVCHGSFLSPAEFVKHAGGSDVA  332

Query  804  HPLKHIIVSP  833
            HPLKHI++ P
Sbjct  333  HPLKHIVIKP  342



>ref|XP_006348683.1| PREDICTED: ninja-family protein AFP3-like [Solanum tuberosum]
Length=444

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 8/93 (9%)
 Frame = +3

Query  561  VEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCV  740
            +E A N +  +G         N L NMPCV T+GDGP GK+++G LYRY KGEEVRI+CV
Sbjct  356  LEAATNRAKETGT--------NTLENMPCVFTKGDGPNGKRVDGILYRYNKGEEVRIMCV  407

Query  741  CHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSC  839
            CHG+F SPAEFVKHAGG DVAHPLKHI+++P+ 
Sbjct  408  CHGSFHSPAEFVKHAGGTDVAHPLKHIVINPNA  440



>ref|XP_009623484.1| PREDICTED: ninja-family protein AFP1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=364

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N L +MPCV T+GDGP G++I+G LY+Y KGEE+RI+CVCHG+FLSPAEFVKHAGG DVA
Sbjct  289  NTLGDMPCVFTKGDGPNGRRIDGILYKYGKGEEIRIMCVCHGSFLSPAEFVKHAGGSDVA  348

Query  804  HPLKHIIVSP  833
            HPLKHI++ P
Sbjct  349  HPLKHIVIKP  358



>ref|XP_010320856.1| PREDICTED: ninja-family protein AFP3 [Solanum lycopersicum]
Length=449

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N L NMPCV T+GDGP GK+++G LYRY KGEEVRI+CVCHG+F SPAEFVKHAGG DVA
Sbjct  374  NTLENMPCVFTKGDGPNGKRVDGILYRYSKGEEVRIMCVCHGSFHSPAEFVKHAGGTDVA  433

Query  804  HPLKHIIVSPSC  839
            HPLKHI+++P+ 
Sbjct  434  HPLKHIVINPNA  445



>dbj|BAJ90997.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            ++ + +MP V+++ DGP GKKI+GFLY+YRKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV
Sbjct  238  KSMMEDMPMVSSKVDGPNGKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDV  297

Query  801  AHPLKHIIVSPS  836
             +PL+HI+V+PS
Sbjct  298  TNPLRHIVVNPS  309



>ref|XP_009760153.1| PREDICTED: ninja-family protein AFP1-like isoform X1 [Nicotiana 
sylvestris]
Length=393

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            NAL +MPCV T+GDGP G++I+G LY+Y KGE++RI+CVCHG+FLSPAEFVKHAGG DVA
Sbjct  318  NALGDMPCVFTKGDGPSGRRIDGILYKYGKGEDIRIMCVCHGSFLSPAEFVKHAGGSDVA  377

Query  804  HPLKHIIVSP  833
            HPLKHI++ P
Sbjct  378  HPLKHIVIKP  387



>ref|XP_003562743.1| PREDICTED: ninja-family protein 1-like [Brachypodium distachyon]
Length=335

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            ++ + +MP V+++ DGP GKKI+GFLY+YRKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV
Sbjct  259  KSMMEDMPMVSSKVDGPNGKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDV  318

Query  801  AHPLKHIIVSPS  836
             +PL+HI+V+PS
Sbjct  319  TNPLRHIVVNPS  330



>ref|XP_009760154.1| PREDICTED: ninja-family protein AFP1-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            NAL +MPCV T+GDGP G++I+G LY+Y KGE++RI+CVCHG+FLSPAEFVKHAGG DVA
Sbjct  302  NALGDMPCVFTKGDGPSGRRIDGILYKYGKGEDIRIMCVCHGSFLSPAEFVKHAGGSDVA  361

Query  804  HPLKHIIVSP  833
            HPLKHI++ P
Sbjct  362  HPLKHIVIKP  371



>sp|B1B5D3.1|NNJA1_WHEAT RecName: Full=Ninja-family protein 1; AltName: Full=ABI five-binding 
protein A1; Short=ABI5-binding protein A1; Short=TaAFP-A1 
[Triticum aestivum]
 dbj|BAG12827.1| ABI5 binding protein A1 [Triticum aestivum]
Length=315

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            ++ + +MP V+++ DGP GKKI+GFLY+YRKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV
Sbjct  239  KSMMEDMPMVSSKVDGPNGKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDV  298

Query  801  AHPLKHIIVSPS  836
             +PL+HI+V+PS
Sbjct  299  TNPLRHIVVNPS  310



>gb|EYU34604.1| hypothetical protein MIMGU_mgv1a010027mg [Erythranthe guttata]
Length=324

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +V+NAL +MP V+TRG  P   KIEGFLYRY+KGEEV+IVCVCHG FLSPAEFVKH GGG
Sbjct  248  LVKNALLDMPYVSTRGFAPHFNKIEGFLYRYKKGEEVKIVCVCHGLFLSPAEFVKHGGGG  307

Query  795  DVAHPLKHIIVSPSCLF  845
            DVA PLKHI+V+P  LF
Sbjct  308  DVAQPLKHIVVNPFPLF  324



>ref|XP_004237223.1| PREDICTED: ninja-family protein AFP3 isoform X1 [Solanum lycopersicum]
Length=384

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = +3

Query  507  SPSSVHS--RELEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGK  680
            SPSS+ S  ++L  R     VE + +N+  S     E     AL +MPCV  +GDGP G+
Sbjct  271  SPSSIQSLHKDLGSRTLGGEVETSPSNTTRSRVQESEA---KALGDMPCVFAKGDGPNGR  327

Query  681  KIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSP  833
            +I+G LY+Y KGEE+RI+CVCHG+FLSPAEFVKHAGG D+A+PLKHI++ P
Sbjct  328  RIDGILYKYGKGEEIRIMCVCHGSFLSPAEFVKHAGGSDIANPLKHIVIKP  378



>sp|B1B5D4.1|NNJA2_WHEAT RecName: Full=Ninja-family protein 2; AltName: Full=ABI five-binding 
protein B1; Short=ABI5-binding protein B1; Short=TaAFP-B1 
[Triticum aestivum]
 dbj|BAG12828.1| ABI5 binding protein B1 [Triticum aestivum]
Length=316

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            ++ + +MP V+++ DGP GKKI+GFLY+YRKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV
Sbjct  240  KSMMEDMPMVSSKVDGPNGKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDV  299

Query  801  AHPLKHIIVSPS  836
             +PL+HI+V+P+
Sbjct  300  TNPLRHIVVNPA  311



>ref|XP_006379694.1| hypothetical protein POPTR_0008s09620g [Populus trichocarpa]
 gb|ERP57491.1| hypothetical protein POPTR_0008s09620g [Populus trichocarpa]
Length=357

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 89/141 (63%), Gaps = 18/141 (13%)
 Frame = +3

Query  465  SQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEPAVNNSGNSGK-------------DS  605
            S+P+Q      EARSP+S  S + E+     L       + N+ +             DS
Sbjct  213  SKPVQGSSSGGEARSPTSNQSLQ-ERGSQEDLDSSGTKKNENACRASRTEMENFSKKLDS  271

Query  606  KEVVVR----NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEF  773
             E + R    NA+ +MPCV T+GDGP G++++G LY+Y KGEEVRI+CVCHG+FLSPAEF
Sbjct  272  AENIGREIGTNAMEDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCVCHGSFLSPAEF  331

Query  774  VKHAGGGDVAHPLKHIIVSPS  836
            VKHAGG DV HPL+HI+++ S
Sbjct  332  VKHAGGSDVNHPLRHIVINSS  352



>ref|XP_009592703.1| PREDICTED: ninja-family protein AFP3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=427

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            NAL +MPCV T+GDGP G++++G LY+Y KGEEVRI+CVCHG+F SPAEFVKHAGG DVA
Sbjct  352  NALGDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCVCHGSFYSPAEFVKHAGGTDVA  411

Query  804  HPLKHIIVSPSC  839
            HPLKHI+V+P+ 
Sbjct  412  HPLKHIVVNPNA  423



>gb|AHA43418.1| ninja-family protein AFP1-like protein [Solanum nigrum]
Length=447

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N L NMPCV T+GDGP G++++G LYRY KGEEVRI+CVCHG+F SPAEFVKHAGG DVA
Sbjct  372  NTLENMPCVFTKGDGPNGRRVDGILYRYGKGEEVRIMCVCHGSFHSPAEFVKHAGGTDVA  431

Query  804  HPLKHIIVSPSC  839
            HPLKHI+++P+ 
Sbjct  432  HPLKHIVINPNA  443



>ref|XP_009411123.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=353

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            R  +  MP V+TRGDGP G+++EGFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDV
Sbjct  279  RRIMEEMPFVSTRGDGPNGRRVEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGGDV  338

Query  801  AHPLKHIIVS  830
            A+PL+HI+V+
Sbjct  339  ANPLRHIVVN  348



>sp|B1B5D5.1|NNJA3_WHEAT RecName: Full=Ninja-family protein 3; AltName: Full=ABI five-binding 
protein D1; Short=ABI5-binding protein D1; Short=TaAFP-D1 
[Triticum aestivum]
 dbj|BAG12829.1| ABI5 binding protein D1 [Triticum aestivum]
Length=310

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            ++ + +MP V+++ DGP  KKI+GFLY+YRKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV
Sbjct  234  KSMMEDMPIVSSKVDGPNSKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDV  293

Query  801  AHPLKHIIVSPS  836
             +PL+HI+V+PS
Sbjct  294  TNPLRHIVVNPS  305



>ref|XP_009407390.1| PREDICTED: ninja-family protein AFP3-like [Musa acuminata subsp. 
malaccensis]
Length=320

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 87/139 (63%), Gaps = 14/139 (10%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARS--PSSVHSRELEQRPAATLVEPAVN----------NSGNSGK  599
            D DSQP Q      E RS   ++  S +   +P AT++   V            +   G 
Sbjct  175  DIDSQPNQGLSNISEVRSSLTATALSDQSICKPKATVLGQHVTCVTEVDDRPRKAARGGP  234

Query  600  DSK--EVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEF  773
             +K  E V +  + +MPCV+T GDGP G++IEG LY+Y KGEEV+IVCVCHG+F SPAEF
Sbjct  235  KTKVLEKVGKKMIQDMPCVSTIGDGPNGRRIEGLLYKYGKGEEVKIVCVCHGSFFSPAEF  294

Query  774  VKHAGGGDVAHPLKHIIVS  830
            VKHAG GDVAHPL+HI+VS
Sbjct  295  VKHAGSGDVAHPLRHIVVS  313



>ref|XP_006658776.1| PREDICTED: ninja-family protein Os07g0602900-like [Oryza brachyantha]
Length=298

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            ++ + +MP V++R DGP G+KI+GFLY+YRKGEEVRIVCVCHGNFL+PAEFVKHAGGGDV
Sbjct  222  KSMMEDMPMVSSRVDGPNGRKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDV  281

Query  801  AHPLKHIIVSPS  836
             +PL+HI+V+PS
Sbjct  282  TNPLRHIVVNPS  293



>gb|EYU28869.1| hypothetical protein MIMGU_mgv1a008006mg [Erythranthe guttata]
Length=388

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 88/143 (62%), Gaps = 21/143 (15%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSRE----LEQRPAATLVEPAVNNSGNSGKDS------  605
            D +S+ LQ     V   SP+S+ S +    L+ R + T      + +    KDS      
Sbjct  244  DLESKTLQGSSGEV---SPASIQSMQESANLDTRSSTTNARGNTSKAAGPDKDSSTPKKP  300

Query  606  -------KEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSP  764
                   KE+   N+L  MPCV T+GDGP G+++EG LYRY KGEEVRI+CVCHG+F SP
Sbjct  301  EASRTRGKEIGT-NSLEEMPCVFTKGDGPNGRRVEGILYRYGKGEEVRIMCVCHGSFHSP  359

Query  765  AEFVKHAGGGDVAHPLKHIIVSP  833
            AEFV+HAGG DV +PLKHI+V+P
Sbjct  360  AEFVRHAGGTDVDNPLKHIVVNP  382



>gb|KEH21656.1| ABI five-binding protein [Medicago truncatula]
Length=362

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            +N   +MP VTT+G+GP GKK+EGFLY+Y KGEEVRI+CVCHG+FL+PAEFVKHAGGGDV
Sbjct  289  KNLFEDMPSVTTKGEGPNGKKVEGFLYKYGKGEEVRILCVCHGSFLTPAEFVKHAGGGDV  348

Query  801  AHPLKHIIVSPSCL  842
             +PLKHI+V+ S +
Sbjct  349  TNPLKHIVVNSSLI  362



>ref|XP_011018739.1| PREDICTED: ninja-family protein AFP2-like [Populus euphratica]
Length=354

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 94/144 (65%), Gaps = 24/144 (17%)
 Frame = +3

Query  465  SQPLQVCGKNVEARSPSSVHS-------RELEQ----------RPAATLVE---PAVNNS  584
            S+P+Q      EARSP+S  S        +L+           R ++T +E     ++++
Sbjct  210  SKPVQGSSSGGEARSPTSNQSLPERGSQEDLDSSGTKKNENACRASSTEMENFSKKLDSA  269

Query  585  GNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSP  764
             N G++    +  NA+ +MPCV T+GDGP G++++G LY+Y KGEEVRI+CVCHG+FLSP
Sbjct  270  ENIGRE----IGTNAMEDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCVCHGSFLSP  325

Query  765  AEFVKHAGGGDVAHPLKHIIVSPS  836
            AEFVKHAGG DV HPL+HI+++ S
Sbjct  326  AEFVKHAGGSDVNHPLRHIVINCS  349



>ref|XP_010527971.1| PREDICTED: ninja-family protein AFP2 [Tarenaya hassleriana]
 ref|XP_010527972.1| PREDICTED: ninja-family protein AFP2 [Tarenaya hassleriana]
Length=345

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +3

Query  633  FNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPL  812
              MPCVTT+G+GP G++I+G LY+Y KGEEVRI+CVCHG+FLSPAEFVKHAGGGDV HPL
Sbjct  275  LEMPCVTTKGEGPNGRRIQGILYKYGKGEEVRIMCVCHGSFLSPAEFVKHAGGGDVDHPL  334

Query  813  KHIIVSPSCL  842
            +HI+V+ S  
Sbjct  335  RHIVVNTSTF  344



>ref|XP_010066842.1| PREDICTED: ninja-family protein AFP3-like [Eucalyptus grandis]
Length=70

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MP V TRGDGP+GK+IEG LY+Y KGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA+P KH
Sbjct  1    MPWVFTRGDGPDGKRIEGILYKYGKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVANPRKH  60

Query  819  IIVS  830
            I +S
Sbjct  61   IFIS  64



>gb|KDP41313.1| hypothetical protein JCGZ_15720 [Jatropha curcas]
Length=346

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 90/152 (59%), Gaps = 27/152 (18%)
 Frame = +3

Query  456  DFDSQPLQVCGKNV----------EARSPSSVHSRELEQRPAATLVEPAVNN--SG----  587
            + +S+P+Q    N           EARSP S  S  L+ R     V    N   SG    
Sbjct  192  ELESKPIQAIATNEMLAFGTSSGGEARSPGSNQS--LQDRSNRETVGTKTNENISGISKP  249

Query  588  ---------NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCV  740
                     +S ++    +  NA+ +MPCV T GDGP G++++G LY+Y KGE+VRI+CV
Sbjct  250  EMENPSKKLDSAENKGRQIGTNAVEDMPCVFTVGDGPNGRRVDGILYKYGKGEDVRIMCV  309

Query  741  CHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            CHG+FLSPAEFVKHAGGGDV HPL+HI+V+ S
Sbjct  310  CHGSFLSPAEFVKHAGGGDVDHPLRHIVVNTS  341



>ref|XP_006845867.1| hypothetical protein AMTR_s00154p00057990 [Amborella trichopoda]
 gb|ERN07542.1| hypothetical protein AMTR_s00154p00057990 [Amborella trichopoda]
Length=122

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +3

Query  552  ATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRI  731
            A ++   ++ S + G +++ V+ +     MPCVTT+G+GP GK++EG LY Y KGEEV I
Sbjct  26   ARVLARGLSGSADKGGEAR-VLAKGLSARMPCVTTKGEGPNGKRVEGVLYNYSKGEEVSI  84

Query  732  VCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  827
            VCVCHG FL+PAEFV+HAGGGDV HPL+HI+V
Sbjct  85   VCVCHGTFLTPAEFVRHAGGGDVDHPLRHIVV  116



>sp|Q6YVY6.1|NNJA2_ORYSJ RecName: Full=Ninja-family protein Os07g0602900 [Oryza sativa 
Japonica Group]
 dbj|BAC84471.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD31712.1| hypothetical protein [Oryza sativa Japonica Group]
Length=319

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            ++ + +MP V++R DGP G+KI+GFLY+YRK EEVRIVCVCHGNFL+PAEFVKHAGGGDV
Sbjct  243  KSMMEDMPMVSSRVDGPNGRKIDGFLYKYRKREEVRIVCVCHGNFLTPAEFVKHAGGGDV  302

Query  801  AHPLKHIIVSPS  836
             +PL+HI+V+PS
Sbjct  303  TNPLRHIVVNPS  314



>ref|XP_008446443.1| PREDICTED: ninja-family protein AFP3-like [Cucumis melo]
Length=396

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 88/138 (64%), Gaps = 13/138 (9%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSRELE----------QRPAATLVEPAVNNSG--NSGK  599
            + DS+ +Q      EARS SS     LE          + P+A+      N S   +SG+
Sbjct  254  ELDSKQIQGSSSYGEARS-SSQERGNLEAAGSSGSKMCENPSASSKTETKNQSKKPDSGE  312

Query  600  DSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVK  779
            +        ++ +MPCV T GDGP+G+++EG LY+Y KGEEVRI+CVCHG FLSPAEFVK
Sbjct  313  NKGREAATMSMEDMPCVFTIGDGPDGRRVEGILYKYGKGEEVRIMCVCHGKFLSPAEFVK  372

Query  780  HAGGGDVAHPLKHIIVSP  833
            HAGG +VAHPL+HI+V+P
Sbjct  373  HAGGKNVAHPLRHIVVNP  390



>ref|XP_009396433.1| PREDICTED: ninja-family protein 6-like [Musa acuminata subsp. 
malaccensis]
Length=335

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            R  +  MP V+TRGDGP G++IEGFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGG DV
Sbjct  259  RKMMEKMPFVSTRGDGPNGRRIEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGHDV  318

Query  801  AHPLKHIIVSPS  836
             +PL+HI+V+ S
Sbjct  319  TNPLRHIVVNSS  330



>ref|XP_004135434.1| PREDICTED: ninja-family protein AFP1-like [Cucumis sativus]
 gb|KGN51983.1| hypothetical protein Csa_5G606730 [Cucumis sativus]
Length=396

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 11/137 (8%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSR---------ELEQRPAATLVEPAVNNSG--NSGKD  602
            + DS+ +Q      EARS S              ++ + P+A+      N S   +SG++
Sbjct  254  ELDSKQIQGSSSYGEARSSSQERGNLEAAGSSGSKMCENPSASYKTETKNQSKKPDSGEN  313

Query  603  SKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKH  782
                    ++ +MPCV T GDGP+G+++EG LY+Y KGEEVRI+CVCHG FLSPAEFVKH
Sbjct  314  KGREAGTMSMEDMPCVFTIGDGPDGRRVEGILYKYGKGEEVRIMCVCHGKFLSPAEFVKH  373

Query  783  AGGGDVAHPLKHIIVSP  833
            AGG +VAHPL+HI+V+P
Sbjct  374  AGGKNVAHPLRHIVVNP  390



>ref|XP_011101763.1| PREDICTED: ninja-family protein AFP1-like [Sesamum indicum]
Length=435

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N++ +MPCV T+GDGP G++++G LY+Y KGEEVRI+CVCHGNF SPAEFVKHAGG DV 
Sbjct  360  NSMEDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCVCHGNFHSPAEFVKHAGGTDVD  419

Query  804  HPLKHIIVSP  833
            HPLKHI+V+P
Sbjct  420  HPLKHIVVNP  429



>gb|KHG14342.1| Ninja-family protein AFP3 [Gossypium arboreum]
Length=293

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 84/134 (63%), Gaps = 8/134 (6%)
 Frame = +3

Query  462  DSQPLQVCGKNVEARSPSSVHSRELEQRPAATLVEPAVNNSGNSGK--------DSKEVV  617
            +S+ LQ    + EARS  S  S + +    A         SG+           ++KE  
Sbjct  156  ESKGLQGARNSGEARSSGSASSLQEQGDSEAATGSSGTKTSGSERTLGLIGETVENKEKE  215

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
               A+ +MP V T+G+GP GK+++G LY+Y KGEEVRI+CVCHGNF SPAEFVKHAGGGD
Sbjct  216  GGKAMEDMPHVFTKGEGPNGKRVDGILYKYGKGEEVRIMCVCHGNFFSPAEFVKHAGGGD  275

Query  798  VAHPLKHIIVSPSC  839
            V +PL+HI+++PS 
Sbjct  276  VDNPLRHIVINPSS  289



>ref|XP_009779157.1| PREDICTED: ninja-family protein AFP3-like [Nicotiana sylvestris]
Length=427

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 82/127 (65%), Gaps = 16/127 (13%)
 Frame = +3

Query  507  SPSSVHS----------------RELEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFN  638
            SP+S+HS                RE+  R +   ++ + +    + K   +    N L +
Sbjct  297  SPASIHSLQGGGSQDVGSSGSKMREIVNRLSGGDMDSSPSKRLGAAKSQAKETGANMLGD  356

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP G++++G LY+Y KGEEVRI+CVCHG+F SPAEFVKHAGG DVAHPLKH
Sbjct  357  MPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCVCHGSFHSPAEFVKHAGGTDVAHPLKH  416

Query  819  IIVSPSC  839
            I+V+P+ 
Sbjct  417  IVVNPNA  423



>ref|XP_004165617.1| PREDICTED: ninja-family protein AFP1-like [Cucumis sativus]
Length=396

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 86/137 (63%), Gaps = 11/137 (8%)
 Frame = +3

Query  456  DFDSQPLQVCGKNVEARSPSSVHSR---------ELEQRPAATLVEPAVNNSG--NSGKD  602
            + DS+ +Q      EARS S              ++   P+A+      N S   +SG++
Sbjct  254  ELDSKQIQGSSSYGEARSSSQERGNLEAAGSSGSKMCDNPSASYKTETKNQSKKPDSGEN  313

Query  603  SKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKH  782
                    ++ +MPCV T GDGP+G+++EG LY+Y KGEEVRI+CVCHG FLSPAEFVKH
Sbjct  314  KGREAGTMSMEDMPCVFTIGDGPDGRRVEGILYKYGKGEEVRIMCVCHGKFLSPAEFVKH  373

Query  783  AGGGDVAHPLKHIIVSP  833
            AGG +VAHPL+HI+V+P
Sbjct  374  AGGKNVAHPLRHIVVNP  390



>ref|XP_006417093.1| hypothetical protein EUTSA_v10008099mg [Eutrema salsugineum]
 gb|ESQ35446.1| hypothetical protein EUTSA_v10008099mg [Eutrema salsugineum]
Length=344

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +3

Query  606  KEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHA  785
            K       LF+MPCV T+GDGP G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH 
Sbjct  264  KGTATSTGLFDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHG  323

Query  786  GGGDVAHPLKHIIVSPS  836
            GGGDV  PL+HI+V+ S
Sbjct  324  GGGDVDRPLRHIVVNTS  340



>ref|XP_009394318.1| PREDICTED: ninja-family protein 6-like [Musa acuminata subsp. 
malaccensis]
Length=314

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            R  +  MP V+T+GDGP G++IEGFLY+Y +GEEVRIVCVCHG+FL+PAEFVKHAGGGDV
Sbjct  240  RRMMEKMPFVSTKGDGPNGRRIEGFLYKYGRGEEVRIVCVCHGSFLTPAEFVKHAGGGDV  299

Query  801  AHPLKHIIVSPS  836
            A+PL+HI+V+ S
Sbjct  300  ANPLRHIVVNSS  311



>ref|XP_010495560.1| PREDICTED: ninja-family protein AFP2 [Camelina sativa]
Length=359

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
             LF+MPCV T+GDGP G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  
Sbjct  286  GLFDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDR  345

Query  807  PLKHIIVSPS  836
            PL+HI+V+ S
Sbjct  346  PLRHIVVNTS  355



>ref|XP_010458838.1| PREDICTED: ninja-family protein AFP2-like [Camelina sativa]
Length=364

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
             LF+MPCV T+GDGP G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  
Sbjct  291  GLFDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDR  350

Query  807  PLKHIIVSPS  836
            PL+HI+V+ S
Sbjct  351  PLRHIVVNTS  360



>emb|CDY33807.1| BnaA09g46130D [Brassica napus]
Length=309

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 69/92 (75%), Gaps = 5/92 (5%)
 Frame = +3

Query  576  NNSGNSGKDS-----KEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCV  740
            NNS + G ++     K       LF+MPCV T+GDGP G++++G LY+Y KGEEVRI+C+
Sbjct  214  NNSESHGNENETPKGKGTASSTGLFDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCI  273

Query  741  CHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  274  CHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  305



>ref|XP_006305186.1| hypothetical protein CARUB_v10009552mg [Capsella rubella]
 gb|EOA38084.1| hypothetical protein CARUB_v10009552mg [Capsella rubella]
Length=357

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  606  KEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHA  785
            K +     LF+MPCV T+GDGP G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH 
Sbjct  277  KGMATSTGLFDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHG  336

Query  786  GGGDVAHPLKHIIVSPS  836
            GGGDV  PL+HI+V+ S
Sbjct  337  GGGDVDRPLRHIVVNTS  353



>ref|XP_009117975.1| PREDICTED: ninja-family protein AFP2-like [Brassica rapa]
Length=309

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 69/92 (75%), Gaps = 5/92 (5%)
 Frame = +3

Query  576  NNSGNSGKDS-----KEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCV  740
            NNS + G ++     K       LF+MPCV T+GDGP G++++G LY+Y KGEEVRI+C+
Sbjct  214  NNSESHGNENETPKGKGTASSTGLFDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCI  273

Query  741  CHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            CHG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  274  CHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  305



>ref|XP_010476399.1| PREDICTED: ninja-family protein AFP2-like [Camelina sativa]
Length=361

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
             LF+MPCV T+GDGP G++++G LY+Y KGEEVRI+C+CHG+FL+PAEFVKH GGGDV  
Sbjct  288  GLFDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDR  347

Query  807  PLKHIIVSPS  836
            PL+HI+V+ S
Sbjct  348  PLRHIVVNTS  357



>ref|XP_004489525.1| PREDICTED: ninja-family protein AFP3-like [Cicer arietinum]
Length=360

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 4/81 (5%)
 Frame = +3

Query  588  NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPA  767
            N  KDS    V+N L +MP V+T+G+GP GK+I+GFLY+Y KGEEVRI+CVCHG+FL+PA
Sbjct  280  NKTKDS----VKNLLEDMPSVSTKGEGPNGKRIQGFLYKYGKGEEVRILCVCHGSFLTPA  335

Query  768  EFVKHAGGGDVAHPLKHIIVS  830
            EFVKHAGG DV +PLKHI+VS
Sbjct  336  EFVKHAGGPDVTNPLKHIVVS  356



>ref|XP_011102058.1| PREDICTED: ninja-family protein AFP3-like [Sesamum indicum]
Length=366

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N++ +MPCV T+GDGP G++++G LY+Y KG+EVRI+CVCHGNF SPAEF KHAGG DV 
Sbjct  291  NSMEDMPCVFTKGDGPNGRRVDGILYKYGKGKEVRIMCVCHGNFHSPAEFAKHAGGTDVD  350

Query  804  HPLKHIIVSP  833
            HPLKHI+V+P
Sbjct  351  HPLKHIVVNP  360



>ref|XP_010550299.1| PREDICTED: ninja-family protein AFP1-like, partial [Tarenaya 
hassleriana]
Length=134

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+G+GP G++++G LYRY KG EVRI+CVCHG FLSPAEFVKHAGGGDV HPL+H
Sbjct  64   MPCVFTKGEGPNGRRVDGILYRYGKGSEVRIMCVCHGTFLSPAEFVKHAGGGDVDHPLRH  123

Query  819  IIVSPS  836
            I+V+ +
Sbjct  124  IVVNTA  129



>ref|XP_010680683.1| PREDICTED: ninja-family protein AFP1 [Beta vulgaris subsp. vulgaris]
Length=461

 Score =   120 bits (300),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
             A+ +MPCV T GDGP G+K+EG LY+Y KGE VRI+CVCHGNF SP+EFVKHAGG DV 
Sbjct  387  TAIEDMPCVFTIGDGPNGRKVEGILYKYGKGEGVRIMCVCHGNFFSPSEFVKHAGGKDVE  446

Query  804  HPLKHIIVSPSC  839
            HPL+HI+VSPS 
Sbjct  447  HPLRHIVVSPSA  458



>ref|XP_010228506.1| PREDICTED: ninja-family protein Os03g0419100-like isoform X2 
[Brachypodium distachyon]
Length=301

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEE-VRIVCVCHGNFLSPAEFVKHAGGGD  797
            ++ + +MP V+++ +GP+GKKI+GFLYRYRKG E VRIVCVCHGNFL+PAEFVKHAGGGD
Sbjct  224  KSMMEDMPMVSSKVEGPDGKKIDGFLYRYRKGGEGVRIVCVCHGNFLTPAEFVKHAGGGD  283

Query  798  VAHPLKHIIVSPS  836
            V++PL+HI+V+PS
Sbjct  284  VSNPLRHIVVNPS  296



>gb|EAZ26053.1| hypothetical protein OsJ_09907 [Oryza sativa Japonica Group]
Length=363

 Score =   119 bits (297),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            V R  +  MPCV T+G  P GK++EGFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGG
Sbjct  286  VERIMMQEMPCVCTKGL-PNGKRVEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGG  344

Query  795  DVAHPLKHIIVSP  833
            DVA+PL+HI+V+P
Sbjct  345  DVANPLRHIVVNP  357



>ref|XP_004958230.1| PREDICTED: ninja-family protein 3-like isoform X1 [Setaria italica]
 ref|XP_004958231.1| PREDICTED: ninja-family protein 3-like isoform X2 [Setaria italica]
Length=318

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  618  VRNALF-NMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +RN++  +MP V+ + +GP G+K +GFLY+YRKGEEVRIVCVCHGNFL+PAEFV+HAGGG
Sbjct  240  LRNSMVEDMPMVSYKVEGPSGRKTDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVRHAGGG  299

Query  795  DVAHPLKHIIVSP  833
            DV +PL+HI+V+P
Sbjct  300  DVTNPLRHIVVNP  312



>ref|XP_002890019.1| hypothetical protein ARALYDRAFT_471533 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66278.1| hypothetical protein ARALYDRAFT_471533 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +3

Query  564  EPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVC  743
            E  V    +  +  K +     L +MPCV T+GDGP G++++G LY+Y KGEEVRI+C+C
Sbjct  234  EKGVRKEDSVDRKGKGMATSTGLVDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCIC  293

Query  744  HGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            HG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  294  HGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  324



>gb|EAY89035.1| hypothetical protein OsI_10519 [Oryza sativa Indica Group]
Length=401

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            V R  +  MPCV T+G  P GK++EGFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGG
Sbjct  324  VERIMMQEMPCVCTKGL-PNGKRVEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGG  382

Query  795  DVAHPLKHIIVSP  833
            DVA+PL+HI+V+P
Sbjct  383  DVANPLRHIVVNP  395



>ref|XP_010044396.1| PREDICTED: ninja-family protein AFP3-like [Eucalyptus grandis]
 gb|KCW86483.1| hypothetical protein EUGRSUZ_B03147 [Eucalyptus grandis]
Length=306

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 82/125 (66%), Gaps = 15/125 (12%)
 Frame = +3

Query  465  SQPLQ--VCGKNVEARSPSSVHSRELEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFN  638
            SQ LQ  V    V +    SV      QRP         ++S + GK+    +  + + +
Sbjct  188  SQTLQRRVSQDTVSSSGGVSVEQMTSTQRP---------DSSESRGKE----ISASTMED  234

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+G+GP G++++G LY+Y KGEEVRI+CVCHGNF SPAEFV+HAGGG+VAHPL+ 
Sbjct  235  MPCVFTKGEGPNGRRVDGILYKYGKGEEVRIMCVCHGNFHSPAEFVRHAGGGEVAHPLRQ  294

Query  819  IIVSP  833
            I+++P
Sbjct  295  IVINP  299



>ref|NP_001173313.1| Os03g0214200 [Oryza sativa Japonica Group]
 sp|Q10Q07.1|NNJA1_ORYSJ RecName: Full=Ninja-family protein Os03g0214200 [Oryza sativa 
Japonica Group]
 gb|ABF94628.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG94685.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH92041.1| Os03g0214200 [Oryza sativa Japonica Group]
Length=401

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            V R  +  MPCV T+G  P GK++EGFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGG
Sbjct  324  VERIMMQEMPCVCTKGL-PNGKRVEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGG  382

Query  795  DVAHPLKHIIVSP  833
            DVA+PL+HI+V+P
Sbjct  383  DVANPLRHIVVNP  395



>gb|AAL07175.1| unknown protein [Arabidopsis thaliana]
Length=348

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +3

Query  564  EPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVC  743
            E  V +  +  +  K +     L +MPCV T+GDGP G++++G LY+Y KGEEVRI+C+C
Sbjct  254  EKRVRSEDSVDRKGKGMATSTGLVDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCIC  313

Query  744  HGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            HG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  314  HGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  344



>ref|NP_563933.1| ABI five binding protein 2 [Arabidopsis thaliana]
 sp|Q9LMX5.1|AFP2_ARATH RecName: Full=Ninja-family protein AFP2; AltName: Full=ABI five-binding 
protein 2; Short=ABI5-binding protein 2 [Arabidopsis 
thaliana]
 gb|AAF81300.1|AC027656_17 Strong similarity to a hypothetical protein F23O10.16 gi|7705096 
from Arabidopsis thaliana BAC F23O10 gb|AC018364 [Arabidopsis 
thaliana]
 gb|ABD85158.1| At1g13740 [Arabidopsis thaliana]
 gb|AEE29062.1| ABI five binding protein 2 [Arabidopsis thaliana]
Length=348

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +3

Query  564  EPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVC  743
            E  V +  +  +  K +     L +MPCV T+GDGP G++++G LY+Y KGEEVRI+C+C
Sbjct  254  EKRVRSEDSVDRKGKGMATSTGLVDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCIC  313

Query  744  HGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            HG+FL+PAEFVKH GGGDV  PL+HI+V+ S
Sbjct  314  HGSFLTPAEFVKHGGGGDVDRPLRHIVVNTS  344



>ref|XP_008656995.1| PREDICTED: ninja-family protein 6-like [Zea mays]
 tpg|DAA45816.1| TPA: putative DUF1675 domain containing family protein [Zea mays]
Length=291

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 84/134 (63%), Gaps = 18/134 (13%)
 Frame = +3

Query  489  KNVEARSPSSVHSRELEQR----PAATLVEPAVNNSGN-------------SGKDSKEVV  617
            ++ +ARSPSS       Q     P     E  +N +               + + S    
Sbjct  155  QSTDARSPSSTSDNNTNQNNMLPPTTKAAEKPLNGTATEQPQPRLRTLGSLTTRTSSTGD  214

Query  618  VRNALF-NMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +R  +  +MP V+++ +GP  ++I+GFLYRY+KGE+VRIVCVCHG+FL+PAEFVKHAGGG
Sbjct  215  IRKLMMEDMPMVSSKVEGPNARRIDGFLYRYKKGEDVRIVCVCHGSFLTPAEFVKHAGGG  274

Query  795  DVAHPLKHIIVSPS  836
            DV++PL+HI+V+P+
Sbjct  275  DVSNPLRHIVVNPA  288



>ref|XP_010228505.1| PREDICTED: ninja-family protein Os03g0419100-like isoform X1 
[Brachypodium distachyon]
Length=325

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = +3

Query  621  RNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEE-VRIVCVCHGNFLSPAEFVKHAGGGD  797
            ++ + +MP V+++ +GP+GKKI+GFLYRYRKG E VRIVCVCHGNFL+PAEFVKHAGGGD
Sbjct  224  KSMMEDMPMVSSKVEGPDGKKIDGFLYRYRKGGEGVRIVCVCHGNFLTPAEFVKHAGGGD  283

Query  798  VAHPLKHIIVSPS  836
            V++PL+HI+V+PS
Sbjct  284  VSNPLRHIVVNPS  296



>ref|XP_006649630.1| PREDICTED: ninja-family protein Os03g0214200-like [Oryza brachyantha]
Length=401

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 62/68 (91%), Gaps = 1/68 (1%)
 Frame = +3

Query  630  LFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHP  809
            +  MPCV T+G  P GK++EGFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDVA+P
Sbjct  329  MQEMPCVCTKGL-PNGKRVEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGGDVANP  387

Query  810  LKHIIVSP  833
            L+HI+V+P
Sbjct  388  LRHIVVNP  395



>ref|XP_004231669.2| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=264

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 79/129 (61%), Gaps = 11/129 (9%)
 Frame = +3

Query  471  PLQVCGKNVEARSPSSVH----SRELEQRPAATLVEPAVNNSGN---SGKDSKEVVVRNA  629
            P Q+ G  +E  S SS      S  LEQ     L      N  +   SGK+     +RN 
Sbjct  140  PNQIDGTFIEGASGSSNEIPPVSGTLEQMQHLVLAAIEATNEQSLDFSGKEG----IRNF  195

Query  630  LFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHP  809
            L  MP  +T+GDGP GKK EGFLY Y++G EV+IVC+CHG FL+PAEF+KHAGGGDV +P
Sbjct  196  LIKMPGASTKGDGPNGKKTEGFLYAYKRGGEVKIVCICHGYFLTPAEFIKHAGGGDVENP  255

Query  810  LKHIIVSPS  836
            L+ I V P+
Sbjct  256  LRLIKVDPN  264



>ref|XP_002467685.1| hypothetical protein SORBIDRAFT_01g032370 [Sorghum bicolor]
 gb|EER94683.1| hypothetical protein SORBIDRAFT_01g032370 [Sorghum bicolor]
Length=187

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +3

Query  630  LFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHP  809
            + +MP V+++ +GP  ++I+GFLYRY+KGE+VRIVCVCHG+FL+PAEFVKHAGGGDV++P
Sbjct  116  MEDMPMVSSKVEGPNTRRIDGFLYRYKKGEDVRIVCVCHGSFLTPAEFVKHAGGGDVSNP  175

Query  810  LKHIIVSPS  836
            L+HI+V+P+
Sbjct  176  LRHIVVNPA  184



>emb|CDY36406.1| BnaC05g10070D [Brassica napus]
Length=292

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = +3

Query  588  NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRK-GEEVRIVCVCHGNFLSP  764
            + GK    V     LF+MPCV T+GDGP G++++G LY+Y K GEEVRI+C+CHG+FL+P
Sbjct  205  DDGKGKGRVPTSTGLFDMPCVFTKGDGPNGRRVDGILYKYGKVGEEVRIMCICHGSFLTP  264

Query  765  AEFVKHAGGGDVAHPLKHIIVSPS  836
            AEFVKH GGGDV  PL+HI+V+ S
Sbjct  265  AEFVKHGGGGDVDRPLRHIVVNTS  288



>ref|XP_009148664.1| PREDICTED: ninja-family protein AFP2 [Brassica rapa]
 ref|XP_009148665.1| PREDICTED: ninja-family protein AFP2 [Brassica rapa]
Length=316

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +3

Query  594  GKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRK-GEEVRIVCVCHGNFLSPAE  770
            GK    V     LF+MPCV T+GDGP G++++G LY+Y K GEEVRI+C+CHG+FL+PAE
Sbjct  231  GKGKGTVPTSTGLFDMPCVFTKGDGPNGRRVDGILYKYGKVGEEVRIMCICHGSFLTPAE  290

Query  771  FVKHAGGGDVAHPLKHIIVSPS  836
            FVKH GGGDV  PL+HI+V+ S
Sbjct  291  FVKHGGGGDVDRPLRHIVVNTS  312



>emb|CDY16104.1| BnaC08g40190D [Brassica napus]
Length=309

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  588  NSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPA  767
            N     K       LF+MPCV T+G GP G++++G LY+Y KGEEVRI+C+CHG+FL+PA
Sbjct  223  NENAKGKGTASSTGLFDMPCVFTKGHGPNGRRVDGILYKYGKGEEVRIMCICHGSFLTPA  282

Query  768  EFVKHAGGGDVAHPLKHIIVSPS  836
            EFVKH GGGDV  PL+HI+V+ S
Sbjct  283  EFVKHGGGGDVDRPLRHIVVNTS  305



>ref|XP_004984009.1| PREDICTED: ninja-family protein 6-like [Setaria italica]
Length=315

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +3

Query  630  LFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHP  809
            + +MP V+++ +GP  ++I+GFLYRY+KGE+VRIVCVCHG+FL+PAEFVKHAGGGDV++P
Sbjct  244  MEDMPMVSSKVEGPNARRIDGFLYRYKKGEDVRIVCVCHGSFLTPAEFVKHAGGGDVSNP  303

Query  810  LKHIIVSPS  836
            L+HI+V+PS
Sbjct  304  LRHIVVNPS  312



>ref|XP_010315690.1| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=241

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +3

Query  558  LVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVC  737
            +VEP    +  S   S +  ++N L  MP V+T+GDGP GKKIEGF Y Y++G EV+IVC
Sbjct  149  IVEPIEATNEQSPHLSGKEALKNFLLKMPGVSTQGDGPNGKKIEGFFYAYKRGGEVKIVC  208

Query  738  VCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            +CHG+FL+PA+FVKHAGGGDV +PL+ I V P+
Sbjct  209  ICHGHFLTPAQFVKHAGGGDVENPLRLINVDPN  241



>emb|CDX98125.1| BnaA06g08760D [Brassica napus]
Length=319

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +3

Query  594  GKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRK-GEEVRIVCVCHGNFLSPAE  770
            GK    V     LF+MPCV T+GDGP G++++G LY+Y K GEEVRI+C+CHG+FL+PAE
Sbjct  234  GKGKGTVPTSTGLFDMPCVFTKGDGPNGRRVDGILYKYGKVGEEVRIMCICHGSFLTPAE  293

Query  771  FVKHAGGGDVAHPLKHIIVSPS  836
            FVKH GGGDV  PL+HI+V+ S
Sbjct  294  FVKHGGGGDVDRPLRHIVVNTS  315



>ref|XP_004231691.1| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=254

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 78/129 (60%), Gaps = 11/129 (9%)
 Frame = +3

Query  471  PLQVCGKNVEARSPSSVH----SRELEQRPAATLVEPAVNNSGN---SGKDSKEVVVRNA  629
            P QV G  +E  S SS      S  LEQ     L      N  +   SGK+      RN 
Sbjct  130  PNQVDGTFIEGASGSSNAIPPVSGTLEQMQHLVLAAIEATNEQSPDFSGKEGP----RNF  185

Query  630  LFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHP  809
            L  MP V T+GDGP GKK EGFLY Y++G +V+IVC+CHG FL+PAEFVKHAGGGDV +P
Sbjct  186  LLKMPGVATKGDGPNGKKTEGFLYAYKRGGDVKIVCICHGYFLTPAEFVKHAGGGDVENP  245

Query  810  LKHIIVSPS  836
            L+ I V P+
Sbjct  246  LRLITVDPN  254



>ref|XP_011070935.1| PREDICTED: ninja-family protein AFP2-like [Sesamum indicum]
Length=327

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 3/76 (4%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N++ +MPCV T GDGP G++++G LYRY K EEVRI+C+CHG+F SPAEF+KHAGG DV 
Sbjct  252  NSMDDMPCVFTVGDGPNGRRVDGILYRYGKREEVRIMCICHGSFHSPAEFIKHAGGTDVD  311

Query  804  HPLKHIIV---SPSCL  842
            HPLKHI++   SPS L
Sbjct  312  HPLKHIVINRNSPSLL  327



>ref|NP_001150339.1| ninja-family protein 6 [Zea mays]
 sp|B6TNQ7.1|NNJA6_MAIZE RecName: Full=Ninja-family protein 6 [Zea mays]
 gb|ACG38740.1| RNA-binding protein [Zea mays]
 gb|AFW88124.1| putative DUF1675 domain containing family protein [Zea mays]
Length=288

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 76/100 (76%), Gaps = 5/100 (5%)
 Frame = +3

Query  537  EQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKG  716
            EQ+P    +      +G S  D +++++ +    MP V+++ +GP  ++I+GFLYRY+KG
Sbjct  191  EQQPRLRTLGSLTTRTG-STSDIRKLMMED----MPMVSSKVEGPNARRIDGFLYRYKKG  245

Query  717  EEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            E+VRIVCVCHG+FL+PAEFVKHAGGGDV +PL+HI+V+P+
Sbjct  246  EDVRIVCVCHGSFLTPAEFVKHAGGGDVPNPLRHIVVNPA  285



>gb|EAY90484.1| hypothetical protein OsI_12072 [Oryza sativa Indica Group]
Length=307

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  630  LFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHP  809
            + +MP V+++ +GP G+KI+GFLY+YRKGE+V I+CVCHG F SPAEFVKHAGGGDV++P
Sbjct  234  MMDMPMVSSKVEGPNGRKIDGFLYKYRKGEDVSIMCVCHGKFHSPAEFVKHAGGGDVSNP  293

Query  810  LKHIIVSPS  836
            L+HI+V+PS
Sbjct  294  LRHIVVNPS  302



>ref|NP_001050378.1| Os03g0419100 [Oryza sativa Japonica Group]
 sp|Q10JI3.1|NNJA3_ORYSJ RecName: Full=Ninja-family protein Os03g0419100 [Oryza sativa 
Japonica Group]
 gb|ABF96648.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12292.1| Os03g0419100 [Oryza sativa Japonica Group]
 dbj|BAG93477.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99827.1| unnamed protein product [Oryza sativa Japonica Group]
Length=307

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  630  LFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHP  809
            + +MP V+++ +GP G+KI+GFLY+YRKGE+V I+CVCHG F SPAEFVKHAGGGDV++P
Sbjct  234  MMDMPMVSSKVEGPNGRKIDGFLYKYRKGEDVSIMCVCHGKFHSPAEFVKHAGGGDVSNP  293

Query  810  LKHIIVSPS  836
            L+HI+V+PS
Sbjct  294  LRHIVVNPS  302



>ref|XP_006302500.1| hypothetical protein CARUB_v10020599mg [Capsella rubella]
 gb|EOA35398.1| hypothetical protein CARUB_v10020599mg [Capsella rubella]
Length=341

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%), Gaps = 3/72 (4%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG +V HPL+H
Sbjct  270  MPCVFTKGDGPNGKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPNVEHPLRH  329

Query  819  IIV---SPSCLF  845
            I+V   SPS L 
Sbjct  330  IVVNTSSPSNLL  341



>gb|EAZ27349.1| hypothetical protein OsJ_11293 [Oryza sativa Japonica Group]
Length=307

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  630  LFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHP  809
            + +MP V+++ +GP G+KI+GFLY+YRKGE+V I+CVCHG F SPAEFVKHAGGGDV++P
Sbjct  234  MMDMPMVSSKVEGPNGRKIDGFLYKYRKGEDVSIMCVCHGKFHSPAEFVKHAGGGDVSNP  293

Query  810  LKHIIVSPS  836
            L+HI+V+PS
Sbjct  294  LRHIVVNPS  302



>ref|XP_009105006.1| PREDICTED: ninja-family protein AFP1-like [Brassica rapa]
 ref|XP_009105007.1| PREDICTED: ninja-family protein AFP1-like [Brassica rapa]
Length=346

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+H
Sbjct  275  MPCVFTKGDGPNGKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRH  334

Query  819  IIV---SPSCLF  845
            I+V   SPS L 
Sbjct  335  IVVNTSSPSNLL  346



>emb|CDY07354.1| BnaA07g24330D [Brassica napus]
Length=347

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+H
Sbjct  276  MPCVFTKGDGPNGKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRH  335

Query  819  IIV---SPSCLF  845
            I+V   SPS L 
Sbjct  336  IVVNTSSPSNLL  347



>ref|XP_010511949.1| PREDICTED: ninja-family protein AFP1-like [Camelina sativa]
Length=349

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG +V HPL+H
Sbjct  277  MPCVFTKGDGPNGKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPNVEHPLRH  336

Query  819  IIVSPS  836
            I+V+ S
Sbjct  337  IVVNTS  342



>ref|NP_564956.1| ABI five binding protein [Arabidopsis thaliana]
 sp|Q9LQ98.1|AFP1_ARATH RecName: Full=Ninja-family protein AFP1; AltName: Full=ABI five-binding 
protein 1; Short=ABI5-binding protein 1 [Arabidopsis 
thaliana]
 gb|AAF27062.1|AC008262_11 F4N2.22 [Arabidopsis thaliana]
 gb|AAM97023.1| expressed protein [Arabidopsis thaliana]
 gb|AAN15518.1| expressed protein [Arabidopsis thaliana]
 gb|AEE34903.1| ABI five binding protein [Arabidopsis thaliana]
Length=345

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+H
Sbjct  274  MPCVFTKGDGPNGKRVDGILYRYGSGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRH  333

Query  819  IIV---SPSCLF  845
            I+V   SPS L 
Sbjct  334  IVVNTSSPSNLL  345



>gb|AAM67141.1| unknown [Arabidopsis thaliana]
Length=334

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+H
Sbjct  263  MPCVFTKGDGPNGKRVDGILYRYGSGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRH  322

Query  819  IIV---SPSCLF  845
            I+V   SPS L 
Sbjct  323  IVVNTSSPSNLL  334



>emb|CDY04272.1| BnaC06g25430D [Brassica napus]
Length=346

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+H
Sbjct  275  MPCVFTKGDGPNGKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRH  334

Query  819  IIV---SPSCLF  845
            I+V   SPS L 
Sbjct  335  IVVNTSSPSNLL  346



>gb|AAG52486.1|AC018364_4 unknown protein; 57564-56338 [Arabidopsis thaliana]
Length=335

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+H
Sbjct  264  MPCVFTKGDGPNGKRVDGILYRYGSGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRH  323

Query  819  IIV---SPSCLF  845
            I+V   SPS L 
Sbjct  324  IVVNTSSPSNLL  335



>ref|XP_010415560.1| PREDICTED: ninja-family protein AFP1-like [Camelina sativa]
Length=346

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG +V HPL+H
Sbjct  274  MPCVFTKGDGPNGKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPNVEHPLRH  333

Query  819  IIVSPS  836
            I+V+ S
Sbjct  334  IVVNTS  339



>ref|XP_010317361.1| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=352

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +3

Query  558  LVEPAVNNSGNSGKD-SKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIV  734
            LV  A+  +     D S++  +RN L  MP V+T+GDGP GKK  GFLY Y++G EV+IV
Sbjct  259  LVLAAIEATNEKSPDFSRKEGLRNFLLKMPGVSTKGDGPNGKKTGGFLYAYKRGGEVKIV  318

Query  735  CVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPS  836
            C+CHG FL+PAEFVKHAGGGDV +PL+ I V P+
Sbjct  319  CICHGYFLTPAEFVKHAGGGDVENPLRLITVDPN  352



>ref|XP_010470901.1| PREDICTED: ninja-family protein AFP1-like [Camelina sativa]
Length=341

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG +V HPL+H
Sbjct  269  MPCVFTKGDGPNGKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPNVEHPLRH  328

Query  819  IIV  827
            I+V
Sbjct  329  IVV  331



>gb|AGT16625.1| hypothetical protein SHCRBa_261_H05_F_190 [Saccharum hybrid cultivar 
R570]
Length=305

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  636  NMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLK  815
            +MP V+++ +GP  ++I+GFLYRY+KGE VRIVCVCHG+FL+PAEFVKHAGGGDV++PL+
Sbjct  236  DMPMVSSKVEGPNTRRIDGFLYRYKKGENVRIVCVCHGSFLTPAEFVKHAGGGDVSNPLR  295

Query  816  HIIVSPS  836
            HI+V+P+
Sbjct  296  HIVVNPA  302



>gb|KFK41350.1| hypothetical protein AALP_AA2G118900 [Arabis alpina]
Length=319

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GE+VRI+CVCHG+FLSPA+FVKHAGG  V HPL+H
Sbjct  247  MPCVFTKGDGPNGKRVDGILYRYGNGEQVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRH  306

Query  819  IIVSPS  836
            I+V+ S
Sbjct  307  IVVNTS  312



>gb|EPS72568.1| hypothetical protein M569_02189, partial [Genlisea aurea]
Length=77

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 58/71 (82%), Gaps = 2/71 (3%)
 Frame = +3

Query  624  NALF-NMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDV  800
            N LF  MP V+T+G G    K+EGFLYRY+KGEEVRI+CVCHG FLSPAEFVKH GG DV
Sbjct  4    NKLFPEMPFVSTKG-GEGSSKVEGFLYRYKKGEEVRILCVCHGQFLSPAEFVKHGGGADV  62

Query  801  AHPLKHIIVSP  833
             HPLKHI+V+P
Sbjct  63   EHPLKHIVVNP  73



>ref|NP_001147185.1| ninja-family protein 5 [Zea mays]
 sp|B6SM63.1|NNJA5_MAIZE RecName: Full=Ninja-family protein 5 [Zea mays]
 gb|ACG25946.1| RNA-binding protein [Zea mays]
 tpg|DAA63508.1| TPA: putative DUF1675 domain containing family protein [Zea mays]
Length=307

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  618  VRNALF-NMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            +R+A+  +MP V+ + +GP G+K +GFLY+YRKGEEVRIVCVCHG+FL+PAEFV+HAGGG
Sbjct  229  LRSAMAEDMPMVSYKAEGPGGRKTDGFLYKYRKGEEVRIVCVCHGSFLTPAEFVEHAGGG  288

Query  795  DVAHPLKHIIVSP  833
            +V +PL+HI+V+P
Sbjct  289  EVPNPLRHIVVNP  301



>ref|XP_006391038.1| hypothetical protein EUTSA_v10018761mg [Eutrema salsugineum]
 gb|ESQ28324.1| hypothetical protein EUTSA_v10018761mg [Eutrema salsugineum]
Length=358

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FVKHAGG  V HPL+H
Sbjct  286  MPCVFTKGDGPNGKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRH  345

Query  819  IIV  827
            I+V
Sbjct  346  IVV  348



>ref|XP_002887227.1| hypothetical protein ARALYDRAFT_894706 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63486.1| hypothetical protein ARALYDRAFT_894706 [Arabidopsis lyrata subsp. 
lyrata]
Length=351

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 3/72 (4%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV T+GDGP GK+++G LYRY  GEEVRI+CVCHG+FLSPA+FV HAGG  V HPL+H
Sbjct  280  MPCVFTKGDGPNGKRVDGILYRYGNGEEVRIMCVCHGDFLSPADFVIHAGGPHVDHPLRH  339

Query  819  IIV---SPSCLF  845
            I+V   SPS L 
Sbjct  340  IVVNTSSPSNLL  351



>emb|CDY40905.1| BnaC06g30430D [Brassica napus]
Length=349

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N    MPCV TRGDGP GK+++G LYRY  GEEV+I+CVCHG+ LSPA+FVKHAGG  V 
Sbjct  273  NGKKEMPCVFTRGDGPNGKRVDGILYRYGNGEEVKIMCVCHGDILSPADFVKHAGGPHVD  332

Query  804  HPLKHIIVSPSCL  842
            HPL+HIIV+ S L
Sbjct  333  HPLRHIIVNTSSL  345



>ref|XP_010315753.1| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=296

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 81/136 (60%), Gaps = 14/136 (10%)
 Frame = +3

Query  459  FDSQ---PLQVCGKNVEARSPSSVH----SRELEQRPAATLVEPAVNNSGN---SGKDSK  608
            F++Q   P Q+ G  +E  S SS      S  LEQ     L      N  +   SGK+  
Sbjct  165  FETQQHLPNQIDGTFIEGASCSSNEIPPVSGTLEQMQHLVLAAIEATNEQSLDFSGKEG-  223

Query  609  EVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAG  788
               +RN L  MP  +T+GDG  GKK EGFLY Y +G EV++VC+CHG FL+PAEF+KHAG
Sbjct  224  ---LRNFLLKMPGASTKGDGANGKKTEGFLYAYNRGGEVKMVCICHGYFLTPAEFIKHAG  280

Query  789  GGDVAHPLKHIIVSPS  836
            GGDV +PL+ I V P+
Sbjct  281  GGDVENPLRLINVDPN  296



>gb|KHN17830.1| Ninja-family protein AFP3 [Glycine soja]
Length=249

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            V   L  MP VTT GDGP GK+IEGFLY+YR G+ V IVCVCHGNFL+PAEFV HAGG +
Sbjct  176  VMEILRQMPSVTTTGDGPNGKRIEGFLYKYRSGQ-VCIVCVCHGNFLTPAEFVMHAGGKE  234

Query  798  VAHPLKHIIV  827
            VA+P+KHI V
Sbjct  235  VANPMKHITV  244



>ref|XP_003527115.1| PREDICTED: ninja-family protein AFP3-like isoform X1 [Glycine 
max]
Length=249

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            V   L  MP VTT GDGP GK+IEGFLY+YR G+ V IVCVCHGNFL+PAEFV HAGG +
Sbjct  176  VMEILRQMPSVTTTGDGPNGKRIEGFLYKYRSGQ-VCIVCVCHGNFLTPAEFVMHAGGKE  234

Query  798  VAHPLKHIIV  827
            VA+P+KHI V
Sbjct  235  VANPMKHITV  244



>gb|ACU23969.1| unknown [Glycine max]
Length=249

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            V   L  MP VTT GDGP GK+IEGFLY+YR G+ V IVCVCHGNFL+PAEFV HAGG +
Sbjct  176  VMEILRQMPSVTTTGDGPNGKRIEGFLYKYRSGQ-VCIVCVCHGNFLTPAEFVMHAGGKE  234

Query  798  VAHPLKHIIV  827
            VA+P+KHI V
Sbjct  235  VANPMKHITV  244



>ref|XP_003522990.1| PREDICTED: ninja-family protein AFP3-like isoformX1 [Glycine 
max]
 ref|XP_006578540.1| PREDICTED: ninja-family protein AFP3-like isoform X5 [Glycine 
max]
 gb|KHN17353.1| Ninja-family protein AFP3 [Glycine soja]
Length=247

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            V   L  MP VTT GDGP GK+IEGFLY+YR G+ V IVCVCHGNFL+PAEFV HAGG +
Sbjct  174  VMEILRRMPSVTTTGDGPNGKRIEGFLYKYRSGQ-VCIVCVCHGNFLTPAEFVMHAGGKE  232

Query  798  VAHPLKHIIV  827
            VA+P+KHI V
Sbjct  233  VANPMKHITV  242



>ref|XP_006582022.1| PREDICTED: ninja-family protein AFP3-like isoform X2 [Glycine 
max]
 ref|XP_006582023.1| PREDICTED: ninja-family protein AFP3-like isoform X3 [Glycine 
max]
Length=262

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            V   L  MP VTT GDGP GK+IEGFLY+YR G+ V IVCVCHGNFL+PAEFV HAGG +
Sbjct  189  VMEILRQMPSVTTTGDGPNGKRIEGFLYKYRSGQ-VCIVCVCHGNFLTPAEFVMHAGGKE  247

Query  798  VAHPLKHIIV  827
            VA+P+KHI V
Sbjct  248  VANPMKHITV  257



>ref|XP_004231689.1| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=262

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            +RN L  MP V T+GDGP GKK EGFLY Y++G EV+IVC+CHG FL+PAEFVKHA GGD
Sbjct  191  IRNFLLKMPGVATKGDGPNGKKTEGFLYAYKRGGEVKIVCICHGYFLTPAEFVKHASGGD  250

Query  798  VAHPL  812
            V +PL
Sbjct  251  VENPL  255



>ref|XP_006578537.1| PREDICTED: ninja-family protein AFP3-like isoform X2 [Glycine 
max]
 ref|XP_006578538.1| PREDICTED: ninja-family protein AFP3-like isoform X3 [Glycine 
max]
 ref|XP_006578539.1| PREDICTED: ninja-family protein AFP3-like isoform X4 [Glycine 
max]
Length=260

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            V   L  MP VTT GDGP GK+IEGFLY+YR G+ V IVCVCHGNFL+PAEFV HAGG +
Sbjct  187  VMEILRRMPSVTTTGDGPNGKRIEGFLYKYRSGQ-VCIVCVCHGNFLTPAEFVMHAGGKE  245

Query  798  VAHPLKHIIV  827
            VA+P+KHI V
Sbjct  246  VANPMKHITV  255



>ref|XP_006848485.1| hypothetical protein AMTR_s00013p00255370 [Amborella trichopoda]
 gb|ERN10066.1| hypothetical protein AMTR_s00013p00255370 [Amborella trichopoda]
Length=515

 Score =   109 bits (273),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
            AL +MPCV+  GDGP+GK I GFLYRY KGE + IVCVCHG+FLSPAEFV+HAG  DV+ 
Sbjct  444  ALPHMPCVSATGDGPDGKTINGFLYRYTKGE-ISIVCVCHGSFLSPAEFVRHAGVTDVSQ  502

Query  807  PLKHIIVSPSCL  842
            PLKHII++P+  
Sbjct  503  PLKHIIMAPTTF  514



>emb|CBW38448.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38449.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38450.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38451.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38452.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38453.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38454.1| ABA responsive protein [Helianthus annuus]
 emb|CBW38455.1| ABA responsive protein [Helianthus annuus]
 gb|AGH13370.1| ABA responsive protein, partial [Helianthus annuus]
 gb|AGH13371.1| ABA responsive protein, partial [Helianthus annuus]
Length=95

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 4/65 (6%)
 Frame = +3

Query  636  NMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLK  815
             MPCVTT+     GK+I+GFLYRY + EEVRIVCVCHG+FL+PAEFVKH GGG+V HPL+
Sbjct  31   KMPCVTTK----VGKRIQGFLYRYGEDEEVRIVCVCHGSFLTPAEFVKHGGGGEVEHPLR  86

Query  816  HIIVS  830
            HI+V+
Sbjct  87   HIVVT  91



>ref|XP_007037582.1| RNA binding-like protein [Theobroma cacao]
 gb|EOY22083.1| RNA binding-like protein [Theobroma cacao]
Length=565

 Score =   109 bits (273),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N +  MP VTT GDGP G+KIEGFLY+Y KG+ V IVCVCHGNFLSP EFVKHAGG DV 
Sbjct  492  NVMKKMPSVTTTGDGPNGRKIEGFLYKYMKGQ-VSIVCVCHGNFLSPEEFVKHAGGKDVT  550

Query  804  HPLKHIIV  827
            +P+KHI V
Sbjct  551  NPMKHINV  558



>gb|AES69254.2| ninja-family protein AFP1 [Medicago truncatula]
Length=219

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            V   L  MP VTT GDGP GK+IEGFLY+YR GE V IVCVCHG+FL+P EFV HAGG +
Sbjct  146  VMEILRQMPTVTTTGDGPNGKRIEGFLYKYRSGE-VCIVCVCHGSFLTPKEFVMHAGGKE  204

Query  798  VAHPLKHIIVSP  833
            VA+P+KHI V P
Sbjct  205  VANPMKHITVYP  216



>ref|XP_002463155.1| hypothetical protein SORBIDRAFT_02g038620 [Sorghum bicolor]
 gb|EER99676.1| hypothetical protein SORBIDRAFT_02g038620 [Sorghum bicolor]
Length=342

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 65/78 (83%), Gaps = 6/78 (8%)
 Frame = +3

Query  618  VRNALF-NMPCVTTRG-DGPE----GKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVK  779
            +RN +  +MP V+ +  +GP     G+KI+GFLY+YRKGEEVRIVCVCHG+FL+PAEFVK
Sbjct  259  LRNTMAEDMPMVSYKAAEGPSASGGGRKIDGFLYKYRKGEEVRIVCVCHGSFLTPAEFVK  318

Query  780  HAGGGDVAHPLKHIIVSP  833
            HAGGG+V +PL+HI+V+P
Sbjct  319  HAGGGEVTNPLRHIVVNP  336



>emb|CDX95951.1| BnaA07g27800D [Brassica napus]
Length=336

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCV TRGDGP GK+++G LYRY  GEEV+I+C CH + LSPA+FVKHAGG  V HPL+H
Sbjct  265  MPCVFTRGDGPNGKRVDGILYRYGNGEEVKIMCACHCDILSPADFVKHAGGPHVDHPLRH  324

Query  819  IIVSPSCL  842
            IIV  S L
Sbjct  325  IIVDTSSL  332



>ref|XP_009105470.1| PREDICTED: ninja-family protein AFP1 [Brassica rapa]
Length=326

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            N    MPCV TRGDGP GK+++G LYRY  GEEV+I+C CH + LSPA+FVKHAGG  V 
Sbjct  250  NGKNEMPCVFTRGDGPNGKRVDGILYRYGNGEEVKIMCACHCDILSPADFVKHAGGPHVD  309

Query  804  HPLKHIIVSPSCL  842
            HPL+HIIV  S L
Sbjct  310  HPLRHIIVDTSSL  322



>gb|EMS53692.1| hypothetical protein TRIUR3_09869 [Triticum urartu]
Length=259

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            V + +  MP V T G  P G++I+GFLY+Y + EEVRIVCVCHG+FL+PAEFV HAGGG+
Sbjct  184  VADMVRKMPVVYTSGL-PNGERIDGFLYQYSRAEEVRIVCVCHGSFLTPAEFVAHAGGGE  242

Query  798  VAHPLKHIIVSP  833
            VAHP++HI+V+P
Sbjct  243  VAHPMRHIVVNP  254



>ref|XP_010464339.1| PREDICTED: ninja-family protein AFP1-like [Camelina sativa]
Length=289

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 77/129 (60%), Gaps = 15/129 (12%)
 Frame = +3

Query  492  NVEARSPSSVHSRELEQRPAATLVEP------AVNNSGNSGKDSKEVVVRNA------LF  635
            N+++R+  +VHS +  +   A +VE       +V  + N+GK  K     N         
Sbjct  164  NMQSRTEETVHSTDGSKD--AVVVETTQEWSNSVTKNNNTGKPPKPYTNSNGDGSMLPFA  221

Query  636  NMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLK  815
             MPCVT+ G+GP+GK + GFLYRY K  E+ I+CVCHG   SPAEF+ HAGG +V+HPL+
Sbjct  222  QMPCVTSTGNGPDGKTVNGFLYRYSK-SEISIICVCHGTSFSPAEFIVHAGGTNVSHPLR  280

Query  816  HIIVSPSCL  842
            HI V PS  
Sbjct  281  HITVVPSTF  289



>gb|KDP26350.1| hypothetical protein JCGZ_17508 [Jatropha curcas]
Length=465

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 1/101 (1%)
 Frame = +3

Query  540  QRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGE  719
            QR A  L++    + G   K  K     ++L +MPCV+T G+GP G+ I GFLYRY K  
Sbjct  366  QRFATPLMKSKSTDLGKPPKPQKLNHSNSSLPSMPCVSTTGNGPNGRTINGFLYRYTK-T  424

Query  720  EVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  842
            EV I+CVCHG+  SPAEFV+HAGG DV+HPLKHI V PS  
Sbjct  425  EVSIICVCHGSSFSPAEFVQHAGGTDVSHPLKHITVIPSAF  465



>ref|XP_007049691.1| UPF0737 protein AFP3, putative [Theobroma cacao]
 gb|EOX93848.1| UPF0737 protein AFP3, putative [Theobroma cacao]
Length=440

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
            +L NMPCV+T G+GP GK I GFLYRY K  EV I+CVCHG+  +PAEFV+HAGG DV+H
Sbjct  370  SLRNMPCVSTTGNGPNGKTINGFLYRYTK-SEVSIICVCHGSSFTPAEFVQHAGGSDVSH  428

Query  807  PLKHIIVSPS  836
            PL+HI V PS
Sbjct  429  PLRHITVIPS  438



>ref|XP_004499859.1| PREDICTED: ninja-family protein AFP3-like [Cicer arietinum]
Length=223

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            V   L  MP VTT GDGP GK+IEGFLY+YR GE V IVCVCHG+FL+PAEFV HA G +
Sbjct  150  VMEILRKMPTVTTIGDGPNGKRIEGFLYKYRSGE-VCIVCVCHGSFLTPAEFVMHAEGKE  208

Query  798  VAHPLKHIIVSPSCL  842
            VA+P+KHI V P  L
Sbjct  209  VANPMKHITVYPVSL  223



>ref|XP_004231670.1| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=240

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 74/128 (58%), Gaps = 11/128 (9%)
 Frame = +3

Query  471  PLQVCGKNVEARSPSSVH----SRELEQRPAATLVEPAVNNSGN---SGKDSKEVVVRNA  629
            P QV G  +E  S SS      S  LEQ     L      N  +   SGK+     +RN 
Sbjct  116  PNQVDGTFIEGASSSSNEIPPVSGTLEQMRHLVLAAIEATNEQSPHFSGKEG----LRNF  171

Query  630  LFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHP  809
            L  MP V T+GDGP GKK EGFLY Y++G EV+IVC+ HG FL+P EFVKHAGG  V +P
Sbjct  172  LLKMPGVFTKGDGPNGKKTEGFLYAYKRGGEVKIVCIFHGYFLTPTEFVKHAGGCAVENP  231

Query  810  LKHIIVSP  833
            L+ + V P
Sbjct  232  LRLLTVDP  239



>ref|XP_003599003.1| hypothetical protein MTR_3g025970 [Medicago truncatula]
Length=114

 Score =   100 bits (248),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            V   L  MP VTT GDGP GK+IEGFLY+YR GE V IVCVCHG+FL+P EFV HAGG +
Sbjct  41   VMEILRQMPTVTTTGDGPNGKRIEGFLYKYRSGE-VCIVCVCHGSFLTPKEFVMHAGGKE  99

Query  798  VAHPLKHIIVSP  833
            VA+P+KHI V P
Sbjct  100  VANPMKHITVYP  111



>ref|XP_007138357.1| hypothetical protein PHAVU_009G202000g [Phaseolus vulgaris]
 gb|ESW10351.1| hypothetical protein PHAVU_009G202000g [Phaseolus vulgaris]
Length=230

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 68/101 (67%), Gaps = 1/101 (1%)
 Frame = +3

Query  525  SRELEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYR  704
            ++++  RPA T +E            S +  V   L  MP V+T GDG +GK+IEGFLY+
Sbjct  126  TKKILPRPADTKLENQAKKHKLGNYCSLKGDVMEILRRMPSVSTTGDGADGKRIEGFLYK  185

Query  705  YRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  827
            YR GE V IVCVCHG+FL+PAEFV HAGG +VA+P+KHI V
Sbjct  186  YRTGE-VCIVCVCHGSFLTPAEFVMHAGGKEVANPMKHITV  225



>gb|AAR06258.1| ABRC5 [Helianthus annuus]
Length=141

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 4/64 (6%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCVTT+     GK+I+GFLYRY + EEVRIVCVCHG+FL+P EFVKH GGG+V HPL+H
Sbjct  78   MPCVTTK----VGKRIQGFLYRYGEDEEVRIVCVCHGSFLTPPEFVKHGGGGEVEHPLRH  133

Query  819  IIVS  830
            I+V+
Sbjct  134  IVVT  137



>ref|XP_010105505.1| hypothetical protein L484_007123 [Morus notabilis]
 gb|EXC04891.1| hypothetical protein L484_007123 [Morus notabilis]
Length=314

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MP VTT GDGP GK+I+GFLY+Y KG+ V IVCVCHGNFLSPAEFVKHAGG +V +P++H
Sbjct  247  MPSVTTTGDGPNGKRIDGFLYKYTKGQ-VSIVCVCHGNFLSPAEFVKHAGGKEVTNPMRH  305

Query  819  IIV  827
            I V
Sbjct  306  INV  308



>gb|AGT16981.1| Protein of unknown function DUF1675 [Saccharum hybrid cultivar 
R570]
Length=287

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            V R  +  MP V T+G  P G ++EGFLY+Y+KGE+VRIVC+CHG+FL+P+EFV+HAG G
Sbjct  212  VERRIMQEMPGVFTKGL-PNGNRVEGFLYKYKKGEDVRIVCICHGSFLTPSEFVEHAGAG  270

Query  795  DVAHPLKHIIVSPS  836
             V +PL+HI+VSP+
Sbjct  271  KVDNPLRHIVVSPT  284



>gb|KHG16149.1| Ninja-family protein AFP3 [Gossypium arboreum]
Length=431

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
            +L NMPCV+T G+GP GK I GFLYRY K  EV I+CVCHG+  +PAEFV HAGG DV+H
Sbjct  361  SLRNMPCVSTTGNGPNGKTINGFLYRYTK-SEVSIICVCHGSSFTPAEFVLHAGGTDVSH  419

Query  807  PLKHIIVSPSCL  842
            PL+HI + PS  
Sbjct  420  PLRHITMIPSAF  431



>ref|XP_002531097.1| hypothetical protein RCOM_1417730 [Ricinus communis]
 gb|EEF31311.1| hypothetical protein RCOM_1417730 [Ricinus communis]
Length=639

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = +3

Query  546  PAATLVEPAVNNSGNSGKDSK---EVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKG  716
            P   +  P +   GN GK  K   E  +  +L  MPCV+T G+GP GK I GFLYRY K 
Sbjct  539  PENPIFIPLMEAKGNMGKPPKPQSENHITPSLPYMPCVSTTGNGPNGKTINGFLYRYTK-  597

Query  717  EEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  842
             EV I+CVCHG+  SPAEFV+HAGG DV+HPL+HI V PS +
Sbjct  598  TEVSIICVCHGSSFSPAEFVQHAGGTDVSHPLRHITVIPSAI  639



>ref|XP_004985196.1| PREDICTED: ninja-family protein 1-like [Setaria italica]
Length=364

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            V R  +  MP V T+G  P G ++EGFLY+YRKGE+VRIVC+CHG F +PA FV+HAGGG
Sbjct  289  VERTMMQEMPSVFTKGL-PNGNRLEGFLYKYRKGEQVRIVCICHGTFHTPAGFVEHAGGG  347

Query  795  DVAHPLKHIIVSP  833
            +V++PL+HI+V+P
Sbjct  348  NVSNPLRHIVVTP  360



>ref|XP_010104165.1| hypothetical protein L484_007004 [Morus notabilis]
 gb|EXB99097.1| hypothetical protein L484_007004 [Morus notabilis]
Length=424

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
            AL  MPCV+TRG+GP GK + GFLY+Y    EV IVCVCHG+  SPAEFV+HAGG DV+H
Sbjct  353  ALPQMPCVSTRGNGPNGKTVRGFLYKY-TNSEVSIVCVCHGSTFSPAEFVQHAGGTDVSH  411

Query  807  PLKHIIVSPSCL  842
            PLKHI V P  L
Sbjct  412  PLKHITVIPFSL  423



>emb|CBI25670.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
            +L  MPCV+T G+GP GK I GFLYRY K E + IVCVCHG+  SPA FV+HAGG DV+H
Sbjct  169  SLEQMPCVSTTGNGPNGKTITGFLYRYTKAE-ISIVCVCHGSSFSPAGFVEHAGGIDVSH  227

Query  807  PLKHIIVSPSCL  842
            PL+HI V PS  
Sbjct  228  PLRHITVIPSAF  239



>gb|EMT13868.1| hypothetical protein F775_31150 [Aegilops tauschii]
Length=396

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            V + +  MP V T G  P G++I+GFLY+Y + EEVRIVCVCHG+FL+PAEFV HAGG +
Sbjct  323  VADMVRKMPVVYTSGL-PNGERIDGFLYQYSRAEEVRIVCVCHGSFLTPAEFVAHAGGSE  381

Query  798  VAHPLKHIIVSPSCL  842
            V HP++HI+V+P  L
Sbjct  382  VTHPMRHIVVNPPSL  396



>ref|XP_002884637.1| hypothetical protein ARALYDRAFT_340917 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60896.1| hypothetical protein ARALYDRAFT_340917 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCVT+ G+GPEGK + GFLYRY K  E+ I+CVCHG   SPAEF+ HAGG +V+HPL+H
Sbjct  220  MPCVTSTGNGPEGKTVNGFLYRYSK-SEISIICVCHGTSFSPAEFIVHAGGTNVSHPLRH  278

Query  819  IIVSPSCL  842
            I V PS L
Sbjct  279  ITVVPSTL  286



>ref|XP_002514649.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF47755.1| RNA binding protein, putative [Ricinus communis]
Length=155

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MP VTT G+GP G+KIEG LY+Y K  +V IVCVCHG+FLSPAEFV+HAGG +VA+P+KH
Sbjct  88   MPSVTTTGNGPYGRKIEGILYKYSK-SQVTIVCVCHGSFLSPAEFVRHAGGNNVANPMKH  146

Query  819  IIVSPSCLF  845
            I V  S  F
Sbjct  147  ITVCSSFSF  155



>ref|XP_002465644.1| hypothetical protein SORBIDRAFT_01g042880 [Sorghum bicolor]
 gb|EER92642.1| hypothetical protein SORBIDRAFT_01g042880 [Sorghum bicolor]
Length=394

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            V R  +  MP V T+G  P G ++EGFLY+YRKGE+VRIVC+CHG+FL+P+EFV+HAG G
Sbjct  317  VERKMMQEMPGVFTKGL-PNGNRVEGFLYKYRKGEDVRIVCICHGSFLTPSEFVEHAGAG  375

Query  795  DVAHPLKHIIVSPS  836
             V +PL+HI+V+P+
Sbjct  376  KVDNPLRHIVVNPT  389



>gb|AGT15870.1| hypothetical protein SHCRBa_252_E12_R_390 [Saccharum hybrid cultivar 
R570]
Length=392

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            V R  +  MP V T+G  P G ++EGFLY+Y+KGE+VRIVC+CHG+FL+P+EFV+HAG G
Sbjct  317  VERRIMQEMPGVFTKGL-PNGNRVEGFLYKYKKGEDVRIVCICHGSFLTPSEFVEHAGAG  375

Query  795  DVAHPLKHIIVSPS  836
             V +PL+HI+VSP+
Sbjct  376  KVDNPLRHIVVSPT  389



>gb|AGT16721.1| hypothetical protein SHCRBa_127_L16_F_40 [Saccharum hybrid cultivar 
R570]
Length=392

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            V R  +  MP V T+G  P G ++EGFLY+Y+KGE+VRIVC+CHG+FL+P+EFV+HAG G
Sbjct  317  VERRIMQEMPGVFTKGL-PNGNRVEGFLYKYKKGEDVRIVCICHGSFLTPSEFVEHAGAG  375

Query  795  DVAHPLKHIIVSPS  836
             V +PL+HI+VSP+
Sbjct  376  KVDNPLRHIVVSPT  389



>gb|KEH18131.1| ninja-family protein AFP1 [Medicago truncatula]
Length=296

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  618  VRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGD  797
            ++ +L  MP V+T+G+G  GK + GFLYRY K +EV IVCVCHG+  SPAEFV+HAGG D
Sbjct  221  IKKSLPQMPYVSTKGNGSNGKVVNGFLYRYSKCDEVSIVCVCHGSTFSPAEFVQHAGGTD  280

Query  798  VAHPLKHIIVSPSCL  842
            + HPL+HI V+ S  
Sbjct  281  ITHPLRHITVNSSAF  295



>ref|XP_008450871.1| PREDICTED: ninja-family protein 6-like isoform X1 [Cucumis melo]
Length=316

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            + +  MP V+T GDGP G+K+EGFLY+Y KG+ V IVCVCHG+FL+P EFVKHAGG +VA
Sbjct  241  DVMRTMPSVSTIGDGPNGRKVEGFLYKYMKGQ-VCIVCVCHGSFLTPTEFVKHAGGKEVA  299

Query  804  HPLKHIIV  827
            +PLKHI V
Sbjct  300  NPLKHIHV  307



>ref|XP_008450949.1| PREDICTED: ninja-family protein 6-like isoform X2 [Cucumis melo]
Length=316

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            + +  MP V+T GDGP G+K+EGFLY+Y KG+ V IVCVCHG+FL+P EFVKHAGG +VA
Sbjct  241  DVMRTMPSVSTIGDGPNGRKVEGFLYKYMKGQ-VCIVCVCHGSFLTPTEFVKHAGGKEVA  299

Query  804  HPLKHIIV  827
            +PLKHI V
Sbjct  300  NPLKHIHV  307



>gb|KHG19654.1| Ninja-family protein AFP3 [Gossypium arboreum]
Length=309

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +3

Query  597  KDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFV  776
            K S+  +    +  MP VTT GDGP G+KI+GFLY+Y KG+ V IVCVCHGNFLSP EFV
Sbjct  227  KLSRGWIQDKEMKKMPSVTTTGDGPNGRKIQGFLYKYTKGQ-VCIVCVCHGNFLSPEEFV  285

Query  777  KHAGGGDVAHPLKHIIV  827
            +HAG  DV +P+KHI V
Sbjct  286  RHAGAKDVTNPMKHINV  302



>gb|AGT16149.1| ABI five biding protein 3 [Saccharum hybrid cultivar R570]
Length=389

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = +3

Query  615  VVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGG  794
            V R  +  MP V T+G  P G ++EGFLY+Y+KGE+VRIVC+CHG+FL+P+EFV+HAG G
Sbjct  314  VERRIMQEMPGVFTKGL-PNGNRVEGFLYKYKKGEDVRIVCICHGSFLTPSEFVEHAGAG  372

Query  795  DVAHPLKHIIVSPS  836
             V +PL+HI+VSP+
Sbjct  373  KVDNPLRHIVVSPT  386



>gb|KDO65985.1| hypothetical protein CISIN_1g011821mg [Citrus sinensis]
Length=477

 Score =   103 bits (256),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
            +L +MPCV+T G+GP GK I GFLYRY K  EV IVCVCHG   SPAEFV HAGG DV+ 
Sbjct  407  SLPHMPCVSTTGNGPNGKTINGFLYRYTK-TEVSIVCVCHGTSFSPAEFVLHAGGTDVSQ  465

Query  807  PLKHIIVSPSCL  842
            PLKHI V PS +
Sbjct  466  PLKHITVIPSAI  477



>ref|XP_002271712.2| PREDICTED: ninja-family protein AFP1-like [Vitis vinifera]
Length=377

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
            +L  MPCV+T G+GP GK I GFLYRY K E + IVCVCHG+  SPA FV+HAGG DV+H
Sbjct  306  SLEQMPCVSTTGNGPNGKTITGFLYRYTKAE-ISIVCVCHGSSFSPAGFVEHAGGIDVSH  364

Query  807  PLKHIIVSPSCL  842
            PL+HI V PS  
Sbjct  365  PLRHITVIPSAF  376



>ref|XP_010486270.1| PREDICTED: ninja-family protein AFP3-like [Camelina sativa]
Length=291

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 72/126 (57%), Gaps = 10/126 (8%)
 Frame = +3

Query  492  NVEARSPSSVHSRELEQRPAATLVEPAVNNS---GNSGKDSKEVVVRNA------LFNMP  644
            N+++R+  +VHS +  +           +NS    N+GK  K     N          MP
Sbjct  167  NMQSRTEETVHSTDGSKDAVVVETTQEWSNSETKSNTGKPPKPYANSNGDGSMLPFAQMP  226

Query  645  CVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHII  824
            CVT+ G+GP+GK + GFL RY K  E+ I+CVCHG   SPAEF+ HAGG +V+HPL+HI 
Sbjct  227  CVTSTGNGPDGKTVNGFLCRYSK-SEISIICVCHGTSFSPAEFIVHAGGTNVSHPLRHIT  285

Query  825  VSPSCL  842
            V PS  
Sbjct  286  VVPSTF  291



>ref|XP_009614852.1| PREDICTED: ninja-family protein 3-like [Nicotiana tomentosiformis]
Length=349

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  630  LFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHP  809
            L  MPCV+T G+GP GK I G LYRY    E+ I+CVCHG   +P+EFV+HAGG DV+HP
Sbjct  279  LSRMPCVSTTGNGPNGKTIRGLLYRYNNRTEISIICVCHGKSFTPSEFVEHAGGVDVSHP  338

Query  810  LKHIIVSPSC  839
            L+HI V P C
Sbjct  339  LRHITVIPPC  348



>ref|XP_004137434.1| PREDICTED: ninja-family protein AFP2-like [Cucumis sativus]
 gb|KGN64057.1| hypothetical protein Csa_1G039230 [Cucumis sativus]
Length=314

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            + +  MP V+T GDGP G+K+EGFLY+Y KG+ V IVCVCHG+FL+P EFVKHAGG +VA
Sbjct  241  DVMRTMPSVSTIGDGPNGRKVEGFLYKYMKGQ-VCIVCVCHGSFLTPTEFVKHAGGKEVA  299

Query  804  HPLKHIIV  827
            +P+KHI V
Sbjct  300  NPMKHIHV  307



>ref|XP_006443552.1| hypothetical protein CICLE_v10019961mg [Citrus clementina]
 ref|XP_006479226.1| PREDICTED: uncharacterized protein LOC102627272 [Citrus sinensis]
 gb|ESR56792.1| hypothetical protein CICLE_v10019961mg [Citrus clementina]
Length=477

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
            +L +MPCV+T G+GP GK I GFLYRY K  EV IVCVCHG   SPAEFV HAGG DV+ 
Sbjct  407  SLPHMPCVSTTGNGPNGKTINGFLYRYTK-TEVSIVCVCHGTSFSPAEFVLHAGGTDVSQ  465

Query  807  PLKHIIVSPSCL  842
            PLKHI V PS  
Sbjct  466  PLKHITVIPSAF  477



>gb|KFK38175.1| hypothetical protein AALP_AA3G079100 [Arabis alpina]
Length=286

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCVT+ G+GPEGK + GFLYRY K  E+ I+CVCHG   SPAEF+ HAGG +V HPL+H
Sbjct  220  MPCVTSTGNGPEGKTVNGFLYRYSK-SEISIICVCHGTSFSPAEFIVHAGGTNVTHPLRH  278

Query  819  IIVSPSCL  842
            I V PS  
Sbjct  279  ITVVPSMF  286



>ref|XP_004510250.1| PREDICTED: uncharacterized protein LOC101492383 [Cicer arietinum]
Length=355

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MP V+T+G+GP GK + GFLYRY K ++V IVCVCHG+  SPAEFV+HAGG D+ HPL+H
Sbjct  287  MPYVSTKGNGPNGKTVNGFLYRYSKSDQVTIVCVCHGSTFSPAEFVQHAGGTDITHPLRH  346

Query  819  IIV  827
            I V
Sbjct  347  ITV  349



>gb|KDP31355.1| hypothetical protein JCGZ_11731 [Jatropha curcas]
Length=214

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  624  NALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVA  803
            + +  MP VTT GDGP G+K+EGFLY+Y +G+ V IVC+CHG+F SP EFV+HAG  DVA
Sbjct  142  DVMKQMPTVTTVGDGPNGRKVEGFLYKYSEGQ-VNIVCICHGSFFSPEEFVRHAGCEDVA  200

Query  804  HPLKHIIVSPSCLF  845
            +P+K I VS S  F
Sbjct  201  NPMKRITVSSSFSF  214



>ref|XP_002862294.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38552.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=286

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCVT+ G+GPEGK + GFLYRY K  E+ I+CVCHG   SPAEF+ HAGG +V+ PL+H
Sbjct  220  MPCVTSTGNGPEGKTVNGFLYRYSK-SEISIICVCHGTSFSPAEFIVHAGGTNVSQPLRH  278

Query  819  IIVSPSCL  842
            I V PS L
Sbjct  279  ITVVPSTL  286



>ref|XP_010547110.1| PREDICTED: ninja-family protein Os03g0419100 [Tarenaya hassleriana]
Length=358

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +3

Query  630  LFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHP  809
            L  MPCVTT G+GPEGK + GFL+RY K  E+ IVCVCHG   SPAEF++HAGG +V++P
Sbjct  289  LARMPCVTTTGNGPEGKVVNGFLHRYSK-SEISIVCVCHGRSFSPAEFIRHAGGTEVSNP  347

Query  810  LKHIIVSPSCL  842
            L+HI V PS  
Sbjct  348  LRHITVVPSSF  358



>emb|CDP03912.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
            +L  MPCV+T G+GP GK I GFLYRY K E + IVCVCHG+  SPAEFV+HAGG D+ H
Sbjct  454  SLPQMPCVSTTGNGPNGKTITGFLYRYTKAE-ISIVCVCHGSSFSPAEFVEHAGGIDITH  512

Query  807  PLKHIIVSPS  836
            PL+HI + PS
Sbjct  513  PLRHITMIPS  522



>ref|XP_002884305.1| two or more abres-containing gene 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60564.1| two or more abres-containing gene 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 79/140 (56%), Gaps = 22/140 (16%)
 Frame = +3

Query  495  VEARSPSSVHSRELEQRPAATLVEPAVNNSGNSGKDSKEVVV------RNALFNMPCVTT  656
            +E + P     +E + R   T        +GN+ K  K V V      RN L +MPCV+T
Sbjct  177  LEFKIPPGKEGKEDKDRFVVTGPVNGNGKNGNTAKKKKNVEVSGMEKARNILEDMPCVST  236

Query  657  RGDGPEGKKIEGFLYRYR-KGEEVRIVCVCHGNFLSPAEFVKHA-------GGGDVA-HP  809
            R  G +GK++EGFLY Y  K EEV+IVCVCHG+FLSPAEFV+H        GGGDV  +P
Sbjct  237  RDVGADGKRVEGFLYWYGGKKEEVKIVCVCHGSFLSPAEFVRHGGGTISDDGGGDVMINP  296

Query  810  LKHIIVSPSCLF*WLPLRKW  869
            L+HI+V        LP   W
Sbjct  297  LRHIVVK-------LPSSSW  309



>ref|XP_010906183.1| PREDICTED: ninja-family protein AFP3-like [Elaeis guineensis]
Length=150

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MP V+T G+GP GK + GFLYRY K E V IVCVCHG+  SPAEFV+HAGG +++ PL+ 
Sbjct  86   MPFVSTTGNGPNGKTVTGFLYRYTKAE-VHIVCVCHGSSFSPAEFVRHAGGTNISQPLRQ  144

Query  819  IIVSPS  836
            I+V PS
Sbjct  145  IVVVPS  150



>emb|CAN68929.1| hypothetical protein VITISV_044375 [Vitis vinifera]
Length=974

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  627  ALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAH  806
            +L  MPCV+T G+GP GK I GFLYRY K E + IVCVCHG+  SPA FV+HAGG DV+H
Sbjct  903  SLEQMPCVSTTGNGPNGKTITGFLYRYTKAE-ISIVCVCHGSSFSPAGFVEHAGGXDVSH  961

Query  807  PLKHIIVSPSCL  842
            PL+HI V PS  
Sbjct  962  PLRHITVIPSAF  973



>ref|XP_006299766.1| hypothetical protein CARUB_v10015962mg [Capsella rubella]
 gb|EOA32664.1| hypothetical protein CARUB_v10015962mg [Capsella rubella]
Length=855

 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 71/121 (59%), Gaps = 9/121 (7%)
 Frame = +3

Query  489  KNVEARSPSSVHSRELEQRPAATLVEPAVNNS--GNSGKDSKEVVVRNA------LFNMP  644
            +N+  R+  +VHS +  +          ++NS   N+GK  K     N          MP
Sbjct  157  RNILTRTEEAVHSTDGSKDAVVVEKSQELSNSVSKNTGKPPKPYTNSNGNGSSLPFAQMP  216

Query  645  CVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHII  824
            CVT+ G+GPEGK + GFLYRY K E + I+CVCHG   SPAEF+ HAGG +V+HPL+HI 
Sbjct  217  CVTSTGNGPEGKTVNGFLYRYSKSE-ISIICVCHGTSFSPAEFIVHAGGTNVSHPLRHIT  275

Query  825  V  827
            V
Sbjct  276  V  276



>ref|XP_007134133.1| hypothetical protein PHAVU_010G022000g [Phaseolus vulgaris]
 gb|ESW06127.1| hypothetical protein PHAVU_010G022000g [Phaseolus vulgaris]
Length=363

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 3/92 (3%)
 Frame = +3

Query  567  PAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCH  746
            P + N G+ GK  K +   + L  MP V+T+G+   GK + GFLYRY K E V I+C CH
Sbjct  274  PLMENKGDLGKPPKPLSHTSLLPQMPYVSTKGNN--GKTVNGFLYRYNKSE-VSIICACH  330

Query  747  GNFLSPAEFVKHAGGGDVAHPLKHIIVSPSCL  842
            G+  SPAEFV+HAGG D+ HPL+HI V PS L
Sbjct  331  GSTFSPAEFVQHAGGTDITHPLRHITVIPSAL  362



>emb|CDY34910.1| BnaA01g32410D [Brassica napus]
Length=279

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = +3

Query  639  MPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKH  818
            MPCVT+ G+GP+GK + GFL+RY K  E+ I+CVCHG   SPAEF+ HAGG +V+HPL+H
Sbjct  213  MPCVTSTGNGPQGKTVNGFLHRYTK-SEISIICVCHGTSFSPAEFIIHAGGTNVSHPLRH  271

Query  819  IIVSPS  836
            I V PS
Sbjct  272  ITVVPS  277



>ref|XP_010418109.1| PREDICTED: uncharacterized protein LOC104703731 [Camelina sativa]
Length=1328

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 80/137 (58%), Gaps = 16/137 (12%)
 Frame = +3

Query  456  DFDSQPLQVC-GKNVEARSPSSVHSRELEQRPAATLVEP------AVNNSGNSGKDSKEV  614
            DF +Q  Q     N+++R+  +VHS +  +   A +VE       +V  + N+GK  K  
Sbjct  153  DFGAQSDQTEPVNNMQSRTEETVHSTDGSK--DAVVVETTQEWSNSVTKNSNTGKPPKPH  210

Query  615  VVRNA------LFNMPCVTTRGDGPEGKKIEGFLYRYRKGEEVRIVCVCHGNFLSPAEFV  776
               N          MPCVT+ G+GP+GK + GFLYRY K E + I+CVCHG   SPAEF+
Sbjct  211  TNSNGNGSMLPFAQMPCVTSTGNGPDGKTVNGFLYRYSKSE-ISIICVCHGTSFSPAEFI  269

Query  777  KHAGGGDVAHPLKHIIV  827
             HAGG +V+HPL+HI +
Sbjct  270  AHAGGTNVSHPLRHITM  286



>ref|XP_010317133.1| PREDICTED: ninja-family protein AFP3-like [Solanum lycopersicum]
Length=135

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 65/105 (62%), Gaps = 12/105 (11%)
 Frame = +3

Query  513  SSVHSRELEQRPAATLVEPAVNNSGNSGKDSKEVVVRNALFNMPCVTTRGDGPEGKKIEG  692
            SSV   E++Q P             N  K+  E  + N   NM  V T+ +GP+GKKIEG
Sbjct  37   SSVAEVEIQQLPT---------QEENIAKEKFENFMLN---NMANVYTKCEGPKGKKIEG  84

Query  693  FLYRYRKGEEVRIVCVCHGNFLSPAEFVKHAGGGDVAHPLKHIIV  827
             LY   + +EV+IVC+CHGNFL+  EFVKHAGGGDV +PL+HI +
Sbjct  85   LLYSCAEIDEVKIVCLCHGNFLNAGEFVKHAGGGDVVNPLEHIFI  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2569280546592